F478348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 737 | 332 | 1474 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300046689|Ga0495613_0141322|Ga0495613_0141322_1179_1661 |
| Length | 160 |
| Sequence | MSRVSRRRTVSAPVEDVWDLVSDPYSLPRWWPRTTRVENVDRKGGGRRSEWTKVLETAEGRGVRADYRCLSSAKDERYVWEQQLAGTPFERHLSSSKLEIALSPDGGGTKVALTAEQALRGMSRLGSPMMRRGQGAILEEALDGIERALRATPPDRAMDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 200 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 326 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 327 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 328 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 330 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.81 |
| Nodule | 0 |
| Rhizoplane | 10.04 |
| Rhizosphere | 85.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495613_0141322 | 3300046689 | Bacteria | 1720 |
| 2 | CNAas_1010051 | 3300000532 | Unclassified | 631 |
| 3 | JGI24746J21847_1000327 | 3300001977 | Bacteria | 6834 |
| 4 | JGI24740J21852_10010017 | 3300001979 | Bacteria | 3671 |
| 5 | JGI24748J21848_1000399 | 3300002074 | Bacteria | 4890 |
| 6 | JGI24034J26672_10000295 | 3300002239 | Bacteria | 6595 |
| 7 | JGI24742J22300_10000807 | 3300002244 | Bacteria | 4770 |
| 8 | JGI25404J52841_10002140 | 3300003659 | Bacteria | 3678 |
| 9 | Ga0070658_10458988 | 3300005327 | Bacteria | 1098 |
| 10 | Ga0070676_10093435 | 3300005328 | Bacteria | 1847 |
| 11 | Ga0070683_100008965 | 3300005329 | Bacteria | 8527 |
| 12 | Ga0070683_100011762 | 3300005329 | Bacteria | 7578 |
| 13 | Ga0070683_100023826 | 3300005329 | Bacteria | 5479 |
| 14 | Ga0070683_100032396 | 3300005329 | Bacteria | 4760 |
| 15 | Ga0070683_100142266 | 3300005329 | Bacteria | 2273 |
| 16 | Ga0070683_100212994 | 3300005329 | Bacteria | 1835 |
| 17 | Ga0070683_100542708 | 3300005329 | Bacteria | 1112 |
| 18 | Ga0070670_100078292 | 3300005331 | Bacteria | 2840 |
| 19 | Ga0070677_10000091 | 3300005333 | Bacteria | 29146 |
| 20 | Ga0068869_100059016 | 3300005334 | Bacteria | 2808 |
| 21 | Ga0070666_10010263 | 3300005335 | Bacteria | 5854 |
| 22 | Ga0070680_100462285 | 3300005336 | Bacteria | 1084 |
| 23 | Ga0070682_100000075 | 3300005337 | Bacteria | 90547 |
| 24 | Ga0070682_100090018 | 3300005337 | Bacteria | 2005 |
| 25 | Ga0070682_100966203 | 3300005337 | Bacteria | 705 |
| 26 | Ga0068868_100000355 | 3300005338 | Bacteria | 31041 |
| 27 | Ga0068868_100010121 | 3300005338 | Bacteria | 6813 |
| 28 | Ga0068868_100071876 | 3300005338 | Bacteria | 2759 |
| 29 | Ga0068868_101445549 | 3300005338 | Bacteria | 642 |
| 30 | Ga0070660_100343343 | 3300005339 | Bacteria | 1229 |
| 31 | Ga0070689_100060950 | 3300005340 | Bacteria | 2934 |
| 32 | Ga0070689_100915981 | 3300005340 | Bacteria | 776 |
| 33 | Ga0070691_10000021 | 3300005341 | Bacteria | 45268 |
| 34 | Ga0070691_10000135 | 3300005341 | Bacteria | 22871 |
| 35 | Ga0070691_10008966 | 3300005341 | Bacteria | 4576 |
| 36 | Ga0070691_10111101 | 3300005341 | Bacteria | 1371 |
| 37 | Ga0070691_10175064 | 3300005341 | Bacteria | 1114 |
| 38 | Ga0070661_100286714 | 3300005344 | Bacteria | 1279 |
| 39 | Ga0070661_100534170 | 3300005344 | Bacteria | 942 |
| 40 | Ga0070668_100092623 | 3300005347 | Bacteria | 2384 |
| 41 | Ga0070668_100187180 | 3300005347 | Bacteria | 1694 |
| 42 | Ga0070669_101041251 | 3300005353 | Unclassified | 703 |
| 43 | Ga0070675_100001374 | 3300005354 | Bacteria | 17848 |
| 44 | Ga0070675_100794070 | 3300005354 | Unclassified | 865 |
| 45 | Ga0070671_100472693 | 3300005355 | Bacteria | 1077 |
| 46 | Ga0070674_100000005 | 3300005356 | Bacteria | 168443 |
| 47 | Ga0070674_100883349 | 3300005356 | Bacteria | 777 |
| 48 | Ga0070688_100000027 | 3300005365 | Bacteria | 67477 |
| 49 | Ga0070688_100000137 | 3300005365 | Bacteria | 39585 |
| 50 | Ga0070688_100131333 | 3300005365 | Bacteria | 1690 |
| 51 | Ga0070688_100316356 | 3300005365 | Unclassified | 1133 |
| 52 | Ga0070659_100045236 | 3300005366 | Bacteria | 3448 |
| 53 | Ga0070659_100205266 | 3300005366 | Bacteria | 1623 |
| 54 | Ga0070667_100001804 | 3300005367 | Bacteria | 19049 |
| 55 | Ga0070714_100149126 | 3300005435 | Bacteria | 2106 |
| 56 | Ga0070714_101110146 | 3300005435 | Bacteria | 771 |
| 57 | Ga0070713_100000010 | 3300005436 | Bacteria | 151790 |
| 58 | Ga0070713_100030614 | 3300005436 | Bacteria | 4275 |
| 59 | Ga0070710_10111940 | 3300005437 | Bacteria | 1641 |
| 60 | Ga0070711_100156261 | 3300005439 | Bacteria | 1725 |
| 61 | Ga0070705_100965030 | 3300005440 | Bacteria | 690 |
| 62 | Ga0070700_100002745 | 3300005441 | Bacteria | 9000 |
| 63 | Ga0070700_100094584 | 3300005441 | Bacteria | 1957 |
| 64 | Ga0070700_100132328 | 3300005441 | Bacteria | 1685 |
| 65 | Ga0070663_100003515 | 3300005455 | Bacteria | 9048 |
| 66 | Ga0070663_100282888 | 3300005455 | Bacteria | 1322 |
| 67 | Ga0070663_100296890 | 3300005455 | Bacteria | 1292 |
| 68 | Ga0070663_100340140 | 3300005455 | Bacteria | 1212 |
| 69 | Ga0070663_101052481 | 3300005455 | Bacteria | 709 |
| 70 | Ga0070678_100014888 | 3300005456 | Bacteria | 4924 |
| 71 | Ga0070678_100291218 | 3300005456 | Bacteria | 1384 |
| 72 | Ga0070662_100000061 | 3300005457 | Bacteria | 58911 |
| 73 | Ga0070662_100039645 | 3300005457 | Bacteria | 3350 |
| 74 | Ga0070681_10059778 | 3300005458 | Bacteria | 3791 |
| 75 | Ga0070685_10000118 | 3300005466 | Bacteria | 50597 |
| 76 | Ga0070685_10000314 | 3300005466 | Bacteria | 30259 |
| 77 | Ga0070685_10072877 | 3300005466 | Bacteria | 2040 |
| 78 | Ga0070685_10087804 | 3300005466 | Bacteria | 1877 |
| 79 | Ga0070685_10106445 | 3300005466 | Bacteria | 1721 |
| 80 | Ga0070679_100013601 | 3300005530 | Bacteria | 7796 |
| 81 | Ga0070684_100053827 | 3300005535 | Bacteria | 3505 |
| 82 | Ga0070684_100123150 | 3300005535 | Bacteria | 2334 |
| 83 | Ga0070684_100143466 | 3300005535 | Bacteria | 2161 |
| 84 | Ga0070684_100294089 | 3300005535 | Bacteria | 1489 |
| 85 | Ga0068853_100004255 | 3300005539 | Bacteria | 11049 |
| 86 | Ga0068853_100095316 | 3300005539 | Bacteria | 2624 |
| 87 | Ga0068853_100362752 | 3300005539 | Bacteria | 1350 |
| 88 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 89 | Ga0070672_100369010 | 3300005543 | Bacteria | 1226 |
| 90 | Ga0070686_100226354 | 3300005544 | Bacteria | 1354 |
| 91 | Ga0070693_100187036 | 3300005547 | Bacteria | 1337 |
| 92 | Ga0070665_100003200 | 3300005548 | Bacteria | 17614 |
| 93 | Ga0070665_100010272 | 3300005548 | Bacteria | 9472 |
| 94 | Ga0070665_100039215 | 3300005548 | Bacteria | 4763 |
| 95 | Ga0070665_100111465 | 3300005548 | Bacteria | 2738 |
| 96 | Ga0070704_100042551 | 3300005549 | Bacteria | 3143 |
| 97 | Ga0070704_100330457 | 3300005549 | Bacteria | 1280 |
| 98 | Ga0070704_101866755 | 3300005549 | Bacteria | 557 |
| 99 | Ga0068855_100956083 | 3300005563 | Bacteria | 902 |
| 100 | Ga0068855_101286635 | 3300005563 | Bacteria | 757 |
| 101 | Ga0070664_100006766 | 3300005564 | Bacteria | 9244 |
| 102 | Ga0070664_100308394 | 3300005564 | Bacteria | 1432 |
| 103 | Ga0068857_101070703 | 3300005577 | Bacteria | 778 |
| 104 | Ga0068854_100000116 | 3300005578 | Bacteria | 54986 |
| 105 | Ga0068854_100023912 | 3300005578 | Bacteria | 4177 |
| 106 | Ga0068856_100000336 | 3300005614 | Bacteria | 51580 |
| 107 | Ga0068856_100037370 | 3300005614 | Bacteria | 4765 |
| 108 | Ga0070702_100061604 | 3300005615 | Bacteria | 2185 |
| 109 | Ga0070702_100737497 | 3300005615 | Bacteria | 755 |
| 110 | Ga0068852_100000056 | 3300005616 | Bacteria | 76111 |
| 111 | Ga0068852_100010346 | 3300005616 | Bacteria | 6967 |
| 112 | Ga0068852_100042343 | 3300005616 | Bacteria | 3855 |
| 113 | Ga0068864_100000031 | 3300005618 | Bacteria | 215331 |
| 114 | Ga0068864_100014239 | 3300005618 | Bacteria | 6604 |
| 115 | Ga0068866_10000195 | 3300005718 | Bacteria | 28485 |
| 116 | Ga0068866_10015213 | 3300005718 | Bacteria | 3415 |
| 117 | Ga0068861_100051349 | 3300005719 | Bacteria | 3130 |
| 118 | Ga0068861_100405829 | 3300005719 | Bacteria | 1210 |
| 119 | Ga0068851_10000468 | 3300005834 | Bacteria | 17827 |
| 120 | Ga0068851_10001033 | 3300005834 | Bacteria | 12088 |
| 121 | Ga0068863_100028395 | 3300005841 | Bacteria | 5342 |
| 122 | Ga0068863_100123870 | 3300005841 | Bacteria | 2466 |
| 123 | Ga0068863_100224842 | 3300005841 | Bacteria | 1809 |
| 124 | Ga0068858_100000097 | 3300005842 | Bacteria | 91503 |
| 125 | Ga0068858_100037360 | 3300005842 | Bacteria | 4504 |
| 126 | Ga0068858_100154879 | 3300005842 | Bacteria | 2156 |
| 127 | Ga0068860_100066633 | 3300005843 | Bacteria | 3421 |
| 128 | Ga0068860_100214280 | 3300005843 | Bacteria | 1869 |
| 129 | Ga0068860_100342690 | 3300005843 | Bacteria | 1470 |
| 130 | Ga0068862_100001600 | 3300005844 | Bacteria | 20633 |
| 131 | Ga0068862_100096434 | 3300005844 | Bacteria | 2581 |
| 132 | Ga0068862_101652106 | 3300005844 | Bacteria | 648 |
| 133 | Ga0081455_10132787 | 3300005937 | Bacteria | 1944 |
| 134 | Ga0081455_10800476 | 3300005937 | Unclassified | 592 |
| 135 | Ga0081540_1000041 | 3300005983 | Bacteria | 136874 |
| 136 | Ga0081539_10004283 | 3300005985 | Bacteria | 16004 |
| 137 | Ga0075432_10288701 | 3300006058 | Bacteria | 677 |
| 138 | Ga0070715_10090477 | 3300006163 | Bacteria | 1407 |
| 139 | Ga0070716_100090602 | 3300006173 | Bacteria | 1850 |
| 140 | Ga0070712_100042998 | 3300006175 | Bacteria | 3108 |
| 141 | Ga0097621_100231596 | 3300006237 | Bacteria | 1613 |
| 142 | Ga0068871_100111298 | 3300006358 | Bacteria | 2303 |
| 143 | Ga0068871_100968166 | 3300006358 | Bacteria | 791 |
| 144 | Ga0075428_100978568 | 3300006844 | Bacteria | 896 |
| 145 | Ga0075428_101087111 | 3300006844 | Bacteria | 845 |
| 146 | Ga0075430_100036158 | 3300006846 | Bacteria | 4187 |
| 147 | Ga0075430_100613883 | 3300006846 | Unclassified | 897 |
| 148 | Ga0075431_100063469 | 3300006847 | Bacteria | 3812 |
| 149 | Ga0075431_100164786 | 3300006847 | Bacteria | 2278 |
| 150 | Ga0075433_10003996 | 3300006852 | Bacteria | 11414 |
| 151 | Ga0075433_10125560 | 3300006852 | Bacteria | 2279 |
| 152 | Ga0075433_10830415 | 3300006852 | Bacteria | 807 |
| 153 | Ga0075434_100386988 | 3300006871 | Bacteria | 1419 |
| 154 | Ga0068865_100000069 | 3300006881 | Bacteria | 53927 |
| 155 | Ga0075435_100413210 | 3300007076 | Bacteria | 1161 |
| 156 | Ga0105251_10146619 | 3300009011 | Bacteria | 1067 |
| 157 | Ga0105251_10348210 | 3300009011 | Unclassified | 676 |
| 158 | Ga0111539_10024141 | 3300009094 | Bacteria | 7466 |
| 159 | Ga0111539_10112388 | 3300009094 | Bacteria | 3196 |
| 160 | Ga0111539_10176370 | 3300009094 | Bacteria | 2497 |
| 161 | Ga0105245_10000130 | 3300009098 | Bacteria | 72166 |
| 162 | Ga0105245_10000141 | 3300009098 | Bacteria | 68413 |
| 163 | Ga0105245_10008690 | 3300009098 | Bacteria | 8856 |
| 164 | Ga0105245_10028361 | 3300009098 | Bacteria | 4938 |
| 165 | Ga0105247_10000278 | 3300009101 | Bacteria | 47180 |
| 166 | Ga0105247_10045335 | 3300009101 | Bacteria | 2698 |
| 167 | Ga0105247_10575652 | 3300009101 | Bacteria | 831 |
| 168 | Ga0114129_10927142 | 3300009147 | Unclassified | 1102 |
| 169 | Ga0105243_10033298 | 3300009148 | Bacteria | 3985 |
| 170 | Ga0105243_10127755 | 3300009148 | Bacteria | 2153 |
| 171 | Ga0105243_11115052 | 3300009148 | Bacteria | 798 |
| 172 | Ga0105243_11429243 | 3300009148 | Bacteria | 713 |
| 173 | Ga0105242_10000921 | 3300009176 | Bacteria | 22877 |
| 174 | Ga0105242_10002595 | 3300009176 | Bacteria | 14157 |
| 175 | Ga0105242_10173736 | 3300009176 | Bacteria | 1895 |
| 176 | Ga0105242_10225132 | 3300009176 | Bacteria | 1678 |
| 177 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 178 | Ga0105248_10076330 | 3300009177 | Bacteria | 3767 |
| 179 | Ga0105248_10238272 | 3300009177 | Bacteria | 2048 |
| 180 | Ga0105248_12007152 | 3300009177 | Unclassified | 657 |
| 181 | Ga0105237_10426527 | 3300009545 | Unclassified | 1332 |
| 182 | Ga0105237_11002831 | 3300009545 | Bacteria | 842 |
| 183 | Ga0105249_10000332 | 3300009553 | Bacteria | 47770 |
| 184 | Ga0105249_10006073 | 3300009553 | Bacteria | 10467 |
| 185 | Ga0105249_10313847 | 3300009553 | Bacteria | 1577 |
| 186 | Ga0105249_12146140 | 3300009553 | Bacteria | 631 |
| 187 | Ga0105239_10025573 | 3300010375 | Bacteria | 6499 |
| 188 | Ga0105239_10389105 | 3300010375 | Bacteria | 1577 |
| 189 | Ga0105239_11490943 | 3300010375 | Bacteria | 781 |
| 190 | Ga0105239_13597765 | 3300010375 | Bacteria | 503 |
| 191 | Ga0105246_10032872 | 3300011119 | Bacteria | 3444 |
| 192 | Ga0105246_10809397 | 3300011119 | Bacteria | 832 |
| 193 | Ga0157371_10007100 | 3300013102 | Bacteria | 9104 |
| 194 | Ga0157370_10054742 | 3300013104 | Bacteria | 3803 |
| 195 | Ga0157370_10191088 | 3300013104 | Bacteria | 1900 |
| 196 | Ga0157370_10279837 | 3300013104 | Bacteria | 1541 |
| 197 | Ga0157370_12125075 | 3300013104 | Unclassified | 503 |
| 198 | Ga0157369_10000074 | 3300013105 | Bacteria | 136668 |
| 199 | Ga0157369_12291855 | 3300013105 | Bacteria | 547 |
| 200 | Ga0157374_10038937 | 3300013296 | Bacteria | 4372 |
| 201 | Ga0157374_10254938 | 3300013296 | Bacteria | 1727 |
| 202 | Ga0157378_10003612 | 3300013297 | Bacteria | 13692 |
| 203 | Ga0157378_10023644 | 3300013297 | Bacteria | 5405 |
| 204 | Ga0163162_10314267 | 3300013306 | Bacteria | 1699 |
| 205 | Ga0163162_11669252 | 3300013306 | Bacteria | 727 |
| 206 | Ga0157372_10000204 | 3300013307 | Bacteria | 65798 |
| 207 | Ga0157372_10032670 | 3300013307 | Bacteria | 5708 |
| 208 | Ga0157372_11912817 | 3300013307 | Bacteria | 682 |
| 209 | Ga0157375_10000349 | 3300013308 | Bacteria | 41764 |
| 210 | Ga0157375_10004278 | 3300013308 | Bacteria | 12385 |
| 211 | Ga0157375_10314075 | 3300013308 | Bacteria | 1731 |
| 212 | Ga0157375_11053829 | 3300013308 | Bacteria | 951 |
| 213 | Ga0157375_11799550 | 3300013308 | Bacteria | 726 |
| 214 | Ga0157375_12368490 | 3300013308 | Bacteria | 633 |
| 215 | Ga0163163_10550945 | 3300014325 | Unclassified | 1216 |
| 216 | Ga0163163_10819172 | 3300014325 | Unclassified | 994 |
| 217 | Ga0157380_10006147 | 3300014326 | Bacteria | 8419 |
| 218 | Ga0157380_10081236 | 3300014326 | Bacteria | 2651 |
| 219 | Ga0157380_10157809 | 3300014326 | Bacteria | 1968 |
| 220 | Ga0157380_11566060 | 3300014326 | Bacteria | 714 |
| 221 | Ga0157377_10000445 | 3300014745 | Bacteria | 17775 |
| 222 | Ga0157377_10265890 | 3300014745 | Bacteria | 1118 |
| 223 | Ga0157379_10005569 | 3300014968 | Bacteria | 10824 |
| 224 | Ga0157379_10058400 | 3300014968 | Bacteria | 3449 |
| 225 | Ga0157379_10133622 | 3300014968 | Bacteria | 2235 |
| 226 | Ga0157379_10144305 | 3300014968 | Bacteria | 2147 |
| 227 | Ga0157379_10176166 | 3300014968 | Bacteria | 1931 |
| 228 | Ga0157376_10070558 | 3300014969 | Bacteria | 2966 |
| 229 | Ga0206356_11724305 | 3300020070 | Bacteria | 1501 |
| 230 | Ga0207672_1001729 | 3300025223 | Bacteria | 1515 |
| 231 | Ga0207656_10000751 | 3300025321 | Bacteria | 10609 |
| 232 | Ga0207656_10023777 | 3300025321 | Bacteria | 2471 |
| 233 | Ga0207653_10084503 | 3300025885 | Unclassified | 1103 |
| 234 | Ga0207692_10682274 | 3300025898 | Unclassified | 666 |
| 235 | Ga0207642_10001193 | 3300025899 | Bacteria | 8011 |
| 236 | Ga0207642_10002040 | 3300025899 | Bacteria | 6229 |
| 237 | Ga0207642_10192895 | 3300025899 | Bacteria | 1119 |
| 238 | Ga0207710_10000502 | 3300025900 | Bacteria | 24324 |
| 239 | Ga0207688_10002520 | 3300025901 | Bacteria | 9878 |
| 240 | Ga0207680_10043395 | 3300025903 | Bacteria | 2637 |
| 241 | Ga0207685_10045505 | 3300025905 | Bacteria | 1665 |
| 242 | Ga0207645_10553227 | 3300025907 | Bacteria | 781 |
| 243 | Ga0207643_10264724 | 3300025908 | Bacteria | 1062 |
| 244 | Ga0207705_10205121 | 3300025909 | Bacteria | 1494 |
| 245 | Ga0207671_10557340 | 3300025914 | Bacteria | 914 |
| 246 | Ga0207693_10015100 | 3300025915 | Bacteria | 6199 |
| 247 | Ga0207663_10029417 | 3300025916 | Bacteria | 3226 |
| 248 | Ga0207663_10902153 | 3300025916 | Bacteria | 707 |
| 249 | Ga0207652_10000867 | 3300025921 | Bacteria | 28615 |
| 250 | Ga0207681_11190819 | 3300025923 | Unclassified | 640 |
| 251 | Ga0207650_10061410 | 3300025925 | Bacteria | 2806 |
| 252 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 253 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 254 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 255 | Ga0207687_10017110 | 3300025927 | Bacteria | 4767 |
| 256 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 257 | Ga0207700_10021763 | 3300025928 | Bacteria | 4385 |
| 258 | Ga0207664_10588084 | 3300025929 | Unclassified | 999 |
| 259 | Ga0207644_10266257 | 3300025931 | Bacteria | 1372 |
| 260 | Ga0207644_11212774 | 3300025931 | Unclassified | 634 |
| 261 | Ga0207690_10002754 | 3300025932 | Bacteria | 10616 |
| 262 | Ga0207690_10102524 | 3300025932 | Bacteria | 2046 |
| 263 | Ga0207706_10000250 | 3300025933 | Bacteria | 58868 |
| 264 | Ga0207706_10021657 | 3300025933 | Bacteria | 5770 |
| 265 | Ga0207686_10000073 | 3300025934 | Bacteria | 92009 |
| 266 | Ga0207686_10002267 | 3300025934 | Bacteria | 10553 |
| 267 | Ga0207686_10093508 | 3300025934 | Bacteria | 1991 |
| 268 | Ga0207686_10129688 | 3300025934 | Bacteria | 1728 |
| 269 | Ga0207709_10007830 | 3300025935 | Bacteria | 5923 |
| 270 | Ga0207709_10677328 | 3300025935 | Bacteria | 823 |
| 271 | Ga0207709_10691067 | 3300025935 | Bacteria | 816 |
| 272 | Ga0207670_10046504 | 3300025936 | Bacteria | 2884 |
| 273 | Ga0207670_10262061 | 3300025936 | Bacteria | 1340 |
| 274 | Ga0207670_10705412 | 3300025936 | Bacteria | 835 |
| 275 | Ga0207669_10000006 | 3300025937 | Bacteria | 176348 |
| 276 | Ga0207669_10086413 | 3300025937 | Bacteria | 2028 |
| 277 | Ga0207704_10000049 | 3300025938 | Bacteria | 83173 |
| 278 | Ga0207665_10166651 | 3300025939 | Bacteria | 1588 |
| 279 | Ga0207691_10000529 | 3300025940 | Bacteria | 38127 |
| 280 | Ga0207691_10761477 | 3300025940 | Bacteria | 815 |
| 281 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 282 | Ga0207711_10439811 | 3300025941 | Bacteria | 1214 |
| 283 | Ga0207711_10814191 | 3300025941 | Unclassified | 870 |
| 284 | Ga0207689_10062152 | 3300025942 | Bacteria | 3071 |
| 285 | Ga0207661_10000312 | 3300025944 | Bacteria | 30978 |
| 286 | Ga0207661_10003572 | 3300025944 | Bacteria | 10812 |
| 287 | Ga0207661_10031276 | 3300025944 | Bacteria | 4109 |
| 288 | Ga0207661_10160640 | 3300025944 | Bacteria | 1949 |
| 289 | Ga0207661_10247915 | 3300025944 | Bacteria | 1582 |
| 290 | Ga0207661_10478776 | 3300025944 | Bacteria | 1136 |
| 291 | Ga0207679_10004161 | 3300025945 | Bacteria | 8990 |
| 292 | Ga0207679_10018226 | 3300025945 | Bacteria | 4700 |
| 293 | Ga0207679_10278898 | 3300025945 | Bacteria | 1432 |
| 294 | Ga0207667_10764523 | 3300025949 | Unclassified | 965 |
| 295 | Ga0207667_10797204 | 3300025949 | Bacteria | 941 |
| 296 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 297 | Ga0207712_10009081 | 3300025961 | Bacteria | 6288 |
| 298 | Ga0207712_11347634 | 3300025961 | Bacteria | 638 |
| 299 | Ga0207668_10084743 | 3300025972 | Bacteria | 2310 |
| 300 | Ga0207668_10317588 | 3300025972 | Bacteria | 1291 |
| 301 | Ga0207640_10000134 | 3300025981 | Bacteria | 54961 |
| 302 | Ga0207640_10081957 | 3300025981 | Bacteria | 2208 |
| 303 | Ga0207640_10989338 | 3300025981 | Bacteria | 739 |
| 304 | Ga0207658_10006099 | 3300025986 | Bacteria | 8229 |
| 305 | Ga0207658_10035972 | 3300025986 | Bacteria | 3549 |
| 306 | Ga0207677_10000263 | 3300026023 | Bacteria | 39869 |
| 307 | Ga0207677_10000374 | 3300026023 | Bacteria | 31092 |
| 308 | Ga0207677_10193593 | 3300026023 | Bacteria | 1610 |
| 309 | Ga0207703_10000103 | 3300026035 | Bacteria | 99918 |
| 310 | Ga0207703_10143408 | 3300026035 | Bacteria | 2075 |
| 311 | Ga0207703_10542076 | 3300026035 | Bacteria | 1096 |
| 312 | Ga0207678_10001469 | 3300026067 | Bacteria | 21623 |
| 313 | Ga0207678_10090039 | 3300026067 | Bacteria | 2622 |
| 314 | Ga0207678_10242140 | 3300026067 | Bacteria | 1545 |
| 315 | Ga0207708_10004524 | 3300026075 | Bacteria | 10232 |
| 316 | Ga0207708_10038188 | 3300026075 | Bacteria | 3658 |
| 317 | Ga0207708_10042099 | 3300026075 | Bacteria | 3482 |
| 318 | Ga0207702_10000368 | 3300026078 | Bacteria | 51559 |
| 319 | Ga0207702_10008621 | 3300026078 | Bacteria | 8599 |
| 320 | Ga0207641_10073252 | 3300026088 | Bacteria | 2951 |
| 321 | Ga0207641_10113808 | 3300026088 | Bacteria | 2403 |
| 322 | Ga0207641_10187194 | 3300026088 | Bacteria | 1900 |
| 323 | Ga0207648_11095651 | 3300026089 | Bacteria | 747 |
| 324 | Ga0207676_10000031 | 3300026095 | Bacteria | 215877 |
| 325 | Ga0207676_10082519 | 3300026095 | Bacteria | 2615 |
| 326 | Ga0207674_10316005 | 3300026116 | Bacteria | 1511 |
| 327 | Ga0207675_100076384 | 3300026118 | Bacteria | 3137 |
| 328 | Ga0207675_100210623 | 3300026118 | Bacteria | 1869 |
| 329 | Ga0207675_101010257 | 3300026118 | Bacteria | 850 |
| 330 | Ga0207683_10004139 | 3300026121 | Bacteria | 12547 |
| 331 | Ga0207683_10290840 | 3300026121 | Bacteria | 1494 |
| 332 | Ga0207698_10000101 | 3300026142 | Bacteria | 54530 |
| 333 | Ga0207698_10006939 | 3300026142 | Bacteria | 7087 |
| 334 | Ga0207698_10273893 | 3300026142 | Bacteria | 1557 |
| 335 | Ga0207428_10041121 | 3300027907 | Bacteria | 3744 |
| 336 | Ga0207428_10061904 | 3300027907 | Bacteria | 2961 |
| 337 | Ga0268266_10000264 | 3300028379 | Bacteria | 88067 |
| 338 | Ga0268266_10005437 | 3300028379 | Bacteria | 11874 |
| 339 | Ga0268266_10028179 | 3300028379 | Bacteria | 4775 |
| 340 | Ga0268266_10041882 | 3300028379 | Bacteria | 3910 |
| 341 | Ga0268266_10108705 | 3300028379 | Bacteria | 2454 |
| 342 | Ga0268265_10009350 | 3300028380 | Bacteria | 6625 |
| 343 | Ga0268265_10047342 | 3300028380 | Bacteria | 3222 |
| 344 | Ga0268264_10049938 | 3300028381 | Bacteria | 3482 |
| 345 | Ga0268264_10355086 | 3300028381 | Bacteria | 1396 |
| 346 | Ga0265337_1000240 | 3300028556 | Bacteria | 29757 |
| 347 | Ga0265326_10000393 | 3300028558 | Bacteria | 17549 |
| 348 | Ga0265319_1000105 | 3300028563 | Bacteria | 65502 |
| 349 | Ga0265334_10086289 | 3300028573 | Bacteria | 1151 |
| 350 | Ga0265322_10000029 | 3300028654 | Bacteria | 82867 |
| 351 | Ga0265338_10000507 | 3300028800 | Bacteria | 69026 |
| 352 | Ga0265324_10001546 | 3300029957 | Bacteria | 12903 |
| 353 | Ga0265332_10010532 | 3300031238 | Bacteria | 4117 |
| 354 | Ga0265328_10008084 | 3300031239 | Bacteria | 4358 |
| 355 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 356 | Ga0265325_10004631 | 3300031241 | Bacteria | 8636 |
| 357 | Ga0265329_10003959 | 3300031242 | Bacteria | 6323 |
| 358 | Ga0265331_10001215 | 3300031250 | Bacteria | 19370 |
| 359 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 360 | Ga0265316_10073036 | 3300031344 | Bacteria | 2642 |
| 361 | Ga0307408_101373428 | 3300031548 | Unclassified | 664 |
| 362 | Ga0316579_10169877 | 3300031691 | Bacteria | 1054 |
| 363 | Ga0265314_10000361 | 3300031711 | Bacteria | 63269 |
| 364 | Ga0265342_10060888 | 3300031712 | Bacteria | 2225 |
| 365 | Ga0265342_10384872 | 3300031712 | Bacteria | 726 |
| 366 | Ga0307413_10007422 | 3300031824 | Bacteria | 5093 |
| 367 | Ga0307410_10003727 | 3300031852 | Bacteria | 7719 |
| 368 | Ga0307406_10046611 | 3300031901 | Bacteria | 2728 |
| 369 | Ga0307407_10001863 | 3300031903 | Bacteria | 7939 |
| 370 | Ga0307412_10130106 | 3300031911 | Bacteria | 1827 |
| 371 | Ga0307416_100001733 | 3300032002 | Bacteria | 12072 |
| 372 | Ga0307411_10159554 | 3300032005 | Bacteria | 1687 |
| 373 | Ga0307415_100001502 | 3300032126 | Bacteria | 11190 |
| 374 | Ga0307415_100003860 | 3300032126 | Bacteria | 7690 |
| 375 | Ga0373954_0402157 | 3300035118 | Unclassified | 677 |
| 376 | Ga0373933_0831544 | 3300035724 | Bacteria | 608 |
| 377 | Ga0373947_0993972 | 3300035725 | Bacteria | 572 |
| 378 | Ga0373937_0009637 | 3300036401 | Bacteria | 8411 |
| 379 | Ga0316582_0153764 | 3300036647 | Bacteria | 1556 |
| 380 | Ga0395901_0309653 | 3300038443 | Bacteria | 1636 |
| 381 | Ga0451807_0449275 | 3300041486 | Bacteria | 1399 |
| 382 | Ga0451807_0563839 | 3300041486 | Bacteria | 782 |
| 383 | Ga0451833_0117804 | 3300041491 | Bacteria | 718 |
| 384 | Ga0451837_1598875 | 3300041494 | Bacteria | 1537 |
| 385 | Ga0451845_0743034 | 3300041501 | Bacteria | 741 |
| 386 | Ga0451853_2844863 | 3300041512 | Bacteria | 1180 |
| 387 | Ga0451853_3468528 | 3300041512 | Unclassified | 696 |
| 388 | Ga0466963_0030303 | 3300044694 | Bacteria | 3490 |
| 389 | Ga0466957_0001462 | 3300044842 | Bacteria | 12380 |
| 390 | Ga0466957_0104645 | 3300044842 | Bacteria | 1788 |
| 391 | Ga0466957_0263224 | 3300044842 | Unclassified | 1150 |
| 392 | Ga0466958_0424672 | 3300045836 | Unclassified | 859 |
| 393 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 394 | Ga0466967_0327750 | 3300045976 | Bacteria | 1478 |
| 395 | Ga0466967_0733621 | 3300045976 | Bacteria | 979 |
| 396 | Ga0466967_1004672 | 3300045976 | Bacteria | 831 |
| 397 | Ga0495592_0108889 | 3300046454 | Bacteria | 1963 |
| 398 | Ga0495592_0250954 | 3300046454 | Bacteria | 1169 |
| 399 | Ga0495592_0465135 | 3300046454 | Bacteria | 790 |
| 400 | Ga0495603_0002090 | 3300046455 | Bacteria | 11745 |
| 401 | Ga0495629_0000411 | 3300046459 | Bacteria | 35904 |
| 402 | Ga0495629_0001073 | 3300046459 | Bacteria | 21818 |
| 403 | Ga0495629_0049756 | 3300046459 | Bacteria | 2937 |
| 404 | Ga0495629_0082097 | 3300046459 | Bacteria | 2249 |
| 405 | Ga0495629_1071665 | 3300046459 | Bacteria | 522 |
| 406 | Ga0495638_0042481 | 3300046460 | Bacteria | 2872 |
| 407 | Ga0495641_0016606 | 3300046461 | Bacteria | 3869 |
| 408 | Ga0495641_0019177 | 3300046461 | Bacteria | 3509 |
| 409 | Ga0495641_0024469 | 3300046461 | Bacteria | 2981 |
| 410 | Ga0495651_0218633 | 3300046462 | Bacteria | 1320 |
| 411 | Ga0495651_0400706 | 3300046462 | Bacteria | 896 |
| 412 | Ga0495651_0444297 | 3300046462 | Bacteria | 839 |
| 413 | Ga0495653_0014708 | 3300046463 | Bacteria | 6384 |
| 414 | Ga0495653_0137220 | 3300046463 | Bacteria | 1724 |
| 415 | Ga0495653_0139619 | 3300046463 | Bacteria | 1706 |
| 416 | Ga0495653_0285572 | 3300046463 | Bacteria | 1081 |
| 417 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 418 | Ga0495662_0008393 | 3300046476 | Bacteria | 5080 |
| 419 | Ga0495662_0177009 | 3300046476 | Bacteria | 1051 |
| 420 | Ga0495664_0597089 | 3300046477 | Bacteria | 656 |
| 421 | Ga0495585_0352966 | 3300046492 | Bacteria | 714 |
| 422 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 423 | Ga0495594_0855962 | 3300046499 | Bacteria | 511 |
| 424 | Ga0495606_0000586 | 3300046507 | Bacteria | 57795 |
| 425 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 426 | Ga0495610_0041699 | 3300046512 | Bacteria | 2302 |
| 427 | Ga0495628_0001264 | 3300046516 | Bacteria | 23154 |
| 428 | Ga0495628_0045591 | 3300046516 | Bacteria | 3485 |
| 429 | Ga0495628_0057763 | 3300046516 | Bacteria | 3052 |
| 430 | Ga0495628_0242678 | 3300046516 | Bacteria | 1347 |
| 431 | Ga0495628_0558443 | 3300046516 | Unclassified | 821 |
| 432 | Ga0495628_0775320 | 3300046516 | Unclassified | 672 |
| 433 | Ga0495628_0864630 | 3300046516 | Unclassified | 629 |
| 434 | Ga0495630_0000075 | 3300046517 | Bacteria | 77378 |
| 435 | Ga0495630_0000176 | 3300046517 | Bacteria | 49731 |
| 436 | Ga0495630_0194987 | 3300046517 | Bacteria | 1545 |
| 437 | Ga0495630_0257757 | 3300046517 | Bacteria | 1332 |
| 438 | Ga0495637_0195474 | 3300046520 | Bacteria | 745 |
| 439 | Ga0495652_0000037 | 3300046529 | Bacteria | 133232 |
| 440 | Ga0495652_0046628 | 3300046529 | Bacteria | 3719 |
| 441 | Ga0495652_0049195 | 3300046529 | Bacteria | 3610 |
| 442 | Ga0495640_0017430 | 3300046533 | Bacteria | 5354 |
| 443 | Ga0495640_0689932 | 3300046533 | Bacteria | 613 |
| 444 | Ga0495586_0630368 | 3300046535 | Bacteria | 619 |
| 445 | Ga0495587_0006294 | 3300046536 | Bacteria | 7747 |
| 446 | Ga0495587_0298466 | 3300046536 | Bacteria | 901 |
| 447 | Ga0495621_0003893 | 3300046539 | Bacteria | 4147 |
| 448 | Ga0495645_0000984 | 3300046543 | Bacteria | 19435 |
| 449 | Ga0495645_0118482 | 3300046543 | Bacteria | 1866 |
| 450 | Ga0495622_0000387 | 3300046557 | Bacteria | 30369 |
| 451 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 452 | Ga0495667_0022744 | 3300046559 | Bacteria | 4223 |
| 453 | Ga0495656_0000651 | 3300046615 | Bacteria | 11103 |
| 454 | Ga0495634_0000031 | 3300046642 | Bacteria | 110396 |
| 455 | Ga0495634_0000381 | 3300046642 | Bacteria | 43342 |
| 456 | Ga0495634_0004572 | 3300046642 | Bacteria | 10807 |
| 457 | Ga0495634_0407165 | 3300046642 | Bacteria | 807 |
| 458 | Ga0495634_0432442 | 3300046642 | Bacteria | 778 |
| 459 | Ga0495634_0569937 | 3300046642 | Unclassified | 659 |
| 460 | Ga0495625_0001050 | 3300046660 | Bacteria | 36223 |
| 461 | Ga0495625_0384437 | 3300046660 | Bacteria | 880 |
| 462 | Ga0495635_0018716 | 3300046663 | Bacteria | 4832 |
| 463 | Ga0495635_0040441 | 3300046663 | Bacteria | 3222 |
| 464 | Ga0495635_0661759 | 3300046663 | Bacteria | 679 |
| 465 | Ga0495588_0000187 | 3300046674 | Bacteria | 67620 |
| 466 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 467 | Ga0495657_0011381 | 3300046675 | Bacteria | 6655 |
| 468 | Ga0495657_0581407 | 3300046675 | Unclassified | 649 |
| 469 | Ga0495599_0107435 | 3300046678 | Bacteria | 1739 |
| 470 | Ga0495647_0000330 | 3300046681 | Bacteria | 13357 |
| 471 | Ga0495647_0320544 | 3300046681 | Bacteria | 701 |
| 472 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 473 | Ga0495658_0000803 | 3300046683 | Bacteria | 16854 |
| 474 | Ga0495658_0306894 | 3300046683 | Bacteria | 1004 |
| 475 | Ga0495669_0000143 | 3300046684 | Bacteria | 45428 |
| 476 | Ga0495669_0044920 | 3300046684 | Bacteria | 1969 |
| 477 | Ga0495613_0000247 | 3300046689 | Bacteria | 51008 |
| 478 | Ga0495613_0895199 | 3300046689 | Bacteria | 575 |
| 479 | Ga0495624_0000027 | 3300046690 | Bacteria | 93611 |
| 480 | Ga0495624_0096253 | 3300046690 | Bacteria | 1824 |
| 481 | Ga0495600_0006201 | 3300046809 | Bacteria | 7251 |
| 482 | Ga0495600_0042494 | 3300046809 | Bacteria | 2963 |
| 483 | Ga0495600_0219515 | 3300046809 | Bacteria | 1216 |
| 484 | Ga0495600_0871357 | 3300046809 | Unclassified | 533 |
| 485 | Ga0495660_0250386 | 3300046810 | Bacteria | 822 |
| 486 | Ga0495604_0000050 | 3300047317 | Bacteria | 108094 |
| 487 | Ga0495604_0000195 | 3300047317 | Bacteria | 54789 |
| 488 | Ga0495604_0120885 | 3300047317 | Bacteria | 1896 |
| 489 | Ga0495604_0526782 | 3300047317 | Bacteria | 764 |
| 490 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 491 | Ga0495674_0184115 | 3300047319 | Bacteria | 1738 |
| 492 | Ga0495672_0047025 | 3300047320 | Bacteria | 2570 |
| 493 | Ga0495672_0097496 | 3300047320 | Bacteria | 1601 |
| 494 | Ga0495672_0143252 | 3300047320 | Bacteria | 1246 |
| 495 | Ga0495676_0079424 | 3300047321 | Bacteria | 2494 |
| 496 | Ga0495676_0080527 | 3300047321 | Bacteria | 2473 |
| 497 | Ga0495676_0106219 | 3300047321 | Bacteria | 2069 |
| 498 | Ga0495676_0130259 | 3300047321 | Bacteria | 1817 |
| 499 | Ga0495680_0002123 | 3300047322 | Bacteria | 20590 |
| 500 | Ga0495680_0084405 | 3300047322 | Bacteria | 2393 |
| 501 | Ga0495680_0097487 | 3300047322 | Bacteria | 2194 |
| 502 | Ga0495680_0313333 | 3300047322 | Bacteria | 1099 |
| 503 | Ga0495680_0950938 | 3300047322 | Bacteria | 552 |
| 504 | Ga0495675_0000453 | 3300047444 | Bacteria | 27185 |
| 505 | Ga0495684_0558426 | 3300047471 | Unclassified | 778 |
| 506 | Ga0495684_0757715 | 3300047471 | Unclassified | 638 |
| 507 | Ga0495686_0461613 | 3300047472 | Bacteria | 673 |
| 508 | Ga0495593_0014303 | 3300047673 | Bacteria | 4512 |
| 509 | Ga0495593_0079888 | 3300047673 | Bacteria | 1693 |
| 510 | Ga0495593_0264483 | 3300047673 | Unclassified | 861 |
| 511 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 512 | Ga0495602_0000571 | 3300048088 | Bacteria | 34252 |
| 513 | Ga0495602_0256129 | 3300048088 | Bacteria | 1301 |
| 514 | Ga0495602_0324782 | 3300048088 | Unclassified | 1118 |
| 515 | Ga0495602_0390652 | 3300048088 | Bacteria | 994 |
| 516 | Ga0495602_0655424 | 3300048088 | Unclassified | 716 |
| 517 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 518 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 519 | Ga0496100_0085035 | 3300048903 | Bacteria | 2146 |
| 520 | Ga0496100_0266461 | 3300048903 | Bacteria | 1272 |
| 521 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 522 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 523 | Ga0496102_0000522 | 3300048905 | Bacteria | 41862 |
| 524 | Ga0496102_0034709 | 3300048905 | Bacteria | 4538 |
| 525 | Ga0496102_0148303 | 3300048905 | Bacteria | 2203 |
| 526 | Ga0496103_0000174 | 3300048906 | Bacteria | 67124 |
| 527 | Ga0496103_0116450 | 3300048906 | Bacteria | 1700 |
| 528 | Ga0496103_0580683 | 3300048906 | Bacteria | 715 |
| 529 | Ga0496104_0000052 | 3300048907 | Bacteria | 137286 |
| 530 | Ga0496104_0010872 | 3300048907 | Bacteria | 8140 |
| 531 | Ga0496104_0070089 | 3300048907 | Bacteria | 3333 |
| 532 | Ga0496104_0192147 | 3300048907 | Bacteria | 1953 |
| 533 | Ga0496104_0652829 | 3300048907 | Unclassified | 961 |
| 534 | Ga0496105_0000030 | 3300048908 | Bacteria | 137325 |
| 535 | Ga0496105_0025392 | 3300048908 | Bacteria | 4823 |
| 536 | Ga0496105_0096371 | 3300048908 | Bacteria | 2443 |
| 537 | Ga0496105_0273167 | 3300048908 | Bacteria | 1364 |
| 538 | Ga0496106_0000062 | 3300048909 | Bacteria | 85769 |
| 539 | Ga0496106_0001278 | 3300048909 | Bacteria | 18871 |
| 540 | Ga0496106_0094420 | 3300048909 | Bacteria | 2312 |
| 541 | Ga0496106_1014754 | 3300048909 | Bacteria | 652 |
| 542 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 543 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 544 | Ga0496107_0216851 | 3300048910 | Bacteria | 1423 |
| 545 | Ga0496107_0229892 | 3300048910 | Bacteria | 1380 |
| 546 | Ga0496107_1122748 | 3300048910 | Bacteria | 567 |
| 547 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 548 | Ga0496108_0000137 | 3300048911 | Bacteria | 70783 |
| 549 | Ga0496108_0001912 | 3300048911 | Bacteria | 16657 |
| 550 | Ga0496108_0031741 | 3300048911 | Bacteria | 4384 |
| 551 | Ga0496108_0039281 | 3300048911 | Bacteria | 3945 |
| 552 | Ga0496108_0284449 | 3300048911 | Bacteria | 1439 |
| 553 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 554 | Ga0496109_0000088 | 3300048912 | Bacteria | 94877 |
| 555 | Ga0496109_0000218 | 3300048912 | Bacteria | 56316 |
| 556 | Ga0496109_0001088 | 3300048912 | Bacteria | 22576 |
| 557 | Ga0496109_0068234 | 3300048912 | Bacteria | 3260 |
| 558 | Ga0496109_0216837 | 3300048912 | Bacteria | 1799 |
| 559 | Ga0496109_0616125 | 3300048912 | Bacteria | 1022 |
| 560 | Ga0496109_0690484 | 3300048912 | Bacteria | 958 |
| 561 | Ga0496110_0000242 | 3300048913 | Bacteria | 35454 |
| 562 | Ga0496110_0001010 | 3300048913 | Bacteria | 19810 |
| 563 | Ga0496110_0064263 | 3300048913 | Bacteria | 3243 |
| 564 | Ga0496110_0167941 | 3300048913 | Bacteria | 1990 |
| 565 | Ga0496110_0168374 | 3300048913 | Bacteria | 1987 |
| 566 | Ga0496110_0216346 | 3300048913 | Bacteria | 1742 |
| 567 | Ga0496111_0000939 | 3300048914 | Bacteria | 15955 |
| 568 | Ga0496111_0016343 | 3300048914 | Bacteria | 5112 |
| 569 | Ga0496111_0108095 | 3300048914 | Bacteria | 2048 |
| 570 | Ga0496111_0178208 | 3300048914 | Bacteria | 1580 |
| 571 | Ga0496111_0312118 | 3300048914 | Unclassified | 1165 |
| 572 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 573 | Ga0496112_0019308 | 3300048915 | Bacteria | 6431 |
| 574 | Ga0496112_0055849 | 3300048915 | Bacteria | 3884 |
| 575 | Ga0496112_0129291 | 3300048915 | Bacteria | 2497 |
| 576 | Ga0496112_1094769 | 3300048915 | Bacteria | 715 |
| 577 | Ga0496113_0000027 | 3300048916 | Bacteria | 63463 |
| 578 | Ga0496113_0055795 | 3300048916 | Bacteria | 2963 |
| 579 | Ga0496113_0072679 | 3300048916 | Bacteria | 2618 |
| 580 | Ga0496113_0344274 | 3300048916 | Bacteria | 1195 |
| 581 | Ga0496113_0350565 | 3300048916 | Bacteria | 1184 |
| 582 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 583 | Ga0496114_0147494 | 3300048917 | Bacteria | 2040 |
| 584 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 585 | Ga0496115_0000162 | 3300048918 | Bacteria | 62522 |
| 586 | Ga0496115_0002639 | 3300048918 | Bacteria | 12880 |
| 587 | Ga0496115_0279281 | 3300048918 | Bacteria | 1371 |
| 588 | Ga0496115_0699792 | 3300048918 | Bacteria | 797 |
| 589 | Ga0496116_0000176 | 3300048919 | Bacteria | 128426 |
| 590 | Ga0496117_0002967 | 3300048920 | Bacteria | 20476 |
| 591 | Ga0496117_0186608 | 3300048920 | Bacteria | 1186 |
| 592 | Ga0496118_0007078 | 3300048921 | Bacteria | 12050 |
| 593 | Ga0496118_0088584 | 3300048921 | Bacteria | 2140 |
| 594 | Ga0496118_0134915 | 3300048921 | Bacteria | 1577 |
| 595 | Ga0496119_0001444 | 3300048922 | Bacteria | 28583 |
| 596 | Ga0496119_0019408 | 3300048922 | Bacteria | 5009 |
| 597 | Ga0496119_0086064 | 3300048922 | Bacteria | 1797 |
| 598 | Ga0496120_0003250 | 3300048923 | Bacteria | 15033 |
| 599 | Ga0496121_0014377 | 3300048924 | Bacteria | 8404 |
| 600 | Ga0496121_0014861 | 3300048924 | Bacteria | 8213 |
| 601 | Ga0496121_0213138 | 3300048924 | Bacteria | 1367 |
| 602 | Ga0496121_0366443 | 3300048924 | Unclassified | 955 |
| 603 | Ga0496121_0671992 | 3300048924 | Bacteria | 628 |
| 604 | Ga0496124_0132865 | 3300048927 | Bacteria | 1975 |
| 605 | Ga0496124_0184401 | 3300048927 | Bacteria | 1603 |
| 606 | Ga0496124_0287237 | 3300048927 | Unclassified | 1196 |
| 607 | Ga0496125_0198717 | 3300048928 | Bacteria | 1315 |
| 608 | Ga0496126_0003514 | 3300048929 | Bacteria | 19727 |
| 609 | Ga0496126_0232957 | 3300048929 | Bacteria | 1542 |
| 610 | Ga0496126_0378071 | 3300048929 | Bacteria | 1153 |
| 611 | Ga0496126_0846706 | 3300048929 | Bacteria | 698 |
| 612 | Ga0501031_0008813 | 3300049568 | Bacteria | 6559 |
| 613 | Ga0501031_0460942 | 3300049568 | Bacteria | 821 |
| 614 | Ga0501032_0011441 | 3300049569 | Bacteria | 6374 |
| 615 | Ga0501032_0238277 | 3300049569 | Bacteria | 1182 |
| 616 | Ga0501033_0001738 | 3300049570 | Bacteria | 19042 |
| 617 | Ga0501034_1421742 | 3300049571 | Bacteria | 568 |
| 618 | Ga0501036_0001408 | 3300049572 | Bacteria | 18483 |
| 619 | Ga0501037_0000901 | 3300049573 | Bacteria | 22167 |
| 620 | Ga0501037_0689930 | 3300049573 | Bacteria | 680 |
| 621 | Ga0501038_0002106 | 3300049574 | Bacteria | 18452 |
| 622 | Ga0501038_0404674 | 3300049574 | Unclassified | 1055 |
| 623 | Ga0501039_0013427 | 3300049575 | Bacteria | 6264 |
| 624 | Ga0501040_0036032 | 3300049576 | Bacteria | 3356 |
| 625 | Ga0501040_0202387 | 3300049576 | Bacteria | 1410 |
| 626 | Ga0501040_0203666 | 3300049576 | Bacteria | 1405 |
| 627 | Ga0501042_0022064 | 3300049578 | Bacteria | 4444 |
| 628 | Ga0501042_0045237 | 3300049578 | Bacteria | 3137 |
| 629 | Ga0501042_0069255 | 3300049578 | Bacteria | 2523 |
| 630 | Ga0501042_0485123 | 3300049578 | Bacteria | 897 |
| 631 | Ga0501043_0011297 | 3300049579 | Bacteria | 6988 |
| 632 | Ga0501046_0015188 | 3300049580 | Bacteria | 6474 |
| 633 | Ga0501047_0002109 | 3300049581 | Bacteria | 19029 |
| 634 | Ga0501047_0006504 | 3300049581 | Bacteria | 10998 |
| 635 | Ga0501047_0008337 | 3300049581 | Bacteria | 9781 |
| 636 | Ga0501047_1158714 | 3300049581 | Bacteria | 586 |
| 637 | Ga0501047_1181704 | 3300049581 | Bacteria | 578 |
| 638 | Ga0501048_0012235 | 3300049582 | Bacteria | 6386 |
| 639 | Ga0501048_0060993 | 3300049582 | Bacteria | 2672 |
| 640 | Ga0501067_0021980 | 3300049583 | Bacteria | 3529 |
| 641 | Ga0501067_0443913 | 3300049583 | Bacteria | 724 |
| 642 | Ga0501068_0018119 | 3300049584 | Bacteria | 4076 |
| 643 | Ga0501068_0087718 | 3300049584 | Bacteria | 1916 |
| 644 | Ga0501068_0199331 | 3300049584 | Bacteria | 1269 |
| 645 | Ga0501069_0009621 | 3300049585 | Bacteria | 5104 |
| 646 | Ga0501070_0000592 | 3300049586 | Bacteria | 33029 |
| 647 | Ga0501070_0008128 | 3300049586 | Bacteria | 8878 |
| 648 | Ga0501070_0602678 | 3300049586 | Bacteria | 875 |
| 649 | Ga0501071_0042291 | 3300049587 | Bacteria | 3264 |
| 650 | Ga0501071_0109142 | 3300049587 | Bacteria | 2044 |
| 651 | Ga0501071_1060811 | 3300049587 | Unclassified | 626 |
| 652 | Ga0501072_0010121 | 3300049588 | Bacteria | 7178 |
| 653 | Ga0501072_0147709 | 3300049588 | Bacteria | 1874 |
| 654 | Ga0501072_0318892 | 3300049588 | Bacteria | 1235 |
| 655 | Ga0501073_0006491 | 3300049589 | Bacteria | 8703 |
| 656 | Ga0501074_0022710 | 3300049590 | Bacteria | 4560 |
| 657 | Ga0501074_0030449 | 3300049590 | Bacteria | 3911 |
| 658 | Ga0501074_0137269 | 3300049590 | Bacteria | 1749 |
| 659 | Ga0501074_0499211 | 3300049590 | Unclassified | 862 |
| 660 | Ga0501075_0135862 | 3300049591 | Bacteria | 1874 |
| 661 | Ga0501077_0374871 | 3300049593 | Bacteria | 909 |
| 662 | Ga0501249_142490 | 3300049679 | Bacteria | 598 |
| 663 | Ga0501079_0013016 | 3300049741 | Bacteria | 6346 |
| 664 | Ga0501079_0050835 | 3300049741 | Bacteria | 3198 |
| 665 | Ga0501079_0431608 | 3300049741 | Unclassified | 1034 |
| 666 | Ga0501079_0771788 | 3300049741 | Bacteria | 757 |
| 667 | Ga0501080_0057426 | 3300049742 | Bacteria | 3623 |
| 668 | Ga0501080_0070877 | 3300049742 | Bacteria | 3241 |
| 669 | Ga0501080_0360974 | 3300049742 | Bacteria | 1311 |
| 670 | Ga0501081_0508897 | 3300049743 | Bacteria | 898 |
| 671 | Ga0501081_0923095 | 3300049743 | Unclassified | 659 |
| 672 | Ga0501081_1216889 | 3300049743 | Unclassified | 571 |
| 673 | Ga0501083_0004753 | 3300049744 | Bacteria | 9592 |
| 674 | Ga0501083_0010981 | 3300049744 | Bacteria | 6365 |
| 675 | Ga0501083_0031296 | 3300049744 | Bacteria | 3652 |
| 676 | Ga0501035_0000368 | 3300049822 | Bacteria | 51908 |
| 677 | Ga0501035_0375289 | 3300049822 | Bacteria | 1187 |
| 678 | Ga0501044_0000684 | 3300049823 | Bacteria | 40967 |
| 679 | Ga0501044_0074576 | 3300049823 | Bacteria | 3446 |
| 680 | Ga0501044_0101755 | 3300049823 | Bacteria | 2890 |
| 681 | Ga0501044_0248802 | 3300049823 | Bacteria | 1719 |
| 682 | Ga0501044_0802011 | 3300049823 | Bacteria | 821 |
| 683 | Ga0501045_0039289 | 3300049824 | Bacteria | 3443 |
| 684 | Ga0501045_0773835 | 3300049824 | Bacteria | 707 |
| 685 | nmdc:mga05p37_59262_c1 | 3300050507 | Bacteria | 4715 |
| 686 | nmdc:mga0qj67_332229_c1 | 3300050509 | Bacteria | 1230 |
| 687 | nmdc:mga0qj67_470103_c1 | 3300050509 | Bacteria | 1012 |
| 688 | nmdc:mga08y16_347531_c1 | 3300050511 | Bacteria | 1524 |
| 689 | nmdc:mga08y16_45474_c1 | 3300050511 | Bacteria | 4600 |
| 690 | nmdc:mga0n895_174888_c1 | 3300050512 | Bacteria | 2178 |
| 691 | nmdc:mga0rr50_61718_c1 | 3300050513 | Bacteria | 2825 |
| 692 | nmdc:mga08x19_27725_c1 | 3300050514 | Bacteria | 3544 |
| 693 | nmdc:mga0a205_113_c3 | 3300050515 | Bacteria | 10852 |
| 694 | nmdc:mga0a205_19929_c1 | 3300050515 | Bacteria | 6327 |
| 695 | nmdc:mga0a205_521_c2 | 3300050515 | Bacteria | 11414 |
| 696 | Ga0495601_0000043 | 3300053077 | Bacteria | 77025 |
| 697 | Ga0495601_0001148 | 3300053077 | Bacteria | 14465 |
| 698 | Ga0495601_0011090 | 3300053077 | Bacteria | 5385 |
| 699 | Ga0495601_0014246 | 3300053077 | Bacteria | 4790 |
| 700 | Ga0495601_0069631 | 3300053077 | Bacteria | 2244 |
| 701 | Ga0495601_0393262 | 3300053077 | Bacteria | 899 |
| 702 | Ga0495612_0000230 | 3300053078 | Bacteria | 23681 |
| 703 | Ga0495612_0001360 | 3300053078 | Bacteria | 10074 |
| 704 | Ga0495612_0001568 | 3300053078 | Bacteria | 9421 |
| 705 | Ga0495612_0077495 | 3300053078 | Bacteria | 1393 |
| 706 | Ga0495612_0089724 | 3300053078 | Bacteria | 1300 |
| 707 | Ga0495612_0125217 | 3300053078 | Bacteria | 1107 |
| 708 | Ga0495612_0184819 | 3300053078 | Bacteria | 916 |
| 709 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 710 | Ga0495655_0083877 | 3300053083 | Bacteria | 916 |
| 711 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 712 | Ga0495595_0003229 | 3300053084 | Bacteria | 6474 |
| 713 | Ga0495595_0065066 | 3300053084 | Bacteria | 1715 |
| 714 | Ga0495595_0113105 | 3300053084 | Bacteria | 1318 |
| 715 | Ga0495595_0345915 | 3300053084 | Unclassified | 750 |
| 716 | Ga0495619_0000010 | 3300053085 | Bacteria | 302390 |
| 717 | Ga0495619_0000047 | 3300053085 | Bacteria | 102152 |
| 718 | Ga0495619_0000276 | 3300053085 | Bacteria | 36931 |
| 719 | Ga0495619_0000801 | 3300053085 | Bacteria | 20570 |
| 720 | Ga0495619_0002422 | 3300053085 | Bacteria | 12247 |
| 721 | Ga0495619_0004064 | 3300053085 | Bacteria | 9370 |
| 722 | Ga0495619_0017246 | 3300053085 | Bacteria | 4572 |
| 723 | Ga0495619_0050110 | 3300053085 | Bacteria | 2755 |
| 724 | Ga0495619_0064404 | 3300053085 | Bacteria | 2444 |
| 725 | Ga0495619_0256761 | 3300053085 | Bacteria | 1211 |
| 726 | Ga0495619_0334113 | 3300053085 | Unclassified | 1049 |
| 727 | Ga0500641_0000977 | 3300053096 | Bacteria | 10162 |
| 728 | Ga0500556_0000885 | 3300053104 | Bacteria | 16804 |
| 729 | Ga0500595_057613 | 3300053119 | Bacteria | 1183 |
| 730 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 731 | Ga0500616_0002393 | 3300053153 | Bacteria | 15658 |
| 732 | Ga0500599_007306 | 3300053736 | Bacteria | 1420 |
| 733 | Ga0590077_073083 | 3300059426 | Unclassified | 785 |
| 734 | Ga0501082_0023889 | 3300060353 | Bacteria | 5271 |
| 735 | Ga0501082_0281779 | 3300060353 | Bacteria | 1447 |
| 736 | Ga0501082_1153233 | 3300060353 | Unclassified | 677 |
| 737 | Ga0530510_0543909 | 3300061734 | Unclassified | 882 |
| 738 | Ga0495613_0141322 | |||
| 739 | CNAas_1010051 | |||
| 740 | JGI24746J21847_1000327 | |||
| 741 | JGI24740J21852_10010017 | |||
| 742 | JGI24748J21848_1000399 | |||
| 743 | JGI24034J26672_10000295 | |||
| 744 | JGI24742J22300_10000807 | |||
| 745 | JGI25404J52841_10002140 | |||
| 746 | Ga0070658_10458988 | |||
| 747 | Ga0070676_10093435 | |||
| 748 | Ga0070683_100008965 | |||
| 749 | Ga0070683_100011762 | |||
| 750 | Ga0070683_100023826 | |||
| 751 | Ga0070683_100032396 | |||
| 752 | Ga0070683_100142266 | |||
| 753 | Ga0070683_100212994 | |||
| 754 | Ga0070683_100542708 | |||
| 755 | Ga0070670_100078292 | |||
| 756 | Ga0070677_10000091 | |||
| 757 | Ga0068869_100059016 | |||
| 758 | Ga0070666_10010263 | |||
| 759 | Ga0070680_100462285 | |||
| 760 | Ga0070682_100000075 | |||
| 761 | Ga0070682_100090018 | |||
| 762 | Ga0070682_100966203 | |||
| 763 | Ga0068868_100000355 | |||
| 764 | Ga0068868_100010121 | |||
| 765 | Ga0068868_100071876 | |||
| 766 | Ga0068868_101445549 | |||
| 767 | Ga0070660_100343343 | |||
| 768 | Ga0070689_100060950 | |||
| 769 | Ga0070689_100915981 | |||
| 770 | Ga0070691_10000021 | |||
| 771 | Ga0070691_10000135 | |||
| 772 | Ga0070691_10008966 | |||
| 773 | Ga0070691_10111101 | |||
| 774 | Ga0070691_10175064 | |||
| 775 | Ga0070661_100286714 | |||
| 776 | Ga0070661_100534170 | |||
| 777 | Ga0070668_100092623 | |||
| 778 | Ga0070668_100187180 | |||
| 779 | Ga0070669_101041251 | |||
| 780 | Ga0070675_100001374 | |||
| 781 | Ga0070675_100794070 | |||
| 782 | Ga0070671_100472693 | |||
| 783 | Ga0070674_100000005 | |||
| 784 | Ga0070674_100883349 | |||
| 785 | Ga0070688_100000027 | |||
| 786 | Ga0070688_100000137 | |||
| 787 | Ga0070688_100131333 | |||
| 788 | Ga0070688_100316356 | |||
| 789 | Ga0070659_100045236 | |||
| 790 | Ga0070659_100205266 | |||
| 791 | Ga0070667_100001804 | |||
| 792 | Ga0070714_100149126 | |||
| 793 | Ga0070714_101110146 | |||
| 794 | Ga0070713_100000010 | |||
| 795 | Ga0070713_100030614 | |||
| 796 | Ga0070710_10111940 | |||
| 797 | Ga0070711_100156261 | |||
| 798 | Ga0070705_100965030 | |||
| 799 | Ga0070700_100002745 | |||
| 800 | Ga0070700_100094584 | |||
| 801 | Ga0070700_100132328 | |||
| 802 | Ga0070663_100003515 | |||
| 803 | Ga0070663_100282888 | |||
| 804 | Ga0070663_100296890 | |||
| 805 | Ga0070663_100340140 | |||
| 806 | Ga0070663_101052481 | |||
| 807 | Ga0070678_100014888 | |||
| 808 | Ga0070678_100291218 | |||
| 809 | Ga0070662_100000061 | |||
| 810 | Ga0070662_100039645 | |||
| 811 | Ga0070681_10059778 | |||
| 812 | Ga0070685_10000118 | |||
| 813 | Ga0070685_10000314 | |||
| 814 | Ga0070685_10072877 | |||
| 815 | Ga0070685_10087804 | |||
| 816 | Ga0070685_10106445 | |||
| 817 | Ga0070679_100013601 | |||
| 818 | Ga0070684_100053827 | |||
| 819 | Ga0070684_100123150 | |||
| 820 | Ga0070684_100143466 | |||
| 821 | Ga0070684_100294089 | |||
| 822 | Ga0068853_100004255 | |||
| 823 | Ga0068853_100095316 | |||
| 824 | Ga0068853_100362752 | |||
| 825 | Ga0070672_100000001 | |||
| 826 | Ga0070672_100369010 | |||
| 827 | Ga0070686_100226354 | |||
| 828 | Ga0070693_100187036 | |||
| 829 | Ga0070665_100003200 | |||
| 830 | Ga0070665_100010272 | |||
| 831 | Ga0070665_100039215 | |||
| 832 | Ga0070665_100111465 | |||
| 833 | Ga0070704_100042551 | |||
| 834 | Ga0070704_100330457 | |||
| 835 | Ga0070704_101866755 | |||
| 836 | Ga0068855_100956083 | |||
| 837 | Ga0068855_101286635 | |||
| 838 | Ga0070664_100006766 | |||
| 839 | Ga0070664_100308394 | |||
| 840 | Ga0068857_101070703 | |||
| 841 | Ga0068854_100000116 | |||
| 842 | Ga0068854_100023912 | |||
| 843 | Ga0068856_100000336 | |||
| 844 | Ga0068856_100037370 | |||
| 845 | Ga0070702_100061604 | |||
| 846 | Ga0070702_100737497 | |||
| 847 | Ga0068852_100000056 | |||
| 848 | Ga0068852_100010346 | |||
| 849 | Ga0068852_100042343 | |||
| 850 | Ga0068864_100000031 | |||
| 851 | Ga0068864_100014239 | |||
| 852 | Ga0068866_10000195 | |||
| 853 | Ga0068866_10015213 | |||
| 854 | Ga0068861_100051349 | |||
| 855 | Ga0068861_100405829 | |||
| 856 | Ga0068851_10000468 | |||
| 857 | Ga0068851_10001033 | |||
| 858 | Ga0068863_100028395 | |||
| 859 | Ga0068863_100123870 | |||
| 860 | Ga0068863_100224842 | |||
| 861 | Ga0068858_100000097 | |||
| 862 | Ga0068858_100037360 | |||
| 863 | Ga0068858_100154879 | |||
| 864 | Ga0068860_100066633 | |||
| 865 | Ga0068860_100214280 | |||
| 866 | Ga0068860_100342690 | |||
| 867 | Ga0068862_100001600 | |||
| 868 | Ga0068862_100096434 | |||
| 869 | Ga0068862_101652106 | |||
| 870 | Ga0081455_10132787 | |||
| 871 | Ga0081455_10800476 | |||
| 872 | Ga0081540_1000041 | |||
| 873 | Ga0081539_10004283 | |||
| 874 | Ga0075432_10288701 | |||
| 875 | Ga0070715_10090477 | |||
| 876 | Ga0070716_100090602 | |||
| 877 | Ga0070712_100042998 | |||
| 878 | Ga0097621_100231596 | |||
| 879 | Ga0068871_100111298 | |||
| 880 | Ga0068871_100968166 | |||
| 881 | Ga0075428_100978568 | |||
| 882 | Ga0075428_101087111 | |||
| 883 | Ga0075430_100036158 | |||
| 884 | Ga0075430_100613883 | |||
| 885 | Ga0075431_100063469 | |||
| 886 | Ga0075431_100164786 | |||
| 887 | Ga0075433_10003996 | |||
| 888 | Ga0075433_10125560 | |||
| 889 | Ga0075433_10830415 | |||
| 890 | Ga0075434_100386988 | |||
| 891 | Ga0068865_100000069 | |||
| 892 | Ga0075435_100413210 | |||
| 893 | Ga0105251_10146619 | |||
| 894 | Ga0105251_10348210 | |||
| 895 | Ga0111539_10024141 | |||
| 896 | Ga0111539_10112388 | |||
| 897 | Ga0111539_10176370 | |||
| 898 | Ga0105245_10000130 | |||
| 899 | Ga0105245_10000141 | |||
| 900 | Ga0105245_10008690 | |||
| 901 | Ga0105245_10028361 | |||
| 902 | Ga0105247_10000278 | |||
| 903 | Ga0105247_10045335 | |||
| 904 | Ga0105247_10575652 | |||
| 905 | Ga0114129_10927142 | |||
| 906 | Ga0105243_10033298 | |||
| 907 | Ga0105243_10127755 | |||
| 908 | Ga0105243_11115052 | |||
| 909 | Ga0105243_11429243 | |||
| 910 | Ga0105242_10000921 | |||
| 911 | Ga0105242_10002595 | |||
| 912 | Ga0105242_10173736 | |||
| 913 | Ga0105242_10225132 | |||
| 914 | Ga0105248_10000020 | |||
| 915 | Ga0105248_10076330 | |||
| 916 | Ga0105248_10238272 | |||
| 917 | Ga0105248_12007152 | |||
| 918 | Ga0105237_10426527 | |||
| 919 | Ga0105237_11002831 | |||
| 920 | Ga0105249_10000332 | |||
| 921 | Ga0105249_10006073 | |||
| 922 | Ga0105249_10313847 | |||
| 923 | Ga0105249_12146140 | |||
| 924 | Ga0105239_10025573 | |||
| 925 | Ga0105239_10389105 | |||
| 926 | Ga0105239_11490943 | |||
| 927 | Ga0105239_13597765 | |||
| 928 | Ga0105246_10032872 | |||
| 929 | Ga0105246_10809397 | |||
| 930 | Ga0157371_10007100 | |||
| 931 | Ga0157370_10054742 | |||
| 932 | Ga0157370_10191088 | |||
| 933 | Ga0157370_10279837 | |||
| 934 | Ga0157370_12125075 | |||
| 935 | Ga0157369_10000074 | |||
| 936 | Ga0157369_12291855 | |||
| 937 | Ga0157374_10038937 | |||
| 938 | Ga0157374_10254938 | |||
| 939 | Ga0157378_10003612 | |||
| 940 | Ga0157378_10023644 | |||
| 941 | Ga0163162_10314267 | |||
| 942 | Ga0163162_11669252 | |||
| 943 | Ga0157372_10000204 | |||
| 944 | Ga0157372_10032670 | |||
| 945 | Ga0157372_11912817 | |||
| 946 | Ga0157375_10000349 | |||
| 947 | Ga0157375_10004278 | |||
| 948 | Ga0157375_10314075 | |||
| 949 | Ga0157375_11053829 | |||
| 950 | Ga0157375_11799550 | |||
| 951 | Ga0157375_12368490 | |||
| 952 | Ga0163163_10550945 | |||
| 953 | Ga0163163_10819172 | |||
| 954 | Ga0157380_10006147 | |||
| 955 | Ga0157380_10081236 | |||
| 956 | Ga0157380_10157809 | |||
| 957 | Ga0157380_11566060 | |||
| 958 | Ga0157377_10000445 | |||
| 959 | Ga0157377_10265890 | |||
| 960 | Ga0157379_10005569 | |||
| 961 | Ga0157379_10058400 | |||
| 962 | Ga0157379_10133622 | |||
| 963 | Ga0157379_10144305 | |||
| 964 | Ga0157379_10176166 | |||
| 965 | Ga0157376_10070558 | |||
| 966 | Ga0206356_11724305 | |||
| 967 | Ga0207672_1001729 | |||
| 968 | Ga0207656_10000751 | |||
| 969 | Ga0207656_10023777 | |||
| 970 | Ga0207653_10084503 | |||
| 971 | Ga0207692_10682274 | |||
| 972 | Ga0207642_10001193 | |||
| 973 | Ga0207642_10002040 | |||
| 974 | Ga0207642_10192895 | |||
| 975 | Ga0207710_10000502 | |||
| 976 | Ga0207688_10002520 | |||
| 977 | Ga0207680_10043395 | |||
| 978 | Ga0207685_10045505 | |||
| 979 | Ga0207645_10553227 | |||
| 980 | Ga0207643_10264724 | |||
| 981 | Ga0207705_10205121 | |||
| 982 | Ga0207671_10557340 | |||
| 983 | Ga0207693_10015100 | |||
| 984 | Ga0207663_10029417 | |||
| 985 | Ga0207663_10902153 | |||
| 986 | Ga0207652_10000867 | |||
| 987 | Ga0207681_11190819 | |||
| 988 | Ga0207650_10061410 | |||
| 989 | Ga0207659_10000013 | |||
| 990 | Ga0207687_10000032 | |||
| 991 | Ga0207687_10000036 | |||
| 992 | Ga0207687_10017110 | |||
| 993 | Ga0207700_10000007 | |||
| 994 | Ga0207700_10021763 | |||
| 995 | Ga0207664_10588084 | |||
| 996 | Ga0207644_10266257 | |||
| 997 | Ga0207644_11212774 | |||
| 998 | Ga0207690_10002754 | |||
| 999 | Ga0207690_10102524 | |||
| 1000 | Ga0207706_10000250 | |||
| 1001 | Ga0207706_10021657 | |||
| 1002 | Ga0207686_10000073 | |||
| 1003 | Ga0207686_10002267 | |||
| 1004 | Ga0207686_10093508 | |||
| 1005 | Ga0207686_10129688 | |||
| 1006 | Ga0207709_10007830 | |||
| 1007 | Ga0207709_10677328 | |||
| 1008 | Ga0207709_10691067 | |||
| 1009 | Ga0207670_10046504 | |||
| 1010 | Ga0207670_10262061 | |||
| 1011 | Ga0207670_10705412 | |||
| 1012 | Ga0207669_10000006 | |||
| 1013 | Ga0207669_10086413 | |||
| 1014 | Ga0207704_10000049 | |||
| 1015 | Ga0207665_10166651 | |||
| 1016 | Ga0207691_10000529 | |||
| 1017 | Ga0207691_10761477 | |||
| 1018 | Ga0207711_10000006 | |||
| 1019 | Ga0207711_10439811 | |||
| 1020 | Ga0207711_10814191 | |||
| 1021 | Ga0207689_10062152 | |||
| 1022 | Ga0207661_10000312 | |||
| 1023 | Ga0207661_10003572 | |||
| 1024 | Ga0207661_10031276 | |||
| 1025 | Ga0207661_10160640 | |||
| 1026 | Ga0207661_10247915 | |||
| 1027 | Ga0207661_10478776 | |||
| 1028 | Ga0207679_10004161 | |||
| 1029 | Ga0207679_10018226 | |||
| 1030 | Ga0207679_10278898 | |||
| 1031 | Ga0207667_10764523 | |||
| 1032 | Ga0207667_10797204 | |||
| 1033 | Ga0207712_10000058 | |||
| 1034 | Ga0207712_10009081 | |||
| 1035 | Ga0207712_11347634 | |||
| 1036 | Ga0207668_10084743 | |||
| 1037 | Ga0207668_10317588 | |||
| 1038 | Ga0207640_10000134 | |||
| 1039 | Ga0207640_10081957 | |||
| 1040 | Ga0207640_10989338 | |||
| 1041 | Ga0207658_10006099 | |||
| 1042 | Ga0207658_10035972 | |||
| 1043 | Ga0207677_10000263 | |||
| 1044 | Ga0207677_10000374 | |||
| 1045 | Ga0207677_10193593 | |||
| 1046 | Ga0207703_10000103 | |||
| 1047 | Ga0207703_10143408 | |||
| 1048 | Ga0207703_10542076 | |||
| 1049 | Ga0207678_10001469 | |||
| 1050 | Ga0207678_10090039 | |||
| 1051 | Ga0207678_10242140 | |||
| 1052 | Ga0207708_10004524 | |||
| 1053 | Ga0207708_10038188 | |||
| 1054 | Ga0207708_10042099 | |||
| 1055 | Ga0207702_10000368 | |||
| 1056 | Ga0207702_10008621 | |||
| 1057 | Ga0207641_10073252 | |||
| 1058 | Ga0207641_10113808 | |||
| 1059 | Ga0207641_10187194 | |||
| 1060 | Ga0207648_11095651 | |||
| 1061 | Ga0207676_10000031 | |||
| 1062 | Ga0207676_10082519 | |||
| 1063 | Ga0207674_10316005 | |||
| 1064 | Ga0207675_100076384 | |||
| 1065 | Ga0207675_100210623 | |||
| 1066 | Ga0207675_101010257 | |||
| 1067 | Ga0207683_10004139 | |||
| 1068 | Ga0207683_10290840 | |||
| 1069 | Ga0207698_10000101 | |||
| 1070 | Ga0207698_10006939 | |||
| 1071 | Ga0207698_10273893 | |||
| 1072 | Ga0207428_10041121 | |||
| 1073 | Ga0207428_10061904 | |||
| 1074 | Ga0268266_10000264 | |||
| 1075 | Ga0268266_10005437 | |||
| 1076 | Ga0268266_10028179 | |||
| 1077 | Ga0268266_10041882 | |||
| 1078 | Ga0268266_10108705 | |||
| 1079 | Ga0268265_10009350 | |||
| 1080 | Ga0268265_10047342 | |||
| 1081 | Ga0268264_10049938 | |||
| 1082 | Ga0268264_10355086 | |||
| 1083 | Ga0265337_1000240 | |||
| 1084 | Ga0265326_10000393 | |||
| 1085 | Ga0265319_1000105 | |||
| 1086 | Ga0265334_10086289 | |||
| 1087 | Ga0265322_10000029 | |||
| 1088 | Ga0265338_10000507 | |||
| 1089 | Ga0265324_10001546 | |||
| 1090 | Ga0265332_10010532 | |||
| 1091 | Ga0265328_10008084 | |||
| 1092 | Ga0265320_10000011 | |||
| 1093 | Ga0265325_10004631 | |||
| 1094 | Ga0265329_10003959 | |||
| 1095 | Ga0265331_10001215 | |||
| 1096 | Ga0265327_10000015 | |||
| 1097 | Ga0265316_10073036 | |||
| 1098 | Ga0307408_101373428 | |||
| 1099 | Ga0316579_10169877 | |||
| 1100 | Ga0265314_10000361 | |||
| 1101 | Ga0265342_10060888 | |||
| 1102 | Ga0265342_10384872 | |||
| 1103 | Ga0307413_10007422 | |||
| 1104 | Ga0307410_10003727 | |||
| 1105 | Ga0307406_10046611 | |||
| 1106 | Ga0307407_10001863 | |||
| 1107 | Ga0307412_10130106 | |||
| 1108 | Ga0307416_100001733 | |||
| 1109 | Ga0307411_10159554 | |||
| 1110 | Ga0307415_100001502 | |||
| 1111 | Ga0307415_100003860 | |||
| 1112 | Ga0373954_0402157 | |||
| 1113 | Ga0373933_0831544 | |||
| 1114 | Ga0373947_0993972 | |||
| 1115 | Ga0373937_0009637 | |||
| 1116 | Ga0316582_0153764 | |||
| 1117 | Ga0395901_0309653 | |||
| 1118 | Ga0451807_0449275 | |||
| 1119 | Ga0451807_0563839 | |||
| 1120 | Ga0451833_0117804 | |||
| 1121 | Ga0451837_1598875 | |||
| 1122 | Ga0451845_0743034 | |||
| 1123 | Ga0451853_2844863 | |||
| 1124 | Ga0451853_3468528 | |||
| 1125 | Ga0466963_0030303 | |||
| 1126 | Ga0466957_0001462 | |||
| 1127 | Ga0466957_0104645 | |||
| 1128 | Ga0466957_0263224 | |||
| 1129 | Ga0466958_0424672 | |||
| 1130 | Ga0466967_0000001 | |||
| 1131 | Ga0466967_0327750 | |||
| 1132 | Ga0466967_0733621 | |||
| 1133 | Ga0466967_1004672 | |||
| 1134 | Ga0495592_0108889 | |||
| 1135 | Ga0495592_0250954 | |||
| 1136 | Ga0495592_0465135 | |||
| 1137 | Ga0495603_0002090 | |||
| 1138 | Ga0495629_0000411 | |||
| 1139 | Ga0495629_0001073 | |||
| 1140 | Ga0495629_0049756 | |||
| 1141 | Ga0495629_0082097 | |||
| 1142 | Ga0495629_1071665 | |||
| 1143 | Ga0495638_0042481 | |||
| 1144 | Ga0495641_0016606 | |||
| 1145 | Ga0495641_0019177 | |||
| 1146 | Ga0495641_0024469 | |||
| 1147 | Ga0495651_0218633 | |||
| 1148 | Ga0495651_0400706 | |||
| 1149 | Ga0495651_0444297 | |||
| 1150 | Ga0495653_0014708 | |||
| 1151 | Ga0495653_0137220 | |||
| 1152 | Ga0495653_0139619 | |||
| 1153 | Ga0495653_0285572 | |||
| 1154 | Ga0495582_0000001 | |||
| 1155 | Ga0495662_0008393 | |||
| 1156 | Ga0495662_0177009 | |||
| 1157 | Ga0495664_0597089 | |||
| 1158 | Ga0495585_0352966 | |||
| 1159 | Ga0495594_0000011 | |||
| 1160 | Ga0495594_0855962 | |||
| 1161 | Ga0495606_0000586 | |||
| 1162 | Ga0495608_0000007 | |||
| 1163 | Ga0495610_0041699 | |||
| 1164 | Ga0495628_0001264 | |||
| 1165 | Ga0495628_0045591 | |||
| 1166 | Ga0495628_0057763 | |||
| 1167 | Ga0495628_0242678 | |||
| 1168 | Ga0495628_0558443 | |||
| 1169 | Ga0495628_0775320 | |||
| 1170 | Ga0495628_0864630 | |||
| 1171 | Ga0495630_0000075 | |||
| 1172 | Ga0495630_0000176 | |||
| 1173 | Ga0495630_0194987 | |||
| 1174 | Ga0495630_0257757 | |||
| 1175 | Ga0495637_0195474 | |||
| 1176 | Ga0495652_0000037 | |||
| 1177 | Ga0495652_0046628 | |||
| 1178 | Ga0495652_0049195 | |||
| 1179 | Ga0495640_0017430 | |||
| 1180 | Ga0495640_0689932 | |||
| 1181 | Ga0495586_0630368 | |||
| 1182 | Ga0495587_0006294 | |||
| 1183 | Ga0495587_0298466 | |||
| 1184 | Ga0495621_0003893 | |||
| 1185 | Ga0495645_0000984 | |||
| 1186 | Ga0495645_0118482 | |||
| 1187 | Ga0495622_0000387 | |||
| 1188 | Ga0495667_0000020 | |||
| 1189 | Ga0495667_0022744 | |||
| 1190 | Ga0495656_0000651 | |||
| 1191 | Ga0495634_0000031 | |||
| 1192 | Ga0495634_0000381 | |||
| 1193 | Ga0495634_0004572 | |||
| 1194 | Ga0495634_0407165 | |||
| 1195 | Ga0495634_0432442 | |||
| 1196 | Ga0495634_0569937 | |||
| 1197 | Ga0495625_0001050 | |||
| 1198 | Ga0495625_0384437 | |||
| 1199 | Ga0495635_0018716 | |||
| 1200 | Ga0495635_0040441 | |||
| 1201 | Ga0495635_0661759 | |||
| 1202 | Ga0495588_0000187 | |||
| 1203 | Ga0495657_0000001 | |||
| 1204 | Ga0495657_0011381 | |||
| 1205 | Ga0495657_0581407 | |||
| 1206 | Ga0495599_0107435 | |||
| 1207 | Ga0495647_0000330 | |||
| 1208 | Ga0495647_0320544 | |||
| 1209 | Ga0495658_0000002 | |||
| 1210 | Ga0495658_0000803 | |||
| 1211 | Ga0495658_0306894 | |||
| 1212 | Ga0495669_0000143 | |||
| 1213 | Ga0495669_0044920 | |||
| 1214 | Ga0495613_0000247 | |||
| 1215 | Ga0495613_0895199 | |||
| 1216 | Ga0495624_0000027 | |||
| 1217 | Ga0495624_0096253 | |||
| 1218 | Ga0495600_0006201 | |||
| 1219 | Ga0495600_0042494 | |||
| 1220 | Ga0495600_0219515 | |||
| 1221 | Ga0495600_0871357 | |||
| 1222 | Ga0495660_0250386 | |||
| 1223 | Ga0495604_0000050 | |||
| 1224 | Ga0495604_0000195 | |||
| 1225 | Ga0495604_0120885 | |||
| 1226 | Ga0495604_0526782 | |||
| 1227 | Ga0495674_0000030 | |||
| 1228 | Ga0495674_0184115 | |||
| 1229 | Ga0495672_0047025 | |||
| 1230 | Ga0495672_0097496 | |||
| 1231 | Ga0495672_0143252 | |||
| 1232 | Ga0495676_0079424 | |||
| 1233 | Ga0495676_0080527 | |||
| 1234 | Ga0495676_0106219 | |||
| 1235 | Ga0495676_0130259 | |||
| 1236 | Ga0495680_0002123 | |||
| 1237 | Ga0495680_0084405 | |||
| 1238 | Ga0495680_0097487 | |||
| 1239 | Ga0495680_0313333 | |||
| 1240 | Ga0495680_0950938 | |||
| 1241 | Ga0495675_0000453 | |||
| 1242 | Ga0495684_0558426 | |||
| 1243 | Ga0495684_0757715 | |||
| 1244 | Ga0495686_0461613 | |||
| 1245 | Ga0495593_0014303 | |||
| 1246 | Ga0495593_0079888 | |||
| 1247 | Ga0495593_0264483 | |||
| 1248 | Ga0495602_0000007 | |||
| 1249 | Ga0495602_0000571 | |||
| 1250 | Ga0495602_0256129 | |||
| 1251 | Ga0495602_0324782 | |||
| 1252 | Ga0495602_0390652 | |||
| 1253 | Ga0495602_0655424 | |||
| 1254 | Ga0496100_0000001 | |||
| 1255 | Ga0496100_0000013 | |||
| 1256 | Ga0496100_0085035 | |||
| 1257 | Ga0496100_0266461 | |||
| 1258 | Ga0496101_0000004 | |||
| 1259 | Ga0496101_0000035 | |||
| 1260 | Ga0496102_0000522 | |||
| 1261 | Ga0496102_0034709 | |||
| 1262 | Ga0496102_0148303 | |||
| 1263 | Ga0496103_0000174 | |||
| 1264 | Ga0496103_0116450 | |||
| 1265 | Ga0496103_0580683 | |||
| 1266 | Ga0496104_0000052 | |||
| 1267 | Ga0496104_0010872 | |||
| 1268 | Ga0496104_0070089 | |||
| 1269 | Ga0496104_0192147 | |||
| 1270 | Ga0496104_0652829 | |||
| 1271 | Ga0496105_0000030 | |||
| 1272 | Ga0496105_0025392 | |||
| 1273 | Ga0496105_0096371 | |||
| 1274 | Ga0496105_0273167 | |||
| 1275 | Ga0496106_0000062 | |||
| 1276 | Ga0496106_0001278 | |||
| 1277 | Ga0496106_0094420 | |||
| 1278 | Ga0496106_1014754 | |||
| 1279 | Ga0496107_0000005 | |||
| 1280 | Ga0496107_0000020 | |||
| 1281 | Ga0496107_0216851 | |||
| 1282 | Ga0496107_0229892 | |||
| 1283 | Ga0496107_1122748 | |||
| 1284 | Ga0496108_0000006 | |||
| 1285 | Ga0496108_0000137 | |||
| 1286 | Ga0496108_0001912 | |||
| 1287 | Ga0496108_0031741 | |||
| 1288 | Ga0496108_0039281 | |||
| 1289 | Ga0496108_0284449 | |||
| 1290 | Ga0496109_0000009 | |||
| 1291 | Ga0496109_0000088 | |||
| 1292 | Ga0496109_0000218 | |||
| 1293 | Ga0496109_0001088 | |||
| 1294 | Ga0496109_0068234 | |||
| 1295 | Ga0496109_0216837 | |||
| 1296 | Ga0496109_0616125 | |||
| 1297 | Ga0496109_0690484 | |||
| 1298 | Ga0496110_0000242 | |||
| 1299 | Ga0496110_0001010 | |||
| 1300 | Ga0496110_0064263 | |||
| 1301 | Ga0496110_0167941 | |||
| 1302 | Ga0496110_0168374 | |||
| 1303 | Ga0496110_0216346 | |||
| 1304 | Ga0496111_0000939 | |||
| 1305 | Ga0496111_0016343 | |||
| 1306 | Ga0496111_0108095 | |||
| 1307 | Ga0496111_0178208 | |||
| 1308 | Ga0496111_0312118 | |||
| 1309 | Ga0496112_0000025 | |||
| 1310 | Ga0496112_0019308 | |||
| 1311 | Ga0496112_0055849 | |||
| 1312 | Ga0496112_0129291 | |||
| 1313 | Ga0496112_1094769 | |||
| 1314 | Ga0496113_0000027 | |||
| 1315 | Ga0496113_0055795 | |||
| 1316 | Ga0496113_0072679 | |||
| 1317 | Ga0496113_0344274 | |||
| 1318 | Ga0496113_0350565 | |||
| 1319 | Ga0496114_0000039 | |||
| 1320 | Ga0496114_0147494 | |||
| 1321 | Ga0496115_0000011 | |||
| 1322 | Ga0496115_0000162 | |||
| 1323 | Ga0496115_0002639 | |||
| 1324 | Ga0496115_0279281 | |||
| 1325 | Ga0496115_0699792 | |||
| 1326 | Ga0496116_0000176 | |||
| 1327 | Ga0496117_0002967 | |||
| 1328 | Ga0496117_0186608 | |||
| 1329 | Ga0496118_0007078 | |||
| 1330 | Ga0496118_0088584 | |||
| 1331 | Ga0496118_0134915 | |||
| 1332 | Ga0496119_0001444 | |||
| 1333 | Ga0496119_0019408 | |||
| 1334 | Ga0496119_0086064 | |||
| 1335 | Ga0496120_0003250 | |||
| 1336 | Ga0496121_0014377 | |||
| 1337 | Ga0496121_0014861 | |||
| 1338 | Ga0496121_0213138 | |||
| 1339 | Ga0496121_0366443 | |||
| 1340 | Ga0496121_0671992 | |||
| 1341 | Ga0496124_0132865 | |||
| 1342 | Ga0496124_0184401 | |||
| 1343 | Ga0496124_0287237 | |||
| 1344 | Ga0496125_0198717 | |||
| 1345 | Ga0496126_0003514 | |||
| 1346 | Ga0496126_0232957 | |||
| 1347 | Ga0496126_0378071 | |||
| 1348 | Ga0496126_0846706 | |||
| 1349 | Ga0501031_0008813 | |||
| 1350 | Ga0501031_0460942 | |||
| 1351 | Ga0501032_0011441 | |||
| 1352 | Ga0501032_0238277 | |||
| 1353 | Ga0501033_0001738 | |||
| 1354 | Ga0501034_1421742 | |||
| 1355 | Ga0501036_0001408 | |||
| 1356 | Ga0501037_0000901 | |||
| 1357 | Ga0501037_0689930 | |||
| 1358 | Ga0501038_0002106 | |||
| 1359 | Ga0501038_0404674 | |||
| 1360 | Ga0501039_0013427 | |||
| 1361 | Ga0501040_0036032 | |||
| 1362 | Ga0501040_0202387 | |||
| 1363 | Ga0501040_0203666 | |||
| 1364 | Ga0501042_0022064 | |||
| 1365 | Ga0501042_0045237 | |||
| 1366 | Ga0501042_0069255 | |||
| 1367 | Ga0501042_0485123 | |||
| 1368 | Ga0501043_0011297 | |||
| 1369 | Ga0501046_0015188 | |||
| 1370 | Ga0501047_0002109 | |||
| 1371 | Ga0501047_0006504 | |||
| 1372 | Ga0501047_0008337 | |||
| 1373 | Ga0501047_1158714 | |||
| 1374 | Ga0501047_1181704 | |||
| 1375 | Ga0501048_0012235 | |||
| 1376 | Ga0501048_0060993 | |||
| 1377 | Ga0501067_0021980 | |||
| 1378 | Ga0501067_0443913 | |||
| 1379 | Ga0501068_0018119 | |||
| 1380 | Ga0501068_0087718 | |||
| 1381 | Ga0501068_0199331 | |||
| 1382 | Ga0501069_0009621 | |||
| 1383 | Ga0501070_0000592 | |||
| 1384 | Ga0501070_0008128 | |||
| 1385 | Ga0501070_0602678 | |||
| 1386 | Ga0501071_0042291 | |||
| 1387 | Ga0501071_0109142 | |||
| 1388 | Ga0501071_1060811 | |||
| 1389 | Ga0501072_0010121 | |||
| 1390 | Ga0501072_0147709 | |||
| 1391 | Ga0501072_0318892 | |||
| 1392 | Ga0501073_0006491 | |||
| 1393 | Ga0501074_0022710 | |||
| 1394 | Ga0501074_0030449 | |||
| 1395 | Ga0501074_0137269 | |||
| 1396 | Ga0501074_0499211 | |||
| 1397 | Ga0501075_0135862 | |||
| 1398 | Ga0501077_0374871 | |||
| 1399 | Ga0501249_142490 | |||
| 1400 | Ga0501079_0013016 | |||
| 1401 | Ga0501079_0050835 | |||
| 1402 | Ga0501079_0431608 | |||
| 1403 | Ga0501079_0771788 | |||
| 1404 | Ga0501080_0057426 | |||
| 1405 | Ga0501080_0070877 | |||
| 1406 | Ga0501080_0360974 | |||
| 1407 | Ga0501081_0508897 | |||
| 1408 | Ga0501081_0923095 | |||
| 1409 | Ga0501081_1216889 | |||
| 1410 | Ga0501083_0004753 | |||
| 1411 | Ga0501083_0010981 | |||
| 1412 | Ga0501083_0031296 | |||
| 1413 | Ga0501035_0000368 | |||
| 1414 | Ga0501035_0375289 | |||
| 1415 | Ga0501044_0000684 | |||
| 1416 | Ga0501044_0074576 | |||
| 1417 | Ga0501044_0101755 | |||
| 1418 | Ga0501044_0248802 | |||
| 1419 | Ga0501044_0802011 | |||
| 1420 | Ga0501045_0039289 | |||
| 1421 | Ga0501045_0773835 | |||
| 1422 | nmdc:mga05p37_59262_c1 | |||
| 1423 | nmdc:mga0qj67_332229_c1 | |||
| 1424 | nmdc:mga0qj67_470103_c1 | |||
| 1425 | nmdc:mga08y16_347531_c1 | |||
| 1426 | nmdc:mga08y16_45474_c1 | |||
| 1427 | nmdc:mga0n895_174888_c1 | |||
| 1428 | nmdc:mga0rr50_61718_c1 | |||
| 1429 | nmdc:mga08x19_27725_c1 | |||
| 1430 | nmdc:mga0a205_113_c3 | |||
| 1431 | nmdc:mga0a205_19929_c1 | |||
| 1432 | nmdc:mga0a205_521_c2 | |||
| 1433 | Ga0495601_0000043 | |||
| 1434 | Ga0495601_0001148 | |||
| 1435 | Ga0495601_0011090 | |||
| 1436 | Ga0495601_0014246 | |||
| 1437 | Ga0495601_0069631 | |||
| 1438 | Ga0495601_0393262 | |||
| 1439 | Ga0495612_0000230 | |||
| 1440 | Ga0495612_0001360 | |||
| 1441 | Ga0495612_0001568 | |||
| 1442 | Ga0495612_0077495 | |||
| 1443 | Ga0495612_0089724 | |||
| 1444 | Ga0495612_0125217 | |||
| 1445 | Ga0495612_0184819 | |||
| 1446 | Ga0495655_0000002 | |||
| 1447 | Ga0495655_0083877 | |||
| 1448 | Ga0495595_0000002 | |||
| 1449 | Ga0495595_0003229 | |||
| 1450 | Ga0495595_0065066 | |||
| 1451 | Ga0495595_0113105 | |||
| 1452 | Ga0495595_0345915 | |||
| 1453 | Ga0495619_0000010 | |||
| 1454 | Ga0495619_0000047 | |||
| 1455 | Ga0495619_0000276 | |||
| 1456 | Ga0495619_0000801 | |||
| 1457 | Ga0495619_0002422 | |||
| 1458 | Ga0495619_0004064 | |||
| 1459 | Ga0495619_0017246 | |||
| 1460 | Ga0495619_0050110 | |||
| 1461 | Ga0495619_0064404 | |||
| 1462 | Ga0495619_0256761 | |||
| 1463 | Ga0495619_0334113 | |||
| 1464 | Ga0500641_0000977 | |||
| 1465 | Ga0500556_0000885 | |||
| 1466 | Ga0500595_057613 | |||
| 1467 | Ga0500628_000001 | |||
| 1468 | Ga0500616_0002393 | |||
| 1469 | Ga0500599_007306 | |||
| 1470 | Ga0590077_073083 | |||
| 1471 | Ga0501082_0023889 | |||
| 1472 | Ga0501082_0281779 | |||
| 1473 | Ga0501082_1153233 | |||
| 1474 | Ga0530510_0543909 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2res-assembly1.cif.gz_A | tetracenomycin aro/cyc mutant r69a | 0.8705 | 2 | 149 |
| 7tmu-assembly4.cif.gz_D | crystal structure of the protein of unknown function ypo0625 from yersinia pestis | 0.8653 | 2 | 150 |
| 7tmu-assembly4.cif.gz_D | crystal structure of the protein of unknown function ypo0625 from yersinia pestis | 0.843 | 2 | 150 |
| 2rez-assembly1.cif.gz_A | tetracenomycin aro/cyc nai structure | 0.8421 | 2 | 149 |
| 7wa9-assembly1.cif.gz_A | crystal structure of msmeg_5634 from mycobacterium smegmatis | 0.841 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WL87_17_165_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.89 | 2 | 147 | 3.30.530.20 |
| 2resA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8705 | 2 | 149 | 3.30.530.20 |
| af_L7N657_19_160_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8659 | 4 | 149 | 3.30.530.20 |
| af_O53519_3_143_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8461 | 2 | 150 | 3.30.530.20 |
| af_A0A1D8PNQ2_25_168_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8428 | 2 | 149 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7X6E1-F1-model_v4 | Polyketide cyclase | 0.993 | 10 | 149 |
|
| AF-A0A2W5YAK6-F1-model_v4 | SRPBCC family protein | 0.9909 | 1 | 150 |
|
| AF-A0A538ECK4-F1-model_v4 | SRPBCC family protein | 0.9861 | 1 | 150 |
|
| AF-A0A840II40-F1-model_v4 | Uncharacterized protein YndB with AHSA1/START domain | 0.9773 | 1 | 149 |
|
| AF-A0A1Q3NH09-F1-model_v4 | deleted | 0.9748 | 1 | 149 |
|