F478337

General Info

Members Datasets Scaffolds Average Seq Length
737 426 689 260

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0081689|Ga0373931_0081689_712_1629
Length 288
Sequence MARAQNELSPFNITALSFNASRLVTVWGGWSLRWYSEFFHDRAMLDAAWMSLRVAAASATMATLLGTLAAVALSRGERFKGRTLFSGMLYAPMVMPEVITGLSLLLLFVALNAERGFWTVTIAHTTLTMCFVAVVVQSRLGALDRSLEEAAMDLGCDPARAFVAVTLPLIAPAIAAGWMLAFTLSLDDVVIASFTTGPDAADPDLFGGAARGEARDQRHLYAGDRLDRGGDRGGIAGLEADEGARRERGAIVVPSFRGDANGWRERAPDDRLRIEPRIPRFPDAQLRI

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2643221558 Rhizobium sp. Root149 Isolate Unclassified
6 2643221568 Rhizobium sp. Root564 Isolate Unclassified
7 2643221651 Afipia sp. Root123D2 Isolate Unclassified
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
11 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
12 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
13 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
14 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
15 2842694124 Methylopila sp. R-72369 Isolate Unclassified
16 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
17 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
18 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
19 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
20 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
21 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
22 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
23 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
24 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
25 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
26 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
27 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
28 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
29 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
30 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
31 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
32 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
33 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
34 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
35 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
36 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
37 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
108 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
109 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
134 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
135 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
136 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
195 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
196 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
197 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
252 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
273 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
310 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
311 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
342 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
343 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
392 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
393 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
394 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
395 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
396 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
397 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
398 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
399 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
400 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
401 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
402 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
403 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
404 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
405 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
406 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
411 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
412 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
413 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
414 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
415 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
416 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
417 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
418 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
419 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
420 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
421 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
422 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
423 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
424 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
425 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
426 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.22
Metatranscriptomes 0.27
Isolates 6.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.72
Nodule 5.7
Rhizoplane 5.29
Rhizosphere 68.52
Stem 0
Stem Tuber 0
Unclassified 9.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000685 3300003214 Bacteria 27199
2 JGI25153J46596_10000872 3300003215 Bacteria 18366
3 JGI25153J46596_10036295 3300003215 Bacteria 1583
4 Ga0055542_1015078 3300003762 Bacteria 1251
5 Ga0055540_1002341 3300003792 Bacteria 10137
6 Ga0055540_1023246 3300003792 Bacteria 1565
7 Ga0055531_10002423 3300003794 Bacteria 12481
8 Ga0065715_10298573 3300005293 Bacteria 1031
9 Ga0070658_10100659 3300005327 Bacteria 2389
10 Ga0070658_10324336 3300005327 Bacteria 1315
11 Ga0070683_100222355 3300005329 Bacteria 1794
12 Ga0070683_100282171 3300005329 Bacteria 1580
13 Ga0070677_10011215 3300005333 Bacteria 3084
14 Ga0068869_100163243 3300005334 Bacteria 1735
15 Ga0070666_10054161 3300005335 Bacteria 2706
16 Ga0070666_10309077 3300005335 Bacteria 1127
17 Ga0070680_100219420 3300005336 Bacteria 1605
18 Ga0070680_100379811 3300005336 Bacteria 1203
19 Ga0068868_100017821 3300005338 Bacteria 5296
20 Ga0070660_100413074 3300005339 Bacteria 1117
21 Ga0070661_100146659 3300005344 Bacteria 1782
22 Ga0070668_100046008 3300005347 Bacteria 3349
23 Ga0070668_100057648 3300005347 Bacteria 3002
24 Ga0070671_100132146 3300005355 Bacteria 2102
25 Ga0070671_100561575 3300005355 Bacteria 985
26 Ga0070674_100031335 3300005356 Bacteria 3523
27 Ga0070674_100043210 3300005356 Bacteria 3064
28 Ga0070673_100034663 3300005364 Bacteria 3821
29 Ga0070688_100060526 3300005365 Bacteria 2391
30 Ga0070659_100134493 3300005366 Bacteria 2010
31 Ga0070667_100259511 3300005367 Bacteria 1555
32 Ga0070714_100094910 3300005435 Bacteria 2619
33 Ga0070714_100286168 3300005435 Bacteria 1533
34 Ga0070713_100119459 3300005436 Bacteria 2309
35 Ga0070713_100544251 3300005436 Bacteria 1099
36 Ga0070701_10271095 3300005438 Bacteria 1033
37 Ga0070708_100035864 3300005445 Bacteria 4323
38 Ga0070663_100024821 3300005455 Bacteria 4039
39 Ga0070663_100078843 3300005455 Bacteria 2415
40 Ga0070678_100036362 3300005456 Bacteria 3446
41 Ga0070678_100347680 3300005456 Bacteria 1274
42 Ga0070662_100062108 3300005457 Bacteria 2729
43 Ga0068867_100059534 3300005459 Bacteria 2831
44 Ga0068867_100553608 3300005459 Bacteria 997
45 Ga0070685_10045378 3300005466 Bacteria 2520
46 Ga0070685_10085396 3300005466 Bacteria 1901
47 Ga0070706_100452508 3300005467 Bacteria 1195
48 Ga0070707_100124412 3300005468 Bacteria 2505
49 Ga0070698_100523884 3300005471 Bacteria 1124
50 Ga0070699_100476325 3300005518 Bacteria 1133
51 Ga0068853_100102316 3300005539 Bacteria 2535
52 Ga0070672_100225477 3300005543 Bacteria 1573
53 Ga0070686_100129075 3300005544 Bacteria 1746
54 Ga0070695_100116495 3300005545 Bacteria 1821
55 Ga0070696_100389750 3300005546 Bacteria 1087
56 Ga0070665_100085000 3300005548 Bacteria 3169
57 Ga0070665_100091160 3300005548 Bacteria 3053
58 Ga0070665_100372631 3300005548 Bacteria 1435
59 Ga0070665_100564277 3300005548 Bacteria 1151
60 Ga0068855_100168146 3300005563 Bacteria 2484
61 Ga0070664_100081717 3300005564 Bacteria 2785
62 Ga0070664_100138593 3300005564 Bacteria 2141
63 Ga0068857_100131263 3300005577 Bacteria 2260
64 Ga0068854_100216108 3300005578 Bacteria 1514
65 Ga0068854_100340505 3300005578 Bacteria 1225
66 Ga0068856_100600332 3300005614 Bacteria 1122
67 Ga0068859_100223991 3300005617 Bacteria 1969
68 Ga0068859_100254302 3300005617 Bacteria 1847
69 Ga0068859_100304399 3300005617 Bacteria 1687
70 Ga0068864_100066513 3300005618 Bacteria 3129
71 Ga0068864_100285926 3300005618 Bacteria 1540
72 Ga0068858_100243034 3300005842 Bacteria 1709
73 Ga0068860_100171237 3300005843 Bacteria 2097
74 Ga0068860_100588963 3300005843 Bacteria 1117
75 Ga0068860_100787551 3300005843 Bacteria 964
76 Ga0081455_10036840 3300005937 Bacteria 4350
77 Ga0081538_10017420 3300005981 Bacteria 5452
78 Ga0081540_1007317 3300005983 Bacteria 7895
79 Ga0081540_1067547 3300005983 Bacteria 1670
80 Ga0070717_10250152 3300006028 Bacteria 1566
81 Ga0075365_10019447 3300006038 Bacteria 4192
82 Ga0075363_100002221 3300006048 Bacteria 7843
83 Ga0075363_100005097 3300006048 Bacteria 5812
84 Ga0075364_10161274 3300006051 Bacteria 1513
85 Ga0075364_10372812 3300006051 Bacteria 973
86 Ga0075362_10002727 3300006177 Bacteria 6017
87 Ga0075362_10136070 3300006177 Bacteria 1172
88 Ga0075367_10002644 3300006178 Bacteria 8245
89 Ga0075367_10012431 3300006178 Bacteria 4539
90 Ga0075367_10104103 3300006178 Bacteria 1737
91 Ga0075369_10004550 3300006186 Bacteria 5134
92 Ga0075366_10005909 3300006195 Bacteria 6655
93 Ga0097621_100053573 3300006237 Bacteria 3288
94 Ga0068871_100536001 3300006358 Bacteria 1059
95 Ga0075431_100022230 3300006847 Bacteria 6485
96 Ga0075431_100663506 3300006847 Bacteria 1023
97 Ga0075433_10041214 3300006852 Bacteria 4000
98 Ga0075434_100072230 3300006871 Bacteria 3443
99 Ga0068865_100069090 3300006881 Bacteria 2499
100 Ga0075436_100079624 3300006914 Bacteria 2270
101 Ga0097620_100223999 3300006931 Bacteria 1969
102 Ga0097620_100254282 3300006931 Bacteria 1847
103 Ga0097620_100304415 3300006931 Bacteria 1687
104 Ga0099825_1018667 3300006941 Bacteria 5348
105 Ga0099824_1003081 3300006942 Bacteria 24341
106 Ga0099824_1022736 3300006942 Bacteria 4059
107 Ga0099822_1008903 3300006943 Bacteria 12758
108 Ga0079104_1000069 3300006946 Bacteria 153993
109 Ga0099795_10004750 3300007788 Bacteria 3540
110 Ga0099795_10015182 3300007788 Bacteria 2406
111 Ga0105240_10182322 3300009093 Bacteria 2477
112 Ga0105240_10430415 3300009093 Bacteria 1481
113 Ga0105240_10637233 3300009093 Bacteria 1170
114 Ga0111539_10023762 3300009094 Bacteria 7531
115 Ga0111539_10856662 3300009094 Bacteria 1057
116 Ga0105245_10139750 3300009098 Bacteria 2280
117 Ga0105245_10169811 3300009098 Bacteria 2076
118 Ga0105245_10203588 3300009098 Bacteria 1902
119 Ga0105245_10270812 3300009098 Bacteria 1656
120 Ga0114129_10022352 3300009147 Bacteria 8977
121 Ga0105241_10017678 3300009174 Bacteria 5243
122 Ga0105242_10343236 3300009176 Bacteria 1377
123 Ga0105242_10856821 3300009176 Bacteria 905
124 Ga0105238_10041225 3300009551 Bacteria 4677
125 Ga0105238_10057553 3300009551 Bacteria 3898
126 Ga0099796_10136819 3300010159 Bacteria 954
127 Ga0105239_10166630 3300010375 Bacteria 2464
128 Ga0157370_10168250 3300013104 Bacteria 2038
129 Ga0157369_10423854 3300013105 Bacteria 1379
130 Ga0157374_10255025 3300013296 Bacteria 1727
131 Ga0157374_10760473 3300013296 Bacteria 984
132 Ga0157378_10053235 3300013297 Bacteria 3604
133 Ga0163162_10026945 3300013306 Bacteria 5683
134 Ga0163162_10631520 3300013306 Bacteria 1196
135 Ga0157372_10860839 3300013307 Bacteria 1052
136 Ga0157375_10385938 3300013308 Bacteria 1567
137 Ga0163163_10431769 3300014325 Bacteria 1376
138 Ga0163163_10599297 3300014325 Bacteria 1165
139 Ga0157377_10036515 3300014745 Bacteria 2704
140 Ga0157379_10033679 3300014968 Bacteria 4569
141 Ga0157379_10110318 3300014968 Bacteria 2471
142 Ga0157376_10002884 3300014969 Bacteria 11783
143 Ga0163161_10193662 3300017792 Bacteria 1564
144 Ga0163161_10382977 3300017792 Bacteria 1124
145 Ga0214544_1000005 3300021320 Bacteria 387675
146 Ga0214542_1000004 3300021321 Bacteria 415597
147 Ga0214545_1000005 3300021324 Bacteria 415590
148 Ga0214543_1000564 3300021327 Bacteria 63531
149 Ga0213876_10175926 3300021384 Bacteria 1139
150 Ga0209760_103121 3300025207 Bacteria 1490
151 Ga0209437_100086 3300025233 Bacteria 254578
152 Ga0209148_1000367 3300025254 Bacteria 55809
153 Ga0209148_1006433 3300025254 Bacteria 2546
154 Ga0209233_1000356 3300025261 Bacteria 42791
155 Ga0209233_1001256 3300025261 Bacteria 10190
156 Ga0209233_1004430 3300025261 Bacteria 4778
157 Ga0209025_1051410 3300025294 Bacteria 1637
158 Ga0209564_1000946 3300025295 Bacteria 37393
159 Ga0209564_1007180 3300025295 Bacteria 5807
160 Ga0209758_1000349 3300025297 Bacteria 84164
161 Ga0209758_1000474 3300025297 Bacteria 66329
162 Ga0209758_1005624 3300025297 Bacteria 9517
163 Ga0209050_1003851 3300025298 Bacteria 10683
164 Ga0209051_1012527 3300025303 Bacteria 4097
165 Ga0209257_1002432 3300025304 Bacteria 18537
166 Ga0207682_10016879 3300025893 Bacteria 2850
167 Ga0207692_10241409 3300025898 Bacteria 1079
168 Ga0207710_10098511 3300025900 Bacteria 1376
169 Ga0207688_10016567 3300025901 Bacteria 3998
170 Ga0207688_10051663 3300025901 Bacteria 2302
171 Ga0207680_10122805 3300025903 Bacteria 1701
172 Ga0207645_10027337 3300025907 Bacteria 3685
173 Ga0207705_10241212 3300025909 Bacteria 1377
174 Ga0207654_10011800 3300025911 Bacteria 4463
175 Ga0207695_10071853 3300025913 Bacteria 3533
176 Ga0207695_10256868 3300025913 Bacteria 1646
177 Ga0207671_10052456 3300025914 Bacteria 3022
178 Ga0207671_10129765 3300025914 Bacteria 1934
179 Ga0207671_10227041 3300025914 Bacteria 1464
180 Ga0207693_10017196 3300025915 Bacteria 5766
181 Ga0207660_10238009 3300025917 Bacteria 1433
182 Ga0207660_10390960 3300025917 Bacteria 1119
183 Ga0207662_10074036 3300025918 Bacteria 2067
184 Ga0207657_10008768 3300025919 Bacteria 10237
185 Ga0207657_10403475 3300025919 Bacteria 1075
186 Ga0207646_10066349 3300025922 Bacteria 3222
187 Ga0207681_10033060 3300025923 Bacteria 3390
188 Ga0207681_10367496 3300025923 Bacteria 1155
189 Ga0207694_10259540 3300025924 Bacteria 1423
190 Ga0207694_10612850 3300025924 Bacteria 916
191 Ga0207650_10207973 3300025925 Bacteria 1570
192 Ga0207659_10461317 3300025926 Bacteria 1071
193 Ga0207687_10025101 3300025927 Bacteria 3988
194 Ga0207687_10249330 3300025927 Bacteria 1411
195 Ga0207700_10204367 3300025928 Bacteria 1666
196 Ga0207700_10254620 3300025928 Bacteria 1501
197 Ga0207700_10260238 3300025928 Bacteria 1485
198 Ga0207664_10563601 3300025929 Bacteria 1022
199 Ga0207644_10415607 3300025931 Bacteria 1101
200 Ga0207686_10249607 3300025934 Bacteria 1296
201 Ga0207709_10019157 3300025935 Bacteria 3843
202 Ga0207669_10010435 3300025937 Bacteria 4472
203 Ga0207669_10012995 3300025937 Bacteria 4117
204 Ga0207669_10336309 3300025937 Bacteria 1161
205 Ga0207704_10056278 3300025938 Bacteria 2408
206 Ga0207704_10323272 3300025938 Bacteria 1191
207 Ga0207691_10006938 3300025940 Bacteria 10922
208 Ga0207691_10024673 3300025940 Bacteria 5655
209 Ga0207711_10207936 3300025941 Bacteria 1787
210 Ga0207689_10024108 3300025942 Bacteria 5105
211 Ga0207689_10176893 3300025942 Bacteria 1760
212 Ga0207689_10181620 3300025942 Bacteria 1735
213 Ga0207679_10077366 3300025945 Bacteria 2531
214 Ga0207679_10090205 3300025945 Bacteria 2369
215 Ga0207667_10128793 3300025949 Bacteria 2607
216 Ga0207667_10469761 3300025949 Bacteria 1277
217 Ga0207712_10152495 3300025961 Bacteria 1787
218 Ga0207668_10076769 3300025972 Bacteria 2406
219 Ga0207668_10144314 3300025972 Bacteria 1834
220 Ga0207640_10284963 3300025981 Bacteria 1300
221 Ga0207640_10416715 3300025981 Bacteria 1098
222 Ga0207677_10016002 3300026023 Bacteria 4428
223 Ga0207677_10150032 3300026023 Bacteria 1797
224 Ga0207703_10054849 3300026035 Bacteria 3242
225 Ga0207703_10101613 3300026035 Bacteria 2438
226 Ga0207639_10078890 3300026041 Bacteria 2601
227 Ga0207639_10184044 3300026041 Bacteria 1779
228 Ga0207639_10468140 3300026041 Bacteria 1147
229 Ga0207678_10022898 3300026067 Bacteria 5468
230 Ga0207678_10025245 3300026067 Bacteria 5187
231 Ga0207678_10229797 3300026067 Bacteria 1588
232 Ga0207708_10035860 3300026075 Bacteria 3773
233 Ga0207702_10000287 3300026078 Bacteria 58488
234 Ga0207702_10472201 3300026078 Bacteria 1220
235 Ga0207648_10015927 3300026089 Bacteria 6889
236 Ga0207648_10493606 3300026089 Bacteria 1119
237 Ga0207676_10142466 3300026095 Bacteria 2054
238 Ga0207676_10230438 3300026095 Bacteria 1655
239 Ga0207676_10236397 3300026095 Bacteria 1636
240 Ga0207675_100179037 3300026118 Bacteria 2030
241 Ga0207675_100386227 3300026118 Bacteria 1377
242 Ga0207683_10000765 3300026121 Bacteria 29217
243 Ga0207683_10032330 3300026121 Bacteria 4545
244 Ga0207683_10102847 3300026121 Bacteria 2551
245 Ga0207683_10208740 3300026121 Bacteria 1777
246 Ga0207683_10286473 3300026121 Bacteria 1506
247 Ga0207683_10350560 3300026121 Bacteria 1355
248 Ga0207683_10391501 3300026121 Bacteria 1278
249 Ga0209281_1000192 3300027111 Bacteria 140252
250 Ga0209389_1000086 3300027296 Bacteria 84925
251 Ga0209589_1000005 3300027357 Bacteria 530958
252 Ga0209589_1000027 3300027357 Bacteria 155295
253 Ga0209489_100005 3300027361 Bacteria 530958
254 Ga0209489_100313 3300027361 Bacteria 85507
255 Ga0209700_100006 3300027363 Bacteria 530958
256 Ga0209588_1001366 3300027671 Bacteria 6360
257 Ga0209813_10060608 3300027866 Bacteria 1207
258 Ga0209813_10079151 3300027866 Bacteria 1083
259 Ga0265357_1007508 3300028023 Bacteria 1054
260 Ga0268266_10028559 3300028379 Bacteria 4740
261 Ga0268266_10071617 3300028379 Bacteria 3004
262 Ga0268266_10271173 3300028379 Bacteria 1575
263 Ga0268264_10379214 3300028381 Bacteria 1354
264 Ga0268264_10676257 3300028381 Bacteria 1024
265 Ga0268264_10698987 3300028381 Bacteria 1007
266 Ga0307517_10000098 3300028786 Bacteria 126044
267 Ga0307515_10014717 3300028794 Bacteria 14476
268 Ga0265338_10088839 3300028800 Bacteria 2562
269 Ga0265763_1000076 3300030763 Bacteria 4236
270 Ga0265330_10016470 3300031235 Bacteria 3411
271 Ga0265332_10000732 3300031238 Bacteria 20494
272 Ga0265332_10011063 3300031238 Bacteria 4009
273 Ga0265325_10007210 3300031241 Bacteria 6686
274 Ga0265325_10018614 3300031241 Bacteria 3852
275 Ga0265329_10018100 3300031242 Bacteria 2413
276 Ga0265339_10001116 3300031249 Bacteria 20311
277 Ga0265339_10100124 3300031249 Bacteria 1509
278 Ga0265331_10004487 3300031250 Bacteria 8708
279 Ga0265331_10009382 3300031250 Bacteria 5494
280 Ga0265313_10061524 3300031595 Bacteria 1757
281 Ga0307508_10000678 3300031616 Bacteria 40932
282 Ga0307508_10039526 3300031616 Bacteria 4238
283 Ga0265314_10057291 3300031711 Bacteria 2677
284 Ga0265314_10245674 3300031711 Bacteria 1030
285 Ga0265342_10000258 3300031712 Bacteria 59570
286 Ga0265342_10054358 3300031712 Bacteria 2379
287 Ga0316576_10074988 3300031727 Bacteria 2502
288 Ga0307516_10059140 3300031730 Bacteria 3728
289 Ga0307410_10064480 3300031852 Bacteria 2517
290 Ga0307409_100724767 3300031995 Bacteria 996
291 Ga0307414_10365783 3300032004 Bacteria 1242
292 Ga0307411_10211331 3300032005 Bacteria 1498
293 Ga0307415_100448708 3300032126 Bacteria 1114
294 Ga0307510_10170849 3300033180 Bacteria 1753
295 Ga0315911_1000022 3300033442 Bacteria 118114
296 Ga0373926_0078474 3300035083 Bacteria 1218
297 Ga0373934_0089024 3300035086 Bacteria 1243
298 Ga0373936_0022106 3300035113 Bacteria 2477
299 Ga0373936_0050899 3300035113 Bacteria 1676
300 Ga0373945_0007444 3300035116 Bacteria 3550
301 Ga0373945_0068794 3300035116 Bacteria 1336
302 Ga0373953_0104624 3300035117 Bacteria 1193
303 Ga0373956_0052829 3300035119 Bacteria 1828
304 Ga0373956_0109121 3300035119 Bacteria 1287
305 Ga0373957_0006595 3300035120 Bacteria 3666
306 Ga0373943_0010012 3300035170 Bacteria 4252
307 Ga0373943_0054164 3300035170 Bacteria 1983
308 Ga0373946_0008000 3300035171 Bacteria 3884
309 Ga0373946_0012184 3300035171 Bacteria 3215
310 Ga0373946_0046527 3300035171 Bacteria 1798
311 Ga0373946_0120796 3300035171 Bacteria 1196
312 Ga0373955_0001596 3300035172 Bacteria 9704
313 Ga0373955_0055789 3300035172 Bacteria 2165
314 Ga0373955_0068848 3300035172 Bacteria 1973
315 Ga0316574_0001652 3300035398 Bacteria 10729
316 Ga0373924_0009271 3300035410 Bacteria 3605
317 Ga0373924_0174019 3300035410 Bacteria 946
318 Ga0373931_0025144 3300035691 Bacteria 3024
319 Ga0373931_0081689 3300035691 Bacteria 1785
320 Ga0373935_0011391 3300035692 Bacteria 5339
321 Ga0373935_0061105 3300035692 Bacteria 2411
322 Ga0373935_0160266 3300035692 Bacteria 1533
323 Ga0373927_0005666 3300035695 Bacteria 8582
324 Ga0373927_0010487 3300035695 Bacteria 6176
325 Ga0373927_0074843 3300035695 Bacteria 2192
326 Ga0373927_0147001 3300035695 Bacteria 1543
327 Ga0373933_0000812 3300035724 Bacteria 19052
328 Ga0373947_0049579 3300035725 Bacteria 2522
329 Ga0373937_0001031 3300036401 Bacteria 23580
330 Ga0373937_0001468 3300036401 Bacteria 19735
331 Ga0373937_0204580 3300036401 Bacteria 1856
332 Ga0372808_017652 3300036459 Bacteria 1025
333 Ga0373925_0006468 3300037068 Bacteria 8617
334 Ga0373925_0053426 3300037068 Bacteria 3020
335 Ga0373925_0088158 3300037068 Bacteria 2369
336 Ga0373925_0738876 3300037068 Bacteria 811
337 Ga0395900_0058294 3300037418 Bacteria 3975
338 Ga0395900_0092633 3300037418 Bacteria 3105
339 Ga0395900_0310786 3300037418 Bacteria 1559
340 Ga0395900_0401109 3300037418 Bacteria 1335
341 Ga0395898_0042480 3300037466 Bacteria 4485
342 Ga0395898_0253720 3300037466 Bacteria 1677
343 Ga0395898_0301087 3300037466 Bacteria 1530
344 Ga0395905_0033945 3300037471 Bacteria 4791
345 Ga0395905_0137774 3300037471 Bacteria 2296
346 Ga0395905_0286868 3300037471 Bacteria 1533
347 Ga0395905_0421935 3300037471 Bacteria 1230
348 Ga0436364_1540260 3300037853 Bacteria 2290
349 Ga0395901_0015664 3300038443 Bacteria 7723
350 Ga0395901_0091694 3300038443 Bacteria 3180
351 Ga0395901_0134371 3300038443 Bacteria 2600
352 Ga0395901_0518623 3300038443 Bacteria 1211
353 Ga0395901_0743728 3300038443 Bacteria 974
354 Ga0400491_15212 3300038727 Bacteria 5200
355 Ga0400483_002929 3300039062 Bacteria 2493
356 Ga0400483_269252 3300039062 Bacteria 2786
357 Ga0436365_0123947 3300039437 Bacteria 1023
358 Ga0436365_0821912 3300039437 Bacteria 2028
359 Ga0436363_0139600 3300039450 Bacteria 1795
360 Ga0436363_0909856 3300039450 Bacteria 1048
361 Ga0436363_1344272 3300039450 Bacteria 1826
362 Ga0436363_1481077 3300039450 Bacteria 5418
363 Ga0466963_0183016 3300044694 Bacteria 1463
364 Ga0466959_0290931 3300045049 Bacteria 1120
365 Ga0466967_0067011 3300045976 Bacteria 3201
366 Ga0495592_0005046 3300046454 Bacteria 9713
367 Ga0495592_0056246 3300046454 Bacteria 2908
368 Ga0495592_0075805 3300046454 Bacteria 2442
369 Ga0495603_0001950 3300046455 Bacteria 12171
370 Ga0495603_0069687 3300046455 Bacteria 2068
371 Ga0495603_0120761 3300046455 Bacteria 1527
372 Ga0495590_0068736 3300046457 Bacteria 1242
373 Ga0495629_0002766 3300046459 Bacteria 13416
374 Ga0495629_0090584 3300046459 Bacteria 2134
375 Ga0495629_0235793 3300046459 Bacteria 1260
376 Ga0495629_0280188 3300046459 Bacteria 1144
377 Ga0495629_0290744 3300046459 Bacteria 1120
378 Ga0495629_0366471 3300046459 Bacteria 981
379 Ga0495651_0020707 3300046462 Bacteria 5106
380 Ga0495653_0002068 3300046463 Bacteria 15779
381 Ga0495653_0058358 3300046463 Bacteria 2934
382 Ga0495653_0076078 3300046463 Bacteria 2496
383 Ga0495582_0047154 3300046473 Bacteria 2373
384 Ga0495605_0032101 3300046474 Bacteria 2677
385 Ga0495639_0015022 3300046475 Bacteria 3357
386 Ga0495639_0038216 3300046475 Bacteria 2155
387 Ga0495639_0210028 3300046475 Bacteria 955
388 Ga0495662_0016778 3300046476 Bacteria 3545
389 Ga0495662_0045146 3300046476 Bacteria 2127
390 Ga0495662_0061292 3300046476 Bacteria 1817
391 Ga0495662_0084410 3300046476 Bacteria 1546
392 Ga0495664_0000214 3300046477 Bacteria 27629
393 Ga0495664_0048838 3300046477 Bacteria 2512
394 Ga0495584_0014850 3300046491 Bacteria 3969
395 Ga0495607_0004985 3300046501 Bacteria 9633
396 Ga0495606_0001322 3300046507 Bacteria 33851
397 Ga0495606_0001556 3300046507 Bacteria 30139
398 Ga0495606_0021576 3300046507 Bacteria 4716
399 Ga0495608_0001557 3300046511 Bacteria 16383
400 Ga0495608_0027336 3300046511 Bacteria 3882
401 Ga0495608_0038589 3300046511 Bacteria 3206
402 Ga0495610_0007802 3300046512 Bacteria 7053
403 Ga0495618_0000576 3300046514 Bacteria 26108
404 Ga0495618_0014304 3300046514 Bacteria 4832
405 Ga0495618_0022432 3300046514 Bacteria 3899
406 Ga0495628_0011632 3300046516 Bacteria 7438
407 Ga0495628_0013710 3300046516 Bacteria 6811
408 Ga0495630_0009161 3300046517 Bacteria 7120
409 Ga0495630_0021118 3300046517 Bacteria 4806
410 Ga0495630_0021273 3300046517 Bacteria 4790
411 Ga0495630_0022700 3300046517 Bacteria 4635
412 Ga0495630_0083415 3300046517 Bacteria 2413
413 Ga0495630_0154271 3300046517 Bacteria 1748
414 Ga0495637_0091648 3300046520 Bacteria 1198
415 Ga0495648_0000576 3300046524 Bacteria 39297
416 Ga0495648_0029520 3300046524 Bacteria 3639
417 Ga0495648_0061655 3300046524 Bacteria 2226
418 Ga0495652_0003106 3300046529 Bacteria 16596
419 Ga0495652_0043797 3300046529 Bacteria 3855
420 Ga0495652_0082531 3300046529 Bacteria 2648
421 Ga0495665_0024607 3300046531 Bacteria 3234
422 Ga0495665_0076829 3300046531 Bacteria 1757
423 Ga0495665_0282738 3300046531 Bacteria 851
424 Ga0495640_0003344 3300046533 Bacteria 12908
425 Ga0495640_0003758 3300046533 Bacteria 12182
426 Ga0495640_0027016 3300046533 Bacteria 4143
427 Ga0495640_0027770 3300046533 Bacteria 4078
428 Ga0495640_0034950 3300046533 Bacteria 3559
429 Ga0495640_0060083 3300046533 Bacteria 2586
430 Ga0495586_0026388 3300046535 Bacteria 3108
431 Ga0495586_0113726 3300046535 Bacteria 1508
432 Ga0495587_0000308 3300046536 Bacteria 34905
433 Ga0495587_0017460 3300046536 Bacteria 4457
434 Ga0495645_0018975 3300046543 Bacteria 4948
435 Ga0495645_0053982 3300046543 Bacteria 2920
436 Ga0495645_0265706 3300046543 Bacteria 1134
437 Ga0495622_0023452 3300046557 Bacteria 2877
438 Ga0495667_0001377 3300046559 Bacteria 16003
439 Ga0495667_0047619 3300046559 Bacteria 2832
440 Ga0495667_0232464 3300046559 Bacteria 1175
441 Ga0495656_0034334 3300046615 Bacteria 2076
442 Ga0495668_0070492 3300046616 Bacteria 1922
443 Ga0495634_0001419 3300046642 Bacteria 21401
444 Ga0495634_0010577 3300046642 Bacteria 6755
445 Ga0495634_0010893 3300046642 Bacteria 6639
446 Ga0495634_0028052 3300046642 Bacteria 3911
447 Ga0495634_0140542 3300046642 Bacteria 1533
448 Ga0495611_0066054 3300046648 Bacteria 1649
449 Ga0495625_0093740 3300046660 Bacteria 2072
450 Ga0495625_0161173 3300046660 Bacteria 1503
451 Ga0495625_0233185 3300046660 Bacteria 1201
452 Ga0495635_0000409 3300046663 Bacteria 27280
453 Ga0495635_0004336 3300046663 Bacteria 9824
454 Ga0495635_0111087 3300046663 Bacteria 1872
455 Ga0495659_0012697 3300046664 Bacteria 2733
456 Ga0495661_0007704 3300046665 Bacteria 7499
457 Ga0495588_0027689 3300046674 Bacteria 2834
458 Ga0495657_0021011 3300046675 Bacteria 4690
459 Ga0495657_0323267 3300046675 Bacteria 916
460 Ga0495599_0002032 3300046678 Bacteria 11712
461 Ga0495599_0023622 3300046678 Bacteria 3844
462 Ga0495623_0000611 3300046679 Bacteria 23793
463 Ga0495623_0064961 3300046679 Bacteria 2282
464 Ga0495646_0084401 3300046680 Bacteria 1844
465 Ga0495646_0122121 3300046680 Bacteria 1473
466 Ga0495646_0203884 3300046680 Bacteria 1076
467 Ga0495647_0014550 3300046681 Bacteria 2743
468 Ga0495647_0036746 3300046681 Bacteria 1845
469 Ga0495658_0023647 3300046683 Bacteria 3264
470 Ga0495658_0039793 3300046683 Bacteria 2610
471 Ga0495613_0027251 3300046689 Bacteria 4252
472 Ga0495613_0045678 3300046689 Bacteria 3239
473 Ga0495613_0210598 3300046689 Bacteria 1367
474 Ga0495624_0079111 3300046690 Bacteria 2039
475 Ga0495624_0133449 3300046690 Bacteria 1522
476 Ga0495670_0028793 3300046691 Bacteria 2754
477 Ga0495671_0022968 3300046692 Bacteria 3262
478 Ga0495600_0000879 3300046809 Bacteria 16048
479 Ga0495600_0086394 3300046809 Bacteria 2047
480 Ga0495581_0056247 3300047315 Bacteria 2271
481 Ga0495581_0156834 3300047315 Bacteria 1330
482 Ga0495581_0226672 3300047315 Bacteria 1093
483 Ga0495604_0000543 3300047317 Bacteria 33191
484 Ga0495604_0025767 3300047317 Bacteria 4684
485 Ga0495604_0256920 3300047317 Bacteria 1189
486 Ga0495636_0038748 3300047318 Bacteria 1973
487 Ga0495674_0002790 3300047319 Bacteria 16953
488 Ga0495674_0026311 3300047319 Bacteria 5325
489 Ga0495674_0065765 3300047319 Bacteria 3148
490 Ga0495674_0089282 3300047319 Bacteria 2635
491 Ga0495672_0062935 3300047320 Bacteria 2132
492 Ga0495680_0002855 3300047322 Bacteria 17362
493 Ga0495680_0004856 3300047322 Bacteria 12736
494 Ga0495680_0037033 3300047322 Bacteria 3910
495 Ga0495675_0005227 3300047444 Bacteria 7904
496 Ga0495675_0127162 3300047444 Bacteria 1585
497 Ga0495684_0002502 3300047471 Bacteria 14639
498 Ga0495684_0011051 3300047471 Bacteria 6981
499 Ga0495684_0129155 3300047471 Bacteria 1899
500 Ga0495686_0010264 3300047472 Bacteria 6668
501 Ga0495686_0021002 3300047472 Bacteria 4347
502 Ga0495686_0151987 3300047472 Bacteria 1358
503 Ga0495593_0011842 3300047673 Bacteria 5002
504 Ga0495593_0029014 3300047673 Bacteria 3037
505 Ga0495593_0081112 3300047673 Bacteria 1678
506 Ga0495602_0041819 3300048088 Bacteria 4182
507 Ga0495615_0011455 3300048090 Bacteria 1803
508 Ga0496100_0115117 3300048903 Bacteria 1874
509 Ga0496100_0135745 3300048903 Bacteria 1738
510 Ga0496100_0246512 3300048903 Bacteria 1320
511 Ga0496101_0042884 3300048904 Bacteria 3231
512 Ga0496102_0003551 3300048905 Bacteria 13206
513 Ga0496102_0139137 3300048905 Bacteria 2276
514 Ga0496102_0182319 3300048905 Bacteria 1978
515 Ga0496102_0207492 3300048905 Bacteria 1847
516 Ga0496103_0237307 3300048906 Bacteria 1173
517 Ga0496104_0021237 3300048907 Bacteria 5957
518 Ga0496105_0038450 3300048908 Bacteria 3941
519 Ga0496105_0096402 3300048908 Bacteria 2443
520 Ga0496105_0132165 3300048908 Bacteria 2057
521 Ga0496106_0033502 3300048909 Bacteria 3832
522 Ga0496107_0000607 3300048910 Bacteria 19967
523 Ga0496107_0092552 3300048910 Bacteria 2210
524 Ga0496107_0095637 3300048910 Bacteria 2173
525 Ga0496107_0342050 3300048910 Bacteria 1113
526 Ga0496108_0001175 3300048911 Bacteria 20416
527 Ga0496108_0142462 3300048911 Bacteria 2065
528 Ga0496108_0329784 3300048911 Bacteria 1331
529 Ga0496108_0332159 3300048911 Bacteria 1326
530 Ga0496109_0001679 3300048912 Bacteria 18452
531 Ga0496109_0251765 3300048912 Bacteria 1663
532 Ga0496109_0384051 3300048912 Bacteria 1327
533 Ga0496110_0080507 3300048913 Bacteria 2902
534 Ga0496110_0087227 3300048913 Bacteria 2787
535 Ga0496110_0704312 3300048913 Bacteria 911
536 Ga0496111_0249000 3300048914 Bacteria 1319
537 Ga0496112_0000054 3300048915 Bacteria 79516
538 Ga0496112_0027470 3300048915 Bacteria 5486
539 Ga0496112_0362702 3300048915 Bacteria 1391
540 Ga0496113_0146263 3300048916 Bacteria 1862
541 Ga0496114_0041804 3300048917 Bacteria 3798
542 Ga0496114_0202173 3300048917 Bacteria 1740
543 Ga0496114_0650131 3300048917 Bacteria 927
544 Ga0496115_0082438 3300048918 Bacteria 2620
545 Ga0496115_0123784 3300048918 Bacteria 2129
546 Ga0496116_0000080 3300048919 Bacteria 224530
547 Ga0496116_0005626 3300048919 Bacteria 11542
548 Ga0496118_0032852 3300048921 Bacteria 4266
549 Ga0496118_0047805 3300048921 Bacteria 3312
550 Ga0496118_0062288 3300048921 Bacteria 2755
551 Ga0496118_0110299 3300048921 Bacteria 1828
552 Ga0496119_0217695 3300048922 Bacteria 979
553 Ga0496121_0005128 3300048924 Bacteria 17062
554 Ga0496121_0025831 3300048924 Bacteria 5557
555 Ga0496121_0032975 3300048924 Bacteria 4697
556 Ga0496121_0036046 3300048924 Bacteria 4416
557 Ga0496121_0038194 3300048924 Bacteria 4257
558 Ga0496121_0044284 3300048924 Bacteria 3841
559 Ga0496121_0173922 3300048924 Bacteria 1561
560 Ga0496121_0194748 3300048924 Bacteria 1450
561 Ga0496121_0234505 3300048924 Bacteria 1283
562 Ga0496122_0033520 3300048925 Bacteria 4222
563 Ga0496122_0052729 3300048925 Bacteria 3075
564 Ga0496122_0177236 3300048925 Bacteria 1276
565 Ga0496123_0020343 3300048926 Bacteria 5194
566 Ga0496123_0120273 3300048926 Bacteria 1479
567 Ga0496124_0000063 3300048927 Bacteria 229705
568 Ga0496124_0043957 3300048927 Bacteria 3837
569 Ga0496124_0157963 3300048927 Bacteria 1771
570 Ga0496124_0254054 3300048927 Bacteria 1298
571 Ga0496125_0002194 3300048928 Bacteria 26068
572 Ga0496125_0025833 3300048928 Bacteria 5368
573 Ga0496126_0000094 3300048929 Bacteria 208184
574 Ga0496126_0008651 3300048929 Bacteria 10939
575 Ga0496126_0011589 3300048929 Bacteria 9100
576 Ga0496126_0014882 3300048929 Bacteria 7847
577 Ga0496126_0014993 3300048929 Bacteria 7813
578 Ga0496126_0314239 3300048929 Bacteria 1289
579 Ga0501031_0000823 3300049568 Bacteria 18677
580 Ga0501032_0000030 3300049569 Bacteria 130405
581 Ga0501033_0000060 3300049570 Bacteria 103159
582 Ga0501034_0000117 3300049571 Bacteria 144865
583 Ga0501034_0538398 3300049571 Bacteria 1078
584 Ga0501036_0000148 3300049572 Bacteria 45613
585 Ga0501037_0000090 3300049573 Bacteria 85021
586 Ga0501038_0000441 3300049574 Bacteria 36178
587 Ga0501039_0000443 3300049575 Bacteria 30068
588 Ga0501039_0073070 3300049575 Bacteria 2665
589 Ga0501039_0476799 3300049575 Bacteria 980
590 Ga0501043_0000919 3300049579 Bacteria 26107
591 Ga0501046_0000214 3300049580 Bacteria 60379
592 Ga0501047_0000571 3300049581 Bacteria 39243
593 Ga0501048_0000563 3300049582 Bacteria 26308
594 Ga0501048_0242636 3300049582 Bacteria 1279
595 Ga0501067_0001731 3300049583 Bacteria 12000
596 Ga0501068_0002887 3300049584 Bacteria 9143
597 Ga0501069_0025285 3300049585 Bacteria 3243
598 Ga0501069_0291932 3300049585 Bacteria 955
599 Ga0501070_0003669 3300049586 Bacteria 13268
600 Ga0501070_0356783 3300049586 Bacteria 1186
601 Ga0501071_0068860 3300049587 Bacteria 2576
602 Ga0501071_0354341 3300049587 Bacteria 1117
603 Ga0501072_0005916 3300049588 Bacteria 9317
604 Ga0501072_0006989 3300049588 Bacteria 8570
605 Ga0501072_0450046 3300049588 Bacteria 1020
606 Ga0501073_0000203 3300049589 Bacteria 39315
607 Ga0501073_0402980 3300049589 Bacteria 945
608 Ga0501074_0000633 3300049590 Bacteria 21831
609 Ga0501077_0046104 3300049593 Bacteria 2770
610 Ga0501238_015525 3300049671 Bacteria 1051
611 Ga0501079_0001528 3300049741 Bacteria 16365
612 Ga0501080_0014195 3300049742 Bacteria 7333
613 Ga0501081_0321267 3300049743 Bacteria 1138
614 Ga0501083_0000539 3300049744 Bacteria 24199
615 Ga0501083_0303610 3300049744 Bacteria 1038
616 Ga0501035_0000212 3300049822 Bacteria 69856
617 Ga0501044_0000304 3300049823 Bacteria 61877
618 Ga0501044_0304277 3300049823 Bacteria 1522
619 Ga0501045_0035178 3300049824 Bacteria 3636
620 nmdc:mga03683_8077_c1 3300050489 Bacteria 3686
621 nmdc:mga03n38_29979_c1 3300050490 Bacteria 2283
622 nmdc:mga03n38_44831_c1 3300050490 Bacteria 1945
623 nmdc:mga00v17_59102_c1 3300050491 Bacteria 2351
624 nmdc:mga0yw44_138665_c1 3300050492 Bacteria 1579
625 nmdc:mga0yw44_169110_c1 3300050492 Bacteria 1434
626 nmdc:mga07m45_27743_c2 3300050496 Bacteria 1493
627 nmdc:mga05p37_129659_c1 3300050507 Bacteria 3094
628 nmdc:mga05p37_15913_c1 3300050507 Bacteria 9049
629 nmdc:mga0qj67_672648_c1 3300050509 Bacteria 825
630 nmdc:mga06r32_103085_c1 3300050510 Bacteria 2801
631 nmdc:mga06r32_42186_c1 3300050510 Bacteria 4337
632 nmdc:mga08y16_305153_c1 3300050511 Bacteria 1640
633 nmdc:mga08y16_313148_c1 3300050511 Bacteria 1616
634 nmdc:mga08y16_380801_c1 3300050511 Bacteria 1446
635 nmdc:mga08x19_297132_c1 3300050514 Bacteria 1121
636 nmdc:mga0sz30_4527_c1 3300050516 Bacteria 5031
637 Ga0495601_0000874 3300053077 Bacteria 16426
638 Ga0495601_0004232 3300053077 Bacteria 8285
639 Ga0495601_0017206 3300053077 Bacteria 4388
640 Ga0495612_0000121 3300053078 Bacteria 32966
641 Ga0495612_0000364 3300053078 Bacteria 18228
642 Ga0495612_0020038 3300053078 Bacteria 2679
643 Ga0495612_0037598 3300053078 Bacteria 1966
644 Ga0495595_0000179 3300053084 Bacteria 25284
645 Ga0495595_0000356 3300053084 Bacteria 17378
646 Ga0495595_0239908 3300053084 Bacteria 907
647 Ga0495619_0000071 3300053085 Bacteria 79814
648 Ga0495619_0001264 3300053085 Bacteria 16587
649 Ga0495619_0003020 3300053085 Bacteria 10929
650 Ga0495619_0240475 3300053085 Bacteria 1254
651 Ga0500651_0133295 3300053093 Bacteria 1501
652 Ga0500566_0004256 3300053094 Bacteria 8540
653 Ga0500641_0001545 3300053096 Bacteria 8220
654 Ga0500641_0013893 3300053096 Bacteria 2963
655 Ga0500650_0000379 3300053098 Bacteria 10864
656 Ga0500650_0183618 3300053098 Bacteria 958
657 Ga0500556_0000045 3300053104 Bacteria 130653
658 Ga0500569_020674 3300053109 Bacteria 1730
659 Ga0500572_032203 3300053111 Bacteria 1470
660 Ga0500592_002040 3300053116 Bacteria 3255
661 Ga0500593_000219 3300053117 Bacteria 23614
662 Ga0500607_150493 3300053121 Bacteria 1079
663 Ga0500608_000919 3300053122 Bacteria 10610
664 Ga0500618_001886 3300053125 Bacteria 8678
665 Ga0500642_0000024 3300053130 Bacteria 134373
666 Ga0500642_0057811 3300053130 Bacteria 1731
667 Ga0500652_000356 3300053131 Bacteria 16417
668 Ga0500559_0000414 3300053136 Bacteria 30678
669 Ga0500568_0000456 3300053139 Bacteria 30484
670 Ga0500585_105683 3300053144 Bacteria 1012
671 Ga0500586_000524 3300053145 Bacteria 7713
672 Ga0500604_0001142 3300053151 Bacteria 7369
673 Ga0500616_0000048 3300053153 Bacteria 313108
674 Ga0500616_0000054 3300053153 Bacteria 290186
675 Ga0500616_0046294 3300053153 Bacteria 2313
676 Ga0500620_006855 3300053155 Bacteria 2769
677 Ga0500622_0000714 3300053156 Bacteria 29050
678 Ga0500627_0021274 3300053158 Bacteria 2615
679 Ga0500627_0059682 3300053158 Bacteria 1676
680 Ga0500633_0025699 3300053160 Bacteria 1845
681 Ga0500636_0001447 3300053177 Bacteria 12924
682 Ga0500636_0006532 3300053177 Bacteria 6697
683 Ga0500636_0033858 3300053177 Bacteria 3023
684 Ga0500601_000376 3300053737 Bacteria 7971
685 Ga0501084_0011763 3300054114 Bacteria 7247
686 Ga0501084_0186200 3300054114 Bacteria 1752
687 Ga0501084_0321439 3300054114 Bacteria 1307
688 Ga0501082_0043670 3300060353 Bacteria 3865
689 Ga0501082_0258758 3300060353 Bacteria 1514

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0538398 Ga0501034_0538398_136_957 230
2 3300005937 Ga0081455_10036840 Ga0081455_100368404 231
3 3300048929 Ga0496126_0011589 Ga0496126_0011589_7403_8218 231
4 3300048090 Ga0495615_0011455 Ga0495615_0011455_832_1647 232
5 3300006942 Ga0099824_1003081 Ga0099824_10030814 234
6 3300027296 Ga0209389_1000086 Ga0209389_100008638 234
7 3300027357 Ga0209589_1000027 Ga0209589_100002747 234
8 3300027361 Ga0209489_100313 Ga0209489_10031338 234
9 3300048903 Ga0496100_0246512 Ga0496100_0246512_15_773 234
10 3300003215 JGI25153J46596_10036295 JGI25153J46596_100362952 235
11 3300006051 Ga0075364_10161274 Ga0075364_101612741 235
12 3300021320 Ga0214544_1000005 Ga0214544_1000005115 235
13 3300021321 Ga0214542_1000004 Ga0214542_1000004119 235
14 3300021324 Ga0214545_1000005 Ga0214545_1000005278 235
15 3300021327 Ga0214543_1000564 Ga0214543_10005644 235
16 3300025295 Ga0209564_1007180 Ga0209564_10071802 235
17 3300025297 Ga0209758_1000474 Ga0209758_100047424 235
18 3300031250 Ga0265331_10009382 Ga0265331_100093826 235
19 3300038443 Ga0395901_0134371 Ga0395901_0134371_828_1640 235
20 3300046455 Ga0495603_0069687 Ga0495603_0069687_340_1155 235
21 3300046664 Ga0495659_0012697 Ga0495659_0012697_663_1478 235
22 3300038443 Ga0395901_0091694 Ga0395901_0091694_210_1028 236
23 3300025926 Ga0207659_10461317 Ga0207659_104613171 237
24 3300048910 Ga0496107_0095637 Ga0496107_0095637_1210_2025 237
25 3300025898 Ga0207692_10241409 Ga0207692_102414092 238
26 3300025915 Ga0207693_10017196 Ga0207693_100171961 238
27 3300025929 Ga0207664_10563601 Ga0207664_105636012 238
28 3300048903 Ga0496100_0135745 Ga0496100_0135745_373_1188 238
29 3300048905 Ga0496102_0207492 Ga0496102_0207492_188_1003 238
30 3300048915 Ga0496112_0362702 Ga0496112_0362702_165_980 238
31 3300048917 Ga0496114_0650131 Ga0496114_0650131_12_815 238
32 3300048924 Ga0496121_0173922 Ga0496121_0173922_366_1181 238
33 3300013308 Ga0157375_10385938 Ga0157375_103859382 239
34 3300037466 Ga0395898_0042480 Ga0395898_0042480_3225_4040 240
35 3300037471 Ga0395905_0286868 Ga0395905_0286868_291_1106 240
36 3300006847 Ga0075431_100022230 Ga0075431_1000222302 241
37 3300036459 Ga0372808_017652 Ga0372808_017652_181_996 241
38 3300037471 Ga0395905_0421935 Ga0395905_0421935_357_1172 241
39 3300050510 nmdc:mga06r32_103085_c1 nmdc:mga06r32_103085_c1_1547_2359 241
40 iso_pu_bacteria 2924710171 2924716807 241
41 3300031238 Ga0265332_10011063 Ga0265332_100110634 242
42 3300046475 Ga0495639_0015022 Ga0495639_0015022_63_878 242
43 3300035691 Ga0373931_0081689 Ga0373931_0081689_712_1629 243
44 3300046520 Ga0495637_0091648 Ga0495637_0091648_253_1068 243
45 3300046663 Ga0495635_0111087 Ga0495635_0111087_122_856 244
46 3300049568 Ga0501031_0000823 Ga0501031_0000823_9587_10408 244
47 3300049569 Ga0501032_0000030 Ga0501032_0000030_102933_103754 244
48 3300049570 Ga0501033_0000060 Ga0501033_0000060_24417_25238 244
49 3300049571 Ga0501034_0000117 Ga0501034_0000117_59081_59902 244
50 3300049572 Ga0501036_0000148 Ga0501036_0000148_14945_15766 244
51 3300049573 Ga0501037_0000090 Ga0501037_0000090_80858_81679 244
52 3300049574 Ga0501038_0000441 Ga0501038_0000441_7924_8745 244
53 3300049575 Ga0501039_0000443 Ga0501039_0000443_14179_15000 244
54 3300049579 Ga0501043_0000919 Ga0501043_0000919_23956_24777 244
55 3300049580 Ga0501046_0000214 Ga0501046_0000214_50441_51262 244
56 3300049581 Ga0501047_0000571 Ga0501047_0000571_20657_21478 244
57 3300049582 Ga0501048_0000563 Ga0501048_0000563_17688_18509 244
58 3300049583 Ga0501067_0001731 Ga0501067_0001731_9616_10437 244
59 3300049584 Ga0501068_0002887 Ga0501068_0002887_7980_8801 244
60 3300049585 Ga0501069_0025285 Ga0501069_0025285_2047_2868 244
61 3300049586 Ga0501070_0003669 Ga0501070_0003669_102_923 244
62 3300049587 Ga0501071_0068860 Ga0501071_0068860_1428_2249 244
63 3300049588 Ga0501072_0006989 Ga0501072_0006989_7507_8328 244
64 3300049589 Ga0501073_0000203 Ga0501073_0000203_27354_28175 244
65 3300049590 Ga0501074_0000633 Ga0501074_0000633_14190_15011 244
66 3300049741 Ga0501079_0001528 Ga0501079_0001528_2606_3427 244
67 3300049742 Ga0501080_0014195 Ga0501080_0014195_1987_2808 244
68 3300049744 Ga0501083_0000539 Ga0501083_0000539_1319_2140 244
69 3300049822 Ga0501035_0000212 Ga0501035_0000212_34374_35195 244
70 3300049823 Ga0501044_0000304 Ga0501044_0000304_1976_2797 244
71 3300049824 Ga0501045_0035178 Ga0501045_0035178_2691_3512 244
72 3300053084 Ga0495595_0239908 Ga0495595_0239908_162_896 244
73 3300054114 Ga0501084_0011763 Ga0501084_0011763_2242_3063 244
74 3300060353 Ga0501082_0043670 Ga0501082_0043670_2670_3491 244
75 3300025903 Ga0207680_10122805 Ga0207680_101228052 245
76 3300003215 JGI25153J46596_10000872 JGI25153J46596_100008726 246
77 3300005329 Ga0070683_100222355 Ga0070683_1002223552 246
78 3300005355 Ga0070671_100132146 Ga0070671_1001321462 246
79 3300005355 Ga0070671_100561575 Ga0070671_1005615751 246
80 3300005456 Ga0070678_100347680 Ga0070678_1003476802 246
81 3300005466 Ga0070685_10085396 Ga0070685_100853962 246
82 3300005539 Ga0068853_100102316 Ga0068853_1001023162 246
83 3300005548 Ga0070665_100085000 Ga0070665_1000850002 246
84 3300005564 Ga0070664_100081717 Ga0070664_1000817172 246
85 3300005842 Ga0068858_100243034 Ga0068858_1002430342 246
86 3300005843 Ga0068860_100171237 Ga0068860_1001712373 246
87 3300006177 Ga0075362_10136070 Ga0075362_101360702 246
88 3300006237 Ga0097621_100053573 Ga0097621_1000535734 246
89 3300009098 Ga0105245_10169811 Ga0105245_101698112 246
90 3300009098 Ga0105245_10203588 Ga0105245_102035883 246
91 3300009176 Ga0105242_10343236 Ga0105242_103432362 246
92 3300009551 Ga0105238_10041225 Ga0105238_100412252 246
93 3300010375 Ga0105239_10166630 Ga0105239_101666302 246
94 3300013296 Ga0157374_10255025 Ga0157374_102550251 246
95 3300013297 Ga0157378_10053235 Ga0157378_100532354 246
96 3300013306 Ga0163162_10026945 Ga0163162_100269455 246
97 3300014968 Ga0157379_10110318 Ga0157379_101103182 246
98 3300014969 Ga0157376_10002884 Ga0157376_1000288410 246
99 3300025297 Ga0209758_1005624 Ga0209758_10056246 246
100 3300025900 Ga0207710_10098511 Ga0207710_100985111 246
101 3300025938 Ga0207704_10056278 Ga0207704_100562782 246
102 3300025945 Ga0207679_10077366 Ga0207679_100773663 246
103 3300026023 Ga0207677_10016002 Ga0207677_100160023 246
104 3300026035 Ga0207703_10101613 Ga0207703_101016132 246
105 3300026095 Ga0207676_10142466 Ga0207676_101424663 246
106 3300026121 Ga0207683_10032330 Ga0207683_100323303 246
107 3300026121 Ga0207683_10102847 Ga0207683_101028472 246
108 3300026121 Ga0207683_10391501 Ga0207683_103915012 246
109 3300028379 Ga0268266_10071617 Ga0268266_100716173 246
110 3300038727 Ga0400491_15212 Ga0400491_15212_4231_5058 246
111 3300046543 Ga0495645_0265706 Ga0495645_0265706_139_957 246
112 3300046615 Ga0495656_0034334 Ga0495656_0034334_1012_1827 246
113 3300046660 Ga0495625_0233185 Ga0495625_0233185_172_987 246
114 3300046809 Ga0495600_0086394 Ga0495600_0086394_521_1339 246
115 3300047315 Ga0495581_0056247 Ga0495581_0056247_1307_2122 246
116 3300048905 Ga0496102_0003551 Ga0496102_0003551_10577_11392 246
117 3300048907 Ga0496104_0021237 Ga0496104_0021237_3492_4307 246
118 3300048908 Ga0496105_0038450 Ga0496105_0038450_1915_2730 246
119 3300048911 Ga0496108_0329784 Ga0496108_0329784_469_1284 246
120 3300048912 Ga0496109_0384051 Ga0496109_0384051_119_934 246
121 3300048913 Ga0496110_0080507 Ga0496110_0080507_447_1262 246
122 3300048913 Ga0496110_0704312 Ga0496110_0704312_75_890 246
123 3300048918 Ga0496115_0082438 Ga0496115_0082438_1371_2186 246
124 3300049585 Ga0501069_0291932 Ga0501069_0291932_103_918 246
125 3300050507 nmdc:mga05p37_129659_c1 nmdc:mga05p37_129659_c1_870_1670 246
126 3300005327 Ga0070658_10324336 Ga0070658_103243362 247
127 3300005366 Ga0070659_100134493 Ga0070659_1001344932 247
128 3300014745 Ga0157377_10036515 Ga0157377_100365153 247
129 3300025261 Ga0209233_1001256 Ga0209233_10012567 247
130 3300025919 Ga0207657_10008768 Ga0207657_100087682 247
131 3300025949 Ga0207667_10469761 Ga0207667_104697611 247
132 3300026041 Ga0207639_10184044 Ga0207639_101840443 247
133 3300035117 Ga0373953_0104624 Ga0373953_0104624_237_1055 247
134 3300035119 Ga0373956_0052829 Ga0373956_0052829_967_1785 247
135 3300037418 Ga0395900_0401109 Ga0395900_0401109_322_1140 247
136 3300046516 Ga0495628_0013710 Ga0495628_0013710_16_834 247
137 3300046529 Ga0495652_0082531 Ga0495652_0082531_1372_2190 247
138 3300046543 Ga0495645_0053982 Ga0495645_0053982_1649_2467 247
139 3300046678 Ga0495599_0023622 Ga0495599_0023622_1643_2461 247
140 3300046679 Ga0495623_0064961 Ga0495623_0064961_1157_1975 247
141 3300047322 Ga0495680_0037033 Ga0495680_0037033_1451_2269 247
142 3300047444 Ga0495675_0127162 Ga0495675_0127162_570_1388 247
143 3300048088 Ga0495602_0041819 Ga0495602_0041819_1807_2625 247
144 3300048924 Ga0496121_0194748 Ga0496121_0194748_407_1222 247
145 3300050511 nmdc:mga08y16_305153_c1 nmdc:mga08y16_305153_c1_516_1331 247
146 3300053078 Ga0495612_0020038 Ga0495612_0020038_422_1240 247
147 3300053085 Ga0495619_0240475 Ga0495619_0240475_238_1056 247
148 3300053153 Ga0500616_0000048 Ga0500616_0000048_233301_234116 247
149 3300005435 Ga0070714_100094910 Ga0070714_1000949102 248
150 3300033442 Ga0315911_1000022 Ga0315911_100002271 248
151 3300035692 Ga0373935_0160266 Ga0373935_0160266_578_1393 248
152 3300036401 Ga0373937_0204580 Ga0373937_0204580_535_1350 248
153 3300046459 Ga0495629_0366471 Ga0495629_0366471_104_919 248
154 3300046511 Ga0495608_0027336 Ga0495608_0027336_370_1185 248
155 3300046517 Ga0495630_0154271 Ga0495630_0154271_707_1522 248
156 3300046533 Ga0495640_0060083 Ga0495640_0060083_1730_2545 248
157 3300046559 Ga0495667_0047619 Ga0495667_0047619_550_1365 248
158 3300046642 Ga0495634_0140542 Ga0495634_0140542_563_1378 248
159 3300046683 Ga0495658_0023647 Ga0495658_0023647_365_1180 248
160 3300047317 Ga0495604_0025767 Ga0495604_0025767_2793_3608 248
161 3300047322 Ga0495680_0004856 Ga0495680_0004856_6445_7260 248
162 3300053077 Ga0495601_0004232 Ga0495601_0004232_1372_2187 248
163 3300053078 Ga0495612_0037598 Ga0495612_0037598_770_1585 248
164 3300053084 Ga0495595_0000356 Ga0495595_0000356_4314_5129 248
165 3300053085 Ga0495619_0000071 Ga0495619_0000071_9949_10764 248
166 3300053153 Ga0500616_0046294 Ga0500616_0046294_132_947 248
167 3300005335 Ga0070666_10309077 Ga0070666_103090771 249
168 3300005347 Ga0070668_100057648 Ga0070668_1000576483 249
169 3300005356 Ga0070674_100031335 Ga0070674_1000313354 249
170 3300005543 Ga0070672_100225477 Ga0070672_1002254772 249
171 3300005544 Ga0070686_100129075 Ga0070686_1001290751 249
172 3300005545 Ga0070695_100116495 Ga0070695_1001164952 249
173 3300005548 Ga0070665_100091160 Ga0070665_1000911603 249
174 3300005981 Ga0081538_10017420 Ga0081538_100174205 249
175 3300006358 Ga0068871_100536001 Ga0068871_1005360012 249
176 3300009098 Ga0105245_10139750 Ga0105245_101397503 249
177 3300013306 Ga0163162_10631520 Ga0163162_106315201 249
178 3300017792 Ga0163161_10193662 Ga0163161_101936622 249
179 3300025919 Ga0207657_10403475 Ga0207657_104034752 249
180 3300025923 Ga0207681_10367496 Ga0207681_103674962 249
181 3300025927 Ga0207687_10249330 Ga0207687_102493301 249
182 3300025935 Ga0207709_10019157 Ga0207709_100191572 249
183 3300025937 Ga0207669_10012995 Ga0207669_100129954 249
184 3300025938 Ga0207704_10323272 Ga0207704_103232722 249
185 3300025940 Ga0207691_10024673 Ga0207691_100246736 249
186 3300025961 Ga0207712_10152495 Ga0207712_101524952 249
187 3300025972 Ga0207668_10076769 Ga0207668_100767693 249
188 3300026067 Ga0207678_10229797 Ga0207678_102297972 249
189 3300026121 Ga0207683_10286473 Ga0207683_102864732 249
190 3300028379 Ga0268266_10271173 Ga0268266_102711732 249
191 3300028381 Ga0268264_10676257 Ga0268264_106762572 249
192 3300039450 Ga0436363_0909856 Ga0436363_0909856_14_823 249
193 3300045049 Ga0466959_0290931 Ga0466959_0290931_150_959 249
194 3300048906 Ga0496103_0237307 Ga0496103_0237307_140_955 249
195 3300048921 Ga0496118_0062288 Ga0496118_0062288_1871_2692 249
196 3300048924 Ga0496121_0025831 Ga0496121_0025831_861_1682 249
197 3300049586 Ga0501070_0356783 Ga0501070_0356783_254_1072 249
198 3300049823 Ga0501044_0304277 Ga0501044_0304277_252_1070 249
199 3300003762 Ga0055542_1015078 Ga0055542_10150782 250
200 3300005334 Ga0068869_100163243 Ga0068869_1001632432 250
201 3300005338 Ga0068868_100017821 Ga0068868_1000178214 250
202 3300005339 Ga0070660_100413074 Ga0070660_1004130741 250
203 3300005347 Ga0070668_100046008 Ga0070668_1000460083 250
204 3300005455 Ga0070663_100024821 Ga0070663_1000248213 250
205 3300005457 Ga0070662_100062108 Ga0070662_1000621081 250
206 3300005546 Ga0070696_100389750 Ga0070696_1003897501 250
207 3300005563 Ga0068855_100168146 Ga0068855_1001681462 250
208 3300005564 Ga0070664_100138593 Ga0070664_1001385932 250
209 3300005578 Ga0068854_100216108 Ga0068854_1002161082 250
210 3300005618 Ga0068864_100066513 Ga0068864_1000665133 250
211 3300006048 Ga0075363_100002221 Ga0075363_1000022214 250
212 3300006051 Ga0075364_10372812 Ga0075364_103728122 250
213 3300006178 Ga0075367_10104103 Ga0075367_101041032 250
214 3300006871 Ga0075434_100072230 Ga0075434_1000722304 250
215 3300006914 Ga0075436_100079624 Ga0075436_1000796243 250
216 3300009098 Ga0105245_10270812 Ga0105245_102708122 250
217 3300009174 Ga0105241_10017678 Ga0105241_100176783 250
218 3300025254 Ga0209148_1000367 Ga0209148_100036730 250
219 3300025261 Ga0209233_1004430 Ga0209233_10044303 250
220 3300025911 Ga0207654_10011800 Ga0207654_100118003 250
221 3300025914 Ga0207671_10129765 Ga0207671_101297652 250
222 3300025924 Ga0207694_10612850 Ga0207694_106128501 250
223 3300025927 Ga0207687_10025101 Ga0207687_100251014 250
224 3300025931 Ga0207644_10415607 Ga0207644_104156072 250
225 3300025934 Ga0207686_10249607 Ga0207686_102496072 250
226 3300025937 Ga0207669_10336309 Ga0207669_103363091 250
227 3300025942 Ga0207689_10181620 Ga0207689_101816202 250
228 3300025945 Ga0207679_10090205 Ga0207679_100902052 250
229 3300025949 Ga0207667_10128793 Ga0207667_101287932 250
230 3300025972 Ga0207668_10144314 Ga0207668_101443141 250
231 3300026023 Ga0207677_10150032 Ga0207677_101500322 250
232 3300026035 Ga0207703_10054849 Ga0207703_100548492 250
233 3300026041 Ga0207639_10078890 Ga0207639_100788902 250
234 3300026067 Ga0207678_10022898 Ga0207678_100228983 250
235 3300026095 Ga0207676_10236397 Ga0207676_102363972 250
236 3300026118 Ga0207675_100386227 Ga0207675_1003862272 250
237 3300026121 Ga0207683_10350560 Ga0207683_103505602 250
238 3300027866 Ga0209813_10060608 Ga0209813_100606082 250
239 3300028379 Ga0268266_10028559 Ga0268266_100285594 250
240 3300035113 Ga0373936_0022106 Ga0373936_0022106_1119_1928 250
241 3300035116 Ga0373945_0007444 Ga0373945_0007444_2013_2822 250
242 3300035170 Ga0373943_0010012 Ga0373943_0010012_820_1629 250
243 3300035171 Ga0373946_0008000 Ga0373946_0008000_2357_3166 250
244 3300035172 Ga0373955_0055789 Ga0373955_0055789_1120_1929 250
245 3300035410 Ga0373924_0009271 Ga0373924_0009271_274_1083 250
246 3300035692 Ga0373935_0061105 Ga0373935_0061105_754_1563 250
247 3300037068 Ga0373925_0006468 Ga0373925_0006468_457_1266 250
248 3300037418 Ga0395900_0058294 Ga0395900_0058294_2009_2824 250
249 3300037466 Ga0395898_0301087 Ga0395898_0301087_526_1341 250
250 3300046459 Ga0495629_0090584 Ga0495629_0090584_852_1661 250
251 3300046473 Ga0495582_0047154 Ga0495582_0047154_916_1725 250
252 3300046514 Ga0495618_0022432 Ga0495618_0022432_775_1584 250
253 3300046517 Ga0495630_0009161 Ga0495630_0009161_2411_3220 250
254 3300046531 Ga0495665_0024607 Ga0495665_0024607_2303_3112 250
255 3300046533 Ga0495640_0034950 Ga0495640_0034950_2627_3436 250
256 3300046535 Ga0495586_0113726 Ga0495586_0113726_187_996 250
257 3300046642 Ga0495634_0028052 Ga0495634_0028052_2925_3734 250
258 3300046680 Ga0495646_0122121 Ga0495646_0122121_220_1029 250
259 3300046681 Ga0495647_0014550 Ga0495647_0014550_438_1247 250
260 3300047319 Ga0495674_0065765 Ga0495674_0065765_1216_2025 250
261 3300047471 Ga0495684_0129155 Ga0495684_0129155_345_1154 250
262 3300047673 Ga0495593_0011842 Ga0495593_0011842_1799_2608 250
263 3300048905 Ga0496102_0139137 Ga0496102_0139137_584_1399 250
264 3300048911 Ga0496108_0332159 Ga0496108_0332159_318_1133 250
265 3300048916 Ga0496113_0146263 Ga0496113_0146263_553_1368 250
266 3300048929 Ga0496126_0008651 Ga0496126_0008651_9619_10437 250
267 3300048929 Ga0496126_0314239 Ga0496126_0314239_90_905 250
268 3300049588 Ga0501072_0450046 Ga0501072_0450046_234_992 250
269 3300050490 nmdc:mga03n38_44831_c1 nmdc:mga03n38_44831_c1_581_1396 250
270 3300050496 nmdc:mga07m45_27743_c2 nmdc:mga07m45_27743_c2_271_1086 250
271 3300053096 Ga0500641_0013893 Ga0500641_0013893_1300_2115 250
272 3300053737 Ga0500601_000376 Ga0500601_000376_6568_7380 250
273 3300005435 Ga0070714_100286168 Ga0070714_1002861682 251
274 3300005983 Ga0081540_1007317 Ga0081540_10073174 251
275 3300025254 Ga0209148_1006433 Ga0209148_10064332 251
276 3300025914 Ga0207671_10227041 Ga0207671_102270412 251
277 3300035120 Ga0373957_0006595 Ga0373957_0006595_1697_2515 251
278 3300035171 Ga0373946_0012184 Ga0373946_0012184_1671_2462 251
279 3300035725 Ga0373947_0049579 Ga0373947_0049579_184_975 251
280 3300046454 Ga0495592_0056246 Ga0495592_0056246_441_1259 251
281 3300046459 Ga0495629_0235793 Ga0495629_0235793_28_819 251
282 3300046459 Ga0495629_0290744 Ga0495629_0290744_28_846 251
283 3300046475 Ga0495639_0210028 Ga0495639_0210028_30_821 251
284 3300046476 Ga0495662_0061292 Ga0495662_0061292_918_1709 251
285 3300046511 Ga0495608_0038589 Ga0495608_0038589_1626_2444 251
286 3300046533 Ga0495640_0027016 Ga0495640_0027016_88_879 251
287 3300046533 Ga0495640_0027770 Ga0495640_0027770_435_1253 251
288 3300046536 Ga0495587_0017460 Ga0495587_0017460_1530_2348 251
289 3300046559 Ga0495667_0232464 Ga0495667_0232464_17_835 251
290 3300046690 Ga0495624_0133449 Ga0495624_0133449_530_1321 251
291 3300047319 Ga0495674_0089282 Ga0495674_0089282_475_1266 251
292 3300047673 Ga0495593_0081112 Ga0495593_0081112_542_1357 251
293 3300048911 Ga0496108_0142462 Ga0496108_0142462_1141_1920 251
294 3300048912 Ga0496109_0251765 Ga0496109_0251765_862_1641 251
295 3300049575 Ga0501039_0073070 Ga0501039_0073070_1528_2349 251
296 3300050509 nmdc:mga0qj67_672648_c1 nmdc:mga0qj67_672648_c1_38_814 251
297 3300053077 Ga0495601_0017206 Ga0495601_0017206_2020_2838 251
298 3300053117 Ga0500593_000219 Ga0500593_000219_15519_16355 251
299 3300031616 Ga0307508_10000678 Ga0307508_1000067817 252
300 3300047315 Ga0495581_0226672 Ga0495581_0226672_190_1005 252
301 3300048918 Ga0496115_0123784 Ga0496115_0123784_1146_1961 252
302 3300005445 Ga0070708_100035864 Ga0070708_1000358643 253
303 3300005459 Ga0068867_100553608 Ga0068867_1005536082 253
304 3300005468 Ga0070707_100124412 Ga0070707_1001244123 253
305 3300005518 Ga0070699_100476325 Ga0070699_1004763251 253
306 3300005614 Ga0068856_100600332 Ga0068856_1006003321 253
307 3300007788 Ga0099795_10015182 Ga0099795_100151821 253
308 3300025922 Ga0207646_10066349 Ga0207646_100663493 253
309 3300025941 Ga0207711_10207936 Ga0207711_102079362 253
310 3300026078 Ga0207702_10472201 Ga0207702_104722012 253
311 3300026089 Ga0207648_10493606 Ga0207648_104936062 253
312 3300028381 Ga0268264_10379214 Ga0268264_103792141 253
313 3300028794 Ga0307515_10014717 Ga0307515_1001471710 253
314 3300031616 Ga0307508_10039526 Ga0307508_100395264 253
315 3300035691 Ga0373931_0025144 Ga0373931_0025144_1061_1888 253
316 3300035695 Ga0373927_0005666 Ga0373927_0005666_1449_2264 253
317 3300037068 Ga0373925_0738876 Ga0373925_0738876_27_791 253
318 3300039062 Ga0400483_002929 Ga0400483_002929_441_1253 253
319 3300046455 Ga0495603_0001950 Ga0495603_0001950_2179_2994 253
320 3300046507 Ga0495606_0001556 Ga0495606_0001556_11568_12371 253
321 3300046674 Ga0495588_0027689 Ga0495588_0027689_620_1435 253
322 3300048903 Ga0496100_0115117 Ga0496100_0115117_816_1643 253
323 3300048905 Ga0496102_0182319 Ga0496102_0182319_1100_1927 253
324 3300048908 Ga0496105_0132165 Ga0496105_0132165_94_921 253
325 3300048910 Ga0496107_0092552 Ga0496107_0092552_726_1553 253
326 3300048914 Ga0496111_0249000 Ga0496111_0249000_116_943 253
327 3300048915 Ga0496112_0000054 Ga0496112_0000054_36255_37070 253
328 3300048915 Ga0496112_0027470 Ga0496112_0027470_3673_4500 253
329 3300048917 Ga0496114_0041804 Ga0496114_0041804_2059_2886 253
330 3300049582 Ga0501048_0242636 Ga0501048_0242636_429_1250 253
331 3300049589 Ga0501073_0402980 Ga0501073_0402980_22_801 253
332 3300050514 nmdc:mga08x19_297132_c1 nmdc:mga08x19_297132_c1_201_1016 253
333 3300006941 Ga0099825_1018667 Ga0099825_10186673 254
334 3300006942 Ga0099824_1022736 Ga0099824_10227364 254
335 3300006943 Ga0099822_1008903 Ga0099822_100890311 254
336 3300007788 Ga0099795_10004750 Ga0099795_100047502 254
337 3300025909 Ga0207705_10241212 Ga0207705_102412122 254
338 3300027357 Ga0209589_1000005 Ga0209589_100000592 254
339 3300027361 Ga0209489_100005 Ga0209489_10000592 254
340 3300027363 Ga0209700_100006 Ga0209700_10000692 254
341 3300005578 Ga0068854_100340505 Ga0068854_1003405051 255
342 3300006178 Ga0075367_10002644 Ga0075367_100026448 255
343 3300025981 Ga0207640_10284963 Ga0207640_102849632 255
344 3300047320 Ga0495672_0062935 Ga0495672_0062935_625_1440 256
345 3300049575 Ga0501039_0476799 Ga0501039_0476799_59_874 256
346 3300049588 Ga0501072_0005916 Ga0501072_0005916_6963_7766 256
347 3300054114 Ga0501084_0186200 Ga0501084_0186200_856_1659 256
348 3300005436 Ga0070713_100544251 Ga0070713_1005442512 257
349 3300025928 Ga0207700_10254620 Ga0207700_102546202 257
350 3300031730 Ga0307516_10059140 Ga0307516_100591403 257
351 3300033180 Ga0307510_10170849 Ga0307510_101708492 257
352 3300048924 Ga0496121_0038194 Ga0496121_0038194_2547_3362 257
353 3300048927 Ga0496124_0000063 Ga0496124_0000063_94995_95807 257
354 3300005336 Ga0070680_100379811 Ga0070680_1003798112 258
355 3300005467 Ga0070706_100452508 Ga0070706_1004525082 258
356 3300025917 Ga0207660_10390960 Ga0207660_103909601 258
357 3300053177 Ga0500636_0033858 Ga0500636_0033858_1466_2272 258
358 3300005336 Ga0070680_100219420 Ga0070680_1002194203 259
359 3300005344 Ga0070661_100146659 Ga0070661_1001466592 259
360 3300009093 Ga0105240_10430415 Ga0105240_104304152 259
361 3300009093 Ga0105240_10637233 Ga0105240_106372332 259
362 3300009176 Ga0105242_10856821 Ga0105242_108568211 259
363 3300013104 Ga0157370_10168250 Ga0157370_101682502 259
364 3300013105 Ga0157369_10423854 Ga0157369_104238542 259
365 3300014325 Ga0163163_10431769 Ga0163163_104317692 259
366 3300025913 Ga0207695_10071853 Ga0207695_100718534 259
367 3300025917 Ga0207660_10238009 Ga0207660_102380092 259
368 3300025981 Ga0207640_10416715 Ga0207640_104167152 259
369 3300026041 Ga0207639_10468140 Ga0207639_104681402 259
370 3300028786 Ga0307517_10000098 Ga0307517_1000009842 259
371 3300031249 Ga0265339_10100124 Ga0265339_101001242 259
372 3300037068 Ga0373925_0053426 Ga0373925_0053426_1793_2572 259
373 3300037418 Ga0395900_0092633 Ga0395900_0092633_2252_3061 259
374 3300037418 Ga0395900_0310786 Ga0395900_0310786_567_1379 259
375 3300037466 Ga0395898_0253720 Ga0395898_0253720_439_1248 259
376 3300038443 Ga0395901_0015664 Ga0395901_0015664_6109_6918 259
377 3300038443 Ga0395901_0743728 Ga0395901_0743728_129_941 259
378 3300046459 Ga0495629_0280188 Ga0495629_0280188_32_811 259
379 3300046463 Ga0495653_0076078 Ga0495653_0076078_1685_2464 259
380 3300046476 Ga0495662_0045146 Ga0495662_0045146_1034_1813 259
381 3300046517 Ga0495630_0021273 Ga0495630_0021273_2907_3686 259
382 3300046531 Ga0495665_0282738 Ga0495665_0282738_49_828 259
383 3300046642 Ga0495634_0010893 Ga0495634_0010893_697_1476 259
384 3300046675 Ga0495657_0323267 Ga0495657_0323267_127_906 259
385 3300046680 Ga0495646_0203884 Ga0495646_0203884_159_938 259
386 3300046689 Ga0495613_0210598 Ga0495613_0210598_542_1321 259
387 3300046690 Ga0495624_0079111 Ga0495624_0079111_1094_1873 259
388 3300053077 Ga0495601_0000874 Ga0495601_0000874_8129_8908 259
389 3300036401 Ga0373937_0001468 Ga0373937_0001468_11343_12131 260
390 3300039450 Ga0436363_0139600 Ga0436363_0139600_109_897 260
391 3300046517 Ga0495630_0083415 Ga0495630_0083415_67_882 260
392 3300046689 Ga0495613_0045678 Ga0495613_0045678_2133_2921 260
393 iso_pu_bacteria 2508501050 2508735897 260
394 iso_pu_bacteria 2508501114 2509078280 260
395 iso_pu_bacteria 2835312727 2835318589 260
396 3300031238 Ga0265332_10000732 Ga0265332_1000073210 261
397 3300031242 Ga0265329_10018100 Ga0265329_100181003 261
398 3300031249 Ga0265339_10001116 Ga0265339_100011169 261
399 3300031711 Ga0265314_10057291 Ga0265314_100572912 261
400 3300031712 Ga0265342_10000258 Ga0265342_1000025832 261
401 3300039062 Ga0400483_269252 Ga0400483_269252_1143_1931 261
402 iso_pu_bacteria 8054563764 8054568926 261
403 3300006847 Ga0075431_100663506 Ga0075431_1006635061 262
404 3300049593 Ga0501077_0046104 Ga0501077_0046104_493_1293 262
405 3300050510 nmdc:mga06r32_42186_c1 nmdc:mga06r32_42186_c1_170_982 262
406 3300060353 Ga0501082_0258758 Ga0501082_0258758_491_1291 262
407 iso_pu_bacteria 2773857925 2774873991 262
408 3300005327 Ga0070658_10100659 Ga0070658_101006592 263
409 iso_pu_bacteria 2775506901 2776259532 263
410 iso_pu_bacteria 2882456835 2882463206 263
411 iso_pu_bacteria 2884298095 2884299784 263
412 iso_pu_bacteria 2894232714 2894238321 263
413 3300005548 Ga0070665_100564277 Ga0070665_1005642772 264
414 3300031595 Ga0265313_10061524 Ga0265313_100615242 264
415 3300031727 Ga0316576_10074988 Ga0316576_100749882 264
416 3300035398 Ga0316574_0001652 Ga0316574_0001652_9733_10530 264
417 3300050492 nmdc:mga0yw44_169110_c1 nmdc:mga0yw44_169110_c1_87_881 264
418 3300005329 Ga0070683_100282171 Ga0070683_1002821711 265
419 3300009093 Ga0105240_10182322 Ga0105240_101823222 265
420 3300009147 Ga0114129_10022352 Ga0114129_100223525 265
421 3300009551 Ga0105238_10057553 Ga0105238_100575533 265
422 3300025913 Ga0207695_10256868 Ga0207695_102568682 265
423 3300025924 Ga0207694_10259540 Ga0207694_102595401 265
424 3300037853 Ga0436364_1540260 Ga0436364_1540260_552_1355 265
425 3300050507 nmdc:mga05p37_15913_c1 nmdc:mga05p37_15913_c1_3926_4729 265
426 3300005577 Ga0068857_100131263 Ga0068857_1001312633 266
427 3300005617 Ga0068859_100254302 Ga0068859_1002543022 266
428 3300005617 Ga0068859_100304399 Ga0068859_1003043992 266
429 3300005618 Ga0068864_100285926 Ga0068864_1002859263 266
430 3300005843 Ga0068860_100787551 Ga0068860_1007875511 266
431 3300005983 Ga0081540_1067547 Ga0081540_10675472 266
432 3300006931 Ga0097620_100254282 Ga0097620_1002542822 266
433 3300006931 Ga0097620_100304415 Ga0097620_1003044152 266
434 3300014325 Ga0163163_10599297 Ga0163163_105992972 266
435 3300025901 Ga0207688_10016567 Ga0207688_100165674 266
436 3300025918 Ga0207662_10074036 Ga0207662_100740363 266
437 3300025942 Ga0207689_10024108 Ga0207689_100241082 266
438 3300026075 Ga0207708_10035860 Ga0207708_100358603 266
439 3300026095 Ga0207676_10230438 Ga0207676_102304383 266
440 3300028381 Ga0268264_10698987 Ga0268264_106989872 266
441 3300031852 Ga0307410_10064480 Ga0307410_100644802 266
442 3300032004 Ga0307414_10365783 Ga0307414_103657832 266
443 3300032005 Ga0307411_10211331 Ga0307411_102113312 266
444 3300032126 Ga0307415_100448708 Ga0307415_1004487082 266
445 3300035086 Ga0373934_0089024 Ga0373934_0089024_365_1165 266
446 3300035113 Ga0373936_0050899 Ga0373936_0050899_398_1198 266
447 3300035116 Ga0373945_0068794 Ga0373945_0068794_342_1142 266
448 3300035119 Ga0373956_0109121 Ga0373956_0109121_243_1043 266
449 3300035170 Ga0373943_0054164 Ga0373943_0054164_883_1683 266
450 3300035171 Ga0373946_0120796 Ga0373946_0120796_252_1052 266
451 3300035172 Ga0373955_0001596 Ga0373955_0001596_7196_7996 266
452 3300035410 Ga0373924_0174019 Ga0373924_0174019_73_873 266
453 3300035695 Ga0373927_0010487 Ga0373927_0010487_4178_4978 266
454 3300035724 Ga0373933_0000812 Ga0373933_0000812_11515_12315 266
455 3300036401 Ga0373937_0001031 Ga0373937_0001031_10149_10949 266
456 3300037471 Ga0395905_0137774 Ga0395905_0137774_999_1802 266
457 3300039437 Ga0436365_0123947 Ga0436365_0123947_59_859 266
458 3300046454 Ga0495592_0005046 Ga0495592_0005046_2902_3702 266
459 3300046455 Ga0495603_0120761 Ga0495603_0120761_373_1173 266
460 3300046459 Ga0495629_0002766 Ga0495629_0002766_6894_7694 266
461 3300046462 Ga0495651_0020707 Ga0495651_0020707_2050_2850 266
462 3300046463 Ga0495653_0002068 Ga0495653_0002068_4739_5539 266
463 3300046474 Ga0495605_0032101 Ga0495605_0032101_827_1636 266
464 3300046477 Ga0495664_0048838 Ga0495664_0048838_1082_1882 266
465 3300046511 Ga0495608_0001557 Ga0495608_0001557_10349_11149 266
466 3300046514 Ga0495618_0000576 Ga0495618_0000576_14974_15774 266
467 3300046516 Ga0495628_0011632 Ga0495628_0011632_2061_2861 266
468 3300046517 Ga0495630_0022700 Ga0495630_0022700_2886_3686 266
469 3300046529 Ga0495652_0003106 Ga0495652_0003106_10256_11056 266
470 3300046533 Ga0495640_0003344 Ga0495640_0003344_181_981 266
471 3300046536 Ga0495587_0000308 Ga0495587_0000308_10325_11125 266
472 3300046559 Ga0495667_0001377 Ga0495667_0001377_1048_1848 266
473 3300046642 Ga0495634_0010577 Ga0495634_0010577_1655_2455 266
474 3300046663 Ga0495635_0004336 Ga0495635_0004336_3740_4540 266
475 3300046675 Ga0495657_0021011 Ga0495657_0021011_3839_4639 266
476 3300046678 Ga0495599_0002032 Ga0495599_0002032_5593_6393 266
477 3300046679 Ga0495623_0000611 Ga0495623_0000611_10321_11121 266
478 3300046683 Ga0495658_0039793 Ga0495658_0039793_1120_1920 266
479 3300046689 Ga0495613_0027251 Ga0495613_0027251_1786_2586 266
480 3300046809 Ga0495600_0000879 Ga0495600_0000879_8250_9050 266
481 3300047315 Ga0495581_0156834 Ga0495581_0156834_186_986 266
482 3300047317 Ga0495604_0000543 Ga0495604_0000543_8618_9418 266
483 3300047318 Ga0495636_0038748 Ga0495636_0038748_646_1455 266
484 3300047319 Ga0495674_0026311 Ga0495674_0026311_3462_4262 266
485 3300047322 Ga0495680_0002855 Ga0495680_0002855_6462_7262 266
486 3300047444 Ga0495675_0005227 Ga0495675_0005227_72_872 266
487 3300047471 Ga0495684_0011051 Ga0495684_0011051_1575_2375 266
488 3300047673 Ga0495593_0029014 Ga0495593_0029014_1141_1941 266
489 3300049671 Ga0501238_015525 Ga0501238_015525_109_912 266
490 3300053078 Ga0495612_0000364 Ga0495612_0000364_10337_11137 266
491 3300053084 Ga0495595_0000179 Ga0495595_0000179_14136_14936 266
492 3300053085 Ga0495619_0001264 Ga0495619_0001264_14094_14894 266
493 iso_pu_bacteria 2643221568 2643856336 266
494 iso_pu_bacteria 2906626472 2906626775 266
495 iso_pu_bacteria 2919166419 2919166897 266
496 iso_pu_bacteria 8006926726 8006931671 266
497 iso_pu_bacteria 8016530956 8016538098 266
498 iso_pu_bacteria 8016583857 8016588580 266
499 iso_pu_bacteria 8054460903 8054461323 266
500 3300005293 Ga0065715_10298573 Ga0065715_102985731 267
501 3300005333 Ga0070677_10011215 Ga0070677_100112152 267
502 3300005335 Ga0070666_10054161 Ga0070666_100541612 267
503 3300005356 Ga0070674_100043210 Ga0070674_1000432102 267
504 3300005364 Ga0070673_100034663 Ga0070673_1000346633 267
505 3300005365 Ga0070688_100060526 Ga0070688_1000605262 267
506 3300005367 Ga0070667_100259511 Ga0070667_1002595111 267
507 3300005436 Ga0070713_100119459 Ga0070713_1001194592 267
508 3300005438 Ga0070701_10271095 Ga0070701_102710952 267
509 3300005455 Ga0070663_100078843 Ga0070663_1000788432 267
510 3300005456 Ga0070678_100036362 Ga0070678_1000363622 267
511 3300005459 Ga0068867_100059534 Ga0068867_1000595343 267
512 3300005466 Ga0070685_10045378 Ga0070685_100453782 267
513 3300005548 Ga0070665_100372631 Ga0070665_1003726312 267
514 3300005617 Ga0068859_100223991 Ga0068859_1002239912 267
515 3300006048 Ga0075363_100005097 Ga0075363_1000050973 267
516 3300006177 Ga0075362_10002727 Ga0075362_100027276 267
517 3300006186 Ga0075369_10004550 Ga0075369_100045503 267
518 3300006195 Ga0075366_10005909 Ga0075366_100059093 267
519 3300006881 Ga0068865_100069090 Ga0068865_1000690902 267
520 3300006931 Ga0097620_100223999 Ga0097620_1002239992 267
521 3300009094 Ga0111539_10856662 Ga0111539_108566621 267
522 3300010159 Ga0099796_10136819 Ga0099796_101368192 267
523 3300013296 Ga0157374_10760473 Ga0157374_107604731 267
524 3300017792 Ga0163161_10382977 Ga0163161_103829771 267
525 3300021384 Ga0213876_10175926 Ga0213876_101759261 267
526 3300025295 Ga0209564_1000946 Ga0209564_10009466 267
527 3300025893 Ga0207682_10016879 Ga0207682_100168792 267
528 3300025901 Ga0207688_10051663 Ga0207688_100516632 267
529 3300025907 Ga0207645_10027337 Ga0207645_100273374 267
530 3300025914 Ga0207671_10052456 Ga0207671_100524562 267
531 3300025923 Ga0207681_10033060 Ga0207681_100330605 267
532 3300025925 Ga0207650_10207973 Ga0207650_102079732 267
533 3300025928 Ga0207700_10204367 Ga0207700_102043672 267
534 3300025928 Ga0207700_10260238 Ga0207700_102602381 267
535 3300025937 Ga0207669_10010435 Ga0207669_100104351 267
536 3300025940 Ga0207691_10006938 Ga0207691_100069386 267
537 3300025942 Ga0207689_10176893 Ga0207689_101768932 267
538 3300026067 Ga0207678_10025245 Ga0207678_100252454 267
539 3300026078 Ga0207702_10000287 Ga0207702_1000028741 267
540 3300026089 Ga0207648_10015927 Ga0207648_100159276 267
541 3300026118 Ga0207675_100179037 Ga0207675_1001790372 267
542 3300026121 Ga0207683_10000765 Ga0207683_100007651 267
543 3300026121 Ga0207683_10208740 Ga0207683_102087402 267
544 3300027671 Ga0209588_1001366 Ga0209588_10013663 267
545 3300027866 Ga0209813_10079151 Ga0209813_100791512 267
546 3300028023 Ga0265357_1007508 Ga0265357_10075082 267
547 3300030763 Ga0265763_1000076 Ga0265763_10000765 267
548 3300031235 Ga0265330_10016470 Ga0265330_100164704 267
549 3300031241 Ga0265325_10007210 Ga0265325_100072104 267
550 3300031250 Ga0265331_10004487 Ga0265331_100044877 267
551 3300031711 Ga0265314_10245674 Ga0265314_102456741 267
552 3300035172 Ga0373955_0068848 Ga0373955_0068848_487_1302 267
553 3300039437 Ga0436365_0821912 Ga0436365_0821912_682_1491 267
554 3300039450 Ga0436363_1344272 Ga0436363_1344272_978_1781 267
555 3300039450 Ga0436363_1481077 Ga0436363_1481077_70_882 267
556 3300044694 Ga0466963_0183016 Ga0466963_0183016_23_841 267
557 3300045976 Ga0466967_0067011 Ga0466967_0067011_672_1490 267
558 3300046457 Ga0495590_0068736 Ga0495590_0068736_304_1116 267
559 3300046476 Ga0495662_0084410 Ga0495662_0084410_330_1139 267
560 3300046491 Ga0495584_0014850 Ga0495584_0014850_2726_3538 267
561 3300046501 Ga0495607_0004985 Ga0495607_0004985_3035_3850 267
562 3300046507 Ga0495606_0021576 Ga0495606_0021576_911_1726 267
563 3300046512 Ga0495610_0007802 Ga0495610_0007802_3010_3825 267
564 3300046524 Ga0495648_0000576 Ga0495648_0000576_4014_4829 267
565 3300046524 Ga0495648_0029520 Ga0495648_0029520_583_1398 267
566 3300046524 Ga0495648_0061655 Ga0495648_0061655_1207_2022 267
567 3300046557 Ga0495622_0023452 Ga0495622_0023452_1954_2769 267
568 3300046616 Ga0495668_0070492 Ga0495668_0070492_99_914 267
569 3300046648 Ga0495611_0066054 Ga0495611_0066054_155_967 267
570 3300046660 Ga0495625_0093740 Ga0495625_0093740_74_889 267
571 3300046660 Ga0495625_0161173 Ga0495625_0161173_161_970 267
572 3300046665 Ga0495661_0007704 Ga0495661_0007704_1535_2350 267
573 3300046691 Ga0495670_0028793 Ga0495670_0028793_1670_2485 267
574 3300046692 Ga0495671_0022968 Ga0495671_0022968_1727_2542 267
575 3300047317 Ga0495604_0256920 Ga0495604_0256920_125_940 267
576 3300047472 Ga0495686_0010264 Ga0495686_0010264_635_1450 267
577 3300048904 Ga0496101_0042884 Ga0496101_0042884_480_1295 267
578 3300048908 Ga0496105_0096402 Ga0496105_0096402_969_1784 267
579 3300048909 Ga0496106_0033502 Ga0496106_0033502_2224_3039 267
580 3300048910 Ga0496107_0000607 Ga0496107_0000607_11174_11989 267
581 3300048911 Ga0496108_0001175 Ga0496108_0001175_9816_10631 267
582 3300048912 Ga0496109_0001679 Ga0496109_0001679_10536_11351 267
583 3300048913 Ga0496110_0087227 Ga0496110_0087227_173_988 267
584 3300048919 Ga0496116_0005626 Ga0496116_0005626_6323_7138 267
585 3300048921 Ga0496118_0032852 Ga0496118_0032852_93_908 267
586 3300048921 Ga0496118_0047805 Ga0496118_0047805_1246_2061 267
587 3300048921 Ga0496118_0110299 Ga0496118_0110299_501_1316 267
588 3300048924 Ga0496121_0032975 Ga0496121_0032975_869_1684 267
589 3300048924 Ga0496121_0036046 Ga0496121_0036046_620_1435 267
590 3300048925 Ga0496122_0052729 Ga0496122_0052729_201_1016 267
591 3300048925 Ga0496122_0177236 Ga0496122_0177236_284_1099 267
592 3300048926 Ga0496123_0020343 Ga0496123_0020343_582_1397 267
593 3300048926 Ga0496123_0120273 Ga0496123_0120273_521_1336 267
594 3300048927 Ga0496124_0157963 Ga0496124_0157963_672_1487 267
595 3300048927 Ga0496124_0254054 Ga0496124_0254054_189_1004 267
596 3300048928 Ga0496125_0002194 Ga0496125_0002194_4946_5761 267
597 3300048928 Ga0496125_0025833 Ga0496125_0025833_702_1517 267
598 3300048929 Ga0496126_0014882 Ga0496126_0014882_5051_5866 267
599 3300048929 Ga0496126_0014993 Ga0496126_0014993_2020_2835 267
600 3300049587 Ga0501071_0354341 Ga0501071_0354341_291_1103 267
601 3300049743 Ga0501081_0321267 Ga0501081_0321267_255_1067 267
602 3300050489 nmdc:mga03683_8077_c1 nmdc:mga03683_8077_c1_401_1210 267
603 3300050490 nmdc:mga03n38_29979_c1 nmdc:mga03n38_29979_c1_470_1279 267
604 3300050491 nmdc:mga00v17_59102_c1 nmdc:mga00v17_59102_c1_219_1028 267
605 3300050492 nmdc:mga0yw44_138665_c1 nmdc:mga0yw44_138665_c1_249_1064 267
606 3300050511 nmdc:mga08y16_313148_c1 nmdc:mga08y16_313148_c1_104_913 267
607 3300050516 nmdc:mga0sz30_4527_c1 nmdc:mga0sz30_4527_c1_1221_2036 267
608 3300053093 Ga0500651_0133295 Ga0500651_0133295_142_951 267
609 3300053094 Ga0500566_0004256 Ga0500566_0004256_2980_3795 267
610 3300053096 Ga0500641_0001545 Ga0500641_0001545_478_1293 267
611 3300053098 Ga0500650_0000379 Ga0500650_0000379_3162_3977 267
612 3300053098 Ga0500650_0183618 Ga0500650_0183618_98_907 267
613 3300053104 Ga0500556_0000045 Ga0500556_0000045_75353_76168 267
614 3300053109 Ga0500569_020674 Ga0500569_020674_518_1333 267
615 3300053116 Ga0500592_002040 Ga0500592_002040_1627_2442 267
616 3300053121 Ga0500607_150493 Ga0500607_150493_217_1032 267
617 3300053122 Ga0500608_000919 Ga0500608_000919_7585_8400 267
618 3300053125 Ga0500618_001886 Ga0500618_001886_5710_6525 267
619 3300053130 Ga0500642_0000024 Ga0500642_0000024_79263_80078 267
620 3300053130 Ga0500642_0057811 Ga0500642_0057811_335_1144 267
621 3300053131 Ga0500652_000356 Ga0500652_000356_4570_5385 267
622 3300053136 Ga0500559_0000414 Ga0500559_0000414_28221_29036 267
623 3300053139 Ga0500568_0000456 Ga0500568_0000456_16884_17699 267
624 3300053144 Ga0500585_105683 Ga0500585_105683_179_991 267
625 3300053145 Ga0500586_000524 Ga0500586_000524_2474_3289 267
626 3300053151 Ga0500604_0001142 Ga0500604_0001142_2147_2962 267
627 3300053153 Ga0500616_0000054 Ga0500616_0000054_78262_79077 267
628 3300053155 Ga0500620_006855 Ga0500620_006855_167_979 267
629 3300053156 Ga0500622_0000714 Ga0500622_0000714_14825_15640 267
630 3300053158 Ga0500627_0021274 Ga0500627_0021274_928_1743 267
631 3300053158 Ga0500627_0059682 Ga0500627_0059682_171_986 267
632 3300053160 Ga0500633_0025699 Ga0500633_0025699_812_1627 267
633 3300053177 Ga0500636_0001447 Ga0500636_0001447_4733_5548 267
634 iso_pu_bacteria 2602042107 2603860510 267
635 iso_pu_bacteria 2643221558 2643812914 267
636 iso_pu_bacteria 2643221651 2644287173 267
637 iso_pu_bacteria 2721755755 2723848758 267
638 iso_pu_bacteria 2841840854 2841843226 267
639 iso_pu_bacteria 2842140634 2842143008 267
640 iso_pu_bacteria 2857524615 2857525461 267
641 iso_pu_bacteria 2893066018 2893070888 267
642 iso_pu_bacteria 2904690495 2904691669 267
643 iso_pu_bacteria 2906635258 2906643158 267
644 iso_pu_bacteria 2906660503 2906664854 267
645 iso_pu_bacteria 2908739725 2908745791 267
646 iso_pu_bacteria 2908756301 2908763815 267
647 iso_pu_bacteria 2919073203 2919074729 267
648 iso_pu_bacteria 2919171160 2919172087 267
649 iso_pu_bacteria 2935630451 2935630686 267
650 iso_pu_bacteria 2935777560 2935782520 267
651 iso_pu_bacteria 2941507105 2941507338 267
652 iso_pu_bacteria 2941515067 2941515765 267
653 iso_pu_bacteria 2941523033 2941523527 267
654 iso_pu_bacteria 8006994254 8006998984 267
655 iso_pu_bacteria 8016603502 8016605000 267
656 iso_pu_bacteria 8016613128 8016620010 267
657 iso_pu_bacteria 8019538911 8019539394 267
658 iso_pu_bacteria 8056681323 8056681794 267
659 3300005471 Ga0070698_100523884 Ga0070698_1005238841 268
660 3300006028 Ga0070717_10250152 Ga0070717_102501522 268
661 3300006852 Ga0075433_10041214 Ga0075433_100412144 268
662 3300009094 Ga0111539_10023762 Ga0111539_100237621 268
663 3300014968 Ga0157379_10033679 Ga0157379_100336794 268
664 3300028800 Ga0265338_10088839 Ga0265338_100888392 268
665 3300031241 Ga0265325_10018614 Ga0265325_100186143 268
666 3300031712 Ga0265342_10054358 Ga0265342_100543582 268
667 3300035083 Ga0373926_0078474 Ga0373926_0078474_191_1003 268
668 3300035171 Ga0373946_0046527 Ga0373946_0046527_24_836 268
669 3300035692 Ga0373935_0011391 Ga0373935_0011391_910_1722 268
670 3300035695 Ga0373927_0074843 Ga0373927_0074843_631_1443 268
671 3300035695 Ga0373927_0147001 Ga0373927_0147001_32_847 268
672 3300037068 Ga0373925_0088158 Ga0373925_0088158_684_1496 268
673 3300046454 Ga0495592_0075805 Ga0495592_0075805_1429_2241 268
674 3300046463 Ga0495653_0058358 Ga0495653_0058358_847_1659 268
675 3300046475 Ga0495639_0038216 Ga0495639_0038216_640_1452 268
676 3300046476 Ga0495662_0016778 Ga0495662_0016778_1827_2639 268
677 3300046477 Ga0495664_0000214 Ga0495664_0000214_7544_8356 268
678 3300046514 Ga0495618_0014304 Ga0495618_0014304_3425_4237 268
679 3300046517 Ga0495630_0021118 Ga0495630_0021118_1274_2086 268
680 3300046529 Ga0495652_0043797 Ga0495652_0043797_1347_2159 268
681 3300046531 Ga0495665_0076829 Ga0495665_0076829_749_1561 268
682 3300046533 Ga0495640_0003758 Ga0495640_0003758_7495_8307 268
683 3300046535 Ga0495586_0026388 Ga0495586_0026388_1123_1935 268
684 3300046543 Ga0495645_0018975 Ga0495645_0018975_3150_3962 268
685 3300046642 Ga0495634_0001419 Ga0495634_0001419_8929_9741 268
686 3300046663 Ga0495635_0000409 Ga0495635_0000409_19725_20537 268
687 3300046680 Ga0495646_0084401 Ga0495646_0084401_585_1397 268
688 3300046681 Ga0495647_0036746 Ga0495647_0036746_817_1629 268
689 3300047319 Ga0495674_0002790 Ga0495674_0002790_6966_7778 268
690 3300047471 Ga0495684_0002502 Ga0495684_0002502_7485_8297 268
691 3300048910 Ga0496107_0342050 Ga0496107_0342050_238_1053 268
692 3300048917 Ga0496114_0202173 Ga0496114_0202173_286_1101 268
693 3300050511 nmdc:mga08y16_380801_c1 nmdc:mga08y16_380801_c1_49_864 268
694 3300053078 Ga0495612_0000121 Ga0495612_0000121_20860_21672 268
695 3300053085 Ga0495619_0003020 Ga0495619_0003020_6569_7381 268
696 iso_pu_bacteria 2821123053 2821123638 268
697 iso_pu_bacteria 2857531043 2857531202 268
698 iso_pu_bacteria 2961127735 2961128352 268
699 iso_pu_bacteria 8004361976 8004362919 268
700 3300005843 Ga0068860_100588963 Ga0068860_1005889632 269
701 3300006038 Ga0075365_10019447 Ga0075365_100194472 269
702 3300006178 Ga0075367_10012431 Ga0075367_100124312 269
703 3300049744 Ga0501083_0303610 Ga0501083_0303610_14_832 269
704 3300054114 Ga0501084_0321439 Ga0501084_0321439_63_881 269
705 iso_pu_bacteria 2523231067 2523466551 269
706 iso_pu_bacteria 2842694124 2842696955 269
707 3300013307 Ga0157372_10860839 Ga0157372_108608392 270
708 3300025294 Ga0209025_1051410 Ga0209025_10514102 270
709 3300048919 Ga0496116_0000080 Ga0496116_0000080_21333_22145 270
710 3300048922 Ga0496119_0217695 Ga0496119_0217695_133_945 270
711 3300048925 Ga0496122_0033520 Ga0496122_0033520_2511_3323 270
712 3300048929 Ga0496126_0000094 Ga0496126_0000094_31373_32185 270
713 3300053111 Ga0500572_032203 Ga0500572_032203_398_1210 270
714 3300053177 Ga0500636_0006532 Ga0500636_0006532_1486_2298 270
715 3300003792 Ga0055540_1002341 Ga0055540_100234111 271
716 3300003792 Ga0055540_1023246 Ga0055540_10232462 271
717 3300003794 Ga0055531_10002423 Ga0055531_1000242313 271
718 3300006946 Ga0079104_1000069 Ga0079104_100006936 271
719 3300025297 Ga0209758_1000349 Ga0209758_100034966 271
720 3300025298 Ga0209050_1003851 Ga0209050_10038514 271
721 3300025303 Ga0209051_1012527 Ga0209051_10125273 271
722 3300025304 Ga0209257_1002432 Ga0209257_100243211 271
723 3300027111 Ga0209281_1000192 Ga0209281_100019279 271
724 3300031995 Ga0307409_100724767 Ga0307409_1007247672 271
725 3300037471 Ga0395905_0033945 Ga0395905_0033945_2548_3363 271
726 3300038443 Ga0395901_0518623 Ga0395901_0518623_294_1109 271
727 3300048924 Ga0496121_0005128 Ga0496121_0005128_981_1802 271
728 3300048927 Ga0496124_0043957 Ga0496124_0043957_588_1409 271
729 3300003214 JGI25165J46597_1000685 JGI25165J46597_100068511 272
730 3300025207 Ga0209760_103121 Ga0209760_1031212 272
731 3300025233 Ga0209437_100086 Ga0209437_100086224 272
732 3300025261 Ga0209233_1000356 Ga0209233_100035613 272
733 3300046507 Ga0495606_0001322 Ga0495606_0001322_4924_5742 272
734 3300047472 Ga0495686_0021002 Ga0495686_0021002_3327_4145 272
735 3300047472 Ga0495686_0151987 Ga0495686_0151987_299_1117 272
736 3300048924 Ga0496121_0044284 Ga0496121_0044284_2042_2860 272
737 3300048924 Ga0496121_0234505 Ga0496121_0234505_247_1083 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

62

211

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7293 48 245
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7053 64 247
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7034 64 243
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6934 42 256
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.6903 64 244
ID Description Score Start End Superfamily
3puzF04 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7791 57 203 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7308 47 257 1.10.3720.10
af_P0AFL1_11_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7235 8 260 1.10.3720.10
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.722 63 256 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7203 46 251 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0U2R4V0-F1-model_v4 3a0106s02: sulfate ABC transporter, permease 0.8659 33 207 GO:0005886
GO:0055085
AF-A0A0J6WAQ6-F1-model_v4 Inner membrane ABC transporter permease protein YdcV 0.8497 68 257 GO:0005886
GO:0055085
AF-A0A0R2QSK7-F1-model_v4 ABC transporter permease 0.8451 42 260 GO:0005886
GO:0055085
AF-A0A529XIG8-F1-model_v4 ABC transporter permease 0.8352 51 221 GO:0005886
GO:0055085
AF-A0A0U2R4V0-F1-model_v4 3a0106s02: sulfate ABC transporter, permease 0.8338 33 207 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
78.13 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map