F478337
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 737 | 426 | 689 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300035691|Ga0373931_0081689|Ga0373931_0081689_712_1629 |
| Length | 288 |
| Sequence | MARAQNELSPFNITALSFNASRLVTVWGGWSLRWYSEFFHDRAMLDAAWMSLRVAAASATMATLLGTLAAVALSRGERFKGRTLFSGMLYAPMVMPEVITGLSLLLLFVALNAERGFWTVTIAHTTLTMCFVAVVVQSRLGALDRSLEEAAMDLGCDPARAFVAVTLPLIAPAIAAGWMLAFTLSLDDVVIASFTTGPDAADPDLFGGAARGEARDQRHLYAGDRLDRGGDRGGIAGLEADEGARRERGAIVVPSFRGDANGWRERAPDDRLRIEPRIPRFPDAQLRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 4 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 5 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 6 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 10 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 11 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 12 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 13 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 14 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 15 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 16 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 17 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 18 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 19 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 20 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 21 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 22 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 23 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 24 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 25 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 26 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 27 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 28 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 29 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 30 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 31 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 32 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 33 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 34 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 35 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 36 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 37 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 40 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 108 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 109 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 110 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 134 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 135 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 136 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 225 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 252 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 336 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 337 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 338 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 339 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 340 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 341 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 342 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 343 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 389 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 391 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 392 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 394 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 397 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 398 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 401 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 402 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 404 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 406 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 409 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 410 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 412 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 414 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 417 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 418 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 419 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 420 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 421 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 422 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 423 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 424 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 425 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 426 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.22 |
| Metatranscriptomes | 0.27 |
| Isolates | 6.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.72 |
| Nodule | 5.7 |
| Rhizoplane | 5.29 |
| Rhizosphere | 68.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000685 | 3300003214 | Bacteria | 27199 |
| 2 | JGI25153J46596_10000872 | 3300003215 | Bacteria | 18366 |
| 3 | JGI25153J46596_10036295 | 3300003215 | Bacteria | 1583 |
| 4 | Ga0055542_1015078 | 3300003762 | Bacteria | 1251 |
| 5 | Ga0055540_1002341 | 3300003792 | Bacteria | 10137 |
| 6 | Ga0055540_1023246 | 3300003792 | Bacteria | 1565 |
| 7 | Ga0055531_10002423 | 3300003794 | Bacteria | 12481 |
| 8 | Ga0065715_10298573 | 3300005293 | Bacteria | 1031 |
| 9 | Ga0070658_10100659 | 3300005327 | Bacteria | 2389 |
| 10 | Ga0070658_10324336 | 3300005327 | Bacteria | 1315 |
| 11 | Ga0070683_100222355 | 3300005329 | Bacteria | 1794 |
| 12 | Ga0070683_100282171 | 3300005329 | Bacteria | 1580 |
| 13 | Ga0070677_10011215 | 3300005333 | Bacteria | 3084 |
| 14 | Ga0068869_100163243 | 3300005334 | Bacteria | 1735 |
| 15 | Ga0070666_10054161 | 3300005335 | Bacteria | 2706 |
| 16 | Ga0070666_10309077 | 3300005335 | Bacteria | 1127 |
| 17 | Ga0070680_100219420 | 3300005336 | Bacteria | 1605 |
| 18 | Ga0070680_100379811 | 3300005336 | Bacteria | 1203 |
| 19 | Ga0068868_100017821 | 3300005338 | Bacteria | 5296 |
| 20 | Ga0070660_100413074 | 3300005339 | Bacteria | 1117 |
| 21 | Ga0070661_100146659 | 3300005344 | Bacteria | 1782 |
| 22 | Ga0070668_100046008 | 3300005347 | Bacteria | 3349 |
| 23 | Ga0070668_100057648 | 3300005347 | Bacteria | 3002 |
| 24 | Ga0070671_100132146 | 3300005355 | Bacteria | 2102 |
| 25 | Ga0070671_100561575 | 3300005355 | Bacteria | 985 |
| 26 | Ga0070674_100031335 | 3300005356 | Bacteria | 3523 |
| 27 | Ga0070674_100043210 | 3300005356 | Bacteria | 3064 |
| 28 | Ga0070673_100034663 | 3300005364 | Bacteria | 3821 |
| 29 | Ga0070688_100060526 | 3300005365 | Bacteria | 2391 |
| 30 | Ga0070659_100134493 | 3300005366 | Bacteria | 2010 |
| 31 | Ga0070667_100259511 | 3300005367 | Bacteria | 1555 |
| 32 | Ga0070714_100094910 | 3300005435 | Bacteria | 2619 |
| 33 | Ga0070714_100286168 | 3300005435 | Bacteria | 1533 |
| 34 | Ga0070713_100119459 | 3300005436 | Bacteria | 2309 |
| 35 | Ga0070713_100544251 | 3300005436 | Bacteria | 1099 |
| 36 | Ga0070701_10271095 | 3300005438 | Bacteria | 1033 |
| 37 | Ga0070708_100035864 | 3300005445 | Bacteria | 4323 |
| 38 | Ga0070663_100024821 | 3300005455 | Bacteria | 4039 |
| 39 | Ga0070663_100078843 | 3300005455 | Bacteria | 2415 |
| 40 | Ga0070678_100036362 | 3300005456 | Bacteria | 3446 |
| 41 | Ga0070678_100347680 | 3300005456 | Bacteria | 1274 |
| 42 | Ga0070662_100062108 | 3300005457 | Bacteria | 2729 |
| 43 | Ga0068867_100059534 | 3300005459 | Bacteria | 2831 |
| 44 | Ga0068867_100553608 | 3300005459 | Bacteria | 997 |
| 45 | Ga0070685_10045378 | 3300005466 | Bacteria | 2520 |
| 46 | Ga0070685_10085396 | 3300005466 | Bacteria | 1901 |
| 47 | Ga0070706_100452508 | 3300005467 | Bacteria | 1195 |
| 48 | Ga0070707_100124412 | 3300005468 | Bacteria | 2505 |
| 49 | Ga0070698_100523884 | 3300005471 | Bacteria | 1124 |
| 50 | Ga0070699_100476325 | 3300005518 | Bacteria | 1133 |
| 51 | Ga0068853_100102316 | 3300005539 | Bacteria | 2535 |
| 52 | Ga0070672_100225477 | 3300005543 | Bacteria | 1573 |
| 53 | Ga0070686_100129075 | 3300005544 | Bacteria | 1746 |
| 54 | Ga0070695_100116495 | 3300005545 | Bacteria | 1821 |
| 55 | Ga0070696_100389750 | 3300005546 | Bacteria | 1087 |
| 56 | Ga0070665_100085000 | 3300005548 | Bacteria | 3169 |
| 57 | Ga0070665_100091160 | 3300005548 | Bacteria | 3053 |
| 58 | Ga0070665_100372631 | 3300005548 | Bacteria | 1435 |
| 59 | Ga0070665_100564277 | 3300005548 | Bacteria | 1151 |
| 60 | Ga0068855_100168146 | 3300005563 | Bacteria | 2484 |
| 61 | Ga0070664_100081717 | 3300005564 | Bacteria | 2785 |
| 62 | Ga0070664_100138593 | 3300005564 | Bacteria | 2141 |
| 63 | Ga0068857_100131263 | 3300005577 | Bacteria | 2260 |
| 64 | Ga0068854_100216108 | 3300005578 | Bacteria | 1514 |
| 65 | Ga0068854_100340505 | 3300005578 | Bacteria | 1225 |
| 66 | Ga0068856_100600332 | 3300005614 | Bacteria | 1122 |
| 67 | Ga0068859_100223991 | 3300005617 | Bacteria | 1969 |
| 68 | Ga0068859_100254302 | 3300005617 | Bacteria | 1847 |
| 69 | Ga0068859_100304399 | 3300005617 | Bacteria | 1687 |
| 70 | Ga0068864_100066513 | 3300005618 | Bacteria | 3129 |
| 71 | Ga0068864_100285926 | 3300005618 | Bacteria | 1540 |
| 72 | Ga0068858_100243034 | 3300005842 | Bacteria | 1709 |
| 73 | Ga0068860_100171237 | 3300005843 | Bacteria | 2097 |
| 74 | Ga0068860_100588963 | 3300005843 | Bacteria | 1117 |
| 75 | Ga0068860_100787551 | 3300005843 | Bacteria | 964 |
| 76 | Ga0081455_10036840 | 3300005937 | Bacteria | 4350 |
| 77 | Ga0081538_10017420 | 3300005981 | Bacteria | 5452 |
| 78 | Ga0081540_1007317 | 3300005983 | Bacteria | 7895 |
| 79 | Ga0081540_1067547 | 3300005983 | Bacteria | 1670 |
| 80 | Ga0070717_10250152 | 3300006028 | Bacteria | 1566 |
| 81 | Ga0075365_10019447 | 3300006038 | Bacteria | 4192 |
| 82 | Ga0075363_100002221 | 3300006048 | Bacteria | 7843 |
| 83 | Ga0075363_100005097 | 3300006048 | Bacteria | 5812 |
| 84 | Ga0075364_10161274 | 3300006051 | Bacteria | 1513 |
| 85 | Ga0075364_10372812 | 3300006051 | Bacteria | 973 |
| 86 | Ga0075362_10002727 | 3300006177 | Bacteria | 6017 |
| 87 | Ga0075362_10136070 | 3300006177 | Bacteria | 1172 |
| 88 | Ga0075367_10002644 | 3300006178 | Bacteria | 8245 |
| 89 | Ga0075367_10012431 | 3300006178 | Bacteria | 4539 |
| 90 | Ga0075367_10104103 | 3300006178 | Bacteria | 1737 |
| 91 | Ga0075369_10004550 | 3300006186 | Bacteria | 5134 |
| 92 | Ga0075366_10005909 | 3300006195 | Bacteria | 6655 |
| 93 | Ga0097621_100053573 | 3300006237 | Bacteria | 3288 |
| 94 | Ga0068871_100536001 | 3300006358 | Bacteria | 1059 |
| 95 | Ga0075431_100022230 | 3300006847 | Bacteria | 6485 |
| 96 | Ga0075431_100663506 | 3300006847 | Bacteria | 1023 |
| 97 | Ga0075433_10041214 | 3300006852 | Bacteria | 4000 |
| 98 | Ga0075434_100072230 | 3300006871 | Bacteria | 3443 |
| 99 | Ga0068865_100069090 | 3300006881 | Bacteria | 2499 |
| 100 | Ga0075436_100079624 | 3300006914 | Bacteria | 2270 |
| 101 | Ga0097620_100223999 | 3300006931 | Bacteria | 1969 |
| 102 | Ga0097620_100254282 | 3300006931 | Bacteria | 1847 |
| 103 | Ga0097620_100304415 | 3300006931 | Bacteria | 1687 |
| 104 | Ga0099825_1018667 | 3300006941 | Bacteria | 5348 |
| 105 | Ga0099824_1003081 | 3300006942 | Bacteria | 24341 |
| 106 | Ga0099824_1022736 | 3300006942 | Bacteria | 4059 |
| 107 | Ga0099822_1008903 | 3300006943 | Bacteria | 12758 |
| 108 | Ga0079104_1000069 | 3300006946 | Bacteria | 153993 |
| 109 | Ga0099795_10004750 | 3300007788 | Bacteria | 3540 |
| 110 | Ga0099795_10015182 | 3300007788 | Bacteria | 2406 |
| 111 | Ga0105240_10182322 | 3300009093 | Bacteria | 2477 |
| 112 | Ga0105240_10430415 | 3300009093 | Bacteria | 1481 |
| 113 | Ga0105240_10637233 | 3300009093 | Bacteria | 1170 |
| 114 | Ga0111539_10023762 | 3300009094 | Bacteria | 7531 |
| 115 | Ga0111539_10856662 | 3300009094 | Bacteria | 1057 |
| 116 | Ga0105245_10139750 | 3300009098 | Bacteria | 2280 |
| 117 | Ga0105245_10169811 | 3300009098 | Bacteria | 2076 |
| 118 | Ga0105245_10203588 | 3300009098 | Bacteria | 1902 |
| 119 | Ga0105245_10270812 | 3300009098 | Bacteria | 1656 |
| 120 | Ga0114129_10022352 | 3300009147 | Bacteria | 8977 |
| 121 | Ga0105241_10017678 | 3300009174 | Bacteria | 5243 |
| 122 | Ga0105242_10343236 | 3300009176 | Bacteria | 1377 |
| 123 | Ga0105242_10856821 | 3300009176 | Bacteria | 905 |
| 124 | Ga0105238_10041225 | 3300009551 | Bacteria | 4677 |
| 125 | Ga0105238_10057553 | 3300009551 | Bacteria | 3898 |
| 126 | Ga0099796_10136819 | 3300010159 | Bacteria | 954 |
| 127 | Ga0105239_10166630 | 3300010375 | Bacteria | 2464 |
| 128 | Ga0157370_10168250 | 3300013104 | Bacteria | 2038 |
| 129 | Ga0157369_10423854 | 3300013105 | Bacteria | 1379 |
| 130 | Ga0157374_10255025 | 3300013296 | Bacteria | 1727 |
| 131 | Ga0157374_10760473 | 3300013296 | Bacteria | 984 |
| 132 | Ga0157378_10053235 | 3300013297 | Bacteria | 3604 |
| 133 | Ga0163162_10026945 | 3300013306 | Bacteria | 5683 |
| 134 | Ga0163162_10631520 | 3300013306 | Bacteria | 1196 |
| 135 | Ga0157372_10860839 | 3300013307 | Bacteria | 1052 |
| 136 | Ga0157375_10385938 | 3300013308 | Bacteria | 1567 |
| 137 | Ga0163163_10431769 | 3300014325 | Bacteria | 1376 |
| 138 | Ga0163163_10599297 | 3300014325 | Bacteria | 1165 |
| 139 | Ga0157377_10036515 | 3300014745 | Bacteria | 2704 |
| 140 | Ga0157379_10033679 | 3300014968 | Bacteria | 4569 |
| 141 | Ga0157379_10110318 | 3300014968 | Bacteria | 2471 |
| 142 | Ga0157376_10002884 | 3300014969 | Bacteria | 11783 |
| 143 | Ga0163161_10193662 | 3300017792 | Bacteria | 1564 |
| 144 | Ga0163161_10382977 | 3300017792 | Bacteria | 1124 |
| 145 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 146 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 147 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 148 | Ga0214543_1000564 | 3300021327 | Bacteria | 63531 |
| 149 | Ga0213876_10175926 | 3300021384 | Bacteria | 1139 |
| 150 | Ga0209760_103121 | 3300025207 | Bacteria | 1490 |
| 151 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 152 | Ga0209148_1000367 | 3300025254 | Bacteria | 55809 |
| 153 | Ga0209148_1006433 | 3300025254 | Bacteria | 2546 |
| 154 | Ga0209233_1000356 | 3300025261 | Bacteria | 42791 |
| 155 | Ga0209233_1001256 | 3300025261 | Bacteria | 10190 |
| 156 | Ga0209233_1004430 | 3300025261 | Bacteria | 4778 |
| 157 | Ga0209025_1051410 | 3300025294 | Bacteria | 1637 |
| 158 | Ga0209564_1000946 | 3300025295 | Bacteria | 37393 |
| 159 | Ga0209564_1007180 | 3300025295 | Bacteria | 5807 |
| 160 | Ga0209758_1000349 | 3300025297 | Bacteria | 84164 |
| 161 | Ga0209758_1000474 | 3300025297 | Bacteria | 66329 |
| 162 | Ga0209758_1005624 | 3300025297 | Bacteria | 9517 |
| 163 | Ga0209050_1003851 | 3300025298 | Bacteria | 10683 |
| 164 | Ga0209051_1012527 | 3300025303 | Bacteria | 4097 |
| 165 | Ga0209257_1002432 | 3300025304 | Bacteria | 18537 |
| 166 | Ga0207682_10016879 | 3300025893 | Bacteria | 2850 |
| 167 | Ga0207692_10241409 | 3300025898 | Bacteria | 1079 |
| 168 | Ga0207710_10098511 | 3300025900 | Bacteria | 1376 |
| 169 | Ga0207688_10016567 | 3300025901 | Bacteria | 3998 |
| 170 | Ga0207688_10051663 | 3300025901 | Bacteria | 2302 |
| 171 | Ga0207680_10122805 | 3300025903 | Bacteria | 1701 |
| 172 | Ga0207645_10027337 | 3300025907 | Bacteria | 3685 |
| 173 | Ga0207705_10241212 | 3300025909 | Bacteria | 1377 |
| 174 | Ga0207654_10011800 | 3300025911 | Bacteria | 4463 |
| 175 | Ga0207695_10071853 | 3300025913 | Bacteria | 3533 |
| 176 | Ga0207695_10256868 | 3300025913 | Bacteria | 1646 |
| 177 | Ga0207671_10052456 | 3300025914 | Bacteria | 3022 |
| 178 | Ga0207671_10129765 | 3300025914 | Bacteria | 1934 |
| 179 | Ga0207671_10227041 | 3300025914 | Bacteria | 1464 |
| 180 | Ga0207693_10017196 | 3300025915 | Bacteria | 5766 |
| 181 | Ga0207660_10238009 | 3300025917 | Bacteria | 1433 |
| 182 | Ga0207660_10390960 | 3300025917 | Bacteria | 1119 |
| 183 | Ga0207662_10074036 | 3300025918 | Bacteria | 2067 |
| 184 | Ga0207657_10008768 | 3300025919 | Bacteria | 10237 |
| 185 | Ga0207657_10403475 | 3300025919 | Bacteria | 1075 |
| 186 | Ga0207646_10066349 | 3300025922 | Bacteria | 3222 |
| 187 | Ga0207681_10033060 | 3300025923 | Bacteria | 3390 |
| 188 | Ga0207681_10367496 | 3300025923 | Bacteria | 1155 |
| 189 | Ga0207694_10259540 | 3300025924 | Bacteria | 1423 |
| 190 | Ga0207694_10612850 | 3300025924 | Bacteria | 916 |
| 191 | Ga0207650_10207973 | 3300025925 | Bacteria | 1570 |
| 192 | Ga0207659_10461317 | 3300025926 | Bacteria | 1071 |
| 193 | Ga0207687_10025101 | 3300025927 | Bacteria | 3988 |
| 194 | Ga0207687_10249330 | 3300025927 | Bacteria | 1411 |
| 195 | Ga0207700_10204367 | 3300025928 | Bacteria | 1666 |
| 196 | Ga0207700_10254620 | 3300025928 | Bacteria | 1501 |
| 197 | Ga0207700_10260238 | 3300025928 | Bacteria | 1485 |
| 198 | Ga0207664_10563601 | 3300025929 | Bacteria | 1022 |
| 199 | Ga0207644_10415607 | 3300025931 | Bacteria | 1101 |
| 200 | Ga0207686_10249607 | 3300025934 | Bacteria | 1296 |
| 201 | Ga0207709_10019157 | 3300025935 | Bacteria | 3843 |
| 202 | Ga0207669_10010435 | 3300025937 | Bacteria | 4472 |
| 203 | Ga0207669_10012995 | 3300025937 | Bacteria | 4117 |
| 204 | Ga0207669_10336309 | 3300025937 | Bacteria | 1161 |
| 205 | Ga0207704_10056278 | 3300025938 | Bacteria | 2408 |
| 206 | Ga0207704_10323272 | 3300025938 | Bacteria | 1191 |
| 207 | Ga0207691_10006938 | 3300025940 | Bacteria | 10922 |
| 208 | Ga0207691_10024673 | 3300025940 | Bacteria | 5655 |
| 209 | Ga0207711_10207936 | 3300025941 | Bacteria | 1787 |
| 210 | Ga0207689_10024108 | 3300025942 | Bacteria | 5105 |
| 211 | Ga0207689_10176893 | 3300025942 | Bacteria | 1760 |
| 212 | Ga0207689_10181620 | 3300025942 | Bacteria | 1735 |
| 213 | Ga0207679_10077366 | 3300025945 | Bacteria | 2531 |
| 214 | Ga0207679_10090205 | 3300025945 | Bacteria | 2369 |
| 215 | Ga0207667_10128793 | 3300025949 | Bacteria | 2607 |
| 216 | Ga0207667_10469761 | 3300025949 | Bacteria | 1277 |
| 217 | Ga0207712_10152495 | 3300025961 | Bacteria | 1787 |
| 218 | Ga0207668_10076769 | 3300025972 | Bacteria | 2406 |
| 219 | Ga0207668_10144314 | 3300025972 | Bacteria | 1834 |
| 220 | Ga0207640_10284963 | 3300025981 | Bacteria | 1300 |
| 221 | Ga0207640_10416715 | 3300025981 | Bacteria | 1098 |
| 222 | Ga0207677_10016002 | 3300026023 | Bacteria | 4428 |
| 223 | Ga0207677_10150032 | 3300026023 | Bacteria | 1797 |
| 224 | Ga0207703_10054849 | 3300026035 | Bacteria | 3242 |
| 225 | Ga0207703_10101613 | 3300026035 | Bacteria | 2438 |
| 226 | Ga0207639_10078890 | 3300026041 | Bacteria | 2601 |
| 227 | Ga0207639_10184044 | 3300026041 | Bacteria | 1779 |
| 228 | Ga0207639_10468140 | 3300026041 | Bacteria | 1147 |
| 229 | Ga0207678_10022898 | 3300026067 | Bacteria | 5468 |
| 230 | Ga0207678_10025245 | 3300026067 | Bacteria | 5187 |
| 231 | Ga0207678_10229797 | 3300026067 | Bacteria | 1588 |
| 232 | Ga0207708_10035860 | 3300026075 | Bacteria | 3773 |
| 233 | Ga0207702_10000287 | 3300026078 | Bacteria | 58488 |
| 234 | Ga0207702_10472201 | 3300026078 | Bacteria | 1220 |
| 235 | Ga0207648_10015927 | 3300026089 | Bacteria | 6889 |
| 236 | Ga0207648_10493606 | 3300026089 | Bacteria | 1119 |
| 237 | Ga0207676_10142466 | 3300026095 | Bacteria | 2054 |
| 238 | Ga0207676_10230438 | 3300026095 | Bacteria | 1655 |
| 239 | Ga0207676_10236397 | 3300026095 | Bacteria | 1636 |
| 240 | Ga0207675_100179037 | 3300026118 | Bacteria | 2030 |
| 241 | Ga0207675_100386227 | 3300026118 | Bacteria | 1377 |
| 242 | Ga0207683_10000765 | 3300026121 | Bacteria | 29217 |
| 243 | Ga0207683_10032330 | 3300026121 | Bacteria | 4545 |
| 244 | Ga0207683_10102847 | 3300026121 | Bacteria | 2551 |
| 245 | Ga0207683_10208740 | 3300026121 | Bacteria | 1777 |
| 246 | Ga0207683_10286473 | 3300026121 | Bacteria | 1506 |
| 247 | Ga0207683_10350560 | 3300026121 | Bacteria | 1355 |
| 248 | Ga0207683_10391501 | 3300026121 | Bacteria | 1278 |
| 249 | Ga0209281_1000192 | 3300027111 | Bacteria | 140252 |
| 250 | Ga0209389_1000086 | 3300027296 | Bacteria | 84925 |
| 251 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 252 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 253 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 254 | Ga0209489_100313 | 3300027361 | Bacteria | 85507 |
| 255 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 256 | Ga0209588_1001366 | 3300027671 | Bacteria | 6360 |
| 257 | Ga0209813_10060608 | 3300027866 | Bacteria | 1207 |
| 258 | Ga0209813_10079151 | 3300027866 | Bacteria | 1083 |
| 259 | Ga0265357_1007508 | 3300028023 | Bacteria | 1054 |
| 260 | Ga0268266_10028559 | 3300028379 | Bacteria | 4740 |
| 261 | Ga0268266_10071617 | 3300028379 | Bacteria | 3004 |
| 262 | Ga0268266_10271173 | 3300028379 | Bacteria | 1575 |
| 263 | Ga0268264_10379214 | 3300028381 | Bacteria | 1354 |
| 264 | Ga0268264_10676257 | 3300028381 | Bacteria | 1024 |
| 265 | Ga0268264_10698987 | 3300028381 | Bacteria | 1007 |
| 266 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 267 | Ga0307515_10014717 | 3300028794 | Bacteria | 14476 |
| 268 | Ga0265338_10088839 | 3300028800 | Bacteria | 2562 |
| 269 | Ga0265763_1000076 | 3300030763 | Bacteria | 4236 |
| 270 | Ga0265330_10016470 | 3300031235 | Bacteria | 3411 |
| 271 | Ga0265332_10000732 | 3300031238 | Bacteria | 20494 |
| 272 | Ga0265332_10011063 | 3300031238 | Bacteria | 4009 |
| 273 | Ga0265325_10007210 | 3300031241 | Bacteria | 6686 |
| 274 | Ga0265325_10018614 | 3300031241 | Bacteria | 3852 |
| 275 | Ga0265329_10018100 | 3300031242 | Bacteria | 2413 |
| 276 | Ga0265339_10001116 | 3300031249 | Bacteria | 20311 |
| 277 | Ga0265339_10100124 | 3300031249 | Bacteria | 1509 |
| 278 | Ga0265331_10004487 | 3300031250 | Bacteria | 8708 |
| 279 | Ga0265331_10009382 | 3300031250 | Bacteria | 5494 |
| 280 | Ga0265313_10061524 | 3300031595 | Bacteria | 1757 |
| 281 | Ga0307508_10000678 | 3300031616 | Bacteria | 40932 |
| 282 | Ga0307508_10039526 | 3300031616 | Bacteria | 4238 |
| 283 | Ga0265314_10057291 | 3300031711 | Bacteria | 2677 |
| 284 | Ga0265314_10245674 | 3300031711 | Bacteria | 1030 |
| 285 | Ga0265342_10000258 | 3300031712 | Bacteria | 59570 |
| 286 | Ga0265342_10054358 | 3300031712 | Bacteria | 2379 |
| 287 | Ga0316576_10074988 | 3300031727 | Bacteria | 2502 |
| 288 | Ga0307516_10059140 | 3300031730 | Bacteria | 3728 |
| 289 | Ga0307410_10064480 | 3300031852 | Bacteria | 2517 |
| 290 | Ga0307409_100724767 | 3300031995 | Bacteria | 996 |
| 291 | Ga0307414_10365783 | 3300032004 | Bacteria | 1242 |
| 292 | Ga0307411_10211331 | 3300032005 | Bacteria | 1498 |
| 293 | Ga0307415_100448708 | 3300032126 | Bacteria | 1114 |
| 294 | Ga0307510_10170849 | 3300033180 | Bacteria | 1753 |
| 295 | Ga0315911_1000022 | 3300033442 | Bacteria | 118114 |
| 296 | Ga0373926_0078474 | 3300035083 | Bacteria | 1218 |
| 297 | Ga0373934_0089024 | 3300035086 | Bacteria | 1243 |
| 298 | Ga0373936_0022106 | 3300035113 | Bacteria | 2477 |
| 299 | Ga0373936_0050899 | 3300035113 | Bacteria | 1676 |
| 300 | Ga0373945_0007444 | 3300035116 | Bacteria | 3550 |
| 301 | Ga0373945_0068794 | 3300035116 | Bacteria | 1336 |
| 302 | Ga0373953_0104624 | 3300035117 | Bacteria | 1193 |
| 303 | Ga0373956_0052829 | 3300035119 | Bacteria | 1828 |
| 304 | Ga0373956_0109121 | 3300035119 | Bacteria | 1287 |
| 305 | Ga0373957_0006595 | 3300035120 | Bacteria | 3666 |
| 306 | Ga0373943_0010012 | 3300035170 | Bacteria | 4252 |
| 307 | Ga0373943_0054164 | 3300035170 | Bacteria | 1983 |
| 308 | Ga0373946_0008000 | 3300035171 | Bacteria | 3884 |
| 309 | Ga0373946_0012184 | 3300035171 | Bacteria | 3215 |
| 310 | Ga0373946_0046527 | 3300035171 | Bacteria | 1798 |
| 311 | Ga0373946_0120796 | 3300035171 | Bacteria | 1196 |
| 312 | Ga0373955_0001596 | 3300035172 | Bacteria | 9704 |
| 313 | Ga0373955_0055789 | 3300035172 | Bacteria | 2165 |
| 314 | Ga0373955_0068848 | 3300035172 | Bacteria | 1973 |
| 315 | Ga0316574_0001652 | 3300035398 | Bacteria | 10729 |
| 316 | Ga0373924_0009271 | 3300035410 | Bacteria | 3605 |
| 317 | Ga0373924_0174019 | 3300035410 | Bacteria | 946 |
| 318 | Ga0373931_0025144 | 3300035691 | Bacteria | 3024 |
| 319 | Ga0373931_0081689 | 3300035691 | Bacteria | 1785 |
| 320 | Ga0373935_0011391 | 3300035692 | Bacteria | 5339 |
| 321 | Ga0373935_0061105 | 3300035692 | Bacteria | 2411 |
| 322 | Ga0373935_0160266 | 3300035692 | Bacteria | 1533 |
| 323 | Ga0373927_0005666 | 3300035695 | Bacteria | 8582 |
| 324 | Ga0373927_0010487 | 3300035695 | Bacteria | 6176 |
| 325 | Ga0373927_0074843 | 3300035695 | Bacteria | 2192 |
| 326 | Ga0373927_0147001 | 3300035695 | Bacteria | 1543 |
| 327 | Ga0373933_0000812 | 3300035724 | Bacteria | 19052 |
| 328 | Ga0373947_0049579 | 3300035725 | Bacteria | 2522 |
| 329 | Ga0373937_0001031 | 3300036401 | Bacteria | 23580 |
| 330 | Ga0373937_0001468 | 3300036401 | Bacteria | 19735 |
| 331 | Ga0373937_0204580 | 3300036401 | Bacteria | 1856 |
| 332 | Ga0372808_017652 | 3300036459 | Bacteria | 1025 |
| 333 | Ga0373925_0006468 | 3300037068 | Bacteria | 8617 |
| 334 | Ga0373925_0053426 | 3300037068 | Bacteria | 3020 |
| 335 | Ga0373925_0088158 | 3300037068 | Bacteria | 2369 |
| 336 | Ga0373925_0738876 | 3300037068 | Bacteria | 811 |
| 337 | Ga0395900_0058294 | 3300037418 | Bacteria | 3975 |
| 338 | Ga0395900_0092633 | 3300037418 | Bacteria | 3105 |
| 339 | Ga0395900_0310786 | 3300037418 | Bacteria | 1559 |
| 340 | Ga0395900_0401109 | 3300037418 | Bacteria | 1335 |
| 341 | Ga0395898_0042480 | 3300037466 | Bacteria | 4485 |
| 342 | Ga0395898_0253720 | 3300037466 | Bacteria | 1677 |
| 343 | Ga0395898_0301087 | 3300037466 | Bacteria | 1530 |
| 344 | Ga0395905_0033945 | 3300037471 | Bacteria | 4791 |
| 345 | Ga0395905_0137774 | 3300037471 | Bacteria | 2296 |
| 346 | Ga0395905_0286868 | 3300037471 | Bacteria | 1533 |
| 347 | Ga0395905_0421935 | 3300037471 | Bacteria | 1230 |
| 348 | Ga0436364_1540260 | 3300037853 | Bacteria | 2290 |
| 349 | Ga0395901_0015664 | 3300038443 | Bacteria | 7723 |
| 350 | Ga0395901_0091694 | 3300038443 | Bacteria | 3180 |
| 351 | Ga0395901_0134371 | 3300038443 | Bacteria | 2600 |
| 352 | Ga0395901_0518623 | 3300038443 | Bacteria | 1211 |
| 353 | Ga0395901_0743728 | 3300038443 | Bacteria | 974 |
| 354 | Ga0400491_15212 | 3300038727 | Bacteria | 5200 |
| 355 | Ga0400483_002929 | 3300039062 | Bacteria | 2493 |
| 356 | Ga0400483_269252 | 3300039062 | Bacteria | 2786 |
| 357 | Ga0436365_0123947 | 3300039437 | Bacteria | 1023 |
| 358 | Ga0436365_0821912 | 3300039437 | Bacteria | 2028 |
| 359 | Ga0436363_0139600 | 3300039450 | Bacteria | 1795 |
| 360 | Ga0436363_0909856 | 3300039450 | Bacteria | 1048 |
| 361 | Ga0436363_1344272 | 3300039450 | Bacteria | 1826 |
| 362 | Ga0436363_1481077 | 3300039450 | Bacteria | 5418 |
| 363 | Ga0466963_0183016 | 3300044694 | Bacteria | 1463 |
| 364 | Ga0466959_0290931 | 3300045049 | Bacteria | 1120 |
| 365 | Ga0466967_0067011 | 3300045976 | Bacteria | 3201 |
| 366 | Ga0495592_0005046 | 3300046454 | Bacteria | 9713 |
| 367 | Ga0495592_0056246 | 3300046454 | Bacteria | 2908 |
| 368 | Ga0495592_0075805 | 3300046454 | Bacteria | 2442 |
| 369 | Ga0495603_0001950 | 3300046455 | Bacteria | 12171 |
| 370 | Ga0495603_0069687 | 3300046455 | Bacteria | 2068 |
| 371 | Ga0495603_0120761 | 3300046455 | Bacteria | 1527 |
| 372 | Ga0495590_0068736 | 3300046457 | Bacteria | 1242 |
| 373 | Ga0495629_0002766 | 3300046459 | Bacteria | 13416 |
| 374 | Ga0495629_0090584 | 3300046459 | Bacteria | 2134 |
| 375 | Ga0495629_0235793 | 3300046459 | Bacteria | 1260 |
| 376 | Ga0495629_0280188 | 3300046459 | Bacteria | 1144 |
| 377 | Ga0495629_0290744 | 3300046459 | Bacteria | 1120 |
| 378 | Ga0495629_0366471 | 3300046459 | Bacteria | 981 |
| 379 | Ga0495651_0020707 | 3300046462 | Bacteria | 5106 |
| 380 | Ga0495653_0002068 | 3300046463 | Bacteria | 15779 |
| 381 | Ga0495653_0058358 | 3300046463 | Bacteria | 2934 |
| 382 | Ga0495653_0076078 | 3300046463 | Bacteria | 2496 |
| 383 | Ga0495582_0047154 | 3300046473 | Bacteria | 2373 |
| 384 | Ga0495605_0032101 | 3300046474 | Bacteria | 2677 |
| 385 | Ga0495639_0015022 | 3300046475 | Bacteria | 3357 |
| 386 | Ga0495639_0038216 | 3300046475 | Bacteria | 2155 |
| 387 | Ga0495639_0210028 | 3300046475 | Bacteria | 955 |
| 388 | Ga0495662_0016778 | 3300046476 | Bacteria | 3545 |
| 389 | Ga0495662_0045146 | 3300046476 | Bacteria | 2127 |
| 390 | Ga0495662_0061292 | 3300046476 | Bacteria | 1817 |
| 391 | Ga0495662_0084410 | 3300046476 | Bacteria | 1546 |
| 392 | Ga0495664_0000214 | 3300046477 | Bacteria | 27629 |
| 393 | Ga0495664_0048838 | 3300046477 | Bacteria | 2512 |
| 394 | Ga0495584_0014850 | 3300046491 | Bacteria | 3969 |
| 395 | Ga0495607_0004985 | 3300046501 | Bacteria | 9633 |
| 396 | Ga0495606_0001322 | 3300046507 | Bacteria | 33851 |
| 397 | Ga0495606_0001556 | 3300046507 | Bacteria | 30139 |
| 398 | Ga0495606_0021576 | 3300046507 | Bacteria | 4716 |
| 399 | Ga0495608_0001557 | 3300046511 | Bacteria | 16383 |
| 400 | Ga0495608_0027336 | 3300046511 | Bacteria | 3882 |
| 401 | Ga0495608_0038589 | 3300046511 | Bacteria | 3206 |
| 402 | Ga0495610_0007802 | 3300046512 | Bacteria | 7053 |
| 403 | Ga0495618_0000576 | 3300046514 | Bacteria | 26108 |
| 404 | Ga0495618_0014304 | 3300046514 | Bacteria | 4832 |
| 405 | Ga0495618_0022432 | 3300046514 | Bacteria | 3899 |
| 406 | Ga0495628_0011632 | 3300046516 | Bacteria | 7438 |
| 407 | Ga0495628_0013710 | 3300046516 | Bacteria | 6811 |
| 408 | Ga0495630_0009161 | 3300046517 | Bacteria | 7120 |
| 409 | Ga0495630_0021118 | 3300046517 | Bacteria | 4806 |
| 410 | Ga0495630_0021273 | 3300046517 | Bacteria | 4790 |
| 411 | Ga0495630_0022700 | 3300046517 | Bacteria | 4635 |
| 412 | Ga0495630_0083415 | 3300046517 | Bacteria | 2413 |
| 413 | Ga0495630_0154271 | 3300046517 | Bacteria | 1748 |
| 414 | Ga0495637_0091648 | 3300046520 | Bacteria | 1198 |
| 415 | Ga0495648_0000576 | 3300046524 | Bacteria | 39297 |
| 416 | Ga0495648_0029520 | 3300046524 | Bacteria | 3639 |
| 417 | Ga0495648_0061655 | 3300046524 | Bacteria | 2226 |
| 418 | Ga0495652_0003106 | 3300046529 | Bacteria | 16596 |
| 419 | Ga0495652_0043797 | 3300046529 | Bacteria | 3855 |
| 420 | Ga0495652_0082531 | 3300046529 | Bacteria | 2648 |
| 421 | Ga0495665_0024607 | 3300046531 | Bacteria | 3234 |
| 422 | Ga0495665_0076829 | 3300046531 | Bacteria | 1757 |
| 423 | Ga0495665_0282738 | 3300046531 | Bacteria | 851 |
| 424 | Ga0495640_0003344 | 3300046533 | Bacteria | 12908 |
| 425 | Ga0495640_0003758 | 3300046533 | Bacteria | 12182 |
| 426 | Ga0495640_0027016 | 3300046533 | Bacteria | 4143 |
| 427 | Ga0495640_0027770 | 3300046533 | Bacteria | 4078 |
| 428 | Ga0495640_0034950 | 3300046533 | Bacteria | 3559 |
| 429 | Ga0495640_0060083 | 3300046533 | Bacteria | 2586 |
| 430 | Ga0495586_0026388 | 3300046535 | Bacteria | 3108 |
| 431 | Ga0495586_0113726 | 3300046535 | Bacteria | 1508 |
| 432 | Ga0495587_0000308 | 3300046536 | Bacteria | 34905 |
| 433 | Ga0495587_0017460 | 3300046536 | Bacteria | 4457 |
| 434 | Ga0495645_0018975 | 3300046543 | Bacteria | 4948 |
| 435 | Ga0495645_0053982 | 3300046543 | Bacteria | 2920 |
| 436 | Ga0495645_0265706 | 3300046543 | Bacteria | 1134 |
| 437 | Ga0495622_0023452 | 3300046557 | Bacteria | 2877 |
| 438 | Ga0495667_0001377 | 3300046559 | Bacteria | 16003 |
| 439 | Ga0495667_0047619 | 3300046559 | Bacteria | 2832 |
| 440 | Ga0495667_0232464 | 3300046559 | Bacteria | 1175 |
| 441 | Ga0495656_0034334 | 3300046615 | Bacteria | 2076 |
| 442 | Ga0495668_0070492 | 3300046616 | Bacteria | 1922 |
| 443 | Ga0495634_0001419 | 3300046642 | Bacteria | 21401 |
| 444 | Ga0495634_0010577 | 3300046642 | Bacteria | 6755 |
| 445 | Ga0495634_0010893 | 3300046642 | Bacteria | 6639 |
| 446 | Ga0495634_0028052 | 3300046642 | Bacteria | 3911 |
| 447 | Ga0495634_0140542 | 3300046642 | Bacteria | 1533 |
| 448 | Ga0495611_0066054 | 3300046648 | Bacteria | 1649 |
| 449 | Ga0495625_0093740 | 3300046660 | Bacteria | 2072 |
| 450 | Ga0495625_0161173 | 3300046660 | Bacteria | 1503 |
| 451 | Ga0495625_0233185 | 3300046660 | Bacteria | 1201 |
| 452 | Ga0495635_0000409 | 3300046663 | Bacteria | 27280 |
| 453 | Ga0495635_0004336 | 3300046663 | Bacteria | 9824 |
| 454 | Ga0495635_0111087 | 3300046663 | Bacteria | 1872 |
| 455 | Ga0495659_0012697 | 3300046664 | Bacteria | 2733 |
| 456 | Ga0495661_0007704 | 3300046665 | Bacteria | 7499 |
| 457 | Ga0495588_0027689 | 3300046674 | Bacteria | 2834 |
| 458 | Ga0495657_0021011 | 3300046675 | Bacteria | 4690 |
| 459 | Ga0495657_0323267 | 3300046675 | Bacteria | 916 |
| 460 | Ga0495599_0002032 | 3300046678 | Bacteria | 11712 |
| 461 | Ga0495599_0023622 | 3300046678 | Bacteria | 3844 |
| 462 | Ga0495623_0000611 | 3300046679 | Bacteria | 23793 |
| 463 | Ga0495623_0064961 | 3300046679 | Bacteria | 2282 |
| 464 | Ga0495646_0084401 | 3300046680 | Bacteria | 1844 |
| 465 | Ga0495646_0122121 | 3300046680 | Bacteria | 1473 |
| 466 | Ga0495646_0203884 | 3300046680 | Bacteria | 1076 |
| 467 | Ga0495647_0014550 | 3300046681 | Bacteria | 2743 |
| 468 | Ga0495647_0036746 | 3300046681 | Bacteria | 1845 |
| 469 | Ga0495658_0023647 | 3300046683 | Bacteria | 3264 |
| 470 | Ga0495658_0039793 | 3300046683 | Bacteria | 2610 |
| 471 | Ga0495613_0027251 | 3300046689 | Bacteria | 4252 |
| 472 | Ga0495613_0045678 | 3300046689 | Bacteria | 3239 |
| 473 | Ga0495613_0210598 | 3300046689 | Bacteria | 1367 |
| 474 | Ga0495624_0079111 | 3300046690 | Bacteria | 2039 |
| 475 | Ga0495624_0133449 | 3300046690 | Bacteria | 1522 |
| 476 | Ga0495670_0028793 | 3300046691 | Bacteria | 2754 |
| 477 | Ga0495671_0022968 | 3300046692 | Bacteria | 3262 |
| 478 | Ga0495600_0000879 | 3300046809 | Bacteria | 16048 |
| 479 | Ga0495600_0086394 | 3300046809 | Bacteria | 2047 |
| 480 | Ga0495581_0056247 | 3300047315 | Bacteria | 2271 |
| 481 | Ga0495581_0156834 | 3300047315 | Bacteria | 1330 |
| 482 | Ga0495581_0226672 | 3300047315 | Bacteria | 1093 |
| 483 | Ga0495604_0000543 | 3300047317 | Bacteria | 33191 |
| 484 | Ga0495604_0025767 | 3300047317 | Bacteria | 4684 |
| 485 | Ga0495604_0256920 | 3300047317 | Bacteria | 1189 |
| 486 | Ga0495636_0038748 | 3300047318 | Bacteria | 1973 |
| 487 | Ga0495674_0002790 | 3300047319 | Bacteria | 16953 |
| 488 | Ga0495674_0026311 | 3300047319 | Bacteria | 5325 |
| 489 | Ga0495674_0065765 | 3300047319 | Bacteria | 3148 |
| 490 | Ga0495674_0089282 | 3300047319 | Bacteria | 2635 |
| 491 | Ga0495672_0062935 | 3300047320 | Bacteria | 2132 |
| 492 | Ga0495680_0002855 | 3300047322 | Bacteria | 17362 |
| 493 | Ga0495680_0004856 | 3300047322 | Bacteria | 12736 |
| 494 | Ga0495680_0037033 | 3300047322 | Bacteria | 3910 |
| 495 | Ga0495675_0005227 | 3300047444 | Bacteria | 7904 |
| 496 | Ga0495675_0127162 | 3300047444 | Bacteria | 1585 |
| 497 | Ga0495684_0002502 | 3300047471 | Bacteria | 14639 |
| 498 | Ga0495684_0011051 | 3300047471 | Bacteria | 6981 |
| 499 | Ga0495684_0129155 | 3300047471 | Bacteria | 1899 |
| 500 | Ga0495686_0010264 | 3300047472 | Bacteria | 6668 |
| 501 | Ga0495686_0021002 | 3300047472 | Bacteria | 4347 |
| 502 | Ga0495686_0151987 | 3300047472 | Bacteria | 1358 |
| 503 | Ga0495593_0011842 | 3300047673 | Bacteria | 5002 |
| 504 | Ga0495593_0029014 | 3300047673 | Bacteria | 3037 |
| 505 | Ga0495593_0081112 | 3300047673 | Bacteria | 1678 |
| 506 | Ga0495602_0041819 | 3300048088 | Bacteria | 4182 |
| 507 | Ga0495615_0011455 | 3300048090 | Bacteria | 1803 |
| 508 | Ga0496100_0115117 | 3300048903 | Bacteria | 1874 |
| 509 | Ga0496100_0135745 | 3300048903 | Bacteria | 1738 |
| 510 | Ga0496100_0246512 | 3300048903 | Bacteria | 1320 |
| 511 | Ga0496101_0042884 | 3300048904 | Bacteria | 3231 |
| 512 | Ga0496102_0003551 | 3300048905 | Bacteria | 13206 |
| 513 | Ga0496102_0139137 | 3300048905 | Bacteria | 2276 |
| 514 | Ga0496102_0182319 | 3300048905 | Bacteria | 1978 |
| 515 | Ga0496102_0207492 | 3300048905 | Bacteria | 1847 |
| 516 | Ga0496103_0237307 | 3300048906 | Bacteria | 1173 |
| 517 | Ga0496104_0021237 | 3300048907 | Bacteria | 5957 |
| 518 | Ga0496105_0038450 | 3300048908 | Bacteria | 3941 |
| 519 | Ga0496105_0096402 | 3300048908 | Bacteria | 2443 |
| 520 | Ga0496105_0132165 | 3300048908 | Bacteria | 2057 |
| 521 | Ga0496106_0033502 | 3300048909 | Bacteria | 3832 |
| 522 | Ga0496107_0000607 | 3300048910 | Bacteria | 19967 |
| 523 | Ga0496107_0092552 | 3300048910 | Bacteria | 2210 |
| 524 | Ga0496107_0095637 | 3300048910 | Bacteria | 2173 |
| 525 | Ga0496107_0342050 | 3300048910 | Bacteria | 1113 |
| 526 | Ga0496108_0001175 | 3300048911 | Bacteria | 20416 |
| 527 | Ga0496108_0142462 | 3300048911 | Bacteria | 2065 |
| 528 | Ga0496108_0329784 | 3300048911 | Bacteria | 1331 |
| 529 | Ga0496108_0332159 | 3300048911 | Bacteria | 1326 |
| 530 | Ga0496109_0001679 | 3300048912 | Bacteria | 18452 |
| 531 | Ga0496109_0251765 | 3300048912 | Bacteria | 1663 |
| 532 | Ga0496109_0384051 | 3300048912 | Bacteria | 1327 |
| 533 | Ga0496110_0080507 | 3300048913 | Bacteria | 2902 |
| 534 | Ga0496110_0087227 | 3300048913 | Bacteria | 2787 |
| 535 | Ga0496110_0704312 | 3300048913 | Bacteria | 911 |
| 536 | Ga0496111_0249000 | 3300048914 | Bacteria | 1319 |
| 537 | Ga0496112_0000054 | 3300048915 | Bacteria | 79516 |
| 538 | Ga0496112_0027470 | 3300048915 | Bacteria | 5486 |
| 539 | Ga0496112_0362702 | 3300048915 | Bacteria | 1391 |
| 540 | Ga0496113_0146263 | 3300048916 | Bacteria | 1862 |
| 541 | Ga0496114_0041804 | 3300048917 | Bacteria | 3798 |
| 542 | Ga0496114_0202173 | 3300048917 | Bacteria | 1740 |
| 543 | Ga0496114_0650131 | 3300048917 | Bacteria | 927 |
| 544 | Ga0496115_0082438 | 3300048918 | Bacteria | 2620 |
| 545 | Ga0496115_0123784 | 3300048918 | Bacteria | 2129 |
| 546 | Ga0496116_0000080 | 3300048919 | Bacteria | 224530 |
| 547 | Ga0496116_0005626 | 3300048919 | Bacteria | 11542 |
| 548 | Ga0496118_0032852 | 3300048921 | Bacteria | 4266 |
| 549 | Ga0496118_0047805 | 3300048921 | Bacteria | 3312 |
| 550 | Ga0496118_0062288 | 3300048921 | Bacteria | 2755 |
| 551 | Ga0496118_0110299 | 3300048921 | Bacteria | 1828 |
| 552 | Ga0496119_0217695 | 3300048922 | Bacteria | 979 |
| 553 | Ga0496121_0005128 | 3300048924 | Bacteria | 17062 |
| 554 | Ga0496121_0025831 | 3300048924 | Bacteria | 5557 |
| 555 | Ga0496121_0032975 | 3300048924 | Bacteria | 4697 |
| 556 | Ga0496121_0036046 | 3300048924 | Bacteria | 4416 |
| 557 | Ga0496121_0038194 | 3300048924 | Bacteria | 4257 |
| 558 | Ga0496121_0044284 | 3300048924 | Bacteria | 3841 |
| 559 | Ga0496121_0173922 | 3300048924 | Bacteria | 1561 |
| 560 | Ga0496121_0194748 | 3300048924 | Bacteria | 1450 |
| 561 | Ga0496121_0234505 | 3300048924 | Bacteria | 1283 |
| 562 | Ga0496122_0033520 | 3300048925 | Bacteria | 4222 |
| 563 | Ga0496122_0052729 | 3300048925 | Bacteria | 3075 |
| 564 | Ga0496122_0177236 | 3300048925 | Bacteria | 1276 |
| 565 | Ga0496123_0020343 | 3300048926 | Bacteria | 5194 |
| 566 | Ga0496123_0120273 | 3300048926 | Bacteria | 1479 |
| 567 | Ga0496124_0000063 | 3300048927 | Bacteria | 229705 |
| 568 | Ga0496124_0043957 | 3300048927 | Bacteria | 3837 |
| 569 | Ga0496124_0157963 | 3300048927 | Bacteria | 1771 |
| 570 | Ga0496124_0254054 | 3300048927 | Bacteria | 1298 |
| 571 | Ga0496125_0002194 | 3300048928 | Bacteria | 26068 |
| 572 | Ga0496125_0025833 | 3300048928 | Bacteria | 5368 |
| 573 | Ga0496126_0000094 | 3300048929 | Bacteria | 208184 |
| 574 | Ga0496126_0008651 | 3300048929 | Bacteria | 10939 |
| 575 | Ga0496126_0011589 | 3300048929 | Bacteria | 9100 |
| 576 | Ga0496126_0014882 | 3300048929 | Bacteria | 7847 |
| 577 | Ga0496126_0014993 | 3300048929 | Bacteria | 7813 |
| 578 | Ga0496126_0314239 | 3300048929 | Bacteria | 1289 |
| 579 | Ga0501031_0000823 | 3300049568 | Bacteria | 18677 |
| 580 | Ga0501032_0000030 | 3300049569 | Bacteria | 130405 |
| 581 | Ga0501033_0000060 | 3300049570 | Bacteria | 103159 |
| 582 | Ga0501034_0000117 | 3300049571 | Bacteria | 144865 |
| 583 | Ga0501034_0538398 | 3300049571 | Bacteria | 1078 |
| 584 | Ga0501036_0000148 | 3300049572 | Bacteria | 45613 |
| 585 | Ga0501037_0000090 | 3300049573 | Bacteria | 85021 |
| 586 | Ga0501038_0000441 | 3300049574 | Bacteria | 36178 |
| 587 | Ga0501039_0000443 | 3300049575 | Bacteria | 30068 |
| 588 | Ga0501039_0073070 | 3300049575 | Bacteria | 2665 |
| 589 | Ga0501039_0476799 | 3300049575 | Bacteria | 980 |
| 590 | Ga0501043_0000919 | 3300049579 | Bacteria | 26107 |
| 591 | Ga0501046_0000214 | 3300049580 | Bacteria | 60379 |
| 592 | Ga0501047_0000571 | 3300049581 | Bacteria | 39243 |
| 593 | Ga0501048_0000563 | 3300049582 | Bacteria | 26308 |
| 594 | Ga0501048_0242636 | 3300049582 | Bacteria | 1279 |
| 595 | Ga0501067_0001731 | 3300049583 | Bacteria | 12000 |
| 596 | Ga0501068_0002887 | 3300049584 | Bacteria | 9143 |
| 597 | Ga0501069_0025285 | 3300049585 | Bacteria | 3243 |
| 598 | Ga0501069_0291932 | 3300049585 | Bacteria | 955 |
| 599 | Ga0501070_0003669 | 3300049586 | Bacteria | 13268 |
| 600 | Ga0501070_0356783 | 3300049586 | Bacteria | 1186 |
| 601 | Ga0501071_0068860 | 3300049587 | Bacteria | 2576 |
| 602 | Ga0501071_0354341 | 3300049587 | Bacteria | 1117 |
| 603 | Ga0501072_0005916 | 3300049588 | Bacteria | 9317 |
| 604 | Ga0501072_0006989 | 3300049588 | Bacteria | 8570 |
| 605 | Ga0501072_0450046 | 3300049588 | Bacteria | 1020 |
| 606 | Ga0501073_0000203 | 3300049589 | Bacteria | 39315 |
| 607 | Ga0501073_0402980 | 3300049589 | Bacteria | 945 |
| 608 | Ga0501074_0000633 | 3300049590 | Bacteria | 21831 |
| 609 | Ga0501077_0046104 | 3300049593 | Bacteria | 2770 |
| 610 | Ga0501238_015525 | 3300049671 | Bacteria | 1051 |
| 611 | Ga0501079_0001528 | 3300049741 | Bacteria | 16365 |
| 612 | Ga0501080_0014195 | 3300049742 | Bacteria | 7333 |
| 613 | Ga0501081_0321267 | 3300049743 | Bacteria | 1138 |
| 614 | Ga0501083_0000539 | 3300049744 | Bacteria | 24199 |
| 615 | Ga0501083_0303610 | 3300049744 | Bacteria | 1038 |
| 616 | Ga0501035_0000212 | 3300049822 | Bacteria | 69856 |
| 617 | Ga0501044_0000304 | 3300049823 | Bacteria | 61877 |
| 618 | Ga0501044_0304277 | 3300049823 | Bacteria | 1522 |
| 619 | Ga0501045_0035178 | 3300049824 | Bacteria | 3636 |
| 620 | nmdc:mga03683_8077_c1 | 3300050489 | Bacteria | 3686 |
| 621 | nmdc:mga03n38_29979_c1 | 3300050490 | Bacteria | 2283 |
| 622 | nmdc:mga03n38_44831_c1 | 3300050490 | Bacteria | 1945 |
| 623 | nmdc:mga00v17_59102_c1 | 3300050491 | Bacteria | 2351 |
| 624 | nmdc:mga0yw44_138665_c1 | 3300050492 | Bacteria | 1579 |
| 625 | nmdc:mga0yw44_169110_c1 | 3300050492 | Bacteria | 1434 |
| 626 | nmdc:mga07m45_27743_c2 | 3300050496 | Bacteria | 1493 |
| 627 | nmdc:mga05p37_129659_c1 | 3300050507 | Bacteria | 3094 |
| 628 | nmdc:mga05p37_15913_c1 | 3300050507 | Bacteria | 9049 |
| 629 | nmdc:mga0qj67_672648_c1 | 3300050509 | Bacteria | 825 |
| 630 | nmdc:mga06r32_103085_c1 | 3300050510 | Bacteria | 2801 |
| 631 | nmdc:mga06r32_42186_c1 | 3300050510 | Bacteria | 4337 |
| 632 | nmdc:mga08y16_305153_c1 | 3300050511 | Bacteria | 1640 |
| 633 | nmdc:mga08y16_313148_c1 | 3300050511 | Bacteria | 1616 |
| 634 | nmdc:mga08y16_380801_c1 | 3300050511 | Bacteria | 1446 |
| 635 | nmdc:mga08x19_297132_c1 | 3300050514 | Bacteria | 1121 |
| 636 | nmdc:mga0sz30_4527_c1 | 3300050516 | Bacteria | 5031 |
| 637 | Ga0495601_0000874 | 3300053077 | Bacteria | 16426 |
| 638 | Ga0495601_0004232 | 3300053077 | Bacteria | 8285 |
| 639 | Ga0495601_0017206 | 3300053077 | Bacteria | 4388 |
| 640 | Ga0495612_0000121 | 3300053078 | Bacteria | 32966 |
| 641 | Ga0495612_0000364 | 3300053078 | Bacteria | 18228 |
| 642 | Ga0495612_0020038 | 3300053078 | Bacteria | 2679 |
| 643 | Ga0495612_0037598 | 3300053078 | Bacteria | 1966 |
| 644 | Ga0495595_0000179 | 3300053084 | Bacteria | 25284 |
| 645 | Ga0495595_0000356 | 3300053084 | Bacteria | 17378 |
| 646 | Ga0495595_0239908 | 3300053084 | Bacteria | 907 |
| 647 | Ga0495619_0000071 | 3300053085 | Bacteria | 79814 |
| 648 | Ga0495619_0001264 | 3300053085 | Bacteria | 16587 |
| 649 | Ga0495619_0003020 | 3300053085 | Bacteria | 10929 |
| 650 | Ga0495619_0240475 | 3300053085 | Bacteria | 1254 |
| 651 | Ga0500651_0133295 | 3300053093 | Bacteria | 1501 |
| 652 | Ga0500566_0004256 | 3300053094 | Bacteria | 8540 |
| 653 | Ga0500641_0001545 | 3300053096 | Bacteria | 8220 |
| 654 | Ga0500641_0013893 | 3300053096 | Bacteria | 2963 |
| 655 | Ga0500650_0000379 | 3300053098 | Bacteria | 10864 |
| 656 | Ga0500650_0183618 | 3300053098 | Bacteria | 958 |
| 657 | Ga0500556_0000045 | 3300053104 | Bacteria | 130653 |
| 658 | Ga0500569_020674 | 3300053109 | Bacteria | 1730 |
| 659 | Ga0500572_032203 | 3300053111 | Bacteria | 1470 |
| 660 | Ga0500592_002040 | 3300053116 | Bacteria | 3255 |
| 661 | Ga0500593_000219 | 3300053117 | Bacteria | 23614 |
| 662 | Ga0500607_150493 | 3300053121 | Bacteria | 1079 |
| 663 | Ga0500608_000919 | 3300053122 | Bacteria | 10610 |
| 664 | Ga0500618_001886 | 3300053125 | Bacteria | 8678 |
| 665 | Ga0500642_0000024 | 3300053130 | Bacteria | 134373 |
| 666 | Ga0500642_0057811 | 3300053130 | Bacteria | 1731 |
| 667 | Ga0500652_000356 | 3300053131 | Bacteria | 16417 |
| 668 | Ga0500559_0000414 | 3300053136 | Bacteria | 30678 |
| 669 | Ga0500568_0000456 | 3300053139 | Bacteria | 30484 |
| 670 | Ga0500585_105683 | 3300053144 | Bacteria | 1012 |
| 671 | Ga0500586_000524 | 3300053145 | Bacteria | 7713 |
| 672 | Ga0500604_0001142 | 3300053151 | Bacteria | 7369 |
| 673 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 674 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 675 | Ga0500616_0046294 | 3300053153 | Bacteria | 2313 |
| 676 | Ga0500620_006855 | 3300053155 | Bacteria | 2769 |
| 677 | Ga0500622_0000714 | 3300053156 | Bacteria | 29050 |
| 678 | Ga0500627_0021274 | 3300053158 | Bacteria | 2615 |
| 679 | Ga0500627_0059682 | 3300053158 | Bacteria | 1676 |
| 680 | Ga0500633_0025699 | 3300053160 | Bacteria | 1845 |
| 681 | Ga0500636_0001447 | 3300053177 | Bacteria | 12924 |
| 682 | Ga0500636_0006532 | 3300053177 | Bacteria | 6697 |
| 683 | Ga0500636_0033858 | 3300053177 | Bacteria | 3023 |
| 684 | Ga0500601_000376 | 3300053737 | Bacteria | 7971 |
| 685 | Ga0501084_0011763 | 3300054114 | Bacteria | 7247 |
| 686 | Ga0501084_0186200 | 3300054114 | Bacteria | 1752 |
| 687 | Ga0501084_0321439 | 3300054114 | Bacteria | 1307 |
| 688 | Ga0501082_0043670 | 3300060353 | Bacteria | 3865 |
| 689 | Ga0501082_0258758 | 3300060353 | Bacteria | 1514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0538398 | Ga0501034_0538398_136_957 | 230 |
| 2 | 3300005937 | Ga0081455_10036840 | Ga0081455_100368404 | 231 |
| 3 | 3300048929 | Ga0496126_0011589 | Ga0496126_0011589_7403_8218 | 231 |
| 4 | 3300048090 | Ga0495615_0011455 | Ga0495615_0011455_832_1647 | 232 |
| 5 | 3300006942 | Ga0099824_1003081 | Ga0099824_10030814 | 234 |
| 6 | 3300027296 | Ga0209389_1000086 | Ga0209389_100008638 | 234 |
| 7 | 3300027357 | Ga0209589_1000027 | Ga0209589_100002747 | 234 |
| 8 | 3300027361 | Ga0209489_100313 | Ga0209489_10031338 | 234 |
| 9 | 3300048903 | Ga0496100_0246512 | Ga0496100_0246512_15_773 | 234 |
| 10 | 3300003215 | JGI25153J46596_10036295 | JGI25153J46596_100362952 | 235 |
| 11 | 3300006051 | Ga0075364_10161274 | Ga0075364_101612741 | 235 |
| 12 | 3300021320 | Ga0214544_1000005 | Ga0214544_1000005115 | 235 |
| 13 | 3300021321 | Ga0214542_1000004 | Ga0214542_1000004119 | 235 |
| 14 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005278 | 235 |
| 15 | 3300021327 | Ga0214543_1000564 | Ga0214543_10005644 | 235 |
| 16 | 3300025295 | Ga0209564_1007180 | Ga0209564_10071802 | 235 |
| 17 | 3300025297 | Ga0209758_1000474 | Ga0209758_100047424 | 235 |
| 18 | 3300031250 | Ga0265331_10009382 | Ga0265331_100093826 | 235 |
| 19 | 3300038443 | Ga0395901_0134371 | Ga0395901_0134371_828_1640 | 235 |
| 20 | 3300046455 | Ga0495603_0069687 | Ga0495603_0069687_340_1155 | 235 |
| 21 | 3300046664 | Ga0495659_0012697 | Ga0495659_0012697_663_1478 | 235 |
| 22 | 3300038443 | Ga0395901_0091694 | Ga0395901_0091694_210_1028 | 236 |
| 23 | 3300025926 | Ga0207659_10461317 | Ga0207659_104613171 | 237 |
| 24 | 3300048910 | Ga0496107_0095637 | Ga0496107_0095637_1210_2025 | 237 |
| 25 | 3300025898 | Ga0207692_10241409 | Ga0207692_102414092 | 238 |
| 26 | 3300025915 | Ga0207693_10017196 | Ga0207693_100171961 | 238 |
| 27 | 3300025929 | Ga0207664_10563601 | Ga0207664_105636012 | 238 |
| 28 | 3300048903 | Ga0496100_0135745 | Ga0496100_0135745_373_1188 | 238 |
| 29 | 3300048905 | Ga0496102_0207492 | Ga0496102_0207492_188_1003 | 238 |
| 30 | 3300048915 | Ga0496112_0362702 | Ga0496112_0362702_165_980 | 238 |
| 31 | 3300048917 | Ga0496114_0650131 | Ga0496114_0650131_12_815 | 238 |
| 32 | 3300048924 | Ga0496121_0173922 | Ga0496121_0173922_366_1181 | 238 |
| 33 | 3300013308 | Ga0157375_10385938 | Ga0157375_103859382 | 239 |
| 34 | 3300037466 | Ga0395898_0042480 | Ga0395898_0042480_3225_4040 | 240 |
| 35 | 3300037471 | Ga0395905_0286868 | Ga0395905_0286868_291_1106 | 240 |
| 36 | 3300006847 | Ga0075431_100022230 | Ga0075431_1000222302 | 241 |
| 37 | 3300036459 | Ga0372808_017652 | Ga0372808_017652_181_996 | 241 |
| 38 | 3300037471 | Ga0395905_0421935 | Ga0395905_0421935_357_1172 | 241 |
| 39 | 3300050510 | nmdc:mga06r32_103085_c1 | nmdc:mga06r32_103085_c1_1547_2359 | 241 |
| 40 | iso_pu_bacteria | 2924710171 | 2924716807 | 241 |
| 41 | 3300031238 | Ga0265332_10011063 | Ga0265332_100110634 | 242 |
| 42 | 3300046475 | Ga0495639_0015022 | Ga0495639_0015022_63_878 | 242 |
| 43 | 3300035691 | Ga0373931_0081689 | Ga0373931_0081689_712_1629 | 243 |
| 44 | 3300046520 | Ga0495637_0091648 | Ga0495637_0091648_253_1068 | 243 |
| 45 | 3300046663 | Ga0495635_0111087 | Ga0495635_0111087_122_856 | 244 |
| 46 | 3300049568 | Ga0501031_0000823 | Ga0501031_0000823_9587_10408 | 244 |
| 47 | 3300049569 | Ga0501032_0000030 | Ga0501032_0000030_102933_103754 | 244 |
| 48 | 3300049570 | Ga0501033_0000060 | Ga0501033_0000060_24417_25238 | 244 |
| 49 | 3300049571 | Ga0501034_0000117 | Ga0501034_0000117_59081_59902 | 244 |
| 50 | 3300049572 | Ga0501036_0000148 | Ga0501036_0000148_14945_15766 | 244 |
| 51 | 3300049573 | Ga0501037_0000090 | Ga0501037_0000090_80858_81679 | 244 |
| 52 | 3300049574 | Ga0501038_0000441 | Ga0501038_0000441_7924_8745 | 244 |
| 53 | 3300049575 | Ga0501039_0000443 | Ga0501039_0000443_14179_15000 | 244 |
| 54 | 3300049579 | Ga0501043_0000919 | Ga0501043_0000919_23956_24777 | 244 |
| 55 | 3300049580 | Ga0501046_0000214 | Ga0501046_0000214_50441_51262 | 244 |
| 56 | 3300049581 | Ga0501047_0000571 | Ga0501047_0000571_20657_21478 | 244 |
| 57 | 3300049582 | Ga0501048_0000563 | Ga0501048_0000563_17688_18509 | 244 |
| 58 | 3300049583 | Ga0501067_0001731 | Ga0501067_0001731_9616_10437 | 244 |
| 59 | 3300049584 | Ga0501068_0002887 | Ga0501068_0002887_7980_8801 | 244 |
| 60 | 3300049585 | Ga0501069_0025285 | Ga0501069_0025285_2047_2868 | 244 |
| 61 | 3300049586 | Ga0501070_0003669 | Ga0501070_0003669_102_923 | 244 |
| 62 | 3300049587 | Ga0501071_0068860 | Ga0501071_0068860_1428_2249 | 244 |
| 63 | 3300049588 | Ga0501072_0006989 | Ga0501072_0006989_7507_8328 | 244 |
| 64 | 3300049589 | Ga0501073_0000203 | Ga0501073_0000203_27354_28175 | 244 |
| 65 | 3300049590 | Ga0501074_0000633 | Ga0501074_0000633_14190_15011 | 244 |
| 66 | 3300049741 | Ga0501079_0001528 | Ga0501079_0001528_2606_3427 | 244 |
| 67 | 3300049742 | Ga0501080_0014195 | Ga0501080_0014195_1987_2808 | 244 |
| 68 | 3300049744 | Ga0501083_0000539 | Ga0501083_0000539_1319_2140 | 244 |
| 69 | 3300049822 | Ga0501035_0000212 | Ga0501035_0000212_34374_35195 | 244 |
| 70 | 3300049823 | Ga0501044_0000304 | Ga0501044_0000304_1976_2797 | 244 |
| 71 | 3300049824 | Ga0501045_0035178 | Ga0501045_0035178_2691_3512 | 244 |
| 72 | 3300053084 | Ga0495595_0239908 | Ga0495595_0239908_162_896 | 244 |
| 73 | 3300054114 | Ga0501084_0011763 | Ga0501084_0011763_2242_3063 | 244 |
| 74 | 3300060353 | Ga0501082_0043670 | Ga0501082_0043670_2670_3491 | 244 |
| 75 | 3300025903 | Ga0207680_10122805 | Ga0207680_101228052 | 245 |
| 76 | 3300003215 | JGI25153J46596_10000872 | JGI25153J46596_100008726 | 246 |
| 77 | 3300005329 | Ga0070683_100222355 | Ga0070683_1002223552 | 246 |
| 78 | 3300005355 | Ga0070671_100132146 | Ga0070671_1001321462 | 246 |
| 79 | 3300005355 | Ga0070671_100561575 | Ga0070671_1005615751 | 246 |
| 80 | 3300005456 | Ga0070678_100347680 | Ga0070678_1003476802 | 246 |
| 81 | 3300005466 | Ga0070685_10085396 | Ga0070685_100853962 | 246 |
| 82 | 3300005539 | Ga0068853_100102316 | Ga0068853_1001023162 | 246 |
| 83 | 3300005548 | Ga0070665_100085000 | Ga0070665_1000850002 | 246 |
| 84 | 3300005564 | Ga0070664_100081717 | Ga0070664_1000817172 | 246 |
| 85 | 3300005842 | Ga0068858_100243034 | Ga0068858_1002430342 | 246 |
| 86 | 3300005843 | Ga0068860_100171237 | Ga0068860_1001712373 | 246 |
| 87 | 3300006177 | Ga0075362_10136070 | Ga0075362_101360702 | 246 |
| 88 | 3300006237 | Ga0097621_100053573 | Ga0097621_1000535734 | 246 |
| 89 | 3300009098 | Ga0105245_10169811 | Ga0105245_101698112 | 246 |
| 90 | 3300009098 | Ga0105245_10203588 | Ga0105245_102035883 | 246 |
| 91 | 3300009176 | Ga0105242_10343236 | Ga0105242_103432362 | 246 |
| 92 | 3300009551 | Ga0105238_10041225 | Ga0105238_100412252 | 246 |
| 93 | 3300010375 | Ga0105239_10166630 | Ga0105239_101666302 | 246 |
| 94 | 3300013296 | Ga0157374_10255025 | Ga0157374_102550251 | 246 |
| 95 | 3300013297 | Ga0157378_10053235 | Ga0157378_100532354 | 246 |
| 96 | 3300013306 | Ga0163162_10026945 | Ga0163162_100269455 | 246 |
| 97 | 3300014968 | Ga0157379_10110318 | Ga0157379_101103182 | 246 |
| 98 | 3300014969 | Ga0157376_10002884 | Ga0157376_1000288410 | 246 |
| 99 | 3300025297 | Ga0209758_1005624 | Ga0209758_10056246 | 246 |
| 100 | 3300025900 | Ga0207710_10098511 | Ga0207710_100985111 | 246 |
| 101 | 3300025938 | Ga0207704_10056278 | Ga0207704_100562782 | 246 |
| 102 | 3300025945 | Ga0207679_10077366 | Ga0207679_100773663 | 246 |
| 103 | 3300026023 | Ga0207677_10016002 | Ga0207677_100160023 | 246 |
| 104 | 3300026035 | Ga0207703_10101613 | Ga0207703_101016132 | 246 |
| 105 | 3300026095 | Ga0207676_10142466 | Ga0207676_101424663 | 246 |
| 106 | 3300026121 | Ga0207683_10032330 | Ga0207683_100323303 | 246 |
| 107 | 3300026121 | Ga0207683_10102847 | Ga0207683_101028472 | 246 |
| 108 | 3300026121 | Ga0207683_10391501 | Ga0207683_103915012 | 246 |
| 109 | 3300028379 | Ga0268266_10071617 | Ga0268266_100716173 | 246 |
| 110 | 3300038727 | Ga0400491_15212 | Ga0400491_15212_4231_5058 | 246 |
| 111 | 3300046543 | Ga0495645_0265706 | Ga0495645_0265706_139_957 | 246 |
| 112 | 3300046615 | Ga0495656_0034334 | Ga0495656_0034334_1012_1827 | 246 |
| 113 | 3300046660 | Ga0495625_0233185 | Ga0495625_0233185_172_987 | 246 |
| 114 | 3300046809 | Ga0495600_0086394 | Ga0495600_0086394_521_1339 | 246 |
| 115 | 3300047315 | Ga0495581_0056247 | Ga0495581_0056247_1307_2122 | 246 |
| 116 | 3300048905 | Ga0496102_0003551 | Ga0496102_0003551_10577_11392 | 246 |
| 117 | 3300048907 | Ga0496104_0021237 | Ga0496104_0021237_3492_4307 | 246 |
| 118 | 3300048908 | Ga0496105_0038450 | Ga0496105_0038450_1915_2730 | 246 |
| 119 | 3300048911 | Ga0496108_0329784 | Ga0496108_0329784_469_1284 | 246 |
| 120 | 3300048912 | Ga0496109_0384051 | Ga0496109_0384051_119_934 | 246 |
| 121 | 3300048913 | Ga0496110_0080507 | Ga0496110_0080507_447_1262 | 246 |
| 122 | 3300048913 | Ga0496110_0704312 | Ga0496110_0704312_75_890 | 246 |
| 123 | 3300048918 | Ga0496115_0082438 | Ga0496115_0082438_1371_2186 | 246 |
| 124 | 3300049585 | Ga0501069_0291932 | Ga0501069_0291932_103_918 | 246 |
| 125 | 3300050507 | nmdc:mga05p37_129659_c1 | nmdc:mga05p37_129659_c1_870_1670 | 246 |
| 126 | 3300005327 | Ga0070658_10324336 | Ga0070658_103243362 | 247 |
| 127 | 3300005366 | Ga0070659_100134493 | Ga0070659_1001344932 | 247 |
| 128 | 3300014745 | Ga0157377_10036515 | Ga0157377_100365153 | 247 |
| 129 | 3300025261 | Ga0209233_1001256 | Ga0209233_10012567 | 247 |
| 130 | 3300025919 | Ga0207657_10008768 | Ga0207657_100087682 | 247 |
| 131 | 3300025949 | Ga0207667_10469761 | Ga0207667_104697611 | 247 |
| 132 | 3300026041 | Ga0207639_10184044 | Ga0207639_101840443 | 247 |
| 133 | 3300035117 | Ga0373953_0104624 | Ga0373953_0104624_237_1055 | 247 |
| 134 | 3300035119 | Ga0373956_0052829 | Ga0373956_0052829_967_1785 | 247 |
| 135 | 3300037418 | Ga0395900_0401109 | Ga0395900_0401109_322_1140 | 247 |
| 136 | 3300046516 | Ga0495628_0013710 | Ga0495628_0013710_16_834 | 247 |
| 137 | 3300046529 | Ga0495652_0082531 | Ga0495652_0082531_1372_2190 | 247 |
| 138 | 3300046543 | Ga0495645_0053982 | Ga0495645_0053982_1649_2467 | 247 |
| 139 | 3300046678 | Ga0495599_0023622 | Ga0495599_0023622_1643_2461 | 247 |
| 140 | 3300046679 | Ga0495623_0064961 | Ga0495623_0064961_1157_1975 | 247 |
| 141 | 3300047322 | Ga0495680_0037033 | Ga0495680_0037033_1451_2269 | 247 |
| 142 | 3300047444 | Ga0495675_0127162 | Ga0495675_0127162_570_1388 | 247 |
| 143 | 3300048088 | Ga0495602_0041819 | Ga0495602_0041819_1807_2625 | 247 |
| 144 | 3300048924 | Ga0496121_0194748 | Ga0496121_0194748_407_1222 | 247 |
| 145 | 3300050511 | nmdc:mga08y16_305153_c1 | nmdc:mga08y16_305153_c1_516_1331 | 247 |
| 146 | 3300053078 | Ga0495612_0020038 | Ga0495612_0020038_422_1240 | 247 |
| 147 | 3300053085 | Ga0495619_0240475 | Ga0495619_0240475_238_1056 | 247 |
| 148 | 3300053153 | Ga0500616_0000048 | Ga0500616_0000048_233301_234116 | 247 |
| 149 | 3300005435 | Ga0070714_100094910 | Ga0070714_1000949102 | 248 |
| 150 | 3300033442 | Ga0315911_1000022 | Ga0315911_100002271 | 248 |
| 151 | 3300035692 | Ga0373935_0160266 | Ga0373935_0160266_578_1393 | 248 |
| 152 | 3300036401 | Ga0373937_0204580 | Ga0373937_0204580_535_1350 | 248 |
| 153 | 3300046459 | Ga0495629_0366471 | Ga0495629_0366471_104_919 | 248 |
| 154 | 3300046511 | Ga0495608_0027336 | Ga0495608_0027336_370_1185 | 248 |
| 155 | 3300046517 | Ga0495630_0154271 | Ga0495630_0154271_707_1522 | 248 |
| 156 | 3300046533 | Ga0495640_0060083 | Ga0495640_0060083_1730_2545 | 248 |
| 157 | 3300046559 | Ga0495667_0047619 | Ga0495667_0047619_550_1365 | 248 |
| 158 | 3300046642 | Ga0495634_0140542 | Ga0495634_0140542_563_1378 | 248 |
| 159 | 3300046683 | Ga0495658_0023647 | Ga0495658_0023647_365_1180 | 248 |
| 160 | 3300047317 | Ga0495604_0025767 | Ga0495604_0025767_2793_3608 | 248 |
| 161 | 3300047322 | Ga0495680_0004856 | Ga0495680_0004856_6445_7260 | 248 |
| 162 | 3300053077 | Ga0495601_0004232 | Ga0495601_0004232_1372_2187 | 248 |
| 163 | 3300053078 | Ga0495612_0037598 | Ga0495612_0037598_770_1585 | 248 |
| 164 | 3300053084 | Ga0495595_0000356 | Ga0495595_0000356_4314_5129 | 248 |
| 165 | 3300053085 | Ga0495619_0000071 | Ga0495619_0000071_9949_10764 | 248 |
| 166 | 3300053153 | Ga0500616_0046294 | Ga0500616_0046294_132_947 | 248 |
| 167 | 3300005335 | Ga0070666_10309077 | Ga0070666_103090771 | 249 |
| 168 | 3300005347 | Ga0070668_100057648 | Ga0070668_1000576483 | 249 |
| 169 | 3300005356 | Ga0070674_100031335 | Ga0070674_1000313354 | 249 |
| 170 | 3300005543 | Ga0070672_100225477 | Ga0070672_1002254772 | 249 |
| 171 | 3300005544 | Ga0070686_100129075 | Ga0070686_1001290751 | 249 |
| 172 | 3300005545 | Ga0070695_100116495 | Ga0070695_1001164952 | 249 |
| 173 | 3300005548 | Ga0070665_100091160 | Ga0070665_1000911603 | 249 |
| 174 | 3300005981 | Ga0081538_10017420 | Ga0081538_100174205 | 249 |
| 175 | 3300006358 | Ga0068871_100536001 | Ga0068871_1005360012 | 249 |
| 176 | 3300009098 | Ga0105245_10139750 | Ga0105245_101397503 | 249 |
| 177 | 3300013306 | Ga0163162_10631520 | Ga0163162_106315201 | 249 |
| 178 | 3300017792 | Ga0163161_10193662 | Ga0163161_101936622 | 249 |
| 179 | 3300025919 | Ga0207657_10403475 | Ga0207657_104034752 | 249 |
| 180 | 3300025923 | Ga0207681_10367496 | Ga0207681_103674962 | 249 |
| 181 | 3300025927 | Ga0207687_10249330 | Ga0207687_102493301 | 249 |
| 182 | 3300025935 | Ga0207709_10019157 | Ga0207709_100191572 | 249 |
| 183 | 3300025937 | Ga0207669_10012995 | Ga0207669_100129954 | 249 |
| 184 | 3300025938 | Ga0207704_10323272 | Ga0207704_103232722 | 249 |
| 185 | 3300025940 | Ga0207691_10024673 | Ga0207691_100246736 | 249 |
| 186 | 3300025961 | Ga0207712_10152495 | Ga0207712_101524952 | 249 |
| 187 | 3300025972 | Ga0207668_10076769 | Ga0207668_100767693 | 249 |
| 188 | 3300026067 | Ga0207678_10229797 | Ga0207678_102297972 | 249 |
| 189 | 3300026121 | Ga0207683_10286473 | Ga0207683_102864732 | 249 |
| 190 | 3300028379 | Ga0268266_10271173 | Ga0268266_102711732 | 249 |
| 191 | 3300028381 | Ga0268264_10676257 | Ga0268264_106762572 | 249 |
| 192 | 3300039450 | Ga0436363_0909856 | Ga0436363_0909856_14_823 | 249 |
| 193 | 3300045049 | Ga0466959_0290931 | Ga0466959_0290931_150_959 | 249 |
| 194 | 3300048906 | Ga0496103_0237307 | Ga0496103_0237307_140_955 | 249 |
| 195 | 3300048921 | Ga0496118_0062288 | Ga0496118_0062288_1871_2692 | 249 |
| 196 | 3300048924 | Ga0496121_0025831 | Ga0496121_0025831_861_1682 | 249 |
| 197 | 3300049586 | Ga0501070_0356783 | Ga0501070_0356783_254_1072 | 249 |
| 198 | 3300049823 | Ga0501044_0304277 | Ga0501044_0304277_252_1070 | 249 |
| 199 | 3300003762 | Ga0055542_1015078 | Ga0055542_10150782 | 250 |
| 200 | 3300005334 | Ga0068869_100163243 | Ga0068869_1001632432 | 250 |
| 201 | 3300005338 | Ga0068868_100017821 | Ga0068868_1000178214 | 250 |
| 202 | 3300005339 | Ga0070660_100413074 | Ga0070660_1004130741 | 250 |
| 203 | 3300005347 | Ga0070668_100046008 | Ga0070668_1000460083 | 250 |
| 204 | 3300005455 | Ga0070663_100024821 | Ga0070663_1000248213 | 250 |
| 205 | 3300005457 | Ga0070662_100062108 | Ga0070662_1000621081 | 250 |
| 206 | 3300005546 | Ga0070696_100389750 | Ga0070696_1003897501 | 250 |
| 207 | 3300005563 | Ga0068855_100168146 | Ga0068855_1001681462 | 250 |
| 208 | 3300005564 | Ga0070664_100138593 | Ga0070664_1001385932 | 250 |
| 209 | 3300005578 | Ga0068854_100216108 | Ga0068854_1002161082 | 250 |
| 210 | 3300005618 | Ga0068864_100066513 | Ga0068864_1000665133 | 250 |
| 211 | 3300006048 | Ga0075363_100002221 | Ga0075363_1000022214 | 250 |
| 212 | 3300006051 | Ga0075364_10372812 | Ga0075364_103728122 | 250 |
| 213 | 3300006178 | Ga0075367_10104103 | Ga0075367_101041032 | 250 |
| 214 | 3300006871 | Ga0075434_100072230 | Ga0075434_1000722304 | 250 |
| 215 | 3300006914 | Ga0075436_100079624 | Ga0075436_1000796243 | 250 |
| 216 | 3300009098 | Ga0105245_10270812 | Ga0105245_102708122 | 250 |
| 217 | 3300009174 | Ga0105241_10017678 | Ga0105241_100176783 | 250 |
| 218 | 3300025254 | Ga0209148_1000367 | Ga0209148_100036730 | 250 |
| 219 | 3300025261 | Ga0209233_1004430 | Ga0209233_10044303 | 250 |
| 220 | 3300025911 | Ga0207654_10011800 | Ga0207654_100118003 | 250 |
| 221 | 3300025914 | Ga0207671_10129765 | Ga0207671_101297652 | 250 |
| 222 | 3300025924 | Ga0207694_10612850 | Ga0207694_106128501 | 250 |
| 223 | 3300025927 | Ga0207687_10025101 | Ga0207687_100251014 | 250 |
| 224 | 3300025931 | Ga0207644_10415607 | Ga0207644_104156072 | 250 |
| 225 | 3300025934 | Ga0207686_10249607 | Ga0207686_102496072 | 250 |
| 226 | 3300025937 | Ga0207669_10336309 | Ga0207669_103363091 | 250 |
| 227 | 3300025942 | Ga0207689_10181620 | Ga0207689_101816202 | 250 |
| 228 | 3300025945 | Ga0207679_10090205 | Ga0207679_100902052 | 250 |
| 229 | 3300025949 | Ga0207667_10128793 | Ga0207667_101287932 | 250 |
| 230 | 3300025972 | Ga0207668_10144314 | Ga0207668_101443141 | 250 |
| 231 | 3300026023 | Ga0207677_10150032 | Ga0207677_101500322 | 250 |
| 232 | 3300026035 | Ga0207703_10054849 | Ga0207703_100548492 | 250 |
| 233 | 3300026041 | Ga0207639_10078890 | Ga0207639_100788902 | 250 |
| 234 | 3300026067 | Ga0207678_10022898 | Ga0207678_100228983 | 250 |
| 235 | 3300026095 | Ga0207676_10236397 | Ga0207676_102363972 | 250 |
| 236 | 3300026118 | Ga0207675_100386227 | Ga0207675_1003862272 | 250 |
| 237 | 3300026121 | Ga0207683_10350560 | Ga0207683_103505602 | 250 |
| 238 | 3300027866 | Ga0209813_10060608 | Ga0209813_100606082 | 250 |
| 239 | 3300028379 | Ga0268266_10028559 | Ga0268266_100285594 | 250 |
| 240 | 3300035113 | Ga0373936_0022106 | Ga0373936_0022106_1119_1928 | 250 |
| 241 | 3300035116 | Ga0373945_0007444 | Ga0373945_0007444_2013_2822 | 250 |
| 242 | 3300035170 | Ga0373943_0010012 | Ga0373943_0010012_820_1629 | 250 |
| 243 | 3300035171 | Ga0373946_0008000 | Ga0373946_0008000_2357_3166 | 250 |
| 244 | 3300035172 | Ga0373955_0055789 | Ga0373955_0055789_1120_1929 | 250 |
| 245 | 3300035410 | Ga0373924_0009271 | Ga0373924_0009271_274_1083 | 250 |
| 246 | 3300035692 | Ga0373935_0061105 | Ga0373935_0061105_754_1563 | 250 |
| 247 | 3300037068 | Ga0373925_0006468 | Ga0373925_0006468_457_1266 | 250 |
| 248 | 3300037418 | Ga0395900_0058294 | Ga0395900_0058294_2009_2824 | 250 |
| 249 | 3300037466 | Ga0395898_0301087 | Ga0395898_0301087_526_1341 | 250 |
| 250 | 3300046459 | Ga0495629_0090584 | Ga0495629_0090584_852_1661 | 250 |
| 251 | 3300046473 | Ga0495582_0047154 | Ga0495582_0047154_916_1725 | 250 |
| 252 | 3300046514 | Ga0495618_0022432 | Ga0495618_0022432_775_1584 | 250 |
| 253 | 3300046517 | Ga0495630_0009161 | Ga0495630_0009161_2411_3220 | 250 |
| 254 | 3300046531 | Ga0495665_0024607 | Ga0495665_0024607_2303_3112 | 250 |
| 255 | 3300046533 | Ga0495640_0034950 | Ga0495640_0034950_2627_3436 | 250 |
| 256 | 3300046535 | Ga0495586_0113726 | Ga0495586_0113726_187_996 | 250 |
| 257 | 3300046642 | Ga0495634_0028052 | Ga0495634_0028052_2925_3734 | 250 |
| 258 | 3300046680 | Ga0495646_0122121 | Ga0495646_0122121_220_1029 | 250 |
| 259 | 3300046681 | Ga0495647_0014550 | Ga0495647_0014550_438_1247 | 250 |
| 260 | 3300047319 | Ga0495674_0065765 | Ga0495674_0065765_1216_2025 | 250 |
| 261 | 3300047471 | Ga0495684_0129155 | Ga0495684_0129155_345_1154 | 250 |
| 262 | 3300047673 | Ga0495593_0011842 | Ga0495593_0011842_1799_2608 | 250 |
| 263 | 3300048905 | Ga0496102_0139137 | Ga0496102_0139137_584_1399 | 250 |
| 264 | 3300048911 | Ga0496108_0332159 | Ga0496108_0332159_318_1133 | 250 |
| 265 | 3300048916 | Ga0496113_0146263 | Ga0496113_0146263_553_1368 | 250 |
| 266 | 3300048929 | Ga0496126_0008651 | Ga0496126_0008651_9619_10437 | 250 |
| 267 | 3300048929 | Ga0496126_0314239 | Ga0496126_0314239_90_905 | 250 |
| 268 | 3300049588 | Ga0501072_0450046 | Ga0501072_0450046_234_992 | 250 |
| 269 | 3300050490 | nmdc:mga03n38_44831_c1 | nmdc:mga03n38_44831_c1_581_1396 | 250 |
| 270 | 3300050496 | nmdc:mga07m45_27743_c2 | nmdc:mga07m45_27743_c2_271_1086 | 250 |
| 271 | 3300053096 | Ga0500641_0013893 | Ga0500641_0013893_1300_2115 | 250 |
| 272 | 3300053737 | Ga0500601_000376 | Ga0500601_000376_6568_7380 | 250 |
| 273 | 3300005435 | Ga0070714_100286168 | Ga0070714_1002861682 | 251 |
| 274 | 3300005983 | Ga0081540_1007317 | Ga0081540_10073174 | 251 |
| 275 | 3300025254 | Ga0209148_1006433 | Ga0209148_10064332 | 251 |
| 276 | 3300025914 | Ga0207671_10227041 | Ga0207671_102270412 | 251 |
| 277 | 3300035120 | Ga0373957_0006595 | Ga0373957_0006595_1697_2515 | 251 |
| 278 | 3300035171 | Ga0373946_0012184 | Ga0373946_0012184_1671_2462 | 251 |
| 279 | 3300035725 | Ga0373947_0049579 | Ga0373947_0049579_184_975 | 251 |
| 280 | 3300046454 | Ga0495592_0056246 | Ga0495592_0056246_441_1259 | 251 |
| 281 | 3300046459 | Ga0495629_0235793 | Ga0495629_0235793_28_819 | 251 |
| 282 | 3300046459 | Ga0495629_0290744 | Ga0495629_0290744_28_846 | 251 |
| 283 | 3300046475 | Ga0495639_0210028 | Ga0495639_0210028_30_821 | 251 |
| 284 | 3300046476 | Ga0495662_0061292 | Ga0495662_0061292_918_1709 | 251 |
| 285 | 3300046511 | Ga0495608_0038589 | Ga0495608_0038589_1626_2444 | 251 |
| 286 | 3300046533 | Ga0495640_0027016 | Ga0495640_0027016_88_879 | 251 |
| 287 | 3300046533 | Ga0495640_0027770 | Ga0495640_0027770_435_1253 | 251 |
| 288 | 3300046536 | Ga0495587_0017460 | Ga0495587_0017460_1530_2348 | 251 |
| 289 | 3300046559 | Ga0495667_0232464 | Ga0495667_0232464_17_835 | 251 |
| 290 | 3300046690 | Ga0495624_0133449 | Ga0495624_0133449_530_1321 | 251 |
| 291 | 3300047319 | Ga0495674_0089282 | Ga0495674_0089282_475_1266 | 251 |
| 292 | 3300047673 | Ga0495593_0081112 | Ga0495593_0081112_542_1357 | 251 |
| 293 | 3300048911 | Ga0496108_0142462 | Ga0496108_0142462_1141_1920 | 251 |
| 294 | 3300048912 | Ga0496109_0251765 | Ga0496109_0251765_862_1641 | 251 |
| 295 | 3300049575 | Ga0501039_0073070 | Ga0501039_0073070_1528_2349 | 251 |
| 296 | 3300050509 | nmdc:mga0qj67_672648_c1 | nmdc:mga0qj67_672648_c1_38_814 | 251 |
| 297 | 3300053077 | Ga0495601_0017206 | Ga0495601_0017206_2020_2838 | 251 |
| 298 | 3300053117 | Ga0500593_000219 | Ga0500593_000219_15519_16355 | 251 |
| 299 | 3300031616 | Ga0307508_10000678 | Ga0307508_1000067817 | 252 |
| 300 | 3300047315 | Ga0495581_0226672 | Ga0495581_0226672_190_1005 | 252 |
| 301 | 3300048918 | Ga0496115_0123784 | Ga0496115_0123784_1146_1961 | 252 |
| 302 | 3300005445 | Ga0070708_100035864 | Ga0070708_1000358643 | 253 |
| 303 | 3300005459 | Ga0068867_100553608 | Ga0068867_1005536082 | 253 |
| 304 | 3300005468 | Ga0070707_100124412 | Ga0070707_1001244123 | 253 |
| 305 | 3300005518 | Ga0070699_100476325 | Ga0070699_1004763251 | 253 |
| 306 | 3300005614 | Ga0068856_100600332 | Ga0068856_1006003321 | 253 |
| 307 | 3300007788 | Ga0099795_10015182 | Ga0099795_100151821 | 253 |
| 308 | 3300025922 | Ga0207646_10066349 | Ga0207646_100663493 | 253 |
| 309 | 3300025941 | Ga0207711_10207936 | Ga0207711_102079362 | 253 |
| 310 | 3300026078 | Ga0207702_10472201 | Ga0207702_104722012 | 253 |
| 311 | 3300026089 | Ga0207648_10493606 | Ga0207648_104936062 | 253 |
| 312 | 3300028381 | Ga0268264_10379214 | Ga0268264_103792141 | 253 |
| 313 | 3300028794 | Ga0307515_10014717 | Ga0307515_1001471710 | 253 |
| 314 | 3300031616 | Ga0307508_10039526 | Ga0307508_100395264 | 253 |
| 315 | 3300035691 | Ga0373931_0025144 | Ga0373931_0025144_1061_1888 | 253 |
| 316 | 3300035695 | Ga0373927_0005666 | Ga0373927_0005666_1449_2264 | 253 |
| 317 | 3300037068 | Ga0373925_0738876 | Ga0373925_0738876_27_791 | 253 |
| 318 | 3300039062 | Ga0400483_002929 | Ga0400483_002929_441_1253 | 253 |
| 319 | 3300046455 | Ga0495603_0001950 | Ga0495603_0001950_2179_2994 | 253 |
| 320 | 3300046507 | Ga0495606_0001556 | Ga0495606_0001556_11568_12371 | 253 |
| 321 | 3300046674 | Ga0495588_0027689 | Ga0495588_0027689_620_1435 | 253 |
| 322 | 3300048903 | Ga0496100_0115117 | Ga0496100_0115117_816_1643 | 253 |
| 323 | 3300048905 | Ga0496102_0182319 | Ga0496102_0182319_1100_1927 | 253 |
| 324 | 3300048908 | Ga0496105_0132165 | Ga0496105_0132165_94_921 | 253 |
| 325 | 3300048910 | Ga0496107_0092552 | Ga0496107_0092552_726_1553 | 253 |
| 326 | 3300048914 | Ga0496111_0249000 | Ga0496111_0249000_116_943 | 253 |
| 327 | 3300048915 | Ga0496112_0000054 | Ga0496112_0000054_36255_37070 | 253 |
| 328 | 3300048915 | Ga0496112_0027470 | Ga0496112_0027470_3673_4500 | 253 |
| 329 | 3300048917 | Ga0496114_0041804 | Ga0496114_0041804_2059_2886 | 253 |
| 330 | 3300049582 | Ga0501048_0242636 | Ga0501048_0242636_429_1250 | 253 |
| 331 | 3300049589 | Ga0501073_0402980 | Ga0501073_0402980_22_801 | 253 |
| 332 | 3300050514 | nmdc:mga08x19_297132_c1 | nmdc:mga08x19_297132_c1_201_1016 | 253 |
| 333 | 3300006941 | Ga0099825_1018667 | Ga0099825_10186673 | 254 |
| 334 | 3300006942 | Ga0099824_1022736 | Ga0099824_10227364 | 254 |
| 335 | 3300006943 | Ga0099822_1008903 | Ga0099822_100890311 | 254 |
| 336 | 3300007788 | Ga0099795_10004750 | Ga0099795_100047502 | 254 |
| 337 | 3300025909 | Ga0207705_10241212 | Ga0207705_102412122 | 254 |
| 338 | 3300027357 | Ga0209589_1000005 | Ga0209589_100000592 | 254 |
| 339 | 3300027361 | Ga0209489_100005 | Ga0209489_10000592 | 254 |
| 340 | 3300027363 | Ga0209700_100006 | Ga0209700_10000692 | 254 |
| 341 | 3300005578 | Ga0068854_100340505 | Ga0068854_1003405051 | 255 |
| 342 | 3300006178 | Ga0075367_10002644 | Ga0075367_100026448 | 255 |
| 343 | 3300025981 | Ga0207640_10284963 | Ga0207640_102849632 | 255 |
| 344 | 3300047320 | Ga0495672_0062935 | Ga0495672_0062935_625_1440 | 256 |
| 345 | 3300049575 | Ga0501039_0476799 | Ga0501039_0476799_59_874 | 256 |
| 346 | 3300049588 | Ga0501072_0005916 | Ga0501072_0005916_6963_7766 | 256 |
| 347 | 3300054114 | Ga0501084_0186200 | Ga0501084_0186200_856_1659 | 256 |
| 348 | 3300005436 | Ga0070713_100544251 | Ga0070713_1005442512 | 257 |
| 349 | 3300025928 | Ga0207700_10254620 | Ga0207700_102546202 | 257 |
| 350 | 3300031730 | Ga0307516_10059140 | Ga0307516_100591403 | 257 |
| 351 | 3300033180 | Ga0307510_10170849 | Ga0307510_101708492 | 257 |
| 352 | 3300048924 | Ga0496121_0038194 | Ga0496121_0038194_2547_3362 | 257 |
| 353 | 3300048927 | Ga0496124_0000063 | Ga0496124_0000063_94995_95807 | 257 |
| 354 | 3300005336 | Ga0070680_100379811 | Ga0070680_1003798112 | 258 |
| 355 | 3300005467 | Ga0070706_100452508 | Ga0070706_1004525082 | 258 |
| 356 | 3300025917 | Ga0207660_10390960 | Ga0207660_103909601 | 258 |
| 357 | 3300053177 | Ga0500636_0033858 | Ga0500636_0033858_1466_2272 | 258 |
| 358 | 3300005336 | Ga0070680_100219420 | Ga0070680_1002194203 | 259 |
| 359 | 3300005344 | Ga0070661_100146659 | Ga0070661_1001466592 | 259 |
| 360 | 3300009093 | Ga0105240_10430415 | Ga0105240_104304152 | 259 |
| 361 | 3300009093 | Ga0105240_10637233 | Ga0105240_106372332 | 259 |
| 362 | 3300009176 | Ga0105242_10856821 | Ga0105242_108568211 | 259 |
| 363 | 3300013104 | Ga0157370_10168250 | Ga0157370_101682502 | 259 |
| 364 | 3300013105 | Ga0157369_10423854 | Ga0157369_104238542 | 259 |
| 365 | 3300014325 | Ga0163163_10431769 | Ga0163163_104317692 | 259 |
| 366 | 3300025913 | Ga0207695_10071853 | Ga0207695_100718534 | 259 |
| 367 | 3300025917 | Ga0207660_10238009 | Ga0207660_102380092 | 259 |
| 368 | 3300025981 | Ga0207640_10416715 | Ga0207640_104167152 | 259 |
| 369 | 3300026041 | Ga0207639_10468140 | Ga0207639_104681402 | 259 |
| 370 | 3300028786 | Ga0307517_10000098 | Ga0307517_1000009842 | 259 |
| 371 | 3300031249 | Ga0265339_10100124 | Ga0265339_101001242 | 259 |
| 372 | 3300037068 | Ga0373925_0053426 | Ga0373925_0053426_1793_2572 | 259 |
| 373 | 3300037418 | Ga0395900_0092633 | Ga0395900_0092633_2252_3061 | 259 |
| 374 | 3300037418 | Ga0395900_0310786 | Ga0395900_0310786_567_1379 | 259 |
| 375 | 3300037466 | Ga0395898_0253720 | Ga0395898_0253720_439_1248 | 259 |
| 376 | 3300038443 | Ga0395901_0015664 | Ga0395901_0015664_6109_6918 | 259 |
| 377 | 3300038443 | Ga0395901_0743728 | Ga0395901_0743728_129_941 | 259 |
| 378 | 3300046459 | Ga0495629_0280188 | Ga0495629_0280188_32_811 | 259 |
| 379 | 3300046463 | Ga0495653_0076078 | Ga0495653_0076078_1685_2464 | 259 |
| 380 | 3300046476 | Ga0495662_0045146 | Ga0495662_0045146_1034_1813 | 259 |
| 381 | 3300046517 | Ga0495630_0021273 | Ga0495630_0021273_2907_3686 | 259 |
| 382 | 3300046531 | Ga0495665_0282738 | Ga0495665_0282738_49_828 | 259 |
| 383 | 3300046642 | Ga0495634_0010893 | Ga0495634_0010893_697_1476 | 259 |
| 384 | 3300046675 | Ga0495657_0323267 | Ga0495657_0323267_127_906 | 259 |
| 385 | 3300046680 | Ga0495646_0203884 | Ga0495646_0203884_159_938 | 259 |
| 386 | 3300046689 | Ga0495613_0210598 | Ga0495613_0210598_542_1321 | 259 |
| 387 | 3300046690 | Ga0495624_0079111 | Ga0495624_0079111_1094_1873 | 259 |
| 388 | 3300053077 | Ga0495601_0000874 | Ga0495601_0000874_8129_8908 | 259 |
| 389 | 3300036401 | Ga0373937_0001468 | Ga0373937_0001468_11343_12131 | 260 |
| 390 | 3300039450 | Ga0436363_0139600 | Ga0436363_0139600_109_897 | 260 |
| 391 | 3300046517 | Ga0495630_0083415 | Ga0495630_0083415_67_882 | 260 |
| 392 | 3300046689 | Ga0495613_0045678 | Ga0495613_0045678_2133_2921 | 260 |
| 393 | iso_pu_bacteria | 2508501050 | 2508735897 | 260 |
| 394 | iso_pu_bacteria | 2508501114 | 2509078280 | 260 |
| 395 | iso_pu_bacteria | 2835312727 | 2835318589 | 260 |
| 396 | 3300031238 | Ga0265332_10000732 | Ga0265332_1000073210 | 261 |
| 397 | 3300031242 | Ga0265329_10018100 | Ga0265329_100181003 | 261 |
| 398 | 3300031249 | Ga0265339_10001116 | Ga0265339_100011169 | 261 |
| 399 | 3300031711 | Ga0265314_10057291 | Ga0265314_100572912 | 261 |
| 400 | 3300031712 | Ga0265342_10000258 | Ga0265342_1000025832 | 261 |
| 401 | 3300039062 | Ga0400483_269252 | Ga0400483_269252_1143_1931 | 261 |
| 402 | iso_pu_bacteria | 8054563764 | 8054568926 | 261 |
| 403 | 3300006847 | Ga0075431_100663506 | Ga0075431_1006635061 | 262 |
| 404 | 3300049593 | Ga0501077_0046104 | Ga0501077_0046104_493_1293 | 262 |
| 405 | 3300050510 | nmdc:mga06r32_42186_c1 | nmdc:mga06r32_42186_c1_170_982 | 262 |
| 406 | 3300060353 | Ga0501082_0258758 | Ga0501082_0258758_491_1291 | 262 |
| 407 | iso_pu_bacteria | 2773857925 | 2774873991 | 262 |
| 408 | 3300005327 | Ga0070658_10100659 | Ga0070658_101006592 | 263 |
| 409 | iso_pu_bacteria | 2775506901 | 2776259532 | 263 |
| 410 | iso_pu_bacteria | 2882456835 | 2882463206 | 263 |
| 411 | iso_pu_bacteria | 2884298095 | 2884299784 | 263 |
| 412 | iso_pu_bacteria | 2894232714 | 2894238321 | 263 |
| 413 | 3300005548 | Ga0070665_100564277 | Ga0070665_1005642772 | 264 |
| 414 | 3300031595 | Ga0265313_10061524 | Ga0265313_100615242 | 264 |
| 415 | 3300031727 | Ga0316576_10074988 | Ga0316576_100749882 | 264 |
| 416 | 3300035398 | Ga0316574_0001652 | Ga0316574_0001652_9733_10530 | 264 |
| 417 | 3300050492 | nmdc:mga0yw44_169110_c1 | nmdc:mga0yw44_169110_c1_87_881 | 264 |
| 418 | 3300005329 | Ga0070683_100282171 | Ga0070683_1002821711 | 265 |
| 419 | 3300009093 | Ga0105240_10182322 | Ga0105240_101823222 | 265 |
| 420 | 3300009147 | Ga0114129_10022352 | Ga0114129_100223525 | 265 |
| 421 | 3300009551 | Ga0105238_10057553 | Ga0105238_100575533 | 265 |
| 422 | 3300025913 | Ga0207695_10256868 | Ga0207695_102568682 | 265 |
| 423 | 3300025924 | Ga0207694_10259540 | Ga0207694_102595401 | 265 |
| 424 | 3300037853 | Ga0436364_1540260 | Ga0436364_1540260_552_1355 | 265 |
| 425 | 3300050507 | nmdc:mga05p37_15913_c1 | nmdc:mga05p37_15913_c1_3926_4729 | 265 |
| 426 | 3300005577 | Ga0068857_100131263 | Ga0068857_1001312633 | 266 |
| 427 | 3300005617 | Ga0068859_100254302 | Ga0068859_1002543022 | 266 |
| 428 | 3300005617 | Ga0068859_100304399 | Ga0068859_1003043992 | 266 |
| 429 | 3300005618 | Ga0068864_100285926 | Ga0068864_1002859263 | 266 |
| 430 | 3300005843 | Ga0068860_100787551 | Ga0068860_1007875511 | 266 |
| 431 | 3300005983 | Ga0081540_1067547 | Ga0081540_10675472 | 266 |
| 432 | 3300006931 | Ga0097620_100254282 | Ga0097620_1002542822 | 266 |
| 433 | 3300006931 | Ga0097620_100304415 | Ga0097620_1003044152 | 266 |
| 434 | 3300014325 | Ga0163163_10599297 | Ga0163163_105992972 | 266 |
| 435 | 3300025901 | Ga0207688_10016567 | Ga0207688_100165674 | 266 |
| 436 | 3300025918 | Ga0207662_10074036 | Ga0207662_100740363 | 266 |
| 437 | 3300025942 | Ga0207689_10024108 | Ga0207689_100241082 | 266 |
| 438 | 3300026075 | Ga0207708_10035860 | Ga0207708_100358603 | 266 |
| 439 | 3300026095 | Ga0207676_10230438 | Ga0207676_102304383 | 266 |
| 440 | 3300028381 | Ga0268264_10698987 | Ga0268264_106989872 | 266 |
| 441 | 3300031852 | Ga0307410_10064480 | Ga0307410_100644802 | 266 |
| 442 | 3300032004 | Ga0307414_10365783 | Ga0307414_103657832 | 266 |
| 443 | 3300032005 | Ga0307411_10211331 | Ga0307411_102113312 | 266 |
| 444 | 3300032126 | Ga0307415_100448708 | Ga0307415_1004487082 | 266 |
| 445 | 3300035086 | Ga0373934_0089024 | Ga0373934_0089024_365_1165 | 266 |
| 446 | 3300035113 | Ga0373936_0050899 | Ga0373936_0050899_398_1198 | 266 |
| 447 | 3300035116 | Ga0373945_0068794 | Ga0373945_0068794_342_1142 | 266 |
| 448 | 3300035119 | Ga0373956_0109121 | Ga0373956_0109121_243_1043 | 266 |
| 449 | 3300035170 | Ga0373943_0054164 | Ga0373943_0054164_883_1683 | 266 |
| 450 | 3300035171 | Ga0373946_0120796 | Ga0373946_0120796_252_1052 | 266 |
| 451 | 3300035172 | Ga0373955_0001596 | Ga0373955_0001596_7196_7996 | 266 |
| 452 | 3300035410 | Ga0373924_0174019 | Ga0373924_0174019_73_873 | 266 |
| 453 | 3300035695 | Ga0373927_0010487 | Ga0373927_0010487_4178_4978 | 266 |
| 454 | 3300035724 | Ga0373933_0000812 | Ga0373933_0000812_11515_12315 | 266 |
| 455 | 3300036401 | Ga0373937_0001031 | Ga0373937_0001031_10149_10949 | 266 |
| 456 | 3300037471 | Ga0395905_0137774 | Ga0395905_0137774_999_1802 | 266 |
| 457 | 3300039437 | Ga0436365_0123947 | Ga0436365_0123947_59_859 | 266 |
| 458 | 3300046454 | Ga0495592_0005046 | Ga0495592_0005046_2902_3702 | 266 |
| 459 | 3300046455 | Ga0495603_0120761 | Ga0495603_0120761_373_1173 | 266 |
| 460 | 3300046459 | Ga0495629_0002766 | Ga0495629_0002766_6894_7694 | 266 |
| 461 | 3300046462 | Ga0495651_0020707 | Ga0495651_0020707_2050_2850 | 266 |
| 462 | 3300046463 | Ga0495653_0002068 | Ga0495653_0002068_4739_5539 | 266 |
| 463 | 3300046474 | Ga0495605_0032101 | Ga0495605_0032101_827_1636 | 266 |
| 464 | 3300046477 | Ga0495664_0048838 | Ga0495664_0048838_1082_1882 | 266 |
| 465 | 3300046511 | Ga0495608_0001557 | Ga0495608_0001557_10349_11149 | 266 |
| 466 | 3300046514 | Ga0495618_0000576 | Ga0495618_0000576_14974_15774 | 266 |
| 467 | 3300046516 | Ga0495628_0011632 | Ga0495628_0011632_2061_2861 | 266 |
| 468 | 3300046517 | Ga0495630_0022700 | Ga0495630_0022700_2886_3686 | 266 |
| 469 | 3300046529 | Ga0495652_0003106 | Ga0495652_0003106_10256_11056 | 266 |
| 470 | 3300046533 | Ga0495640_0003344 | Ga0495640_0003344_181_981 | 266 |
| 471 | 3300046536 | Ga0495587_0000308 | Ga0495587_0000308_10325_11125 | 266 |
| 472 | 3300046559 | Ga0495667_0001377 | Ga0495667_0001377_1048_1848 | 266 |
| 473 | 3300046642 | Ga0495634_0010577 | Ga0495634_0010577_1655_2455 | 266 |
| 474 | 3300046663 | Ga0495635_0004336 | Ga0495635_0004336_3740_4540 | 266 |
| 475 | 3300046675 | Ga0495657_0021011 | Ga0495657_0021011_3839_4639 | 266 |
| 476 | 3300046678 | Ga0495599_0002032 | Ga0495599_0002032_5593_6393 | 266 |
| 477 | 3300046679 | Ga0495623_0000611 | Ga0495623_0000611_10321_11121 | 266 |
| 478 | 3300046683 | Ga0495658_0039793 | Ga0495658_0039793_1120_1920 | 266 |
| 479 | 3300046689 | Ga0495613_0027251 | Ga0495613_0027251_1786_2586 | 266 |
| 480 | 3300046809 | Ga0495600_0000879 | Ga0495600_0000879_8250_9050 | 266 |
| 481 | 3300047315 | Ga0495581_0156834 | Ga0495581_0156834_186_986 | 266 |
| 482 | 3300047317 | Ga0495604_0000543 | Ga0495604_0000543_8618_9418 | 266 |
| 483 | 3300047318 | Ga0495636_0038748 | Ga0495636_0038748_646_1455 | 266 |
| 484 | 3300047319 | Ga0495674_0026311 | Ga0495674_0026311_3462_4262 | 266 |
| 485 | 3300047322 | Ga0495680_0002855 | Ga0495680_0002855_6462_7262 | 266 |
| 486 | 3300047444 | Ga0495675_0005227 | Ga0495675_0005227_72_872 | 266 |
| 487 | 3300047471 | Ga0495684_0011051 | Ga0495684_0011051_1575_2375 | 266 |
| 488 | 3300047673 | Ga0495593_0029014 | Ga0495593_0029014_1141_1941 | 266 |
| 489 | 3300049671 | Ga0501238_015525 | Ga0501238_015525_109_912 | 266 |
| 490 | 3300053078 | Ga0495612_0000364 | Ga0495612_0000364_10337_11137 | 266 |
| 491 | 3300053084 | Ga0495595_0000179 | Ga0495595_0000179_14136_14936 | 266 |
| 492 | 3300053085 | Ga0495619_0001264 | Ga0495619_0001264_14094_14894 | 266 |
| 493 | iso_pu_bacteria | 2643221568 | 2643856336 | 266 |
| 494 | iso_pu_bacteria | 2906626472 | 2906626775 | 266 |
| 495 | iso_pu_bacteria | 2919166419 | 2919166897 | 266 |
| 496 | iso_pu_bacteria | 8006926726 | 8006931671 | 266 |
| 497 | iso_pu_bacteria | 8016530956 | 8016538098 | 266 |
| 498 | iso_pu_bacteria | 8016583857 | 8016588580 | 266 |
| 499 | iso_pu_bacteria | 8054460903 | 8054461323 | 266 |
| 500 | 3300005293 | Ga0065715_10298573 | Ga0065715_102985731 | 267 |
| 501 | 3300005333 | Ga0070677_10011215 | Ga0070677_100112152 | 267 |
| 502 | 3300005335 | Ga0070666_10054161 | Ga0070666_100541612 | 267 |
| 503 | 3300005356 | Ga0070674_100043210 | Ga0070674_1000432102 | 267 |
| 504 | 3300005364 | Ga0070673_100034663 | Ga0070673_1000346633 | 267 |
| 505 | 3300005365 | Ga0070688_100060526 | Ga0070688_1000605262 | 267 |
| 506 | 3300005367 | Ga0070667_100259511 | Ga0070667_1002595111 | 267 |
| 507 | 3300005436 | Ga0070713_100119459 | Ga0070713_1001194592 | 267 |
| 508 | 3300005438 | Ga0070701_10271095 | Ga0070701_102710952 | 267 |
| 509 | 3300005455 | Ga0070663_100078843 | Ga0070663_1000788432 | 267 |
| 510 | 3300005456 | Ga0070678_100036362 | Ga0070678_1000363622 | 267 |
| 511 | 3300005459 | Ga0068867_100059534 | Ga0068867_1000595343 | 267 |
| 512 | 3300005466 | Ga0070685_10045378 | Ga0070685_100453782 | 267 |
| 513 | 3300005548 | Ga0070665_100372631 | Ga0070665_1003726312 | 267 |
| 514 | 3300005617 | Ga0068859_100223991 | Ga0068859_1002239912 | 267 |
| 515 | 3300006048 | Ga0075363_100005097 | Ga0075363_1000050973 | 267 |
| 516 | 3300006177 | Ga0075362_10002727 | Ga0075362_100027276 | 267 |
| 517 | 3300006186 | Ga0075369_10004550 | Ga0075369_100045503 | 267 |
| 518 | 3300006195 | Ga0075366_10005909 | Ga0075366_100059093 | 267 |
| 519 | 3300006881 | Ga0068865_100069090 | Ga0068865_1000690902 | 267 |
| 520 | 3300006931 | Ga0097620_100223999 | Ga0097620_1002239992 | 267 |
| 521 | 3300009094 | Ga0111539_10856662 | Ga0111539_108566621 | 267 |
| 522 | 3300010159 | Ga0099796_10136819 | Ga0099796_101368192 | 267 |
| 523 | 3300013296 | Ga0157374_10760473 | Ga0157374_107604731 | 267 |
| 524 | 3300017792 | Ga0163161_10382977 | Ga0163161_103829771 | 267 |
| 525 | 3300021384 | Ga0213876_10175926 | Ga0213876_101759261 | 267 |
| 526 | 3300025295 | Ga0209564_1000946 | Ga0209564_10009466 | 267 |
| 527 | 3300025893 | Ga0207682_10016879 | Ga0207682_100168792 | 267 |
| 528 | 3300025901 | Ga0207688_10051663 | Ga0207688_100516632 | 267 |
| 529 | 3300025907 | Ga0207645_10027337 | Ga0207645_100273374 | 267 |
| 530 | 3300025914 | Ga0207671_10052456 | Ga0207671_100524562 | 267 |
| 531 | 3300025923 | Ga0207681_10033060 | Ga0207681_100330605 | 267 |
| 532 | 3300025925 | Ga0207650_10207973 | Ga0207650_102079732 | 267 |
| 533 | 3300025928 | Ga0207700_10204367 | Ga0207700_102043672 | 267 |
| 534 | 3300025928 | Ga0207700_10260238 | Ga0207700_102602381 | 267 |
| 535 | 3300025937 | Ga0207669_10010435 | Ga0207669_100104351 | 267 |
| 536 | 3300025940 | Ga0207691_10006938 | Ga0207691_100069386 | 267 |
| 537 | 3300025942 | Ga0207689_10176893 | Ga0207689_101768932 | 267 |
| 538 | 3300026067 | Ga0207678_10025245 | Ga0207678_100252454 | 267 |
| 539 | 3300026078 | Ga0207702_10000287 | Ga0207702_1000028741 | 267 |
| 540 | 3300026089 | Ga0207648_10015927 | Ga0207648_100159276 | 267 |
| 541 | 3300026118 | Ga0207675_100179037 | Ga0207675_1001790372 | 267 |
| 542 | 3300026121 | Ga0207683_10000765 | Ga0207683_100007651 | 267 |
| 543 | 3300026121 | Ga0207683_10208740 | Ga0207683_102087402 | 267 |
| 544 | 3300027671 | Ga0209588_1001366 | Ga0209588_10013663 | 267 |
| 545 | 3300027866 | Ga0209813_10079151 | Ga0209813_100791512 | 267 |
| 546 | 3300028023 | Ga0265357_1007508 | Ga0265357_10075082 | 267 |
| 547 | 3300030763 | Ga0265763_1000076 | Ga0265763_10000765 | 267 |
| 548 | 3300031235 | Ga0265330_10016470 | Ga0265330_100164704 | 267 |
| 549 | 3300031241 | Ga0265325_10007210 | Ga0265325_100072104 | 267 |
| 550 | 3300031250 | Ga0265331_10004487 | Ga0265331_100044877 | 267 |
| 551 | 3300031711 | Ga0265314_10245674 | Ga0265314_102456741 | 267 |
| 552 | 3300035172 | Ga0373955_0068848 | Ga0373955_0068848_487_1302 | 267 |
| 553 | 3300039437 | Ga0436365_0821912 | Ga0436365_0821912_682_1491 | 267 |
| 554 | 3300039450 | Ga0436363_1344272 | Ga0436363_1344272_978_1781 | 267 |
| 555 | 3300039450 | Ga0436363_1481077 | Ga0436363_1481077_70_882 | 267 |
| 556 | 3300044694 | Ga0466963_0183016 | Ga0466963_0183016_23_841 | 267 |
| 557 | 3300045976 | Ga0466967_0067011 | Ga0466967_0067011_672_1490 | 267 |
| 558 | 3300046457 | Ga0495590_0068736 | Ga0495590_0068736_304_1116 | 267 |
| 559 | 3300046476 | Ga0495662_0084410 | Ga0495662_0084410_330_1139 | 267 |
| 560 | 3300046491 | Ga0495584_0014850 | Ga0495584_0014850_2726_3538 | 267 |
| 561 | 3300046501 | Ga0495607_0004985 | Ga0495607_0004985_3035_3850 | 267 |
| 562 | 3300046507 | Ga0495606_0021576 | Ga0495606_0021576_911_1726 | 267 |
| 563 | 3300046512 | Ga0495610_0007802 | Ga0495610_0007802_3010_3825 | 267 |
| 564 | 3300046524 | Ga0495648_0000576 | Ga0495648_0000576_4014_4829 | 267 |
| 565 | 3300046524 | Ga0495648_0029520 | Ga0495648_0029520_583_1398 | 267 |
| 566 | 3300046524 | Ga0495648_0061655 | Ga0495648_0061655_1207_2022 | 267 |
| 567 | 3300046557 | Ga0495622_0023452 | Ga0495622_0023452_1954_2769 | 267 |
| 568 | 3300046616 | Ga0495668_0070492 | Ga0495668_0070492_99_914 | 267 |
| 569 | 3300046648 | Ga0495611_0066054 | Ga0495611_0066054_155_967 | 267 |
| 570 | 3300046660 | Ga0495625_0093740 | Ga0495625_0093740_74_889 | 267 |
| 571 | 3300046660 | Ga0495625_0161173 | Ga0495625_0161173_161_970 | 267 |
| 572 | 3300046665 | Ga0495661_0007704 | Ga0495661_0007704_1535_2350 | 267 |
| 573 | 3300046691 | Ga0495670_0028793 | Ga0495670_0028793_1670_2485 | 267 |
| 574 | 3300046692 | Ga0495671_0022968 | Ga0495671_0022968_1727_2542 | 267 |
| 575 | 3300047317 | Ga0495604_0256920 | Ga0495604_0256920_125_940 | 267 |
| 576 | 3300047472 | Ga0495686_0010264 | Ga0495686_0010264_635_1450 | 267 |
| 577 | 3300048904 | Ga0496101_0042884 | Ga0496101_0042884_480_1295 | 267 |
| 578 | 3300048908 | Ga0496105_0096402 | Ga0496105_0096402_969_1784 | 267 |
| 579 | 3300048909 | Ga0496106_0033502 | Ga0496106_0033502_2224_3039 | 267 |
| 580 | 3300048910 | Ga0496107_0000607 | Ga0496107_0000607_11174_11989 | 267 |
| 581 | 3300048911 | Ga0496108_0001175 | Ga0496108_0001175_9816_10631 | 267 |
| 582 | 3300048912 | Ga0496109_0001679 | Ga0496109_0001679_10536_11351 | 267 |
| 583 | 3300048913 | Ga0496110_0087227 | Ga0496110_0087227_173_988 | 267 |
| 584 | 3300048919 | Ga0496116_0005626 | Ga0496116_0005626_6323_7138 | 267 |
| 585 | 3300048921 | Ga0496118_0032852 | Ga0496118_0032852_93_908 | 267 |
| 586 | 3300048921 | Ga0496118_0047805 | Ga0496118_0047805_1246_2061 | 267 |
| 587 | 3300048921 | Ga0496118_0110299 | Ga0496118_0110299_501_1316 | 267 |
| 588 | 3300048924 | Ga0496121_0032975 | Ga0496121_0032975_869_1684 | 267 |
| 589 | 3300048924 | Ga0496121_0036046 | Ga0496121_0036046_620_1435 | 267 |
| 590 | 3300048925 | Ga0496122_0052729 | Ga0496122_0052729_201_1016 | 267 |
| 591 | 3300048925 | Ga0496122_0177236 | Ga0496122_0177236_284_1099 | 267 |
| 592 | 3300048926 | Ga0496123_0020343 | Ga0496123_0020343_582_1397 | 267 |
| 593 | 3300048926 | Ga0496123_0120273 | Ga0496123_0120273_521_1336 | 267 |
| 594 | 3300048927 | Ga0496124_0157963 | Ga0496124_0157963_672_1487 | 267 |
| 595 | 3300048927 | Ga0496124_0254054 | Ga0496124_0254054_189_1004 | 267 |
| 596 | 3300048928 | Ga0496125_0002194 | Ga0496125_0002194_4946_5761 | 267 |
| 597 | 3300048928 | Ga0496125_0025833 | Ga0496125_0025833_702_1517 | 267 |
| 598 | 3300048929 | Ga0496126_0014882 | Ga0496126_0014882_5051_5866 | 267 |
| 599 | 3300048929 | Ga0496126_0014993 | Ga0496126_0014993_2020_2835 | 267 |
| 600 | 3300049587 | Ga0501071_0354341 | Ga0501071_0354341_291_1103 | 267 |
| 601 | 3300049743 | Ga0501081_0321267 | Ga0501081_0321267_255_1067 | 267 |
| 602 | 3300050489 | nmdc:mga03683_8077_c1 | nmdc:mga03683_8077_c1_401_1210 | 267 |
| 603 | 3300050490 | nmdc:mga03n38_29979_c1 | nmdc:mga03n38_29979_c1_470_1279 | 267 |
| 604 | 3300050491 | nmdc:mga00v17_59102_c1 | nmdc:mga00v17_59102_c1_219_1028 | 267 |
| 605 | 3300050492 | nmdc:mga0yw44_138665_c1 | nmdc:mga0yw44_138665_c1_249_1064 | 267 |
| 606 | 3300050511 | nmdc:mga08y16_313148_c1 | nmdc:mga08y16_313148_c1_104_913 | 267 |
| 607 | 3300050516 | nmdc:mga0sz30_4527_c1 | nmdc:mga0sz30_4527_c1_1221_2036 | 267 |
| 608 | 3300053093 | Ga0500651_0133295 | Ga0500651_0133295_142_951 | 267 |
| 609 | 3300053094 | Ga0500566_0004256 | Ga0500566_0004256_2980_3795 | 267 |
| 610 | 3300053096 | Ga0500641_0001545 | Ga0500641_0001545_478_1293 | 267 |
| 611 | 3300053098 | Ga0500650_0000379 | Ga0500650_0000379_3162_3977 | 267 |
| 612 | 3300053098 | Ga0500650_0183618 | Ga0500650_0183618_98_907 | 267 |
| 613 | 3300053104 | Ga0500556_0000045 | Ga0500556_0000045_75353_76168 | 267 |
| 614 | 3300053109 | Ga0500569_020674 | Ga0500569_020674_518_1333 | 267 |
| 615 | 3300053116 | Ga0500592_002040 | Ga0500592_002040_1627_2442 | 267 |
| 616 | 3300053121 | Ga0500607_150493 | Ga0500607_150493_217_1032 | 267 |
| 617 | 3300053122 | Ga0500608_000919 | Ga0500608_000919_7585_8400 | 267 |
| 618 | 3300053125 | Ga0500618_001886 | Ga0500618_001886_5710_6525 | 267 |
| 619 | 3300053130 | Ga0500642_0000024 | Ga0500642_0000024_79263_80078 | 267 |
| 620 | 3300053130 | Ga0500642_0057811 | Ga0500642_0057811_335_1144 | 267 |
| 621 | 3300053131 | Ga0500652_000356 | Ga0500652_000356_4570_5385 | 267 |
| 622 | 3300053136 | Ga0500559_0000414 | Ga0500559_0000414_28221_29036 | 267 |
| 623 | 3300053139 | Ga0500568_0000456 | Ga0500568_0000456_16884_17699 | 267 |
| 624 | 3300053144 | Ga0500585_105683 | Ga0500585_105683_179_991 | 267 |
| 625 | 3300053145 | Ga0500586_000524 | Ga0500586_000524_2474_3289 | 267 |
| 626 | 3300053151 | Ga0500604_0001142 | Ga0500604_0001142_2147_2962 | 267 |
| 627 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_78262_79077 | 267 |
| 628 | 3300053155 | Ga0500620_006855 | Ga0500620_006855_167_979 | 267 |
| 629 | 3300053156 | Ga0500622_0000714 | Ga0500622_0000714_14825_15640 | 267 |
| 630 | 3300053158 | Ga0500627_0021274 | Ga0500627_0021274_928_1743 | 267 |
| 631 | 3300053158 | Ga0500627_0059682 | Ga0500627_0059682_171_986 | 267 |
| 632 | 3300053160 | Ga0500633_0025699 | Ga0500633_0025699_812_1627 | 267 |
| 633 | 3300053177 | Ga0500636_0001447 | Ga0500636_0001447_4733_5548 | 267 |
| 634 | iso_pu_bacteria | 2602042107 | 2603860510 | 267 |
| 635 | iso_pu_bacteria | 2643221558 | 2643812914 | 267 |
| 636 | iso_pu_bacteria | 2643221651 | 2644287173 | 267 |
| 637 | iso_pu_bacteria | 2721755755 | 2723848758 | 267 |
| 638 | iso_pu_bacteria | 2841840854 | 2841843226 | 267 |
| 639 | iso_pu_bacteria | 2842140634 | 2842143008 | 267 |
| 640 | iso_pu_bacteria | 2857524615 | 2857525461 | 267 |
| 641 | iso_pu_bacteria | 2893066018 | 2893070888 | 267 |
| 642 | iso_pu_bacteria | 2904690495 | 2904691669 | 267 |
| 643 | iso_pu_bacteria | 2906635258 | 2906643158 | 267 |
| 644 | iso_pu_bacteria | 2906660503 | 2906664854 | 267 |
| 645 | iso_pu_bacteria | 2908739725 | 2908745791 | 267 |
| 646 | iso_pu_bacteria | 2908756301 | 2908763815 | 267 |
| 647 | iso_pu_bacteria | 2919073203 | 2919074729 | 267 |
| 648 | iso_pu_bacteria | 2919171160 | 2919172087 | 267 |
| 649 | iso_pu_bacteria | 2935630451 | 2935630686 | 267 |
| 650 | iso_pu_bacteria | 2935777560 | 2935782520 | 267 |
| 651 | iso_pu_bacteria | 2941507105 | 2941507338 | 267 |
| 652 | iso_pu_bacteria | 2941515067 | 2941515765 | 267 |
| 653 | iso_pu_bacteria | 2941523033 | 2941523527 | 267 |
| 654 | iso_pu_bacteria | 8006994254 | 8006998984 | 267 |
| 655 | iso_pu_bacteria | 8016603502 | 8016605000 | 267 |
| 656 | iso_pu_bacteria | 8016613128 | 8016620010 | 267 |
| 657 | iso_pu_bacteria | 8019538911 | 8019539394 | 267 |
| 658 | iso_pu_bacteria | 8056681323 | 8056681794 | 267 |
| 659 | 3300005471 | Ga0070698_100523884 | Ga0070698_1005238841 | 268 |
| 660 | 3300006028 | Ga0070717_10250152 | Ga0070717_102501522 | 268 |
| 661 | 3300006852 | Ga0075433_10041214 | Ga0075433_100412144 | 268 |
| 662 | 3300009094 | Ga0111539_10023762 | Ga0111539_100237621 | 268 |
| 663 | 3300014968 | Ga0157379_10033679 | Ga0157379_100336794 | 268 |
| 664 | 3300028800 | Ga0265338_10088839 | Ga0265338_100888392 | 268 |
| 665 | 3300031241 | Ga0265325_10018614 | Ga0265325_100186143 | 268 |
| 666 | 3300031712 | Ga0265342_10054358 | Ga0265342_100543582 | 268 |
| 667 | 3300035083 | Ga0373926_0078474 | Ga0373926_0078474_191_1003 | 268 |
| 668 | 3300035171 | Ga0373946_0046527 | Ga0373946_0046527_24_836 | 268 |
| 669 | 3300035692 | Ga0373935_0011391 | Ga0373935_0011391_910_1722 | 268 |
| 670 | 3300035695 | Ga0373927_0074843 | Ga0373927_0074843_631_1443 | 268 |
| 671 | 3300035695 | Ga0373927_0147001 | Ga0373927_0147001_32_847 | 268 |
| 672 | 3300037068 | Ga0373925_0088158 | Ga0373925_0088158_684_1496 | 268 |
| 673 | 3300046454 | Ga0495592_0075805 | Ga0495592_0075805_1429_2241 | 268 |
| 674 | 3300046463 | Ga0495653_0058358 | Ga0495653_0058358_847_1659 | 268 |
| 675 | 3300046475 | Ga0495639_0038216 | Ga0495639_0038216_640_1452 | 268 |
| 676 | 3300046476 | Ga0495662_0016778 | Ga0495662_0016778_1827_2639 | 268 |
| 677 | 3300046477 | Ga0495664_0000214 | Ga0495664_0000214_7544_8356 | 268 |
| 678 | 3300046514 | Ga0495618_0014304 | Ga0495618_0014304_3425_4237 | 268 |
| 679 | 3300046517 | Ga0495630_0021118 | Ga0495630_0021118_1274_2086 | 268 |
| 680 | 3300046529 | Ga0495652_0043797 | Ga0495652_0043797_1347_2159 | 268 |
| 681 | 3300046531 | Ga0495665_0076829 | Ga0495665_0076829_749_1561 | 268 |
| 682 | 3300046533 | Ga0495640_0003758 | Ga0495640_0003758_7495_8307 | 268 |
| 683 | 3300046535 | Ga0495586_0026388 | Ga0495586_0026388_1123_1935 | 268 |
| 684 | 3300046543 | Ga0495645_0018975 | Ga0495645_0018975_3150_3962 | 268 |
| 685 | 3300046642 | Ga0495634_0001419 | Ga0495634_0001419_8929_9741 | 268 |
| 686 | 3300046663 | Ga0495635_0000409 | Ga0495635_0000409_19725_20537 | 268 |
| 687 | 3300046680 | Ga0495646_0084401 | Ga0495646_0084401_585_1397 | 268 |
| 688 | 3300046681 | Ga0495647_0036746 | Ga0495647_0036746_817_1629 | 268 |
| 689 | 3300047319 | Ga0495674_0002790 | Ga0495674_0002790_6966_7778 | 268 |
| 690 | 3300047471 | Ga0495684_0002502 | Ga0495684_0002502_7485_8297 | 268 |
| 691 | 3300048910 | Ga0496107_0342050 | Ga0496107_0342050_238_1053 | 268 |
| 692 | 3300048917 | Ga0496114_0202173 | Ga0496114_0202173_286_1101 | 268 |
| 693 | 3300050511 | nmdc:mga08y16_380801_c1 | nmdc:mga08y16_380801_c1_49_864 | 268 |
| 694 | 3300053078 | Ga0495612_0000121 | Ga0495612_0000121_20860_21672 | 268 |
| 695 | 3300053085 | Ga0495619_0003020 | Ga0495619_0003020_6569_7381 | 268 |
| 696 | iso_pu_bacteria | 2821123053 | 2821123638 | 268 |
| 697 | iso_pu_bacteria | 2857531043 | 2857531202 | 268 |
| 698 | iso_pu_bacteria | 2961127735 | 2961128352 | 268 |
| 699 | iso_pu_bacteria | 8004361976 | 8004362919 | 268 |
| 700 | 3300005843 | Ga0068860_100588963 | Ga0068860_1005889632 | 269 |
| 701 | 3300006038 | Ga0075365_10019447 | Ga0075365_100194472 | 269 |
| 702 | 3300006178 | Ga0075367_10012431 | Ga0075367_100124312 | 269 |
| 703 | 3300049744 | Ga0501083_0303610 | Ga0501083_0303610_14_832 | 269 |
| 704 | 3300054114 | Ga0501084_0321439 | Ga0501084_0321439_63_881 | 269 |
| 705 | iso_pu_bacteria | 2523231067 | 2523466551 | 269 |
| 706 | iso_pu_bacteria | 2842694124 | 2842696955 | 269 |
| 707 | 3300013307 | Ga0157372_10860839 | Ga0157372_108608392 | 270 |
| 708 | 3300025294 | Ga0209025_1051410 | Ga0209025_10514102 | 270 |
| 709 | 3300048919 | Ga0496116_0000080 | Ga0496116_0000080_21333_22145 | 270 |
| 710 | 3300048922 | Ga0496119_0217695 | Ga0496119_0217695_133_945 | 270 |
| 711 | 3300048925 | Ga0496122_0033520 | Ga0496122_0033520_2511_3323 | 270 |
| 712 | 3300048929 | Ga0496126_0000094 | Ga0496126_0000094_31373_32185 | 270 |
| 713 | 3300053111 | Ga0500572_032203 | Ga0500572_032203_398_1210 | 270 |
| 714 | 3300053177 | Ga0500636_0006532 | Ga0500636_0006532_1486_2298 | 270 |
| 715 | 3300003792 | Ga0055540_1002341 | Ga0055540_100234111 | 271 |
| 716 | 3300003792 | Ga0055540_1023246 | Ga0055540_10232462 | 271 |
| 717 | 3300003794 | Ga0055531_10002423 | Ga0055531_1000242313 | 271 |
| 718 | 3300006946 | Ga0079104_1000069 | Ga0079104_100006936 | 271 |
| 719 | 3300025297 | Ga0209758_1000349 | Ga0209758_100034966 | 271 |
| 720 | 3300025298 | Ga0209050_1003851 | Ga0209050_10038514 | 271 |
| 721 | 3300025303 | Ga0209051_1012527 | Ga0209051_10125273 | 271 |
| 722 | 3300025304 | Ga0209257_1002432 | Ga0209257_100243211 | 271 |
| 723 | 3300027111 | Ga0209281_1000192 | Ga0209281_100019279 | 271 |
| 724 | 3300031995 | Ga0307409_100724767 | Ga0307409_1007247672 | 271 |
| 725 | 3300037471 | Ga0395905_0033945 | Ga0395905_0033945_2548_3363 | 271 |
| 726 | 3300038443 | Ga0395901_0518623 | Ga0395901_0518623_294_1109 | 271 |
| 727 | 3300048924 | Ga0496121_0005128 | Ga0496121_0005128_981_1802 | 271 |
| 728 | 3300048927 | Ga0496124_0043957 | Ga0496124_0043957_588_1409 | 271 |
| 729 | 3300003214 | JGI25165J46597_1000685 | JGI25165J46597_100068511 | 272 |
| 730 | 3300025207 | Ga0209760_103121 | Ga0209760_1031212 | 272 |
| 731 | 3300025233 | Ga0209437_100086 | Ga0209437_100086224 | 272 |
| 732 | 3300025261 | Ga0209233_1000356 | Ga0209233_100035613 | 272 |
| 733 | 3300046507 | Ga0495606_0001322 | Ga0495606_0001322_4924_5742 | 272 |
| 734 | 3300047472 | Ga0495686_0021002 | Ga0495686_0021002_3327_4145 | 272 |
| 735 | 3300047472 | Ga0495686_0151987 | Ga0495686_0151987_299_1117 | 272 |
| 736 | 3300048924 | Ga0496121_0044284 | Ga0496121_0044284_2042_2860 | 272 |
| 737 | 3300048924 | Ga0496121_0234505 | Ga0496121_0234505_247_1083 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
62
211
0.91
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.7293 | 48 | 245 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.7053 | 64 | 247 |
| 7ahc-assembly1.cif.gz_B | opua apo inward-facing | 0.7034 | 64 | 243 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.6934 | 42 | 256 |
| 7ahh-assembly1.cif.gz_A | opua inhibited inward-facing, sbd docked | 0.6903 | 64 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3puzF04 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7791 | 57 | 203 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7308 | 47 | 257 | 1.10.3720.10 |
| af_P0AFL1_11_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7235 | 8 | 260 | 1.10.3720.10 |
| af_P45768_144_364_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.722 | 63 | 256 | 1.10.3720.10 |
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7203 | 46 | 251 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0U2R4V0-F1-model_v4 | 3a0106s02: sulfate ABC transporter, permease | 0.8659 | 33 | 207 |
GO:0005886
GO:0055085 |
| AF-A0A0J6WAQ6-F1-model_v4 | Inner membrane ABC transporter permease protein YdcV | 0.8497 | 68 | 257 |
GO:0005886
GO:0055085 |
| AF-A0A0R2QSK7-F1-model_v4 | ABC transporter permease | 0.8451 | 42 | 260 |
GO:0005886
GO:0055085 |
| AF-A0A529XIG8-F1-model_v4 | ABC transporter permease | 0.8352 | 51 | 221 |
GO:0005886
GO:0055085 |
| AF-A0A0U2R4V0-F1-model_v4 | 3a0106s02: sulfate ABC transporter, permease | 0.8338 | 33 | 207 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar