F478339
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 737 | 373 | 1474 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300042435|Ga0439434_0033002|Ga0439434_0033002_494_1048 |
| Length | 171 |
| Sequence | MDRLWGGPAGSLMNLSDTDFQLFAVPATFAQDRAALDARWKELQREAHPDRFAAQGAAAQRVAMQWSVRINEAYQRLKDPIRRASYLCELNGAPLNAEHNTAMPPDFLMQQMEWREEQAEVEAGRARALSSLDWLIDEKGDYPAAAQQVRALMFIERFGQDVEAKFDQLGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 96 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 167 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 168 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 169 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 170 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 171 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 172 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 173 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 174 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 175 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 181 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 198 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 199 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 209 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 210 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 211 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 220 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 221 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 227 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 228 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 229 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 230 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 231 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 232 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 233 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 234 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 235 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 236 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 237 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 238 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 239 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 240 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 313 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 315 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 331 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 333 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 337 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 338 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 341 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 343 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 344 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 345 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 347 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 348 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 349 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 350 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 356 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 357 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 362 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 364 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 367 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 370 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 371 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 372 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.41 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 37.31 |
| Nodule | 0.95 |
| Rhizoplane | 4.61 |
| Rhizosphere | 46.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439434_0033002 | 3300042435 | Bacteria | 1576 |
| 2 | SwRhRL2b_contig_1676596 | 2162886007 | Bacteria | 909 |
| 3 | JGI25155J39150_1000008 | 3300002704 | Bacteria | 236146 |
| 4 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 5 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 6 | JGI25158J39367_1004693 | 3300002739 | Bacteria | 2042 |
| 7 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 8 | JGI25150J39212_1005831 | 3300002774 | Bacteria | 2595 |
| 9 | JGI25159J45721_1001779 | 3300002987 | Bacteria | 8640 |
| 10 | JGI25159J45721_1016712 | 3300002987 | Bacteria | 1551 |
| 11 | JGI25151J46595_10042847 | 3300003187 | Bacteria | 1626 |
| 12 | JGI25151J46595_10098200 | 3300003187 | Bacteria | 796 |
| 13 | JGI25153J46596_10033839 | 3300003215 | Bacteria | 1680 |
| 14 | rootH1_10045872 | 3300003316 | Bacteria | 1343 |
| 15 | JGI25160J50197_1001319 | 3300003354 | Bacteria | 12526 |
| 16 | JGI25160J50197_1027407 | 3300003354 | Bacteria | 1551 |
| 17 | JGI26145J50221_1004583 | 3300003371 | Bacteria | 1122 |
| 18 | JGI25161J50226_1000043 | 3300003374 | Bacteria | 120741 |
| 19 | JGI25161J50226_1007981 | 3300003374 | Bacteria | 1683 |
| 20 | JGI25161J50226_1007993 | 3300003374 | Bacteria | 1680 |
| 21 | Ga0006562J51391_1171694 | 3300003578 | Bacteria | 2630 |
| 22 | Ga0006562J51391_1171695 | 3300003578 | Bacteria | 2710 |
| 23 | Ga0055535_1001571 | 3300003761 | Bacteria | 11046 |
| 24 | Ga0055542_1000027 | 3300003762 | Bacteria | 254819 |
| 25 | Ga0055526_1004321 | 3300003771 | Bacteria | 8580 |
| 26 | Ga0055526_1012797 | 3300003771 | Bacteria | 3620 |
| 27 | Ga0055526_1028607 | 3300003771 | Bacteria | 1680 |
| 28 | Ga0055537_1000193 | 3300003773 | Bacteria | 45640 |
| 29 | Ga0055537_1001140 | 3300003773 | Bacteria | 11403 |
| 30 | Ga0055537_1007153 | 3300003773 | Bacteria | 2732 |
| 31 | Ga0055537_1012283 | 3300003773 | Bacteria | 1680 |
| 32 | Ga0055524_1000166 | 3300003775 | Bacteria | 75509 |
| 33 | Ga0055524_1000845 | 3300003775 | Bacteria | 20102 |
| 34 | Ga0055524_1028316 | 3300003775 | Bacteria | 1680 |
| 35 | Ga0055524_1042588 | 3300003775 | Bacteria | 1127 |
| 36 | Ga0055536_1000085 | 3300003781 | Bacteria | 80741 |
| 37 | Ga0055536_1003097 | 3300003781 | Bacteria | 9048 |
| 38 | Ga0055536_1007352 | 3300003781 | Bacteria | 4949 |
| 39 | Ga0055536_1041184 | 3300003781 | Bacteria | 1092 |
| 40 | Ga0055534_1000186 | 3300003784 | Bacteria | 45640 |
| 41 | Ga0055534_1000984 | 3300003784 | Bacteria | 12593 |
| 42 | Ga0055534_1001126 | 3300003784 | Bacteria | 11334 |
| 43 | Ga0055528_1000682 | 3300003790 | Bacteria | 24399 |
| 44 | Ga0055528_1013451 | 3300003790 | Bacteria | 3096 |
| 45 | Ga0055528_1028234 | 3300003790 | Bacteria | 1554 |
| 46 | Ga0055530_10000754 | 3300003791 | Bacteria | 26927 |
| 47 | Ga0055530_10000859 | 3300003791 | Bacteria | 25048 |
| 48 | Ga0055530_10002231 | 3300003791 | Bacteria | 12758 |
| 49 | Ga0055530_10022468 | 3300003791 | Bacteria | 1835 |
| 50 | Ga0055530_10040536 | 3300003791 | Bacteria | 1142 |
| 51 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 52 | Ga0055540_1000079 | 3300003792 | Bacteria | 112817 |
| 53 | Ga0055540_1002266 | 3300003792 | Bacteria | 10370 |
| 54 | Ga0055540_1002894 | 3300003792 | Bacteria | 8695 |
| 55 | Ga0055540_1012872 | 3300003792 | Bacteria | 2595 |
| 56 | Ga0055540_1058076 | 3300003792 | Bacteria | 780 |
| 57 | Ga0055531_10000665 | 3300003794 | Bacteria | 29356 |
| 58 | Ga0055531_10000985 | 3300003794 | Bacteria | 22675 |
| 59 | Ga0055531_10002479 | 3300003794 | Bacteria | 12312 |
| 60 | Ga0055531_10002823 | 3300003794 | Bacteria | 11383 |
| 61 | Ga0055531_10019455 | 3300003794 | Bacteria | 2745 |
| 62 | Ga0055531_10032003 | 3300003794 | Bacteria | 1728 |
| 63 | Ga0055543_1000127 | 3300004625 | Bacteria | 63245 |
| 64 | Ga0055543_1004852 | 3300004625 | Bacteria | 3562 |
| 65 | Ga0055543_1011122 | 3300004625 | Bacteria | 1856 |
| 66 | Ga0065165_1012751 | 3300005262 | Bacteria | 3398 |
| 67 | Ga0065704_10071806 | 3300005289 | Bacteria | 9886 |
| 68 | Ga0065704_10112761 | 3300005289 | Bacteria | 1927 |
| 69 | Ga0070658_10067797 | 3300005327 | Bacteria | 2916 |
| 70 | Ga0070658_10303884 | 3300005327 | Bacteria | 1361 |
| 71 | Ga0070658_10984002 | 3300005327 | Bacteria | 734 |
| 72 | Ga0070676_10307847 | 3300005328 | Bacteria | 1076 |
| 73 | Ga0070676_10561964 | 3300005328 | Bacteria | 818 |
| 74 | Ga0070677_10089595 | 3300005333 | Bacteria | 1335 |
| 75 | Ga0068869_100165975 | 3300005334 | Bacteria | 1722 |
| 76 | Ga0070666_10120249 | 3300005335 | Bacteria | 1821 |
| 77 | Ga0070666_10776527 | 3300005335 | Bacteria | 705 |
| 78 | Ga0068868_100149139 | 3300005338 | Bacteria | 1925 |
| 79 | Ga0068868_100672155 | 3300005338 | Bacteria | 924 |
| 80 | Ga0070660_100214833 | 3300005339 | Bacteria | 1562 |
| 81 | Ga0070660_100311999 | 3300005339 | Bacteria | 1291 |
| 82 | Ga0070661_100019416 | 3300005344 | Bacteria | 4844 |
| 83 | Ga0070661_100636144 | 3300005344 | Bacteria | 865 |
| 84 | Ga0070668_100348582 | 3300005347 | Bacteria | 1253 |
| 85 | Ga0070674_100742364 | 3300005356 | Bacteria | 843 |
| 86 | Ga0070673_100267728 | 3300005364 | Bacteria | 1495 |
| 87 | Ga0070659_100001486 | 3300005366 | Bacteria | 16875 |
| 88 | Ga0070659_100318852 | 3300005366 | Bacteria | 1299 |
| 89 | Ga0070659_100877082 | 3300005366 | Bacteria | 783 |
| 90 | Ga0070667_100038506 | 3300005367 | Bacteria | 4008 |
| 91 | Ga0070667_100244267 | 3300005367 | Bacteria | 1604 |
| 92 | Ga0070663_100000131 | 3300005455 | Bacteria | 35664 |
| 93 | Ga0070678_100532811 | 3300005456 | Bacteria | 1040 |
| 94 | Ga0070678_101348568 | 3300005456 | Bacteria | 665 |
| 95 | Ga0070662_100051143 | 3300005457 | Bacteria | 2983 |
| 96 | Ga0068867_100178534 | 3300005459 | Bacteria | 1687 |
| 97 | Ga0070706_100674838 | 3300005467 | Bacteria | 959 |
| 98 | Ga0068853_100012228 | 3300005539 | Bacteria | 6980 |
| 99 | Ga0068853_100285993 | 3300005539 | Bacteria | 1521 |
| 100 | Ga0070672_100123177 | 3300005543 | Bacteria | 2124 |
| 101 | Ga0070672_100410223 | 3300005543 | Bacteria | 1162 |
| 102 | Ga0070665_100067849 | 3300005548 | Bacteria | 3576 |
| 103 | Ga0070665_100988504 | 3300005548 | Bacteria | 854 |
| 104 | Ga0068855_100145733 | 3300005563 | Bacteria | 2696 |
| 105 | Ga0070664_100019476 | 3300005564 | Bacteria | 5583 |
| 106 | Ga0070664_100029444 | 3300005564 | Bacteria | 4578 |
| 107 | Ga0068854_100578350 | 3300005578 | Bacteria | 956 |
| 108 | Ga0068852_100183871 | 3300005616 | Bacteria | 1967 |
| 109 | Ga0068852_100561429 | 3300005616 | Bacteria | 1143 |
| 110 | Ga0068859_100653250 | 3300005617 | Bacteria | 1144 |
| 111 | Ga0068864_100089681 | 3300005618 | Bacteria | 2709 |
| 112 | Ga0068851_10023486 | 3300005834 | Bacteria | 3015 |
| 113 | Ga0068863_100310819 | 3300005841 | Bacteria | 1530 |
| 114 | Ga0068860_100610639 | 3300005843 | Bacteria | 1097 |
| 115 | Ga0068862_100216656 | 3300005844 | Bacteria | 1732 |
| 116 | Ga0075365_10353607 | 3300006038 | Bacteria | 1036 |
| 117 | Ga0075365_10476870 | 3300006038 | Bacteria | 881 |
| 118 | Ga0075365_10532293 | 3300006038 | Bacteria | 831 |
| 119 | Ga0075368_10070241 | 3300006042 | Bacteria | 1413 |
| 120 | Ga0075363_100001372 | 3300006048 | Bacteria | 9171 |
| 121 | Ga0075363_100003657 | 3300006048 | Bacteria | 6603 |
| 122 | Ga0075363_100044593 | 3300006048 | Bacteria | 2350 |
| 123 | Ga0075364_10053787 | 3300006051 | Bacteria | 2632 |
| 124 | Ga0075364_10078271 | 3300006051 | Bacteria | 2183 |
| 125 | Ga0075362_10016056 | 3300006177 | Bacteria | 3059 |
| 126 | Ga0075362_10044435 | 3300006177 | Bacteria | 1970 |
| 127 | Ga0075367_10012600 | 3300006178 | Bacteria | 4517 |
| 128 | Ga0075367_10038176 | 3300006178 | Bacteria | 2794 |
| 129 | Ga0075367_10047708 | 3300006178 | Bacteria | 2520 |
| 130 | Ga0075367_10109050 | 3300006178 | Bacteria | 1698 |
| 131 | Ga0075366_10001124 | 3300006195 | Bacteria | 13182 |
| 132 | Ga0075366_10035701 | 3300006195 | Bacteria | 2931 |
| 133 | Ga0075366_10037137 | 3300006195 | Bacteria | 2874 |
| 134 | Ga0075366_10139790 | 3300006195 | Bacteria | 1464 |
| 135 | Ga0075366_10200592 | 3300006195 | Bacteria | 1213 |
| 136 | Ga0075366_10213890 | 3300006195 | Bacteria | 1174 |
| 137 | Ga0075366_10238446 | 3300006195 | Bacteria | 1109 |
| 138 | Ga0075366_10244350 | 3300006195 | Bacteria | 1094 |
| 139 | Ga0097621_100086862 | 3300006237 | Bacteria | 2611 |
| 140 | Ga0097621_100368613 | 3300006237 | Bacteria | 1281 |
| 141 | Ga0075370_10008279 | 3300006353 | Bacteria | 5343 |
| 142 | Ga0075370_10011875 | 3300006353 | Bacteria | 4586 |
| 143 | Ga0075370_10045060 | 3300006353 | Bacteria | 2494 |
| 144 | Ga0075370_10066640 | 3300006353 | Bacteria | 2054 |
| 145 | Ga0075370_10106028 | 3300006353 | Bacteria | 1629 |
| 146 | Ga0075370_10125392 | 3300006353 | Bacteria | 1497 |
| 147 | Ga0075370_10138122 | 3300006353 | Bacteria | 1424 |
| 148 | Ga0075370_10265843 | 3300006353 | Bacteria | 1018 |
| 149 | Ga0068871_100064039 | 3300006358 | Bacteria | 3009 |
| 150 | Ga0068871_100781857 | 3300006358 | Bacteria | 879 |
| 151 | Ga0075429_100001431 | 3300006880 | Bacteria | 19585 |
| 152 | Ga0097620_100653218 | 3300006931 | Bacteria | 1144 |
| 153 | Ga0079104_1000017 | 3300006946 | Bacteria | 313784 |
| 154 | Ga0079104_1013999 | 3300006946 | Bacteria | 2442 |
| 155 | Ga0079104_1016037 | 3300006946 | Bacteria | 2201 |
| 156 | Ga0099826_10029080 | 3300006948 | Bacteria | 4032 |
| 157 | Ga0105240_10371230 | 3300009093 | Bacteria | 1617 |
| 158 | Ga0105245_10088009 | 3300009098 | Bacteria | 2852 |
| 159 | Ga0105245_10579257 | 3300009098 | Bacteria | 1147 |
| 160 | Ga0114129_10051750 | 3300009147 | Bacteria | 5765 |
| 161 | Ga0105243_10000486 | 3300009148 | Bacteria | 40508 |
| 162 | Ga0105243_10003068 | 3300009148 | Bacteria | 13759 |
| 163 | Ga0105243_10003231 | 3300009148 | Bacteria | 13312 |
| 164 | Ga0105243_10012628 | 3300009148 | Bacteria | 6379 |
| 165 | Ga0105242_11676668 | 3300009176 | Bacteria | 671 |
| 166 | Ga0105248_10480134 | 3300009177 | Bacteria | 1401 |
| 167 | Ga0105248_10772524 | 3300009177 | Bacteria | 1084 |
| 168 | Ga0157347_1001460 | 3300012502 | Bacteria | 1858 |
| 169 | Ga0157373_10126088 | 3300013100 | Bacteria | 1800 |
| 170 | Ga0157370_10014128 | 3300013104 | Bacteria | 8189 |
| 171 | Ga0157370_10614824 | 3300013104 | Bacteria | 994 |
| 172 | Ga0163162_10256232 | 3300013306 | Bacteria | 1881 |
| 173 | Ga0163162_10274397 | 3300013306 | Bacteria | 1818 |
| 174 | Ga0163162_10475418 | 3300013306 | Bacteria | 1381 |
| 175 | Ga0157372_10280863 | 3300013307 | Bacteria | 1936 |
| 176 | Ga0157375_10121684 | 3300013308 | Bacteria | 2720 |
| 177 | Ga0157375_10177301 | 3300013308 | Bacteria | 2281 |
| 178 | Ga0157375_10205853 | 3300013308 | Bacteria | 2124 |
| 179 | Ga0157380_10618780 | 3300014326 | Bacteria | 1075 |
| 180 | Ga0182008_10000093 | 3300014497 | Bacteria | 67966 |
| 181 | Ga0182008_10001960 | 3300014497 | Bacteria | 13217 |
| 182 | Ga0182008_10009359 | 3300014497 | Bacteria | 5292 |
| 183 | Ga0182008_10018987 | 3300014497 | Bacteria | 3553 |
| 184 | Ga0182008_10094641 | 3300014497 | Bacteria | 1474 |
| 185 | Ga0157377_10000035 | 3300014745 | Bacteria | 116860 |
| 186 | Ga0157379_10361175 | 3300014968 | Bacteria | 1331 |
| 187 | Ga0157376_10163245 | 3300014969 | Bacteria | 2021 |
| 188 | Ga0157376_10578051 | 3300014969 | Bacteria | 1115 |
| 189 | Ga0182006_1001354 | 3300015261 | Bacteria | 14997 |
| 190 | Ga0163161_10001250 | 3300017792 | Bacteria | 19010 |
| 191 | Ga0163161_10110174 | 3300017792 | Bacteria | 2058 |
| 192 | Ga0163161_10126217 | 3300017792 | Bacteria | 1927 |
| 193 | Ga0213872_10009993 | 3300021361 | Bacteria | 4530 |
| 194 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 195 | Ga0209436_101446 | 3300025208 | Bacteria | 8293 |
| 196 | Ga0209672_100222 | 3300025228 | Bacteria | 44005 |
| 197 | Ga0209147_100435 | 3300025229 | Bacteria | 26860 |
| 198 | Ga0209258_100048 | 3300025242 | Bacteria | 365881 |
| 199 | Ga0207425_1000786 | 3300025245 | Bacteria | 16194 |
| 200 | Ga0207425_1001555 | 3300025245 | Bacteria | 9355 |
| 201 | Ga0207425_1010433 | 3300025245 | Bacteria | 2260 |
| 202 | Ga0207425_1034381 | 3300025245 | Bacteria | 994 |
| 203 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 204 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 205 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 206 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 207 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 208 | Ga0209129_1001205 | 3300025258 | Bacteria | 14869 |
| 209 | Ga0209129_1006871 | 3300025258 | Bacteria | 3544 |
| 210 | Ga0209129_1019697 | 3300025258 | Bacteria | 1269 |
| 211 | Ga0209565_1000153 | 3300025263 | Bacteria | 92909 |
| 212 | Ga0209565_1001390 | 3300025263 | Bacteria | 10816 |
| 213 | Ga0209565_1003425 | 3300025263 | Bacteria | 5136 |
| 214 | Ga0209565_1005018 | 3300025263 | Bacteria | 3919 |
| 215 | Ga0209565_1009673 | 3300025263 | Bacteria | 2429 |
| 216 | Ga0209565_1023257 | 3300025263 | Bacteria | 1274 |
| 217 | Ga0209673_1000423 | 3300025273 | Bacteria | 73682 |
| 218 | Ga0209673_1000566 | 3300025273 | Bacteria | 59095 |
| 219 | Ga0209673_1000801 | 3300025273 | Bacteria | 41669 |
| 220 | Ga0209673_1024378 | 3300025273 | Bacteria | 2034 |
| 221 | Ga0209673_1050910 | 3300025273 | Bacteria | 1097 |
| 222 | Ga0209130_1000041 | 3300025284 | Bacteria | 261078 |
| 223 | Ga0209130_1000953 | 3300025284 | Bacteria | 22898 |
| 224 | Ga0209130_1001018 | 3300025284 | Bacteria | 21612 |
| 225 | Ga0209130_1001734 | 3300025284 | Bacteria | 13039 |
| 226 | Ga0209675_1000150 | 3300025291 | Bacteria | 92909 |
| 227 | Ga0209675_1001481 | 3300025291 | Bacteria | 13497 |
| 228 | Ga0209675_1002237 | 3300025291 | Bacteria | 10110 |
| 229 | Ga0209675_1002661 | 3300025291 | Bacteria | 9017 |
| 230 | Ga0209675_1002884 | 3300025291 | Bacteria | 8522 |
| 231 | Ga0209675_1015968 | 3300025291 | Bacteria | 2206 |
| 232 | Ga0209675_1021121 | 3300025291 | Bacteria | 1743 |
| 233 | Ga0209675_1028625 | 3300025291 | Bacteria | 1352 |
| 234 | Ga0209675_1035537 | 3300025291 | Bacteria | 1135 |
| 235 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 236 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 237 | Ga0209676_1000735 | 3300025292 | Bacteria | 44818 |
| 238 | Ga0209676_1001743 | 3300025292 | Bacteria | 18592 |
| 239 | Ga0209676_1002326 | 3300025292 | Bacteria | 13761 |
| 240 | Ga0209676_1002586 | 3300025292 | Bacteria | 12456 |
| 241 | Ga0209676_1004231 | 3300025292 | Bacteria | 8115 |
| 242 | Ga0209676_1015972 | 3300025292 | Bacteria | 2735 |
| 243 | Ga0209025_1000217 | 3300025294 | Bacteria | 137909 |
| 244 | Ga0209025_1000278 | 3300025294 | Bacteria | 117718 |
| 245 | Ga0209025_1001179 | 3300025294 | Bacteria | 36980 |
| 246 | Ga0209025_1003927 | 3300025294 | Bacteria | 13378 |
| 247 | Ga0209025_1006669 | 3300025294 | Bacteria | 8871 |
| 248 | Ga0209025_1029535 | 3300025294 | Bacteria | 2649 |
| 249 | Ga0209025_1031916 | 3300025294 | Bacteria | 2476 |
| 250 | Ga0209025_1064423 | 3300025294 | Bacteria | 1346 |
| 251 | Ga0209564_1000915 | 3300025295 | Bacteria | 38566 |
| 252 | Ga0209564_1002066 | 3300025295 | Bacteria | 17268 |
| 253 | Ga0209564_1007036 | 3300025295 | Bacteria | 5896 |
| 254 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 255 | Ga0209758_1002316 | 3300025297 | Bacteria | 19694 |
| 256 | Ga0209758_1047685 | 3300025297 | Bacteria | 1530 |
| 257 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 258 | Ga0209050_1000066 | 3300025298 | Bacteria | 305458 |
| 259 | Ga0209050_1000651 | 3300025298 | Bacteria | 53742 |
| 260 | Ga0209050_1000861 | 3300025298 | Bacteria | 41048 |
| 261 | Ga0209050_1002866 | 3300025298 | Bacteria | 13651 |
| 262 | Ga0209050_1012119 | 3300025298 | Bacteria | 3995 |
| 263 | Ga0209050_1026025 | 3300025298 | Bacteria | 1970 |
| 264 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 265 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 266 | Ga0209256_1000067 | 3300025299 | Bacteria | 246812 |
| 267 | Ga0209256_1000366 | 3300025299 | Bacteria | 72685 |
| 268 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 269 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 270 | Ga0207426_1000061 | 3300025302 | Bacteria | 362507 |
| 271 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 272 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 273 | Ga0209051_1000044 | 3300025303 | Bacteria | 305458 |
| 274 | Ga0209051_1000049 | 3300025303 | Bacteria | 287483 |
| 275 | Ga0209051_1000096 | 3300025303 | Bacteria | 167399 |
| 276 | Ga0209051_1000430 | 3300025303 | Bacteria | 57225 |
| 277 | Ga0209051_1000532 | 3300025303 | Bacteria | 47250 |
| 278 | Ga0209051_1000913 | 3300025303 | Bacteria | 29387 |
| 279 | Ga0209051_1004959 | 3300025303 | Bacteria | 7955 |
| 280 | Ga0209051_1013466 | 3300025303 | Bacteria | 3892 |
| 281 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 282 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 283 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 284 | Ga0209257_1000082 | 3300025304 | Bacteria | 305458 |
| 285 | Ga0209257_1001131 | 3300025304 | Bacteria | 34256 |
| 286 | Ga0209257_1005948 | 3300025304 | Bacteria | 8192 |
| 287 | Ga0209257_1013234 | 3300025304 | Bacteria | 3698 |
| 288 | Ga0209257_1017381 | 3300025304 | Bacteria | 2837 |
| 289 | Ga0207656_10079144 | 3300025321 | Bacteria | 1474 |
| 290 | Ga0207682_10132721 | 3300025893 | Bacteria | 1112 |
| 291 | Ga0207680_10172384 | 3300025903 | Bacteria | 1458 |
| 292 | Ga0207645_10356221 | 3300025907 | Bacteria | 980 |
| 293 | Ga0207643_10353005 | 3300025908 | Bacteria | 923 |
| 294 | Ga0207705_10267575 | 3300025909 | Bacteria | 1306 |
| 295 | Ga0207705_10371042 | 3300025909 | Bacteria | 1105 |
| 296 | Ga0207654_10597833 | 3300025911 | Bacteria | 787 |
| 297 | Ga0207695_10612545 | 3300025913 | Bacteria | 970 |
| 298 | Ga0207657_10150341 | 3300025919 | Bacteria | 1897 |
| 299 | Ga0207649_10016746 | 3300025920 | Bacteria | 4142 |
| 300 | Ga0207649_10152945 | 3300025920 | Bacteria | 1591 |
| 301 | Ga0207687_11072644 | 3300025927 | Bacteria | 691 |
| 302 | Ga0207644_10197781 | 3300025931 | Bacteria | 1584 |
| 303 | Ga0207644_10622715 | 3300025931 | Bacteria | 897 |
| 304 | Ga0207690_10001103 | 3300025932 | Bacteria | 17214 |
| 305 | Ga0207706_10023334 | 3300025933 | Bacteria | 5557 |
| 306 | Ga0207706_10764444 | 3300025933 | Bacteria | 823 |
| 307 | Ga0207709_10000193 | 3300025935 | Bacteria | 81025 |
| 308 | Ga0207709_10000348 | 3300025935 | Bacteria | 47582 |
| 309 | Ga0207709_10001710 | 3300025935 | Bacteria | 14779 |
| 310 | Ga0207709_10006258 | 3300025935 | Bacteria | 6689 |
| 311 | Ga0207709_10007492 | 3300025935 | Bacteria | 6075 |
| 312 | Ga0207669_10088010 | 3300025937 | Bacteria | 2013 |
| 313 | Ga0207691_10098794 | 3300025940 | Bacteria | 2607 |
| 314 | Ga0207691_10329808 | 3300025940 | Bacteria | 1308 |
| 315 | Ga0207711_10948082 | 3300025941 | Bacteria | 799 |
| 316 | Ga0207689_10337837 | 3300025942 | Bacteria | 1251 |
| 317 | Ga0207679_10000368 | 3300025945 | Bacteria | 32625 |
| 318 | Ga0207679_10122288 | 3300025945 | Bacteria | 2074 |
| 319 | Ga0207667_10119720 | 3300025949 | Bacteria | 2713 |
| 320 | Ga0207651_10240124 | 3300025960 | Bacteria | 1476 |
| 321 | Ga0207651_10557872 | 3300025960 | Bacteria | 997 |
| 322 | Ga0207668_10162279 | 3300025972 | Bacteria | 1743 |
| 323 | Ga0207640_10159836 | 3300025981 | Bacteria | 1666 |
| 324 | Ga0207658_10036451 | 3300025986 | Bacteria | 3526 |
| 325 | Ga0207658_11106100 | 3300025986 | Bacteria | 724 |
| 326 | Ga0207677_10217484 | 3300026023 | Bacteria | 1530 |
| 327 | Ga0207703_10510039 | 3300026035 | Bacteria | 1130 |
| 328 | Ga0207703_11152408 | 3300026035 | Bacteria | 745 |
| 329 | Ga0207639_10013989 | 3300026041 | Bacteria | 5630 |
| 330 | Ga0207639_10247606 | 3300026041 | Bacteria | 1553 |
| 331 | Ga0207639_10288915 | 3300026041 | Bacteria | 1445 |
| 332 | Ga0207678_10000500 | 3300026067 | Bacteria | 35694 |
| 333 | Ga0207678_10422184 | 3300026067 | Bacteria | 1156 |
| 334 | Ga0207648_10000040 | 3300026089 | Bacteria | 116539 |
| 335 | Ga0207648_10466209 | 3300026089 | Bacteria | 1152 |
| 336 | Ga0207676_10604803 | 3300026095 | Bacteria | 1053 |
| 337 | Ga0207674_10091491 | 3300026116 | Bacteria | 3032 |
| 338 | Ga0207674_10185677 | 3300026116 | Bacteria | 2030 |
| 339 | Ga0207683_10162903 | 3300026121 | Bacteria | 2017 |
| 340 | Ga0207683_10406234 | 3300026121 | Bacteria | 1253 |
| 341 | Ga0207683_10433370 | 3300026121 | Bacteria | 1211 |
| 342 | Ga0207683_10986136 | 3300026121 | Bacteria | 782 |
| 343 | Ga0207683_11020196 | 3300026121 | Bacteria | 768 |
| 344 | Ga0207698_10087558 | 3300026142 | Bacteria | 2537 |
| 345 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 346 | Ga0209281_1000042 | 3300027111 | Bacteria | 344748 |
| 347 | Ga0209973_1010653 | 3300027252 | Bacteria | 1091 |
| 348 | Ga0209970_1001115 | 3300027614 | Bacteria | 4743 |
| 349 | Ga0209983_1119185 | 3300027665 | Bacteria | 602 |
| 350 | Ga0209282_1010228 | 3300027666 | Bacteria | 5933 |
| 351 | Ga0209974_10001570 | 3300027876 | Bacteria | 8281 |
| 352 | Ga0209974_10040175 | 3300027876 | Bacteria | 1556 |
| 353 | Ga0209974_10075366 | 3300027876 | Bacteria | 1155 |
| 354 | Ga0207428_10365639 | 3300027907 | Bacteria | 1060 |
| 355 | Ga0268266_10014410 | 3300028379 | Bacteria | 6796 |
| 356 | Ga0268266_10815724 | 3300028379 | Bacteria | 901 |
| 357 | Ga0268265_10172957 | 3300028380 | Bacteria | 1848 |
| 358 | Ga0268264_10233395 | 3300028381 | Bacteria | 1700 |
| 359 | Ga0307517_10000805 | 3300028786 | Bacteria | 53822 |
| 360 | Ga0307517_10479431 | 3300028786 | Bacteria | 638 |
| 361 | Ga0307515_10000053 | 3300028794 | Bacteria | 266512 |
| 362 | Ga0307515_10001032 | 3300028794 | Bacteria | 63662 |
| 363 | Ga0307515_10001342 | 3300028794 | Bacteria | 55698 |
| 364 | Ga0307515_10002612 | 3300028794 | Bacteria | 38796 |
| 365 | Ga0307515_10013171 | 3300028794 | Bacteria | 15473 |
| 366 | Ga0307515_10019472 | 3300028794 | Bacteria | 12203 |
| 367 | Ga0307515_10084485 | 3300028794 | Bacteria | 4076 |
| 368 | Ga0307515_10314414 | 3300028794 | Bacteria | 1238 |
| 369 | Ga0307515_10570329 | 3300028794 | Bacteria | 742 |
| 370 | Ga0307512_10019179 | 3300030522 | Bacteria | 6233 |
| 371 | Ga0307512_10044313 | 3300030522 | Bacteria | 3659 |
| 372 | Ga0307512_10115617 | 3300030522 | Bacteria | 1746 |
| 373 | Ga0316177_1181706 | 3300030731 | Bacteria | 1071 |
| 374 | Ga0316176_1208777 | 3300030732 | Bacteria | 5275 |
| 375 | Ga0314311_1026962 | 3300030733 | Bacteria | 2714 |
| 376 | Ga0316179_1036211 | 3300030734 | Bacteria | 1491 |
| 377 | Ga0316178_1055728 | 3300030735 | Bacteria | 1904 |
| 378 | Ga0316180_1157758 | 3300030736 | Bacteria | 2175 |
| 379 | Ga0316183_1008427 | 3300030742 | Bacteria | 808 |
| 380 | Ga0316183_1017320 | 3300030742 | Bacteria | 4162 |
| 381 | Ga0316181_1160208 | 3300030744 | Bacteria | 1743 |
| 382 | Ga0316182_1388978 | 3300030745 | Bacteria | 2505 |
| 383 | Ga0265330_10000675 | 3300031235 | Bacteria | 21898 |
| 384 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 385 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 386 | Ga0265328_10214773 | 3300031239 | Bacteria | 732 |
| 387 | Ga0265325_10035119 | 3300031241 | Bacteria | 2664 |
| 388 | Ga0265340_10009932 | 3300031247 | Bacteria | 5101 |
| 389 | Ga0265327_10000640 | 3300031251 | Bacteria | 56812 |
| 390 | Ga0265327_10023188 | 3300031251 | Bacteria | 3682 |
| 391 | Ga0307513_10000285 | 3300031456 | Bacteria | 73356 |
| 392 | Ga0307513_10084111 | 3300031456 | Bacteria | 3269 |
| 393 | Ga0307513_10279241 | 3300031456 | Bacteria | 1449 |
| 394 | Ga0307513_10818655 | 3300031456 | Bacteria | 637 |
| 395 | Ga0307509_10001946 | 3300031507 | Bacteria | 34096 |
| 396 | Ga0307509_10045814 | 3300031507 | Bacteria | 4712 |
| 397 | Ga0307509_10078909 | 3300031507 | Bacteria | 3409 |
| 398 | Ga0307509_10251580 | 3300031507 | Bacteria | 1550 |
| 399 | Ga0307509_10310849 | 3300031507 | Bacteria | 1318 |
| 400 | Ga0307408_100008062 | 3300031548 | Bacteria | 6962 |
| 401 | Ga0307408_100008200 | 3300031548 | Bacteria | 6899 |
| 402 | Ga0307408_100076543 | 3300031548 | Bacteria | 2489 |
| 403 | Ga0307408_100096423 | 3300031548 | Bacteria | 2244 |
| 404 | Ga0307408_100352697 | 3300031548 | Bacteria | 1249 |
| 405 | Ga0307408_100362532 | 3300031548 | Bacteria | 1233 |
| 406 | Ga0307508_10000004 | 3300031616 | Bacteria | 287547 |
| 407 | Ga0307508_10000078 | 3300031616 | Bacteria | 113416 |
| 408 | Ga0307508_10002611 | 3300031616 | Bacteria | 18949 |
| 409 | Ga0307514_10023123 | 3300031649 | Bacteria | 5047 |
| 410 | Ga0307514_10032879 | 3300031649 | Bacteria | 4144 |
| 411 | Ga0265314_10000012 | 3300031711 | Bacteria | 415184 |
| 412 | Ga0307516_10009495 | 3300031730 | Bacteria | 10837 |
| 413 | Ga0307516_10046323 | 3300031730 | Bacteria | 4291 |
| 414 | Ga0307516_10285418 | 3300031730 | Bacteria | 1331 |
| 415 | Ga0307516_10286274 | 3300031730 | Bacteria | 1328 |
| 416 | Ga0307516_10433175 | 3300031730 | Bacteria | 972 |
| 417 | Ga0307516_10455297 | 3300031730 | Bacteria | 935 |
| 418 | Ga0307405_10093525 | 3300031731 | Bacteria | 1997 |
| 419 | Ga0307405_10110081 | 3300031731 | Bacteria | 1864 |
| 420 | Ga0307405_10310694 | 3300031731 | Bacteria | 1200 |
| 421 | Ga0307405_10427985 | 3300031731 | Bacteria | 1043 |
| 422 | Ga0307405_10444466 | 3300031731 | Bacteria | 1026 |
| 423 | Ga0307405_10521100 | 3300031731 | Bacteria | 956 |
| 424 | Ga0307405_10548974 | 3300031731 | Bacteria | 935 |
| 425 | Ga0307410_10176786 | 3300031852 | Bacteria | 1613 |
| 426 | Ga0307406_10084134 | 3300031901 | Bacteria | 2123 |
| 427 | Ga0307406_10084329 | 3300031901 | Bacteria | 2121 |
| 428 | Ga0307406_10237368 | 3300031901 | Bacteria | 1365 |
| 429 | Ga0307406_10482323 | 3300031901 | Bacteria | 1001 |
| 430 | Ga0307407_10265419 | 3300031903 | Bacteria | 1183 |
| 431 | Ga0307412_10021895 | 3300031911 | Bacteria | 3910 |
| 432 | Ga0307412_10031954 | 3300031911 | Bacteria | 3329 |
| 433 | Ga0307412_10105019 | 3300031911 | Bacteria | 2005 |
| 434 | Ga0307412_10373355 | 3300031911 | Bacteria | 1152 |
| 435 | Ga0307412_10674874 | 3300031911 | Bacteria | 884 |
| 436 | Ga0307416_100258600 | 3300032002 | Bacteria | 1700 |
| 437 | Ga0307416_101057913 | 3300032002 | Bacteria | 915 |
| 438 | Ga0307411_10043221 | 3300032005 | Bacteria | 2882 |
| 439 | Ga0307411_10154442 | 3300032005 | Bacteria | 1710 |
| 440 | Ga0307411_11167906 | 3300032005 | Bacteria | 697 |
| 441 | Ga0307415_101110832 | 3300032126 | Bacteria | 741 |
| 442 | Ga0307507_10164168 | 3300033179 | Bacteria | 1632 |
| 443 | Ga0307510_10017087 | 3300033180 | Bacteria | 8559 |
| 444 | Ga0307510_10041763 | 3300033180 | Bacteria | 5008 |
| 445 | Ga0373928_0015290 | 3300035084 | Bacteria | 1561 |
| 446 | Ga0373932_0057300 | 3300035112 | Bacteria | 1174 |
| 447 | Ga0373937_0498956 | 3300036401 | Bacteria | 1156 |
| 448 | Ga0373925_0596284 | 3300037068 | Bacteria | 910 |
| 449 | Ga0395900_0050252 | 3300037418 | Bacteria | 4295 |
| 450 | Ga0395900_0414718 | 3300037418 | Bacteria | 1308 |
| 451 | Ga0395898_0010705 | 3300037466 | Bacteria | 9584 |
| 452 | Ga0395905_0036288 | 3300037471 | Bacteria | 4629 |
| 453 | Ga0395905_0037264 | 3300037471 | Bacteria | 4566 |
| 454 | Ga0395905_0088118 | 3300037471 | Bacteria | 2909 |
| 455 | Ga0395901_0084441 | 3300038443 | Bacteria | 3318 |
| 456 | Ga0436361_0474781 | 3300039447 | Bacteria | 20263 |
| 457 | Ga0439436_0019407 | 3300041404 | Bacteria | 2030 |
| 458 | Ga0439439_0000304 | 3300041406 | Bacteria | 7878 |
| 459 | Ga0439461_0003861 | 3300041410 | Bacteria | 2480 |
| 460 | Ga0439461_0022695 | 3300041410 | Bacteria | 1259 |
| 461 | Ga0439466_0002298 | 3300041411 | Bacteria | 7498 |
| 462 | Ga0439466_0032790 | 3300041411 | Bacteria | 1768 |
| 463 | Ga0439465_0001722 | 3300041413 | Bacteria | 7149 |
| 464 | Ga0451791_1504222 | 3300041451 | Bacteria | 860 |
| 465 | Ga0451791_1831968 | 3300041451 | Bacteria | 945 |
| 466 | Ga0451793_0420993 | 3300041452 | Bacteria | 779 |
| 467 | Ga0451793_0790542 | 3300041452 | Bacteria | 1176 |
| 468 | Ga0451795_0269663 | 3300041456 | Bacteria | 2125 |
| 469 | Ga0451798_0014371 | 3300041458 | Bacteria | 2270 |
| 470 | Ga0451800_0719183 | 3300041459 | Bacteria | 1524 |
| 471 | Ga0451802_0064298 | 3300041460 | Bacteria | 2019 |
| 472 | Ga0451802_1637868 | 3300041460 | Bacteria | 913 |
| 473 | Ga0451839_0261286 | 3300041496 | Bacteria | 1195 |
| 474 | Ga0451839_0744399 | 3300041496 | Bacteria | 824 |
| 475 | Ga0451847_0695134 | 3300041503 | Bacteria | 835 |
| 476 | Ga0451851_0477554 | 3300041507 | Bacteria | 1037 |
| 477 | Ga0451851_0721193 | 3300041507 | Bacteria | 1690 |
| 478 | Ga0439431_0002206 | 3300041997 | Bacteria | 4291 |
| 479 | Ga0439431_0011466 | 3300041997 | Bacteria | 2025 |
| 480 | Ga0439445_0000315 | 3300042004 | Bacteria | 9392 |
| 481 | Ga0439432_002851 | 3300042006 | Bacteria | 6444 |
| 482 | Ga0439432_018080 | 3300042006 | Bacteria | 2359 |
| 483 | Ga0439449_0002911 | 3300042007 | Bacteria | 6658 |
| 484 | Ga0439449_0004348 | 3300042007 | Bacteria | 5469 |
| 485 | Ga0439449_0009187 | 3300042007 | Bacteria | 3746 |
| 486 | Ga0439452_001163 | 3300042010 | Bacteria | 11413 |
| 487 | Ga0439452_023585 | 3300042010 | Bacteria | 1582 |
| 488 | Ga0439457_006138 | 3300042014 | Bacteria | 2965 |
| 489 | Ga0439457_043301 | 3300042014 | Bacteria | 1005 |
| 490 | Ga0439462_0003203 | 3300042015 | Bacteria | 3903 |
| 491 | Ga0439462_0003593 | 3300042015 | Bacteria | 3733 |
| 492 | Ga0450912_001147 | 3300042116 | Bacteria | 1548 |
| 493 | Ga0450897_002784 | 3300042128 | Bacteria | 1347 |
| 494 | Ga0450896_014578 | 3300042133 | Bacteria | 1123 |
| 495 | Ga0450905_027826 | 3300042142 | Bacteria | 861 |
| 496 | Ga0450906_042330 | 3300042145 | Bacteria | 804 |
| 497 | Ga0439446_0006142 | 3300042156 | Bacteria | 3120 |
| 498 | Ga0439446_0046454 | 3300042156 | Bacteria | 1290 |
| 499 | Ga0439458_0083748 | 3300042157 | Bacteria | 816 |
| 500 | Ga0450909_003341 | 3300042185 | Bacteria | 2285 |
| 501 | Ga0439434_0002020 | 3300042435 | Bacteria | 5865 |
| 502 | Ga0439434_0026783 | 3300042435 | Bacteria | 1741 |
| 503 | Ga0439459_0049516 | 3300042438 | Bacteria | 918 |
| 504 | Ga0439459_0067137 | 3300042438 | Bacteria | 822 |
| 505 | Ga0439464_0004567 | 3300042439 | Bacteria | 3548 |
| 506 | Ga0439460_0237228 | 3300042461 | Bacteria | 628 |
| 507 | Ga0450893_0000990 | 3300042532 | Bacteria | 4265 |
| 508 | Ga0451577_0924304 | 3300042876 | Bacteria | 785 |
| 509 | Ga0451577_1183741 | 3300042876 | Bacteria | 682 |
| 510 | Ga0453684_0440397 | 3300044712 | Bacteria | 1452 |
| 511 | Ga0451576_0123662 | 3300045051 | Bacteria | 2695 |
| 512 | Ga0466967_0850764 | 3300045976 | Bacteria | 906 |
| 513 | Ga0495592_0008709 | 3300046454 | Bacteria | 7615 |
| 514 | Ga0495603_0312211 | 3300046455 | Bacteria | 903 |
| 515 | Ga0495629_0285901 | 3300046459 | Bacteria | 1131 |
| 516 | Ga0495638_0117704 | 3300046460 | Bacteria | 1572 |
| 517 | Ga0495582_0102426 | 3300046473 | Bacteria | 1604 |
| 518 | Ga0495639_0028807 | 3300046475 | Bacteria | 2461 |
| 519 | Ga0495610_0023385 | 3300046512 | Bacteria | 3362 |
| 520 | Ga0495610_0025850 | 3300046512 | Bacteria | 3143 |
| 521 | Ga0495610_0167991 | 3300046512 | Bacteria | 922 |
| 522 | Ga0495616_0020913 | 3300046513 | Bacteria | 3553 |
| 523 | Ga0495620_0010437 | 3300046515 | Bacteria | 4901 |
| 524 | Ga0495620_0091302 | 3300046515 | Bacteria | 1222 |
| 525 | Ga0495628_0280774 | 3300046516 | Bacteria | 1237 |
| 526 | Ga0495630_0318281 | 3300046517 | Bacteria | 1189 |
| 527 | Ga0495631_0002748 | 3300046518 | Bacteria | 9757 |
| 528 | Ga0495632_0009715 | 3300046519 | Bacteria | 5772 |
| 529 | Ga0495632_0056661 | 3300046519 | Bacteria | 1915 |
| 530 | Ga0495637_0029215 | 3300046520 | Bacteria | 2455 |
| 531 | Ga0495637_0072987 | 3300046520 | Bacteria | 1381 |
| 532 | Ga0495637_0174877 | 3300046520 | Bacteria | 799 |
| 533 | Ga0495663_0087722 | 3300046525 | Bacteria | 1010 |
| 534 | Ga0495642_0156357 | 3300046528 | Bacteria | 987 |
| 535 | Ga0495642_0353304 | 3300046528 | Bacteria | 646 |
| 536 | Ga0495654_0216249 | 3300046530 | Bacteria | 813 |
| 537 | Ga0495654_0363409 | 3300046530 | Bacteria | 580 |
| 538 | Ga0495586_0085991 | 3300046535 | Bacteria | 1733 |
| 539 | Ga0495609_0118628 | 3300046538 | Bacteria | 1139 |
| 540 | Ga0495621_0006967 | 3300046539 | Bacteria | 3327 |
| 541 | Ga0495621_0081071 | 3300046539 | Bacteria | 1210 |
| 542 | Ga0495621_0099636 | 3300046539 | Bacteria | 1104 |
| 543 | Ga0495621_0153126 | 3300046539 | Bacteria | 908 |
| 544 | Ga0495597_0000153 | 3300046542 | Bacteria | 61233 |
| 545 | Ga0495645_0305402 | 3300046543 | Bacteria | 1038 |
| 546 | Ga0495622_0092513 | 3300046557 | Bacteria | 1389 |
| 547 | Ga0495633_0000827 | 3300046558 | Bacteria | 27307 |
| 548 | Ga0495633_0117411 | 3300046558 | Bacteria | 1233 |
| 549 | Ga0495656_0000929 | 3300046615 | Bacteria | 9473 |
| 550 | Ga0495656_0145278 | 3300046615 | Bacteria | 1141 |
| 551 | Ga0495656_0342951 | 3300046615 | Bacteria | 773 |
| 552 | Ga0495668_0389801 | 3300046616 | Bacteria | 765 |
| 553 | Ga0495634_0633094 | 3300046642 | Bacteria | 619 |
| 554 | Ga0495625_0015771 | 3300046660 | Bacteria | 5966 |
| 555 | Ga0495625_0051251 | 3300046660 | Bacteria | 2959 |
| 556 | Ga0495659_0174097 | 3300046664 | Bacteria | 874 |
| 557 | Ga0495588_0063669 | 3300046674 | Bacteria | 1912 |
| 558 | Ga0495588_0101704 | 3300046674 | Bacteria | 1510 |
| 559 | Ga0495588_0204802 | 3300046674 | Bacteria | 1042 |
| 560 | Ga0495588_0316590 | 3300046674 | Bacteria | 821 |
| 561 | Ga0495658_0039537 | 3300046683 | Bacteria | 2617 |
| 562 | Ga0495658_0079416 | 3300046683 | Bacteria | 1922 |
| 563 | Ga0495669_0272242 | 3300046684 | Bacteria | 814 |
| 564 | Ga0495670_0029469 | 3300046691 | Bacteria | 2724 |
| 565 | Ga0495670_0130388 | 3300046691 | Bacteria | 1310 |
| 566 | Ga0495671_0019317 | 3300046692 | Bacteria | 3605 |
| 567 | Ga0495676_0007147 | 3300047321 | Bacteria | 10247 |
| 568 | Ga0495676_0133099 | 3300047321 | Bacteria | 1792 |
| 569 | Ga0495677_0019590 | 3300047445 | Bacteria | 2453 |
| 570 | Ga0495677_0053846 | 3300047445 | Bacteria | 1484 |
| 571 | Ga0495685_030533 | 3300047447 | Bacteria | 1853 |
| 572 | Ga0495681_0221901 | 3300047470 | Bacteria | 758 |
| 573 | Ga0495686_0047420 | 3300047472 | Bacteria | 2713 |
| 574 | Ga0495593_0006672 | 3300047673 | Bacteria | 6755 |
| 575 | Ga0495602_0158368 | 3300048088 | Bacteria | 1771 |
| 576 | Ga0496100_0348704 | 3300048903 | Bacteria | 1117 |
| 577 | Ga0496101_0021483 | 3300048904 | Bacteria | 4435 |
| 578 | Ga0496102_0059818 | 3300048905 | Bacteria | 3484 |
| 579 | Ga0496102_0109713 | 3300048905 | Bacteria | 2571 |
| 580 | Ga0496103_0015478 | 3300048906 | Bacteria | 4540 |
| 581 | Ga0496104_0102630 | 3300048907 | Bacteria | 2739 |
| 582 | Ga0496104_0193783 | 3300048907 | Bacteria | 1944 |
| 583 | Ga0496105_0005071 | 3300048908 | Bacteria | 9977 |
| 584 | Ga0496105_0031820 | 3300048908 | Bacteria | 4327 |
| 585 | Ga0496106_0081178 | 3300048909 | Bacteria | 2491 |
| 586 | Ga0496107_0083157 | 3300048910 | Bacteria | 2334 |
| 587 | Ga0496107_0156616 | 3300048910 | Bacteria | 1687 |
| 588 | Ga0496108_0093704 | 3300048911 | Bacteria | 2555 |
| 589 | Ga0496110_0027229 | 3300048913 | Bacteria | 4899 |
| 590 | Ga0496110_0117537 | 3300048913 | Bacteria | 2394 |
| 591 | Ga0496110_0956566 | 3300048913 | Bacteria | 763 |
| 592 | Ga0496110_1586368 | 3300048913 | Bacteria | 564 |
| 593 | Ga0496111_0030572 | 3300048914 | Bacteria | 3830 |
| 594 | Ga0496111_0373726 | 3300048914 | Bacteria | 1054 |
| 595 | Ga0496113_0270259 | 3300048916 | Bacteria | 1359 |
| 596 | Ga0496114_0004085 | 3300048917 | Bacteria | 11279 |
| 597 | Ga0496114_0091093 | 3300048917 | Bacteria | 2589 |
| 598 | Ga0496114_0821022 | 3300048917 | Bacteria | 809 |
| 599 | Ga0496114_0855851 | 3300048917 | Bacteria | 789 |
| 600 | Ga0496115_0385765 | 3300048918 | Bacteria | 1139 |
| 601 | Ga0496116_0080697 | 3300048919 | Bacteria | 2019 |
| 602 | Ga0496117_0038912 | 3300048920 | Bacteria | 3517 |
| 603 | Ga0496117_0071291 | 3300048920 | Bacteria | 2329 |
| 604 | Ga0496117_0302614 | 3300048920 | Bacteria | 846 |
| 605 | Ga0496118_0032460 | 3300048921 | Bacteria | 4300 |
| 606 | Ga0496118_0180480 | 3300048921 | Bacteria | 1276 |
| 607 | Ga0496119_0190562 | 3300048922 | Bacteria | 1069 |
| 608 | Ga0496121_0050847 | 3300048924 | Bacteria | 3496 |
| 609 | Ga0496121_0132622 | 3300048924 | Bacteria | 1861 |
| 610 | Ga0496122_0000103 | 3300048925 | Bacteria | 196819 |
| 611 | Ga0496122_0056621 | 3300048925 | Bacteria | 2921 |
| 612 | Ga0496122_0118048 | 3300048925 | Bacteria | 1720 |
| 613 | Ga0496123_0000261 | 3300048926 | Bacteria | 106547 |
| 614 | Ga0496123_0020532 | 3300048926 | Bacteria | 5164 |
| 615 | Ga0496123_0245793 | 3300048926 | Bacteria | 886 |
| 616 | Ga0496124_0051070 | 3300048927 | Bacteria | 3520 |
| 617 | Ga0496124_0082070 | 3300048927 | Bacteria | 2647 |
| 618 | Ga0496124_0102304 | 3300048927 | Bacteria | 2319 |
| 619 | Ga0496124_0123885 | 3300048927 | Bacteria | 2062 |
| 620 | Ga0496125_0007765 | 3300048928 | Bacteria | 11355 |
| 621 | Ga0496125_0031217 | 3300048928 | Bacteria | 4751 |
| 622 | Ga0496125_0037783 | 3300048928 | Bacteria | 4193 |
| 623 | Ga0496125_0134457 | 3300048928 | Bacteria | 1733 |
| 624 | Ga0496125_0140009 | 3300048928 | Bacteria | 1684 |
| 625 | Ga0496125_0336233 | 3300048928 | Bacteria | 908 |
| 626 | Ga0501034_0381306 | 3300049571 | Bacteria | 1335 |
| 627 | Ga0501046_0119725 | 3300049580 | Bacteria | 2004 |
| 628 | Ga0501047_0092095 | 3300049581 | Bacteria | 2910 |
| 629 | Ga0501238_001607 | 3300049671 | Bacteria | 2619 |
| 630 | Ga0501249_011971 | 3300049679 | Bacteria | 1829 |
| 631 | Ga0501257_048914 | 3300049686 | Bacteria | 1051 |
| 632 | Ga0501225_0008398 | 3300049705 | Bacteria | 2964 |
| 633 | Ga0501035_0151722 | 3300049822 | Bacteria | 2010 |
| 634 | Ga0501044_0144395 | 3300049823 | Bacteria | 2366 |
| 635 | nmdc:mga03683_103702_c1 | 3300050489 | Bacteria | 1252 |
| 636 | nmdc:mga03683_229640_c1 | 3300050489 | Bacteria | 858 |
| 637 | nmdc:mga03683_36449_c1 | 3300050489 | Bacteria | 2001 |
| 638 | nmdc:mga03683_71279_c1 | 3300050489 | Bacteria | 1486 |
| 639 | nmdc:mga03683_77769_c1 | 3300050489 | Bacteria | 1428 |
| 640 | nmdc:mga03n38_126332_c1 | 3300050490 | Bacteria | 1262 |
| 641 | nmdc:mga03n38_19647_c1 | 3300050490 | Bacteria | 2688 |
| 642 | nmdc:mga03n38_238081_c1 | 3300050490 | Bacteria | 957 |
| 643 | nmdc:mga03n38_445120_c1 | 3300050490 | Bacteria | 720 |
| 644 | nmdc:mga00v17_25049_c1 | 3300050491 | Bacteria | 3465 |
| 645 | nmdc:mga00v17_36752_c1 | 3300050491 | Bacteria | 2921 |
| 646 | nmdc:mga00v17_484765_c1 | 3300050491 | Bacteria | 802 |
| 647 | nmdc:mga0yw44_2117_c1 | 3300050492 | Bacteria | 8316 |
| 648 | nmdc:mga0yw44_302968_c1 | 3300050492 | Bacteria | 1071 |
| 649 | nmdc:mga0yw44_404770_c1 | 3300050492 | Bacteria | 923 |
| 650 | nmdc:mga0k408_110780_c1 | 3300050493 | Bacteria | 1623 |
| 651 | nmdc:mga0k408_13250_c1 | 3300050493 | Bacteria | 4519 |
| 652 | nmdc:mga0k408_167179_c1 | 3300050493 | Bacteria | 1311 |
| 653 | nmdc:mga0k408_181128_c1 | 3300050493 | Bacteria | 1257 |
| 654 | nmdc:mga0k408_189872_c1 | 3300050493 | Bacteria | 1226 |
| 655 | nmdc:mga0k408_22221_c1 | 3300050493 | Bacteria | 3571 |
| 656 | nmdc:mga0k408_224887_c1 | 3300050493 | Bacteria | 1120 |
| 657 | nmdc:mga0k408_78454_c1 | 3300050493 | Bacteria | 1932 |
| 658 | nmdc:mga06z11_140247_c1 | 3300050494 | Bacteria | 1366 |
| 659 | nmdc:mga06z11_225563_c1 | 3300050494 | Bacteria | 1096 |
| 660 | nmdc:mga06z11_578311_c1 | 3300050494 | Bacteria | 683 |
| 661 | nmdc:mga07m45_102670_c1 | 3300050496 | Bacteria | 1643 |
| 662 | nmdc:mga07m45_104831_c1 | 3300050496 | Bacteria | 1104 |
| 663 | nmdc:mga07m45_10794_c1 | 3300050496 | Bacteria | 4784 |
| 664 | nmdc:mga07m45_14093_c1 | 3300050496 | Bacteria | 4253 |
| 665 | nmdc:mga07m45_178190_c1 | 3300050496 | Bacteria | 1236 |
| 666 | nmdc:mga07m45_23747_c1 | 3300050496 | Bacteria | 3354 |
| 667 | nmdc:mga07m45_614236_c1 | 3300050496 | Bacteria | 628 |
| 668 | nmdc:mga07m45_8991_c1 | 3300050496 | Bacteria | 5159 |
| 669 | nmdc:mga09592_18661_c1 | 3300050508 | Bacteria | 5689 |
| 670 | nmdc:mga0qj67_74358_c1 | 3300050509 | Bacteria | 2715 |
| 671 | nmdc:mga0sz30_33160_c2 | 3300050516 | Bacteria | 1834 |
| 672 | nmdc:mga0sz30_59406_c1 | 3300050516 | Bacteria | 1631 |
| 673 | Ga0500610_0013258 | 3300053079 | Bacteria | 3829 |
| 674 | Ga0500610_0087266 | 3300053079 | Bacteria | 1622 |
| 675 | Ga0495619_0224718 | 3300053085 | Bacteria | 1301 |
| 676 | Ga0500643_013594 | 3300053087 | Bacteria | 2868 |
| 677 | Ga0500643_054543 | 3300053087 | Bacteria | 1134 |
| 678 | Ga0500644_0003921 | 3300053088 | Bacteria | 3703 |
| 679 | Ga0500644_0148631 | 3300053088 | Bacteria | 937 |
| 680 | Ga0500646_0019967 | 3300053090 | Bacteria | 1776 |
| 681 | Ga0500583_0238538 | 3300053092 | Bacteria | 899 |
| 682 | Ga0500651_0000430 | 3300053093 | Bacteria | 22553 |
| 683 | Ga0500651_0042063 | 3300053093 | Bacteria | 2879 |
| 684 | Ga0500651_0347233 | 3300053093 | Bacteria | 842 |
| 685 | Ga0500650_0101407 | 3300053098 | Bacteria | 1346 |
| 686 | Ga0500562_028292 | 3300053108 | Bacteria | 1473 |
| 687 | Ga0500569_082281 | 3300053109 | Bacteria | 1031 |
| 688 | Ga0500571_000252 | 3300053110 | Bacteria | 20356 |
| 689 | Ga0500592_047966 | 3300053116 | Bacteria | 693 |
| 690 | Ga0500593_000652 | 3300053117 | Bacteria | 13240 |
| 691 | Ga0500593_002060 | 3300053117 | Bacteria | 7295 |
| 692 | Ga0500593_002533 | 3300053117 | Bacteria | 6725 |
| 693 | Ga0500594_0000441 | 3300053118 | Bacteria | 9179 |
| 694 | Ga0500607_001874 | 3300053121 | Bacteria | 18035 |
| 695 | Ga0500608_003111 | 3300053122 | Bacteria | 6160 |
| 696 | Ga0500614_053718 | 3300053123 | Bacteria | 1065 |
| 697 | Ga0500618_038162 | 3300053125 | Bacteria | 1109 |
| 698 | Ga0500626_028311 | 3300053128 | Bacteria | 2528 |
| 699 | Ga0500642_0003789 | 3300053130 | Bacteria | 4632 |
| 700 | Ga0500652_000307 | 3300053131 | Bacteria | 17714 |
| 701 | Ga0500655_001160 | 3300053133 | Bacteria | 5025 |
| 702 | Ga0500658_0000352 | 3300053134 | Bacteria | 20402 |
| 703 | Ga0500658_0003377 | 3300053134 | Bacteria | 6041 |
| 704 | Ga0500658_0283932 | 3300053134 | Bacteria | 761 |
| 705 | Ga0500559_0000191 | 3300053136 | Bacteria | 49243 |
| 706 | Ga0500559_0001027 | 3300053136 | Bacteria | 17107 |
| 707 | Ga0500559_0011898 | 3300053136 | Bacteria | 3709 |
| 708 | Ga0500559_0024763 | 3300053136 | Bacteria | 2554 |
| 709 | Ga0500561_0148396 | 3300053137 | Bacteria | 729 |
| 710 | Ga0500564_047935 | 3300053138 | Bacteria | 1959 |
| 711 | Ga0500568_0013994 | 3300053139 | Bacteria | 3636 |
| 712 | Ga0500573_0111477 | 3300053140 | Bacteria | 1530 |
| 713 | Ga0500574_002382 | 3300053141 | Bacteria | 3084 |
| 714 | Ga0500577_0014789 | 3300053142 | Bacteria | 2422 |
| 715 | Ga0500590_055132 | 3300053148 | Bacteria | 2011 |
| 716 | Ga0500604_0130019 | 3300053151 | Bacteria | 846 |
| 717 | Ga0500619_001373 | 3300053154 | Bacteria | 4281 |
| 718 | Ga0500619_060043 | 3300053154 | Bacteria | 1249 |
| 719 | Ga0500622_0000160 | 3300053156 | Bacteria | 70774 |
| 720 | Ga0500622_0001454 | 3300053156 | Bacteria | 18928 |
| 721 | Ga0500622_0084018 | 3300053156 | Bacteria | 1590 |
| 722 | Ga0500624_004796 | 3300053157 | Bacteria | 1788 |
| 723 | Ga0500634_0016453 | 3300053161 | Bacteria | 3945 |
| 724 | Ga0500634_0028221 | 3300053161 | Bacteria | 3056 |
| 725 | Ga0500638_003518 | 3300053162 | Bacteria | 5815 |
| 726 | Ga0500636_0336229 | 3300053177 | Bacteria | 727 |
| 727 | Ga0500636_0353385 | 3300053177 | Bacteria | 700 |
| 728 | Ga0500570_060968 | 3300053724 | Bacteria | 1826 |
| 729 | Ga0500645_003389 | 3300053730 | Bacteria | 6508 |
| 730 | Ga0500645_036265 | 3300053730 | Bacteria | 1467 |
| 731 | Ga0500596_005608 | 3300053735 | Bacteria | 2190 |
| 732 | Ga0500587_000344 | 3300053739 | Bacteria | 5279 |
| 733 | Ga0500587_002693 | 3300053739 | Bacteria | 2518 |
| 734 | Ga0500661_036114 | 3300055283 | Bacteria | 874 |
| 735 | Ga0590075_006111 | 3300059424 | Bacteria | 2852 |
| 736 | Ga0587111_0088833 | 3300060346 | Bacteria | 751 |
| 737 | 2904480509 | 2904479285 | Bacteria | 5073931 |
| 738 | Ga0439434_0033002 | |||
| 739 | SwRhRL2b_contig_1676596 | |||
| 740 | JGI25155J39150_1000008 | |||
| 741 | JGI25156J39149_1000002 | |||
| 742 | JGI25154J39366_1000010 | |||
| 743 | JGI25158J39367_1004693 | |||
| 744 | JGI25157J39369_1000001 | |||
| 745 | JGI25150J39212_1005831 | |||
| 746 | JGI25159J45721_1001779 | |||
| 747 | JGI25159J45721_1016712 | |||
| 748 | JGI25151J46595_10042847 | |||
| 749 | JGI25151J46595_10098200 | |||
| 750 | JGI25153J46596_10033839 | |||
| 751 | rootH1_10045872 | |||
| 752 | JGI25160J50197_1001319 | |||
| 753 | JGI25160J50197_1027407 | |||
| 754 | JGI26145J50221_1004583 | |||
| 755 | JGI25161J50226_1000043 | |||
| 756 | JGI25161J50226_1007981 | |||
| 757 | JGI25161J50226_1007993 | |||
| 758 | Ga0006562J51391_1171694 | |||
| 759 | Ga0006562J51391_1171695 | |||
| 760 | Ga0055535_1001571 | |||
| 761 | Ga0055542_1000027 | |||
| 762 | Ga0055526_1004321 | |||
| 763 | Ga0055526_1012797 | |||
| 764 | Ga0055526_1028607 | |||
| 765 | Ga0055537_1000193 | |||
| 766 | Ga0055537_1001140 | |||
| 767 | Ga0055537_1007153 | |||
| 768 | Ga0055537_1012283 | |||
| 769 | Ga0055524_1000166 | |||
| 770 | Ga0055524_1000845 | |||
| 771 | Ga0055524_1028316 | |||
| 772 | Ga0055524_1042588 | |||
| 773 | Ga0055536_1000085 | |||
| 774 | Ga0055536_1003097 | |||
| 775 | Ga0055536_1007352 | |||
| 776 | Ga0055536_1041184 | |||
| 777 | Ga0055534_1000186 | |||
| 778 | Ga0055534_1000984 | |||
| 779 | Ga0055534_1001126 | |||
| 780 | Ga0055528_1000682 | |||
| 781 | Ga0055528_1013451 | |||
| 782 | Ga0055528_1028234 | |||
| 783 | Ga0055530_10000754 | |||
| 784 | Ga0055530_10000859 | |||
| 785 | Ga0055530_10002231 | |||
| 786 | Ga0055530_10022468 | |||
| 787 | Ga0055530_10040536 | |||
| 788 | Ga0055540_1000002 | |||
| 789 | Ga0055540_1000079 | |||
| 790 | Ga0055540_1002266 | |||
| 791 | Ga0055540_1002894 | |||
| 792 | Ga0055540_1012872 | |||
| 793 | Ga0055540_1058076 | |||
| 794 | Ga0055531_10000665 | |||
| 795 | Ga0055531_10000985 | |||
| 796 | Ga0055531_10002479 | |||
| 797 | Ga0055531_10002823 | |||
| 798 | Ga0055531_10019455 | |||
| 799 | Ga0055531_10032003 | |||
| 800 | Ga0055543_1000127 | |||
| 801 | Ga0055543_1004852 | |||
| 802 | Ga0055543_1011122 | |||
| 803 | Ga0065165_1012751 | |||
| 804 | Ga0065704_10071806 | |||
| 805 | Ga0065704_10112761 | |||
| 806 | Ga0070658_10067797 | |||
| 807 | Ga0070658_10303884 | |||
| 808 | Ga0070658_10984002 | |||
| 809 | Ga0070676_10307847 | |||
| 810 | Ga0070676_10561964 | |||
| 811 | Ga0070677_10089595 | |||
| 812 | Ga0068869_100165975 | |||
| 813 | Ga0070666_10120249 | |||
| 814 | Ga0070666_10776527 | |||
| 815 | Ga0068868_100149139 | |||
| 816 | Ga0068868_100672155 | |||
| 817 | Ga0070660_100214833 | |||
| 818 | Ga0070660_100311999 | |||
| 819 | Ga0070661_100019416 | |||
| 820 | Ga0070661_100636144 | |||
| 821 | Ga0070668_100348582 | |||
| 822 | Ga0070674_100742364 | |||
| 823 | Ga0070673_100267728 | |||
| 824 | Ga0070659_100001486 | |||
| 825 | Ga0070659_100318852 | |||
| 826 | Ga0070659_100877082 | |||
| 827 | Ga0070667_100038506 | |||
| 828 | Ga0070667_100244267 | |||
| 829 | Ga0070663_100000131 | |||
| 830 | Ga0070678_100532811 | |||
| 831 | Ga0070678_101348568 | |||
| 832 | Ga0070662_100051143 | |||
| 833 | Ga0068867_100178534 | |||
| 834 | Ga0070706_100674838 | |||
| 835 | Ga0068853_100012228 | |||
| 836 | Ga0068853_100285993 | |||
| 837 | Ga0070672_100123177 | |||
| 838 | Ga0070672_100410223 | |||
| 839 | Ga0070665_100067849 | |||
| 840 | Ga0070665_100988504 | |||
| 841 | Ga0068855_100145733 | |||
| 842 | Ga0070664_100019476 | |||
| 843 | Ga0070664_100029444 | |||
| 844 | Ga0068854_100578350 | |||
| 845 | Ga0068852_100183871 | |||
| 846 | Ga0068852_100561429 | |||
| 847 | Ga0068859_100653250 | |||
| 848 | Ga0068864_100089681 | |||
| 849 | Ga0068851_10023486 | |||
| 850 | Ga0068863_100310819 | |||
| 851 | Ga0068860_100610639 | |||
| 852 | Ga0068862_100216656 | |||
| 853 | Ga0075365_10353607 | |||
| 854 | Ga0075365_10476870 | |||
| 855 | Ga0075365_10532293 | |||
| 856 | Ga0075368_10070241 | |||
| 857 | Ga0075363_100001372 | |||
| 858 | Ga0075363_100003657 | |||
| 859 | Ga0075363_100044593 | |||
| 860 | Ga0075364_10053787 | |||
| 861 | Ga0075364_10078271 | |||
| 862 | Ga0075362_10016056 | |||
| 863 | Ga0075362_10044435 | |||
| 864 | Ga0075367_10012600 | |||
| 865 | Ga0075367_10038176 | |||
| 866 | Ga0075367_10047708 | |||
| 867 | Ga0075367_10109050 | |||
| 868 | Ga0075366_10001124 | |||
| 869 | Ga0075366_10035701 | |||
| 870 | Ga0075366_10037137 | |||
| 871 | Ga0075366_10139790 | |||
| 872 | Ga0075366_10200592 | |||
| 873 | Ga0075366_10213890 | |||
| 874 | Ga0075366_10238446 | |||
| 875 | Ga0075366_10244350 | |||
| 876 | Ga0097621_100086862 | |||
| 877 | Ga0097621_100368613 | |||
| 878 | Ga0075370_10008279 | |||
| 879 | Ga0075370_10011875 | |||
| 880 | Ga0075370_10045060 | |||
| 881 | Ga0075370_10066640 | |||
| 882 | Ga0075370_10106028 | |||
| 883 | Ga0075370_10125392 | |||
| 884 | Ga0075370_10138122 | |||
| 885 | Ga0075370_10265843 | |||
| 886 | Ga0068871_100064039 | |||
| 887 | Ga0068871_100781857 | |||
| 888 | Ga0075429_100001431 | |||
| 889 | Ga0097620_100653218 | |||
| 890 | Ga0079104_1000017 | |||
| 891 | Ga0079104_1013999 | |||
| 892 | Ga0079104_1016037 | |||
| 893 | Ga0099826_10029080 | |||
| 894 | Ga0105240_10371230 | |||
| 895 | Ga0105245_10088009 | |||
| 896 | Ga0105245_10579257 | |||
| 897 | Ga0114129_10051750 | |||
| 898 | Ga0105243_10000486 | |||
| 899 | Ga0105243_10003068 | |||
| 900 | Ga0105243_10003231 | |||
| 901 | Ga0105243_10012628 | |||
| 902 | Ga0105242_11676668 | |||
| 903 | Ga0105248_10480134 | |||
| 904 | Ga0105248_10772524 | |||
| 905 | Ga0157347_1001460 | |||
| 906 | Ga0157373_10126088 | |||
| 907 | Ga0157370_10014128 | |||
| 908 | Ga0157370_10614824 | |||
| 909 | Ga0163162_10256232 | |||
| 910 | Ga0163162_10274397 | |||
| 911 | Ga0163162_10475418 | |||
| 912 | Ga0157372_10280863 | |||
| 913 | Ga0157375_10121684 | |||
| 914 | Ga0157375_10177301 | |||
| 915 | Ga0157375_10205853 | |||
| 916 | Ga0157380_10618780 | |||
| 917 | Ga0182008_10000093 | |||
| 918 | Ga0182008_10001960 | |||
| 919 | Ga0182008_10009359 | |||
| 920 | Ga0182008_10018987 | |||
| 921 | Ga0182008_10094641 | |||
| 922 | Ga0157377_10000035 | |||
| 923 | Ga0157379_10361175 | |||
| 924 | Ga0157376_10163245 | |||
| 925 | Ga0157376_10578051 | |||
| 926 | Ga0182006_1001354 | |||
| 927 | Ga0163161_10001250 | |||
| 928 | Ga0163161_10110174 | |||
| 929 | Ga0163161_10126217 | |||
| 930 | Ga0213872_10009993 | |||
| 931 | Ga0209435_100001 | |||
| 932 | Ga0209436_101446 | |||
| 933 | Ga0209672_100222 | |||
| 934 | Ga0209147_100435 | |||
| 935 | Ga0209258_100048 | |||
| 936 | Ga0207425_1000786 | |||
| 937 | Ga0207425_1001555 | |||
| 938 | Ga0207425_1010433 | |||
| 939 | Ga0207425_1034381 | |||
| 940 | Ga0209646_1000001 | |||
| 941 | Ga0209026_1000001 | |||
| 942 | Ga0209148_1000040 | |||
| 943 | Ga0209759_1000001 | |||
| 944 | Ga0209129_1000007 | |||
| 945 | Ga0209129_1001205 | |||
| 946 | Ga0209129_1006871 | |||
| 947 | Ga0209129_1019697 | |||
| 948 | Ga0209565_1000153 | |||
| 949 | Ga0209565_1001390 | |||
| 950 | Ga0209565_1003425 | |||
| 951 | Ga0209565_1005018 | |||
| 952 | Ga0209565_1009673 | |||
| 953 | Ga0209565_1023257 | |||
| 954 | Ga0209673_1000423 | |||
| 955 | Ga0209673_1000566 | |||
| 956 | Ga0209673_1000801 | |||
| 957 | Ga0209673_1024378 | |||
| 958 | Ga0209673_1050910 | |||
| 959 | Ga0209130_1000041 | |||
| 960 | Ga0209130_1000953 | |||
| 961 | Ga0209130_1001018 | |||
| 962 | Ga0209130_1001734 | |||
| 963 | Ga0209675_1000150 | |||
| 964 | Ga0209675_1001481 | |||
| 965 | Ga0209675_1002237 | |||
| 966 | Ga0209675_1002661 | |||
| 967 | Ga0209675_1002884 | |||
| 968 | Ga0209675_1015968 | |||
| 969 | Ga0209675_1021121 | |||
| 970 | Ga0209675_1028625 | |||
| 971 | Ga0209675_1035537 | |||
| 972 | Ga0209676_1000004 | |||
| 973 | Ga0209676_1000054 | |||
| 974 | Ga0209676_1000735 | |||
| 975 | Ga0209676_1001743 | |||
| 976 | Ga0209676_1002326 | |||
| 977 | Ga0209676_1002586 | |||
| 978 | Ga0209676_1004231 | |||
| 979 | Ga0209676_1015972 | |||
| 980 | Ga0209025_1000217 | |||
| 981 | Ga0209025_1000278 | |||
| 982 | Ga0209025_1001179 | |||
| 983 | Ga0209025_1003927 | |||
| 984 | Ga0209025_1006669 | |||
| 985 | Ga0209025_1029535 | |||
| 986 | Ga0209025_1031916 | |||
| 987 | Ga0209025_1064423 | |||
| 988 | Ga0209564_1000915 | |||
| 989 | Ga0209564_1002066 | |||
| 990 | Ga0209564_1007036 | |||
| 991 | Ga0209758_1000025 | |||
| 992 | Ga0209758_1002316 | |||
| 993 | Ga0209758_1047685 | |||
| 994 | Ga0209050_1000002 | |||
| 995 | Ga0209050_1000066 | |||
| 996 | Ga0209050_1000651 | |||
| 997 | Ga0209050_1000861 | |||
| 998 | Ga0209050_1002866 | |||
| 999 | Ga0209050_1012119 | |||
| 1000 | Ga0209050_1026025 | |||
| 1001 | Ga0209256_1000003 | |||
| 1002 | Ga0209256_1000011 | |||
| 1003 | Ga0209256_1000067 | |||
| 1004 | Ga0209256_1000366 | |||
| 1005 | Ga0207426_1000001 | |||
| 1006 | Ga0207426_1000028 | |||
| 1007 | Ga0207426_1000061 | |||
| 1008 | Ga0209051_1000002 | |||
| 1009 | Ga0209051_1000024 | |||
| 1010 | Ga0209051_1000044 | |||
| 1011 | Ga0209051_1000049 | |||
| 1012 | Ga0209051_1000096 | |||
| 1013 | Ga0209051_1000430 | |||
| 1014 | Ga0209051_1000532 | |||
| 1015 | Ga0209051_1000913 | |||
| 1016 | Ga0209051_1004959 | |||
| 1017 | Ga0209051_1013466 | |||
| 1018 | Ga0209257_1000002 | |||
| 1019 | Ga0209257_1000012 | |||
| 1020 | Ga0209257_1000072 | |||
| 1021 | Ga0209257_1000082 | |||
| 1022 | Ga0209257_1001131 | |||
| 1023 | Ga0209257_1005948 | |||
| 1024 | Ga0209257_1013234 | |||
| 1025 | Ga0209257_1017381 | |||
| 1026 | Ga0207656_10079144 | |||
| 1027 | Ga0207682_10132721 | |||
| 1028 | Ga0207680_10172384 | |||
| 1029 | Ga0207645_10356221 | |||
| 1030 | Ga0207643_10353005 | |||
| 1031 | Ga0207705_10267575 | |||
| 1032 | Ga0207705_10371042 | |||
| 1033 | Ga0207654_10597833 | |||
| 1034 | Ga0207695_10612545 | |||
| 1035 | Ga0207657_10150341 | |||
| 1036 | Ga0207649_10016746 | |||
| 1037 | Ga0207649_10152945 | |||
| 1038 | Ga0207687_11072644 | |||
| 1039 | Ga0207644_10197781 | |||
| 1040 | Ga0207644_10622715 | |||
| 1041 | Ga0207690_10001103 | |||
| 1042 | Ga0207706_10023334 | |||
| 1043 | Ga0207706_10764444 | |||
| 1044 | Ga0207709_10000193 | |||
| 1045 | Ga0207709_10000348 | |||
| 1046 | Ga0207709_10001710 | |||
| 1047 | Ga0207709_10006258 | |||
| 1048 | Ga0207709_10007492 | |||
| 1049 | Ga0207669_10088010 | |||
| 1050 | Ga0207691_10098794 | |||
| 1051 | Ga0207691_10329808 | |||
| 1052 | Ga0207711_10948082 | |||
| 1053 | Ga0207689_10337837 | |||
| 1054 | Ga0207679_10000368 | |||
| 1055 | Ga0207679_10122288 | |||
| 1056 | Ga0207667_10119720 | |||
| 1057 | Ga0207651_10240124 | |||
| 1058 | Ga0207651_10557872 | |||
| 1059 | Ga0207668_10162279 | |||
| 1060 | Ga0207640_10159836 | |||
| 1061 | Ga0207658_10036451 | |||
| 1062 | Ga0207658_11106100 | |||
| 1063 | Ga0207677_10217484 | |||
| 1064 | Ga0207703_10510039 | |||
| 1065 | Ga0207703_11152408 | |||
| 1066 | Ga0207639_10013989 | |||
| 1067 | Ga0207639_10247606 | |||
| 1068 | Ga0207639_10288915 | |||
| 1069 | Ga0207678_10000500 | |||
| 1070 | Ga0207678_10422184 | |||
| 1071 | Ga0207648_10000040 | |||
| 1072 | Ga0207648_10466209 | |||
| 1073 | Ga0207676_10604803 | |||
| 1074 | Ga0207674_10091491 | |||
| 1075 | Ga0207674_10185677 | |||
| 1076 | Ga0207683_10162903 | |||
| 1077 | Ga0207683_10406234 | |||
| 1078 | Ga0207683_10433370 | |||
| 1079 | Ga0207683_10986136 | |||
| 1080 | Ga0207683_11020196 | |||
| 1081 | Ga0207698_10087558 | |||
| 1082 | Ga0209281_1000020 | |||
| 1083 | Ga0209281_1000042 | |||
| 1084 | Ga0209973_1010653 | |||
| 1085 | Ga0209970_1001115 | |||
| 1086 | Ga0209983_1119185 | |||
| 1087 | Ga0209282_1010228 | |||
| 1088 | Ga0209974_10001570 | |||
| 1089 | Ga0209974_10040175 | |||
| 1090 | Ga0209974_10075366 | |||
| 1091 | Ga0207428_10365639 | |||
| 1092 | Ga0268266_10014410 | |||
| 1093 | Ga0268266_10815724 | |||
| 1094 | Ga0268265_10172957 | |||
| 1095 | Ga0268264_10233395 | |||
| 1096 | Ga0307517_10000805 | |||
| 1097 | Ga0307517_10479431 | |||
| 1098 | Ga0307515_10000053 | |||
| 1099 | Ga0307515_10001032 | |||
| 1100 | Ga0307515_10001342 | |||
| 1101 | Ga0307515_10002612 | |||
| 1102 | Ga0307515_10013171 | |||
| 1103 | Ga0307515_10019472 | |||
| 1104 | Ga0307515_10084485 | |||
| 1105 | Ga0307515_10314414 | |||
| 1106 | Ga0307515_10570329 | |||
| 1107 | Ga0307512_10019179 | |||
| 1108 | Ga0307512_10044313 | |||
| 1109 | Ga0307512_10115617 | |||
| 1110 | Ga0316177_1181706 | |||
| 1111 | Ga0316176_1208777 | |||
| 1112 | Ga0314311_1026962 | |||
| 1113 | Ga0316179_1036211 | |||
| 1114 | Ga0316178_1055728 | |||
| 1115 | Ga0316180_1157758 | |||
| 1116 | Ga0316183_1008427 | |||
| 1117 | Ga0316183_1017320 | |||
| 1118 | Ga0316181_1160208 | |||
| 1119 | Ga0316182_1388978 | |||
| 1120 | Ga0265330_10000675 | |||
| 1121 | Ga0265332_10000002 | |||
| 1122 | Ga0265332_10000003 | |||
| 1123 | Ga0265328_10214773 | |||
| 1124 | Ga0265325_10035119 | |||
| 1125 | Ga0265340_10009932 | |||
| 1126 | Ga0265327_10000640 | |||
| 1127 | Ga0265327_10023188 | |||
| 1128 | Ga0307513_10000285 | |||
| 1129 | Ga0307513_10084111 | |||
| 1130 | Ga0307513_10279241 | |||
| 1131 | Ga0307513_10818655 | |||
| 1132 | Ga0307509_10001946 | |||
| 1133 | Ga0307509_10045814 | |||
| 1134 | Ga0307509_10078909 | |||
| 1135 | Ga0307509_10251580 | |||
| 1136 | Ga0307509_10310849 | |||
| 1137 | Ga0307408_100008062 | |||
| 1138 | Ga0307408_100008200 | |||
| 1139 | Ga0307408_100076543 | |||
| 1140 | Ga0307408_100096423 | |||
| 1141 | Ga0307408_100352697 | |||
| 1142 | Ga0307408_100362532 | |||
| 1143 | Ga0307508_10000004 | |||
| 1144 | Ga0307508_10000078 | |||
| 1145 | Ga0307508_10002611 | |||
| 1146 | Ga0307514_10023123 | |||
| 1147 | Ga0307514_10032879 | |||
| 1148 | Ga0265314_10000012 | |||
| 1149 | Ga0307516_10009495 | |||
| 1150 | Ga0307516_10046323 | |||
| 1151 | Ga0307516_10285418 | |||
| 1152 | Ga0307516_10286274 | |||
| 1153 | Ga0307516_10433175 | |||
| 1154 | Ga0307516_10455297 | |||
| 1155 | Ga0307405_10093525 | |||
| 1156 | Ga0307405_10110081 | |||
| 1157 | Ga0307405_10310694 | |||
| 1158 | Ga0307405_10427985 | |||
| 1159 | Ga0307405_10444466 | |||
| 1160 | Ga0307405_10521100 | |||
| 1161 | Ga0307405_10548974 | |||
| 1162 | Ga0307410_10176786 | |||
| 1163 | Ga0307406_10084134 | |||
| 1164 | Ga0307406_10084329 | |||
| 1165 | Ga0307406_10237368 | |||
| 1166 | Ga0307406_10482323 | |||
| 1167 | Ga0307407_10265419 | |||
| 1168 | Ga0307412_10021895 | |||
| 1169 | Ga0307412_10031954 | |||
| 1170 | Ga0307412_10105019 | |||
| 1171 | Ga0307412_10373355 | |||
| 1172 | Ga0307412_10674874 | |||
| 1173 | Ga0307416_100258600 | |||
| 1174 | Ga0307416_101057913 | |||
| 1175 | Ga0307411_10043221 | |||
| 1176 | Ga0307411_10154442 | |||
| 1177 | Ga0307411_11167906 | |||
| 1178 | Ga0307415_101110832 | |||
| 1179 | Ga0307507_10164168 | |||
| 1180 | Ga0307510_10017087 | |||
| 1181 | Ga0307510_10041763 | |||
| 1182 | Ga0373928_0015290 | |||
| 1183 | Ga0373932_0057300 | |||
| 1184 | Ga0373937_0498956 | |||
| 1185 | Ga0373925_0596284 | |||
| 1186 | Ga0395900_0050252 | |||
| 1187 | Ga0395900_0414718 | |||
| 1188 | Ga0395898_0010705 | |||
| 1189 | Ga0395905_0036288 | |||
| 1190 | Ga0395905_0037264 | |||
| 1191 | Ga0395905_0088118 | |||
| 1192 | Ga0395901_0084441 | |||
| 1193 | Ga0436361_0474781 | |||
| 1194 | Ga0439436_0019407 | |||
| 1195 | Ga0439439_0000304 | |||
| 1196 | Ga0439461_0003861 | |||
| 1197 | Ga0439461_0022695 | |||
| 1198 | Ga0439466_0002298 | |||
| 1199 | Ga0439466_0032790 | |||
| 1200 | Ga0439465_0001722 | |||
| 1201 | Ga0451791_1504222 | |||
| 1202 | Ga0451791_1831968 | |||
| 1203 | Ga0451793_0420993 | |||
| 1204 | Ga0451793_0790542 | |||
| 1205 | Ga0451795_0269663 | |||
| 1206 | Ga0451798_0014371 | |||
| 1207 | Ga0451800_0719183 | |||
| 1208 | Ga0451802_0064298 | |||
| 1209 | Ga0451802_1637868 | |||
| 1210 | Ga0451839_0261286 | |||
| 1211 | Ga0451839_0744399 | |||
| 1212 | Ga0451847_0695134 | |||
| 1213 | Ga0451851_0477554 | |||
| 1214 | Ga0451851_0721193 | |||
| 1215 | Ga0439431_0002206 | |||
| 1216 | Ga0439431_0011466 | |||
| 1217 | Ga0439445_0000315 | |||
| 1218 | Ga0439432_002851 | |||
| 1219 | Ga0439432_018080 | |||
| 1220 | Ga0439449_0002911 | |||
| 1221 | Ga0439449_0004348 | |||
| 1222 | Ga0439449_0009187 | |||
| 1223 | Ga0439452_001163 | |||
| 1224 | Ga0439452_023585 | |||
| 1225 | Ga0439457_006138 | |||
| 1226 | Ga0439457_043301 | |||
| 1227 | Ga0439462_0003203 | |||
| 1228 | Ga0439462_0003593 | |||
| 1229 | Ga0450912_001147 | |||
| 1230 | Ga0450897_002784 | |||
| 1231 | Ga0450896_014578 | |||
| 1232 | Ga0450905_027826 | |||
| 1233 | Ga0450906_042330 | |||
| 1234 | Ga0439446_0006142 | |||
| 1235 | Ga0439446_0046454 | |||
| 1236 | Ga0439458_0083748 | |||
| 1237 | Ga0450909_003341 | |||
| 1238 | Ga0439434_0002020 | |||
| 1239 | Ga0439434_0026783 | |||
| 1240 | Ga0439459_0049516 | |||
| 1241 | Ga0439459_0067137 | |||
| 1242 | Ga0439464_0004567 | |||
| 1243 | Ga0439460_0237228 | |||
| 1244 | Ga0450893_0000990 | |||
| 1245 | Ga0451577_0924304 | |||
| 1246 | Ga0451577_1183741 | |||
| 1247 | Ga0453684_0440397 | |||
| 1248 | Ga0451576_0123662 | |||
| 1249 | Ga0466967_0850764 | |||
| 1250 | Ga0495592_0008709 | |||
| 1251 | Ga0495603_0312211 | |||
| 1252 | Ga0495629_0285901 | |||
| 1253 | Ga0495638_0117704 | |||
| 1254 | Ga0495582_0102426 | |||
| 1255 | Ga0495639_0028807 | |||
| 1256 | Ga0495610_0023385 | |||
| 1257 | Ga0495610_0025850 | |||
| 1258 | Ga0495610_0167991 | |||
| 1259 | Ga0495616_0020913 | |||
| 1260 | Ga0495620_0010437 | |||
| 1261 | Ga0495620_0091302 | |||
| 1262 | Ga0495628_0280774 | |||
| 1263 | Ga0495630_0318281 | |||
| 1264 | Ga0495631_0002748 | |||
| 1265 | Ga0495632_0009715 | |||
| 1266 | Ga0495632_0056661 | |||
| 1267 | Ga0495637_0029215 | |||
| 1268 | Ga0495637_0072987 | |||
| 1269 | Ga0495637_0174877 | |||
| 1270 | Ga0495663_0087722 | |||
| 1271 | Ga0495642_0156357 | |||
| 1272 | Ga0495642_0353304 | |||
| 1273 | Ga0495654_0216249 | |||
| 1274 | Ga0495654_0363409 | |||
| 1275 | Ga0495586_0085991 | |||
| 1276 | Ga0495609_0118628 | |||
| 1277 | Ga0495621_0006967 | |||
| 1278 | Ga0495621_0081071 | |||
| 1279 | Ga0495621_0099636 | |||
| 1280 | Ga0495621_0153126 | |||
| 1281 | Ga0495597_0000153 | |||
| 1282 | Ga0495645_0305402 | |||
| 1283 | Ga0495622_0092513 | |||
| 1284 | Ga0495633_0000827 | |||
| 1285 | Ga0495633_0117411 | |||
| 1286 | Ga0495656_0000929 | |||
| 1287 | Ga0495656_0145278 | |||
| 1288 | Ga0495656_0342951 | |||
| 1289 | Ga0495668_0389801 | |||
| 1290 | Ga0495634_0633094 | |||
| 1291 | Ga0495625_0015771 | |||
| 1292 | Ga0495625_0051251 | |||
| 1293 | Ga0495659_0174097 | |||
| 1294 | Ga0495588_0063669 | |||
| 1295 | Ga0495588_0101704 | |||
| 1296 | Ga0495588_0204802 | |||
| 1297 | Ga0495588_0316590 | |||
| 1298 | Ga0495658_0039537 | |||
| 1299 | Ga0495658_0079416 | |||
| 1300 | Ga0495669_0272242 | |||
| 1301 | Ga0495670_0029469 | |||
| 1302 | Ga0495670_0130388 | |||
| 1303 | Ga0495671_0019317 | |||
| 1304 | Ga0495676_0007147 | |||
| 1305 | Ga0495676_0133099 | |||
| 1306 | Ga0495677_0019590 | |||
| 1307 | Ga0495677_0053846 | |||
| 1308 | Ga0495685_030533 | |||
| 1309 | Ga0495681_0221901 | |||
| 1310 | Ga0495686_0047420 | |||
| 1311 | Ga0495593_0006672 | |||
| 1312 | Ga0495602_0158368 | |||
| 1313 | Ga0496100_0348704 | |||
| 1314 | Ga0496101_0021483 | |||
| 1315 | Ga0496102_0059818 | |||
| 1316 | Ga0496102_0109713 | |||
| 1317 | Ga0496103_0015478 | |||
| 1318 | Ga0496104_0102630 | |||
| 1319 | Ga0496104_0193783 | |||
| 1320 | Ga0496105_0005071 | |||
| 1321 | Ga0496105_0031820 | |||
| 1322 | Ga0496106_0081178 | |||
| 1323 | Ga0496107_0083157 | |||
| 1324 | Ga0496107_0156616 | |||
| 1325 | Ga0496108_0093704 | |||
| 1326 | Ga0496110_0027229 | |||
| 1327 | Ga0496110_0117537 | |||
| 1328 | Ga0496110_0956566 | |||
| 1329 | Ga0496110_1586368 | |||
| 1330 | Ga0496111_0030572 | |||
| 1331 | Ga0496111_0373726 | |||
| 1332 | Ga0496113_0270259 | |||
| 1333 | Ga0496114_0004085 | |||
| 1334 | Ga0496114_0091093 | |||
| 1335 | Ga0496114_0821022 | |||
| 1336 | Ga0496114_0855851 | |||
| 1337 | Ga0496115_0385765 | |||
| 1338 | Ga0496116_0080697 | |||
| 1339 | Ga0496117_0038912 | |||
| 1340 | Ga0496117_0071291 | |||
| 1341 | Ga0496117_0302614 | |||
| 1342 | Ga0496118_0032460 | |||
| 1343 | Ga0496118_0180480 | |||
| 1344 | Ga0496119_0190562 | |||
| 1345 | Ga0496121_0050847 | |||
| 1346 | Ga0496121_0132622 | |||
| 1347 | Ga0496122_0000103 | |||
| 1348 | Ga0496122_0056621 | |||
| 1349 | Ga0496122_0118048 | |||
| 1350 | Ga0496123_0000261 | |||
| 1351 | Ga0496123_0020532 | |||
| 1352 | Ga0496123_0245793 | |||
| 1353 | Ga0496124_0051070 | |||
| 1354 | Ga0496124_0082070 | |||
| 1355 | Ga0496124_0102304 | |||
| 1356 | Ga0496124_0123885 | |||
| 1357 | Ga0496125_0007765 | |||
| 1358 | Ga0496125_0031217 | |||
| 1359 | Ga0496125_0037783 | |||
| 1360 | Ga0496125_0134457 | |||
| 1361 | Ga0496125_0140009 | |||
| 1362 | Ga0496125_0336233 | |||
| 1363 | Ga0501034_0381306 | |||
| 1364 | Ga0501046_0119725 | |||
| 1365 | Ga0501047_0092095 | |||
| 1366 | Ga0501238_001607 | |||
| 1367 | Ga0501249_011971 | |||
| 1368 | Ga0501257_048914 | |||
| 1369 | Ga0501225_0008398 | |||
| 1370 | Ga0501035_0151722 | |||
| 1371 | Ga0501044_0144395 | |||
| 1372 | nmdc:mga03683_103702_c1 | |||
| 1373 | nmdc:mga03683_229640_c1 | |||
| 1374 | nmdc:mga03683_36449_c1 | |||
| 1375 | nmdc:mga03683_71279_c1 | |||
| 1376 | nmdc:mga03683_77769_c1 | |||
| 1377 | nmdc:mga03n38_126332_c1 | |||
| 1378 | nmdc:mga03n38_19647_c1 | |||
| 1379 | nmdc:mga03n38_238081_c1 | |||
| 1380 | nmdc:mga03n38_445120_c1 | |||
| 1381 | nmdc:mga00v17_25049_c1 | |||
| 1382 | nmdc:mga00v17_36752_c1 | |||
| 1383 | nmdc:mga00v17_484765_c1 | |||
| 1384 | nmdc:mga0yw44_2117_c1 | |||
| 1385 | nmdc:mga0yw44_302968_c1 | |||
| 1386 | nmdc:mga0yw44_404770_c1 | |||
| 1387 | nmdc:mga0k408_110780_c1 | |||
| 1388 | nmdc:mga0k408_13250_c1 | |||
| 1389 | nmdc:mga0k408_167179_c1 | |||
| 1390 | nmdc:mga0k408_181128_c1 | |||
| 1391 | nmdc:mga0k408_189872_c1 | |||
| 1392 | nmdc:mga0k408_22221_c1 | |||
| 1393 | nmdc:mga0k408_224887_c1 | |||
| 1394 | nmdc:mga0k408_78454_c1 | |||
| 1395 | nmdc:mga06z11_140247_c1 | |||
| 1396 | nmdc:mga06z11_225563_c1 | |||
| 1397 | nmdc:mga06z11_578311_c1 | |||
| 1398 | nmdc:mga07m45_102670_c1 | |||
| 1399 | nmdc:mga07m45_104831_c1 | |||
| 1400 | nmdc:mga07m45_10794_c1 | |||
| 1401 | nmdc:mga07m45_14093_c1 | |||
| 1402 | nmdc:mga07m45_178190_c1 | |||
| 1403 | nmdc:mga07m45_23747_c1 | |||
| 1404 | nmdc:mga07m45_614236_c1 | |||
| 1405 | nmdc:mga07m45_8991_c1 | |||
| 1406 | nmdc:mga09592_18661_c1 | |||
| 1407 | nmdc:mga0qj67_74358_c1 | |||
| 1408 | nmdc:mga0sz30_33160_c2 | |||
| 1409 | nmdc:mga0sz30_59406_c1 | |||
| 1410 | Ga0500610_0013258 | |||
| 1411 | Ga0500610_0087266 | |||
| 1412 | Ga0495619_0224718 | |||
| 1413 | Ga0500643_013594 | |||
| 1414 | Ga0500643_054543 | |||
| 1415 | Ga0500644_0003921 | |||
| 1416 | Ga0500644_0148631 | |||
| 1417 | Ga0500646_0019967 | |||
| 1418 | Ga0500583_0238538 | |||
| 1419 | Ga0500651_0000430 | |||
| 1420 | Ga0500651_0042063 | |||
| 1421 | Ga0500651_0347233 | |||
| 1422 | Ga0500650_0101407 | |||
| 1423 | Ga0500562_028292 | |||
| 1424 | Ga0500569_082281 | |||
| 1425 | Ga0500571_000252 | |||
| 1426 | Ga0500592_047966 | |||
| 1427 | Ga0500593_000652 | |||
| 1428 | Ga0500593_002060 | |||
| 1429 | Ga0500593_002533 | |||
| 1430 | Ga0500594_0000441 | |||
| 1431 | Ga0500607_001874 | |||
| 1432 | Ga0500608_003111 | |||
| 1433 | Ga0500614_053718 | |||
| 1434 | Ga0500618_038162 | |||
| 1435 | Ga0500626_028311 | |||
| 1436 | Ga0500642_0003789 | |||
| 1437 | Ga0500652_000307 | |||
| 1438 | Ga0500655_001160 | |||
| 1439 | Ga0500658_0000352 | |||
| 1440 | Ga0500658_0003377 | |||
| 1441 | Ga0500658_0283932 | |||
| 1442 | Ga0500559_0000191 | |||
| 1443 | Ga0500559_0001027 | |||
| 1444 | Ga0500559_0011898 | |||
| 1445 | Ga0500559_0024763 | |||
| 1446 | Ga0500561_0148396 | |||
| 1447 | Ga0500564_047935 | |||
| 1448 | Ga0500568_0013994 | |||
| 1449 | Ga0500573_0111477 | |||
| 1450 | Ga0500574_002382 | |||
| 1451 | Ga0500577_0014789 | |||
| 1452 | Ga0500590_055132 | |||
| 1453 | Ga0500604_0130019 | |||
| 1454 | Ga0500619_001373 | |||
| 1455 | Ga0500619_060043 | |||
| 1456 | Ga0500622_0000160 | |||
| 1457 | Ga0500622_0001454 | |||
| 1458 | Ga0500622_0084018 | |||
| 1459 | Ga0500624_004796 | |||
| 1460 | Ga0500634_0016453 | |||
| 1461 | Ga0500634_0028221 | |||
| 1462 | Ga0500638_003518 | |||
| 1463 | Ga0500636_0336229 | |||
| 1464 | Ga0500636_0353385 | |||
| 1465 | Ga0500570_060968 | |||
| 1466 | Ga0500645_003389 | |||
| 1467 | Ga0500645_036265 | |||
| 1468 | Ga0500596_005608 | |||
| 1469 | Ga0500587_000344 | |||
| 1470 | Ga0500587_002693 | |||
| 1471 | Ga0500661_036114 | |||
| 1472 | Ga0590075_006111 | |||
| 1473 | Ga0587111_0088833 | |||
| 1474 | 2904480509 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bvo-assembly1.cif.gz_A | crystal structure of human co-chaperone protein hscb | 0.9129 | 1 | 167 |
| 2qsa-assembly1.cif.gz_A | crystal structure of j-domain of dnaj homolog dnj-2 precursor from c.elegans. | 0.9093 | 5 | 78 |
| 1fpo-assembly1.cif.gz_A | hsc20 (hscb), a j-type co-chaperone from e. coli | 0.9028 | 5 | 170 |
| 4it5-assembly1.cif.gz_D | chaperone hscb from vibrio cholerae | 0.9 | 6 | 170 |
| 3bvo-assembly1.cif.gz_A | crystal structure of human co-chaperone protein hscb | 0.878 | 1 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fpoC01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9626 | 5 | 82 | 1.10.287.110 |
| af_Q54PV9_19_125_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9369 | 4 | 74 | 1.10.287.110 |
| 1fpoC01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9346 | 5 | 82 | 1.10.287.110 |
| 3uo2A02 | Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain | 0.9342 | 94 | 164 | 1.20.1280.20 |
| 1fpoB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9339 | 5 | 82 | 1.10.287.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3MPA3-F1-model_v4 | deleted | 0.9845 | 1 | 74 |
|
| AF-A0A6N8IN41-F1-model_v4 | Co-chaperone protein HscB homolog | 0.9745 | 1 | 172 |
GO:0001671
GO:0006457 GO:0044571 GO:0051087 GO:0051259 GO:0097428 GO:1990230 |
| AF-A0A7Y3NEB8-F1-model_v4 | Co-chaperone protein HscB homolog | 0.963 | 2 | 171 |
GO:0001671
GO:0006457 GO:0044571 GO:0051087 GO:0051259 GO:0097428 GO:1990230 |
| AF-A0A7X8UZG2-F1-model_v4 | deleted | 0.9609 | 1 | 172 |
|
| AF-A0A4Q3MPA3-F1-model_v4 | deleted | 0.959 | 1 | 74 |
|