F478352

General Info

Members Datasets Scaffolds Average Seq Length
737 325 1474 241

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_180338_c1|nmdc:mga0k408_180338_c1_389_1216
Length 275
Sequence MTKARQALDEHSPNGVATKAGDDVRVDQLLVQRGLAPTRSAAQRLIAGGAVRWLGPAGWATPKKSGEELPEACELEVSDDAELRYVSRGGLKLEAALLHAGLDVHGMTCLDVGQSTGGFTDVLLQRGAARVVGIDVGHGQLHPRLRGDARVVALEGINARHLTAAALPVDRFDLVVGDLSFISLALVLPALGPLLDGGGELLLLVKPQFELQPADIGKGGLVKDPLAHVRVEQRLREACAASRLQVLDWFACSITGGDGNQEFFLRARPGNGDPS

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
203 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
204 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
286 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
302 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
303 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
308 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
309 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
314 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
319 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
320 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
321 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
322 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
323 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
324 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
325 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 0
Rhizoplane 4.07
Rhizosphere 79.51
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_180338_c1 3300050493 Bacteria 1259
2 JGI24736J21556_1003772 3300001904 Bacteria 2611
3 JGI24740J21852_10013184 3300001979 Bacteria 3092
4 JGI25153J46596_10008423 3300003215 Bacteria 4929
5 rootH1_10010451 3300003323 Bacteria 1170
6 Ga0055526_1002246 3300003771 Bacteria 13215
7 Ga0055530_10014921 3300003791 Bacteria 2562
8 Ga0065712_10132044 3300005290 Bacteria 1538
9 Ga0070658_10027022 3300005327 Bacteria 4608
10 Ga0070658_10158905 3300005327 Bacteria 1895
11 Ga0070676_10000434 3300005328 Bacteria 19840
12 Ga0070676_10005544 3300005328 Bacteria 6720
13 Ga0070676_10076348 3300005328 Bacteria 2022
14 Ga0070676_10135586 3300005328 Bacteria 1561
15 Ga0070676_10463154 3300005328 Bacteria 894
16 Ga0070683_100110394 3300005329 Bacteria 2594
17 Ga0070690_100001931 3300005330 Bacteria 11018
18 Ga0070670_100011920 3300005331 Bacteria 7434
19 Ga0070670_100057768 3300005331 Bacteria 3330
20 Ga0070670_100139592 3300005331 Bacteria 2095
21 Ga0070670_100220135 3300005331 Bacteria 1651
22 Ga0070670_100253181 3300005331 Bacteria 1534
23 Ga0070677_10002998 3300005333 Bacteria 5427
24 Ga0070677_10217885 3300005333 Bacteria 930
25 Ga0068869_100035950 3300005334 Bacteria 3515
26 Ga0068869_100052968 3300005334 Bacteria 2948
27 Ga0068869_100073084 3300005334 Bacteria 2542
28 Ga0070666_10000203 3300005335 Bacteria 40659
29 Ga0070666_10002319 3300005335 Bacteria 11506
30 Ga0070666_10332801 3300005335 Bacteria 1084
31 Ga0070680_100001090 3300005336 Bacteria 19474
32 Ga0070682_100011294 3300005337 Bacteria 5099
33 Ga0068868_100002885 3300005338 Bacteria 11932
34 Ga0068868_100022383 3300005338 Bacteria 4769
35 Ga0068868_100045059 3300005338 Bacteria 3450
36 Ga0068868_100133866 3300005338 Bacteria 2030
37 Ga0068868_100223005 3300005338 Bacteria 1579
38 Ga0068868_100371744 3300005338 Bacteria 1228
39 Ga0070660_100062262 3300005339 Bacteria 2898
40 Ga0070660_100143292 3300005339 Bacteria 1918
41 Ga0070689_100140805 3300005340 Bacteria 1940
42 Ga0070687_100097414 3300005343 Bacteria 1640
43 Ga0070661_100144055 3300005344 Bacteria 1797
44 Ga0070661_100158470 3300005344 Bacteria 1713
45 Ga0070661_100289946 3300005344 Bacteria 1271
46 Ga0070661_100445597 3300005344 Bacteria 1029
47 Ga0070692_10110649 3300005345 Bacteria 1519
48 Ga0070668_100000210 3300005347 Bacteria 38311
49 Ga0070668_100134892 3300005347 Bacteria 1984
50 Ga0070669_100000370 3300005353 Bacteria 34811
51 Ga0070669_100395568 3300005353 Bacteria 1130
52 Ga0070669_100396394 3300005353 Bacteria 1128
53 Ga0070669_100664447 3300005353 Bacteria 878
54 Ga0070675_100000692 3300005354 Bacteria 23415
55 Ga0070675_100024652 3300005354 Bacteria 4817
56 Ga0070675_100112076 3300005354 Bacteria 2309
57 Ga0070675_100183008 3300005354 Bacteria 1812
58 Ga0070675_100211102 3300005354 Bacteria 1687
59 Ga0070675_100564094 3300005354 Bacteria 1030
60 Ga0070671_100001030 3300005355 Bacteria 20495
61 Ga0070671_100025332 3300005355 Bacteria 4866
62 Ga0070671_100103137 3300005355 Bacteria 2393
63 Ga0070671_100189936 3300005355 Bacteria 1741
64 Ga0070671_100450194 3300005355 Bacteria 1105
65 Ga0070674_100017826 3300005356 Bacteria 4474
66 Ga0070674_100280459 3300005356 Bacteria 1320
67 Ga0070674_100363375 3300005356 Bacteria 1173
68 Ga0070673_100005042 3300005364 Bacteria 8423
69 Ga0070673_100017993 3300005364 Bacteria 5038
70 Ga0070673_100044461 3300005364 Bacteria 3439
71 Ga0070673_100165374 3300005364 Bacteria 1884
72 Ga0070673_100313731 3300005364 Bacteria 1384
73 Ga0070673_100381498 3300005364 Bacteria 1257
74 Ga0070688_100072165 3300005365 Bacteria 2211
75 Ga0070688_100205646 3300005365 Bacteria 1380
76 Ga0070659_100002668 3300005366 Bacteria 12688
77 Ga0070659_100077082 3300005366 Bacteria 2658
78 Ga0070659_100227019 3300005366 Bacteria 1542
79 Ga0070659_100235666 3300005366 Bacteria 1513
80 Ga0070667_100000294 3300005367 Bacteria 56218
81 Ga0070667_100003264 3300005367 Bacteria 13863
82 Ga0070667_100441377 3300005367 Bacteria 1188
83 Ga0070705_100106817 3300005440 Bacteria 1780
84 Ga0070663_100080353 3300005455 Bacteria 2394
85 Ga0070663_100233373 3300005455 Bacteria 1450
86 Ga0070678_100004854 3300005456 Bacteria 7679
87 Ga0070678_100046438 3300005456 Bacteria 3114
88 Ga0070678_100064650 3300005456 Bacteria 2712
89 Ga0070678_100131988 3300005456 Bacteria 1986
90 Ga0070678_100221017 3300005456 Bacteria 1574
91 Ga0070678_100223385 3300005456 Bacteria 1566
92 Ga0070678_100364205 3300005456 Bacteria 1246
93 Ga0070662_100046171 3300005457 Bacteria 3129
94 Ga0070662_100235123 3300005457 Bacteria 1467
95 Ga0070662_100342851 3300005457 Bacteria 1223
96 Ga0070662_100421132 3300005457 Bacteria 1105
97 Ga0070681_10353482 3300005458 Bacteria 1380
98 Ga0068867_100001702 3300005459 Bacteria 15330
99 Ga0068867_100002661 3300005459 Bacteria 12602
100 Ga0068867_100008359 3300005459 Bacteria 7304
101 Ga0068867_100191965 3300005459 Bacteria 1630
102 Ga0070706_100003301 3300005467 Bacteria 15955
103 Ga0070707_100035771 3300005468 Bacteria 4739
104 Ga0070699_100429763 3300005518 Bacteria 1196
105 Ga0070679_100147594 3300005530 Bacteria 2329
106 Ga0070684_100200687 3300005535 Bacteria 1816
107 Ga0070684_100551644 3300005535 Bacteria 1069
108 Ga0068853_100065642 3300005539 Bacteria 3150
109 Ga0068853_100168511 3300005539 Bacteria 1980
110 Ga0068853_100175584 3300005539 Bacteria 1940
111 Ga0068853_100528699 3300005539 Bacteria 1115
112 Ga0070672_100000286 3300005543 Bacteria 28584
113 Ga0070672_100000712 3300005543 Bacteria 19713
114 Ga0070672_100018646 3300005543 Bacteria 5022
115 Ga0070672_100088674 3300005543 Bacteria 2491
116 Ga0070672_100137000 3300005543 Bacteria 2016
117 Ga0070672_100223953 3300005543 Bacteria 1578
118 Ga0070672_100247339 3300005543 Bacteria 1501
119 Ga0070672_100488852 3300005543 Bacteria 1063
120 Ga0070672_100517523 3300005543 Bacteria 1033
121 Ga0070672_100615512 3300005543 Bacteria 947
122 Ga0070686_100161839 3300005544 Bacteria 1577
123 Ga0070693_100032105 3300005547 Bacteria 2884
124 Ga0070693_100239374 3300005547 Bacteria 1198
125 Ga0070665_100316608 3300005548 Bacteria 1564
126 Ga0070665_100526144 3300005548 Bacteria 1194
127 Ga0070665_100620059 3300005548 Bacteria 1095
128 Ga0068855_100299632 3300005563 Bacteria 1781
129 Ga0068855_100379772 3300005563 Bacteria 1552
130 Ga0070664_100000246 3300005564 Bacteria 39053
131 Ga0070664_100244563 3300005564 Bacteria 1611
132 Ga0068857_100048044 3300005577 Bacteria 3789
133 Ga0068857_100122293 3300005577 Bacteria 2344
134 Ga0068857_100199148 3300005577 Bacteria 1825
135 Ga0068854_100061897 3300005578 Bacteria 2711
136 Ga0068854_100095200 3300005578 Bacteria 2222
137 Ga0068854_100260804 3300005578 Bacteria 1387
138 Ga0068854_100607285 3300005578 Bacteria 935
139 Ga0068856_100147504 3300005614 Bacteria 2360
140 Ga0068856_100249190 3300005614 Bacteria 1791
141 Ga0068852_100005256 3300005616 Bacteria 9239
142 Ga0068852_100006988 3300005616 Bacteria 8214
143 Ga0068852_100170213 3300005616 Bacteria 2041
144 Ga0068852_100280025 3300005616 Bacteria 1607
145 Ga0068852_100422966 3300005616 Bacteria 1314
146 Ga0068852_100740493 3300005616 Bacteria 995
147 Ga0068859_100000038 3300005617 Bacteria 165071
148 Ga0068859_100120053 3300005617 Bacteria 2695
149 Ga0068859_100243573 3300005617 Bacteria 1888
150 Ga0068864_100000417 3300005618 Bacteria 36778
151 Ga0068864_100018136 3300005618 Bacteria 5873
152 Ga0068864_100137085 3300005618 Bacteria 2204
153 Ga0068864_100163058 3300005618 Bacteria 2027
154 Ga0068864_100211600 3300005618 Bacteria 1786
155 Ga0068864_100341832 3300005618 Bacteria 1410
156 Ga0068866_10005226 3300005718 Bacteria 5348
157 Ga0068866_10130237 3300005718 Bacteria 1430
158 Ga0068861_100000398 3300005719 Bacteria 25148
159 Ga0068861_100009093 3300005719 Bacteria 6849
160 Ga0068861_100010875 3300005719 Bacteria 6323
161 Ga0068851_10008763 3300005834 Bacteria 4685
162 Ga0068851_10063995 3300005834 Bacteria 1889
163 Ga0068851_10094524 3300005834 Bacteria 1578
164 Ga0068851_10175439 3300005834 Bacteria 1185
165 Ga0068870_10055112 3300005840 Bacteria 2117
166 Ga0068863_100000638 3300005841 Bacteria 35489
167 Ga0068863_100021605 3300005841 Bacteria 6138
168 Ga0068863_100095002 3300005841 Bacteria 2830
169 Ga0068863_100116242 3300005841 Bacteria 2549
170 Ga0068863_100227981 3300005841 Bacteria 1796
171 Ga0068863_100316059 3300005841 Bacteria 1516
172 Ga0068863_100371010 3300005841 Bacteria 1397
173 Ga0068858_100000623 3300005842 Bacteria 36873
174 Ga0068858_100042716 3300005842 Bacteria 4203
175 Ga0068858_100141853 3300005842 Bacteria 2256
176 Ga0068860_100001020 3300005843 Bacteria 30989
177 Ga0068860_100447002 3300005843 Bacteria 1285
178 Ga0068860_100528861 3300005843 Bacteria 1180
179 Ga0068860_100684632 3300005843 Bacteria 1035
180 Ga0068862_100003087 3300005844 Bacteria 14521
181 Ga0068862_100098908 3300005844 Bacteria 2549
182 Ga0075365_10014450 3300006038 Bacteria 4751
183 Ga0075368_10010902 3300006042 Bacteria 3296
184 Ga0075368_10015811 3300006042 Bacteria 2804
185 Ga0075363_100049829 3300006048 Bacteria 2231
186 Ga0075363_100227806 3300006048 Bacteria 1069
187 Ga0075364_10067075 3300006051 Bacteria 2358
188 Ga0070715_10146492 3300006163 Bacteria 1153
189 Ga0075362_10018818 3300006177 Bacteria 2863
190 Ga0075362_10047564 3300006177 Bacteria 1911
191 Ga0075362_10095777 3300006177 Bacteria 1382
192 Ga0075362_10174433 3300006177 Bacteria 1040
193 Ga0075367_10027649 3300006178 Bacteria 3229
194 Ga0075367_10048135 3300006178 Bacteria 2510
195 Ga0075367_10115657 3300006178 Bacteria 1649
196 Ga0075367_10152737 3300006178 Bacteria 1433
197 Ga0075369_10026509 3300006186 Bacteria 2416
198 Ga0075366_10003944 3300006195 Bacteria 7916
199 Ga0075366_10004375 3300006195 Bacteria 7579
200 Ga0075366_10016373 3300006195 Bacteria 4261
201 Ga0075366_10124656 3300006195 Bacteria 1553
202 Ga0075366_10260556 3300006195 Bacteria 1058
203 Ga0097621_100010671 3300006237 Bacteria 6732
204 Ga0097621_100031314 3300006237 Bacteria 4220
205 Ga0097621_100138552 3300006237 Bacteria 2078
206 Ga0097621_100401975 3300006237 Bacteria 1226
207 Ga0075370_10000291 3300006353 Bacteria 17999
208 Ga0075370_10005245 3300006353 Bacteria 6414
209 Ga0075370_10006650 3300006353 Bacteria 5831
210 Ga0075370_10041151 3300006353 Bacteria 2608
211 Ga0075370_10041291 3300006353 Bacteria 2604
212 Ga0075370_10077198 3300006353 Bacteria 1911
213 Ga0075370_10146945 3300006353 Bacteria 1380
214 Ga0075370_10147874 3300006353 Bacteria 1376
215 Ga0068871_100094720 3300006358 Bacteria 2492
216 Ga0068871_100095347 3300006358 Bacteria 2484
217 Ga0068871_100397639 3300006358 Bacteria 1227
218 Ga0075429_100000224 3300006880 Bacteria 38311
219 Ga0068865_100000504 3300006881 Bacteria 21850
220 Ga0068865_100104594 3300006881 Bacteria 2078
221 Ga0097620_100000038 3300006931 Bacteria 165071
222 Ga0097620_100120048 3300006931 Bacteria 2695
223 Ga0097620_100243566 3300006931 Bacteria 1888
224 Ga0075435_100265258 3300007076 Bacteria 1464
225 Ga0075435_100290719 3300007076 Bacteria 1396
226 Ga0105240_10013327 3300009093 Bacteria 11298
227 Ga0105240_10615354 3300009093 Bacteria 1194
228 Ga0111539_10499082 3300009094 Bacteria 1417
229 Ga0111539_10720735 3300009094 Bacteria 1161
230 Ga0111539_10769616 3300009094 Bacteria 1120
231 Ga0105245_10012144 3300009098 Bacteria 7490
232 Ga0105245_10448488 3300009098 Bacteria 1298
233 Ga0105245_10518996 3300009098 Bacteria 1210
234 Ga0105245_10571141 3300009098 Bacteria 1155
235 Ga0114129_10098725 3300009147 Bacteria 4042
236 Ga0105243_10119821 3300009148 Bacteria 2216
237 Ga0105243_10611909 3300009148 Bacteria 1050
238 Ga0105241_10181444 3300009174 Bacteria 1747
239 Ga0105248_10027320 3300009177 Bacteria 6351
240 Ga0105248_10150457 3300009177 Bacteria 2626
241 Ga0105248_10750176 3300009177 Bacteria 1101
242 Ga0105237_10018202 3300009545 Bacteria 7272
243 Ga0105237_10080569 3300009545 Bacteria 3246
244 Ga0105238_10007405 3300009551 Bacteria 10994
245 Ga0105238_10095502 3300009551 Bacteria 2959
246 Ga0105238_10318949 3300009551 Bacteria 1540
247 Ga0105249_10002938 3300009553 Bacteria 14709
248 Ga0105239_10006326 3300010375 Bacteria 13771
249 Ga0105239_10237568 3300010375 Bacteria 2045
250 Ga0105239_10408146 3300010375 Bacteria 1538
251 Ga0157373_10079106 3300013100 Bacteria 2319
252 Ga0157371_10168501 3300013102 Bacteria 1564
253 Ga0157371_10506467 3300013102 Bacteria 892
254 Ga0157374_10024366 3300013296 Bacteria 5425
255 Ga0157374_10202519 3300013296 Bacteria 1944
256 Ga0163162_10000701 3300013306 Bacteria 30951
257 Ga0157372_10377364 3300013307 Bacteria 1652
258 Ga0157372_10483270 3300013307 Bacteria 1444
259 Ga0157375_10006514 3300013308 Bacteria 10163
260 Ga0157375_10009924 3300013308 Bacteria 8376
261 Ga0157375_10246281 3300013308 Bacteria 1948
262 Ga0157375_10298117 3300013308 Bacteria 1776
263 Ga0157375_10398608 3300013308 Bacteria 1543
264 Ga0157375_10789217 3300013308 Bacteria 1099
265 Ga0163163_10007184 3300014325 Bacteria 9804
266 Ga0163163_10195108 3300014325 Bacteria 2073
267 Ga0163163_10205725 3300014325 Bacteria 2016
268 Ga0163163_10231195 3300014325 Bacteria 1898
269 Ga0163163_10302973 3300014325 Bacteria 1650
270 Ga0163163_10431752 3300014325 Bacteria 1376
271 Ga0157380_10000472 3300014326 Bacteria 24494
272 Ga0157380_10131982 3300014326 Bacteria 2132
273 Ga0157380_10415018 3300014326 Bacteria 1282
274 Ga0157380_10572194 3300014326 Bacteria 1112
275 Ga0157377_10039116 3300014745 Bacteria 2622
276 Ga0157377_10229276 3300014745 Bacteria 1193
277 Ga0157379_10001128 3300014968 Bacteria 21831
278 Ga0157379_10005918 3300014968 Bacteria 10530
279 Ga0157379_10050097 3300014968 Bacteria 3727
280 Ga0157379_10072142 3300014968 Bacteria 3089
281 Ga0157376_10213596 3300014969 Bacteria 1783
282 Ga0157376_10422517 3300014969 Bacteria 1294
283 Ga0157376_10442945 3300014969 Bacteria 1265
284 Ga0163161_10001102 3300017792 Bacteria 20382
285 Ga0163161_10012016 3300017792 Bacteria 6007
286 Ga0163161_10327339 3300017792 Bacteria 1213
287 Ga0163161_10475135 3300017792 Bacteria 1014
288 Ga0207425_1000871 3300025245 Bacteria 14753
289 Ga0209129_1000185 3300025258 Bacteria 86854
290 Ga0209673_1013671 3300025273 Bacteria 3192
291 Ga0209673_1017348 3300025273 Bacteria 2655
292 Ga0209564_1000349 3300025295 Bacteria 86861
293 Ga0209758_1000339 3300025297 Bacteria 86850
294 Ga0209050_1000223 3300025298 Bacteria 125465
295 Ga0209257_1021536 3300025304 Bacteria 2337
296 Ga0209257_1026564 3300025304 Bacteria 1948
297 Ga0207656_10007965 3300025321 Bacteria 3885
298 Ga0207656_10068232 3300025321 Bacteria 1575
299 Ga0207656_10076876 3300025321 Bacteria 1494
300 Ga0207656_10117045 3300025321 Bacteria 1237
301 Ga0207682_10001283 3300025893 Bacteria 11529
302 Ga0207682_10030869 3300025893 Bacteria 2148
303 Ga0207682_10044282 3300025893 Bacteria 1824
304 Ga0207682_10058670 3300025893 Bacteria 1607
305 Ga0207682_10086925 3300025893 Bacteria 1349
306 Ga0207682_10128588 3300025893 Bacteria 1129
307 Ga0207642_10005579 3300025899 Bacteria 4118
308 Ga0207642_10113219 3300025899 Bacteria 1386
309 Ga0207688_10055694 3300025901 Bacteria 2220
310 Ga0207680_10000121 3300025903 Bacteria 36291
311 Ga0207680_10002133 3300025903 Bacteria 9262
312 Ga0207680_10048731 3300025903 Bacteria 2518
313 Ga0207647_10000003 3300025904 Bacteria 321014
314 Ga0207645_10001321 3300025907 Bacteria 20363
315 Ga0207645_10002041 3300025907 Bacteria 16211
316 Ga0207645_10004182 3300025907 Bacteria 10717
317 Ga0207645_10034575 3300025907 Bacteria 3247
318 Ga0207645_10162002 3300025907 Bacteria 1464
319 Ga0207645_10236658 3300025907 Bacteria 1206
320 Ga0207645_10247273 3300025907 Bacteria 1179
321 Ga0207643_10104403 3300025908 Bacteria 1664
322 Ga0207705_10053592 3300025909 Bacteria 2906
323 Ga0207705_10103283 3300025909 Bacteria 2099
324 Ga0207705_10391875 3300025909 Bacteria 1074
325 Ga0207684_10012702 3300025910 Bacteria 7312
326 Ga0207654_10174644 3300025911 Bacteria 1398
327 Ga0207695_10009656 3300025913 Bacteria 11894
328 Ga0207695_10357203 3300025913 Bacteria 1348
329 Ga0207660_10006825 3300025917 Bacteria 7390
330 Ga0207662_10103584 3300025918 Bacteria 1766
331 Ga0207662_10223684 3300025918 Bacteria 1227
332 Ga0207657_10100062 3300025919 Bacteria 2407
333 Ga0207657_10127064 3300025919 Bacteria 2093
334 Ga0207657_10138999 3300025919 Bacteria 1985
335 Ga0207649_10018725 3300025920 Bacteria 3944
336 Ga0207649_10037495 3300025920 Bacteria 2928
337 Ga0207649_10095109 3300025920 Bacteria 1959
338 Ga0207681_10001157 3300025923 Bacteria 17033
339 Ga0207681_10012075 3300025923 Bacteria 5322
340 Ga0207694_10046107 3300025924 Bacteria 3369
341 Ga0207650_10000603 3300025925 Bacteria 28763
342 Ga0207650_10001006 3300025925 Bacteria 21205
343 Ga0207650_10006557 3300025925 Bacteria 7939
344 Ga0207650_10242884 3300025925 Bacteria 1456
345 Ga0207650_10446112 3300025925 Bacteria 1076
346 Ga0207659_10000488 3300025926 Bacteria 23860
347 Ga0207659_10003135 3300025926 Bacteria 9880
348 Ga0207659_10033524 3300025926 Bacteria 3535
349 Ga0207659_10038095 3300025926 Bacteria 3342
350 Ga0207659_10089763 3300025926 Bacteria 2292
351 Ga0207659_10178091 3300025926 Bacteria 1682
352 Ga0207659_10228763 3300025926 Bacteria 1499
353 Ga0207687_10019791 3300025927 Bacteria 4463
354 Ga0207687_10399252 3300025927 Bacteria 1130
355 Ga0207644_10019134 3300025931 Bacteria 4642
356 Ga0207644_10021105 3300025931 Bacteria 4434
357 Ga0207644_10043820 3300025931 Bacteria 3176
358 Ga0207644_10134366 3300025931 Bacteria 1898
359 Ga0207644_10149637 3300025931 Bacteria 1805
360 Ga0207644_10207993 3300025931 Bacteria 1546
361 Ga0207644_10292193 3300025931 Bacteria 1311
362 Ga0207644_10451193 3300025931 Bacteria 1056
363 Ga0207690_10028043 3300025932 Bacteria 3564
364 Ga0207690_10061546 3300025932 Bacteria 2552
365 Ga0207690_10197954 3300025932 Bacteria 1524
366 Ga0207706_10005604 3300025933 Bacteria 11696
367 Ga0207706_10190301 3300025933 Bacteria 1801
368 Ga0207706_10243977 3300025933 Bacteria 1570
369 Ga0207706_10290454 3300025933 Bacteria 1425
370 Ga0207709_10339056 3300025935 Bacteria 1131
371 Ga0207709_10380336 3300025935 Bacteria 1074
372 Ga0207670_10137243 3300025936 Bacteria 1799
373 Ga0207670_10137759 3300025936 Bacteria 1796
374 Ga0207669_10010185 3300025937 Bacteria 4516
375 Ga0207669_10153484 3300025937 Bacteria 1616
376 Ga0207704_10002511 3300025938 Bacteria 8267
377 Ga0207704_10190113 3300025938 Bacteria 1493
378 Ga0207691_10001925 3300025940 Bacteria 20256
379 Ga0207691_10002589 3300025940 Bacteria 17678
380 Ga0207691_10026069 3300025940 Bacteria 5486
381 Ga0207691_10044567 3300025940 Bacteria 4081
382 Ga0207691_10105579 3300025940 Bacteria 2509
383 Ga0207691_10120897 3300025940 Bacteria 2321
384 Ga0207691_10210590 3300025940 Bacteria 1688
385 Ga0207691_10239485 3300025940 Bacteria 1569
386 Ga0207691_10506269 3300025940 Bacteria 1025
387 Ga0207691_10597388 3300025940 Bacteria 934
388 Ga0207711_10009121 3300025941 Bacteria 8282
389 Ga0207711_10057113 3300025941 Bacteria 3355
390 Ga0207711_10512957 3300025941 Bacteria 1118
391 Ga0207711_10672907 3300025941 Bacteria 965
392 Ga0207689_10000415 3300025942 Bacteria 39864
393 Ga0207689_10132148 3300025942 Bacteria 2054
394 Ga0207689_10144222 3300025942 Bacteria 1962
395 Ga0207661_10067617 3300025944 Bacteria 2906
396 Ga0207679_10000077 3300025945 Bacteria 86432
397 Ga0207679_10072028 3300025945 Bacteria 2609
398 Ga0207679_10197301 3300025945 Bacteria 1679
399 Ga0207679_10431431 3300025945 Bacteria 1165
400 Ga0207667_10339780 3300025949 Bacteria 1532
401 Ga0207651_10009589 3300025960 Bacteria 5312
402 Ga0207651_10031644 3300025960 Bacteria 3385
403 Ga0207651_10062810 3300025960 Bacteria 2590
404 Ga0207651_10164580 3300025960 Bacteria 1742
405 Ga0207651_10198415 3300025960 Bacteria 1606
406 Ga0207651_10258465 3300025960 Bacteria 1428
407 Ga0207651_10326450 3300025960 Bacteria 1284
408 Ga0207712_10002826 3300025961 Bacteria 11123
409 Ga0207668_10002671 3300025972 Bacteria 10432
410 Ga0207668_10212535 3300025972 Bacteria 1548
411 Ga0207640_10168510 3300025981 Bacteria 1629
412 Ga0207640_10194258 3300025981 Bacteria 1532
413 Ga0207658_10000212 3300025986 Bacteria 60851
414 Ga0207658_10006064 3300025986 Bacteria 8255
415 Ga0207658_10012558 3300025986 Bacteria 5782
416 Ga0207677_10007613 3300026023 Bacteria 6007
417 Ga0207677_10086434 3300026023 Bacteria 2267
418 Ga0207677_10107251 3300026023 Bacteria 2071
419 Ga0207677_10193621 3300026023 Bacteria 1610
420 Ga0207677_10255171 3300026023 Bacteria 1426
421 Ga0207677_10413726 3300026023 Bacteria 1147
422 Ga0207703_10002429 3300026035 Bacteria 16148
423 Ga0207703_10009710 3300026035 Bacteria 7551
424 Ga0207639_10044767 3300026041 Bacteria 3330
425 Ga0207639_10308072 3300026041 Bacteria 1402
426 Ga0207639_10483237 3300026041 Bacteria 1129
427 Ga0207678_10109883 3300026067 Bacteria 2352
428 Ga0207678_10188659 3300026067 Bacteria 1761
429 Ga0207678_10273941 3300026067 Bacteria 1448
430 Ga0207678_10351265 3300026067 Bacteria 1272
431 Ga0207678_10530087 3300026067 Bacteria 1028
432 Ga0207708_10254097 3300026075 Bacteria 1417
433 Ga0207702_10183995 3300026078 Bacteria 1926
434 Ga0207641_10009276 3300026088 Bacteria 8114
435 Ga0207641_10097769 3300026088 Bacteria 2581
436 Ga0207641_10153136 3300026088 Bacteria 2089
437 Ga0207641_10163664 3300026088 Bacteria 2024
438 Ga0207641_10313487 3300026088 Bacteria 1485
439 Ga0207641_10354971 3300026088 Bacteria 1398
440 Ga0207648_10005336 3300026089 Bacteria 12956
441 Ga0207648_10008160 3300026089 Bacteria 10182
442 Ga0207676_10044261 3300026095 Bacteria 3433
443 Ga0207676_10057970 3300026095 Bacteria 3052
444 Ga0207676_10075167 3300026095 Bacteria 2724
445 Ga0207676_10078899 3300026095 Bacteria 2668
446 Ga0207676_10083234 3300026095 Bacteria 2605
447 Ga0207676_10358186 3300026095 Bacteria 1351
448 Ga0207676_10579162 3300026095 Bacteria 1076
449 Ga0207674_10010925 3300026116 Bacteria 10218
450 Ga0207674_10068252 3300026116 Bacteria 3578
451 Ga0207674_10113917 3300026116 Bacteria 2677
452 Ga0207675_100000177 3300026118 Bacteria 57433
453 Ga0207675_100002649 3300026118 Bacteria 17661
454 Ga0207675_100006737 3300026118 Bacteria 10864
455 Ga0207683_10011037 3300026121 Bacteria 7699
456 Ga0207683_10125588 3300026121 Bacteria 2305
457 Ga0207683_10234972 3300026121 Bacteria 1672
458 Ga0207683_10247283 3300026121 Bacteria 1627
459 Ga0207683_10280319 3300026121 Bacteria 1523
460 Ga0207683_10387224 3300026121 Bacteria 1285
461 Ga0207698_10005873 3300026142 Bacteria 7627
462 Ga0207698_10056932 3300026142 Bacteria 3021
463 Ga0207698_10104678 3300026142 Bacteria 2355
464 Ga0207698_10337985 3300026142 Bacteria 1417
465 Ga0207698_10564213 3300026142 Bacteria 1118
466 Ga0268266_10356358 3300028379 Bacteria 1376
467 Ga0268266_10499439 3300028379 Bacteria 1161
468 Ga0268265_10089362 3300028380 Bacteria 2457
469 Ga0268265_10103325 3300028380 Bacteria 2307
470 Ga0268265_10242308 3300028380 Bacteria 1592
471 Ga0268264_10004985 3300028381 Bacteria 11241
472 Ga0268264_10136682 3300028381 Bacteria 2180
473 Ga0268264_10511284 3300028381 Bacteria 1173
474 Ga0268264_10601761 3300028381 Bacteria 1083
475 Ga0307517_10012331 3300028786 Bacteria 11744
476 Ga0307517_10092799 3300028786 Bacteria 2453
477 Ga0307515_10000139 3300028794 Bacteria 173074
478 Ga0307515_10014127 3300028794 Bacteria 14844
479 Ga0307515_10018130 3300028794 Bacteria 12769
480 Ga0307515_10114598 3300028794 Bacteria 3113
481 Ga0307515_10229052 3300028794 Bacteria 1656
482 Ga0307512_10051922 3300030522 Bacteria 3275
483 Ga0307512_10061828 3300030522 Bacteria 2880
484 Ga0307512_10088326 3300030522 Bacteria 2177
485 Ga0265325_10012636 3300031241 Bacteria 4823
486 Ga0307513_10016545 3300031456 Bacteria 8890
487 Ga0307513_10072430 3300031456 Bacteria 3591
488 Ga0307513_10266887 3300031456 Bacteria 1497
489 Ga0307509_10006706 3300031507 Bacteria 15360
490 Ga0307509_10013664 3300031507 Bacteria 9594
491 Ga0307509_10168499 3300031507 Bacteria 2074
492 Ga0307509_10221211 3300031507 Bacteria 1706
493 Ga0307509_10312047 3300031507 Bacteria 1314
494 Ga0307408_100037196 3300031548 Bacteria 3427
495 Ga0307408_100049670 3300031548 Bacteria 3014
496 Ga0307408_100090349 3300031548 Bacteria 2311
497 Ga0307508_10000028 3300031616 Bacteria 168639
498 Ga0307508_10001315 3300031616 Bacteria 28115
499 Ga0307508_10001377 3300031616 Bacteria 27383
500 Ga0307508_10065069 3300031616 Bacteria 3213
501 Ga0307508_10329147 3300031616 Bacteria 1119
502 Ga0307508_10410429 3300031616 Bacteria 945
503 Ga0307514_10000369 3300031649 Bacteria 102951
504 Ga0307514_10011232 3300031649 Bacteria 7447
505 Ga0307514_10244086 3300031649 Bacteria 1072
506 Ga0316576_10012989 3300031727 Bacteria 5517
507 Ga0307516_10002125 3300031730 Bacteria 26852
508 Ga0307516_10250876 3300031730 Bacteria 1464
509 Ga0307405_10089539 3300031731 Bacteria 2033
510 Ga0307413_10072875 3300031824 Bacteria 2169
511 Ga0307410_10426181 3300031852 Bacteria 1077
512 Ga0307406_10106443 3300031901 Bacteria 1921
513 Ga0307406_10206122 3300031901 Bacteria 1451
514 Ga0307407_10074559 3300031903 Bacteria 2031
515 Ga0307407_10265430 3300031903 Bacteria 1183
516 Ga0307407_10434002 3300031903 Bacteria 950
517 Ga0307409_100019603 3300031995 Bacteria 4585
518 Ga0307409_100084584 3300031995 Bacteria 2576
519 Ga0307416_100032323 3300032002 Bacteria 3952
520 Ga0316583_10000332 3300032133 Bacteria 13332
521 Ga0307507_10078003 3300033179 Bacteria 2940
522 Ga0307507_10131326 3300033179 Bacteria 1958
523 Ga0307507_10137247 3300033179 Bacteria 1889
524 Ga0373941_0161429 3300035115 Unclassified 829
525 Ga0373946_0415267 3300035171 Bacteria 681
526 Ga0373942_0031871 3300035207 Bacteria 1397
527 Ga0373962_0029923 3300035242 Bacteria 1487
528 Ga0316574_0078576 3300035398 Bacteria 2092
529 Ga0373931_0048610 3300035691 Bacteria 2249
530 Ga0373933_0154521 3300035724 Bacteria 1455
531 Ga0373947_0043758 3300035725 Bacteria 2675
532 Ga0373937_0073412 3300036401 Bacteria 3156
533 Ga0373925_0013041 3300037068 Bacteria 6018
534 Ga0373925_0342337 3300037068 Bacteria 1213
535 Ga0373925_0554374 3300037068 Bacteria 945
536 Ga0395899_0004383 3300037312 Bacteria 11004
537 Ga0395900_0013773 3300037418 Bacteria 8255
538 Ga0395900_0249843 3300037418 Bacteria 1775
539 Ga0395900_0277530 3300037418 Bacteria 1669
540 Ga0395898_0012659 3300037466 Bacteria 8720
541 Ga0395905_0000027 3300037471 Bacteria 297239
542 Ga0395905_0001424 3300037471 Bacteria 28863
543 Ga0395905_0023196 3300037471 Bacteria 5865
544 Ga0395905_0141334 3300037471 Bacteria 2264
545 Ga0395901_0007843 3300038443 Bacteria 10769
546 Ga0395901_0035527 3300038443 Bacteria 5149
547 Ga0395901_0452309 3300038443 Bacteria 1313
548 Ga0451789_0893179 3300041443 Bacteria 2770
549 Ga0451798_0987518 3300041458 Bacteria 1747
550 Ga0451800_0588886 3300041459 Bacteria 1087
551 Ga0451802_1642668 3300041460 Bacteria 1589
552 Ga0451804_0944280 3300041463 Bacteria 2707
553 Ga0451807_2361489 3300041486 Bacteria 1090
554 Ga0451835_1125021 3300041492 Bacteria 1353
555 Ga0451841_0066929 3300041498 Bacteria 1365
556 Ga0451843_1560734 3300041509 Bacteria 1011
557 Ga0439455_0050189 3300042012 Bacteria 1089
558 Ga0439458_0123101 3300042157 Bacteria 684
559 Ga0439464_0024582 3300042439 Bacteria 1666
560 Ga0439460_0104113 3300042461 Bacteria 915
561 Ga0451577_0000503 3300042876 Bacteria 65640
562 Ga0451577_0031175 3300042876 Bacteria 4812
563 Ga0451577_0039921 3300042876 Bacteria 4215
564 Ga0451577_0607229 3300042876 Bacteria 993
565 Ga0451577_0729077 3300042876 Bacteria 897
566 Ga0466969_0003153 3300044656 Bacteria 8780
567 Ga0466969_0018727 3300044656 Bacteria 3604
568 Ga0453683_0184343 3300044673 Bacteria 1324
569 Ga0466965_0035913 3300044683 Bacteria 2429
570 Ga0466966_0001081 3300044684 Bacteria 17423
571 Ga0466966_0038987 3300044684 Bacteria 3060
572 Ga0466966_0090564 3300044684 Bacteria 1899
573 Ga0466961_0006686 3300044693 Bacteria 7334
574 Ga0466961_0008463 3300044693 Bacteria 6553
575 Ga0466961_0078539 3300044693 Bacteria 2090
576 Ga0466964_0001581 3300044706 Bacteria 7844
577 Ga0453684_0000014 3300044712 Bacteria 993311
578 Ga0453684_0000080 3300044712 Bacteria 411138
579 Ga0453684_0000142 3300044712 Bacteria 316405
580 Ga0453684_0001597 3300044712 Bacteria 62266
581 Ga0453684_0042904 3300044712 Bacteria 6088
582 Ga0453684_0205778 3300044712 Bacteria 2291
583 Ga0453684_0862948 3300044712 Bacteria 972
584 Ga0466968_0004214 3300044735 Bacteria 5360
585 Ga0466970_0005780 3300044765 Bacteria 6149
586 Ga0466970_0046921 3300044765 Bacteria 2301
587 Ga0466957_0009229 3300044842 Bacteria 5625
588 Ga0466960_0039586 3300044901 Bacteria 2224
589 Ga0466960_0402907 3300044901 Bacteria 788
590 Ga0466959_0004233 3300045049 Bacteria 9572
591 Ga0466959_0056971 3300045049 Bacteria 2850
592 Ga0466959_0229121 3300045049 Bacteria 1286
593 Ga0451576_0000272 3300045051 Bacteria 126530
594 Ga0451576_0021486 3300045051 Bacteria 7014
595 Ga0451576_0503230 3300045051 Bacteria 1273
596 Ga0466958_0392775 3300045836 Bacteria 895
597 Ga0466967_0293312 3300045976 Bacteria 1563
598 Ga0495603_0110380 3300046455 Bacteria 1605
599 Ga0495603_0118136 3300046455 Bacteria 1546
600 Ga0495629_0047432 3300046459 Bacteria 3013
601 Ga0495638_0120472 3300046460 Bacteria 1551
602 Ga0495650_0024295 3300046471 Bacteria 2864
603 Ga0495580_0048626 3300046472 Bacteria 3002
604 Ga0495608_0275794 3300046511 Bacteria 1045
605 Ga0495610_0089226 3300046512 Bacteria 1400
606 Ga0495628_0207960 3300046516 Bacteria 1473
607 Ga0495628_0283486 3300046516 Bacteria 1230
608 Ga0495631_0162790 3300046518 Bacteria 957
609 Ga0495632_0001574 3300046519 Bacteria 18820
610 Ga0495632_0009387 3300046519 Bacteria 5903
611 Ga0495643_0110135 3300046522 Bacteria 1401
612 Ga0495643_0150960 3300046522 Bacteria 1150
613 Ga0495597_0012048 3300046542 Bacteria 4179
614 Ga0495645_0026599 3300046543 Bacteria 4201
615 Ga0495645_0136103 3300046543 Bacteria 1718
616 Ga0495611_0162472 3300046648 Bacteria 1044
617 Ga0495625_0020973 3300046660 Bacteria 5037
618 Ga0495625_0033839 3300046660 Bacteria 3775
619 Ga0495635_0061843 3300046663 Bacteria 2571
620 Ga0495646_0142718 3300046680 Bacteria 1338
621 Ga0495647_0030816 3300046681 Bacteria 1992
622 Ga0495647_0143598 3300046681 Bacteria 1019
623 Ga0495658_0072161 3300046683 Bacteria 2007
624 Ga0495624_0189888 3300046690 Bacteria 1250
625 Ga0495649_0000541 3300046694 Bacteria 32077
626 Ga0495674_0419673 3300047319 Bacteria 1078
627 Ga0495680_0344243 3300047322 Bacteria 1039
628 Ga0495687_001991 3300047443 Bacteria 17372
629 Ga0495687_006560 3300047443 Bacteria 7098
630 Ga0495687_014896 3300047443 Bacteria 3974
631 Ga0495675_0262506 3300047444 Bacteria 1034
632 Ga0495684_0062323 3300047471 Bacteria 2837
633 Ga0495686_0007111 3300047472 Bacteria 8434
634 Ga0496100_0023701 3300048903 Bacteria 3733
635 Ga0496100_0359354 3300048903 Bacteria 1102
636 Ga0496101_0013511 3300048904 Bacteria 5473
637 Ga0496102_0002998 3300048905 Bacteria 14302
638 Ga0496102_0477350 3300048905 Bacteria 1168
639 Ga0496104_0418679 3300048907 Bacteria 1252
640 Ga0496105_0110051 3300048908 Bacteria 2274
641 Ga0496106_0006072 3300048909 Bacteria 8940
642 Ga0496107_0141916 3300048910 Bacteria 1775
643 Ga0496107_0391241 3300048910 Bacteria 1034
644 Ga0496108_0017021 3300048911 Bacteria 5942
645 Ga0496108_0082980 3300048911 Bacteria 2718
646 Ga0496108_0133201 3300048911 Bacteria 2136
647 Ga0496108_0252291 3300048911 Bacteria 1535
648 Ga0496109_0126960 3300048912 Bacteria 2378
649 Ga0496109_0129150 3300048912 Bacteria 2358
650 Ga0496109_0226707 3300048912 Bacteria 1758
651 Ga0496109_0622561 3300048912 Bacteria 1016
652 Ga0496110_0007472 3300048913 Bacteria 8735
653 Ga0496113_0232465 3300048916 Bacteria 1470
654 Ga0496114_0285242 3300048917 Bacteria 1456
655 Ga0496114_0386048 3300048917 Bacteria 1240
656 Ga0496114_0394701 3300048917 Bacteria 1225
657 Ga0496115_0007917 3300048918 Bacteria 7839
658 Ga0496121_0003335 3300048924 Bacteria 23043
659 Ga0496123_0126856 3300048926 Bacteria 1422
660 Ga0496124_0000733 3300048927 Bacteria 53604
661 Ga0496125_0007614 3300048928 Bacteria 11494
662 Ga0501032_0684540 3300049569 Bacteria 650
663 Ga0501037_0050620 3300049573 Bacteria 3040
664 Ga0501038_0123731 3300049574 Bacteria 2130
665 Ga0501038_0295363 3300049574 Bacteria 1272
666 Ga0501043_0117687 3300049579 Bacteria 2085
667 Ga0501047_0377630 3300049581 Bacteria 1252
668 Ga0501047_0477085 3300049581 Bacteria 1075
669 Ga0501067_0020229 3300049583 Bacteria 3682
670 Ga0501067_0045124 3300049583 Bacteria 2448
671 Ga0501073_0210288 3300049589 Bacteria 1344
672 Ga0501074_0067576 3300049590 Bacteria 2570
673 Ga0501076_0075420 3300049592 Bacteria 2703
674 Ga0501076_0467804 3300049592 Bacteria 1038
675 Ga0501077_0029657 3300049593 Bacteria 3479
676 Ga0501198_000007 3300049649 Bacteria 129700
677 Ga0501222_000005 3300049662 Bacteria 129724
678 Ga0501083_0066784 3300049744 Bacteria 2394
679 nmdc:mga03683_154391_c1 3300050489 Bacteria 1037
680 nmdc:mga03n38_228910_c1 3300050490 Bacteria 974
681 nmdc:mga03n38_68180_c1 3300050490 Bacteria 1639
682 nmdc:mga0yw44_49506_c1 3300050492 Bacteria 2537
683 nmdc:mga0k408_111157_c2 3300050493 Bacteria 859
684 nmdc:mga0k408_133666_c1 3300050493 Bacteria 1473
685 nmdc:mga0k408_153256_c1 3300050493 Bacteria 1373
686 nmdc:mga0k408_20391_c1 3300050493 Bacteria 2752
687 nmdc:mga0k408_23723_c1 3300050493 Bacteria 3464
688 nmdc:mga0k408_264670_c1 3300050493 Bacteria 1027
689 nmdc:mga0k408_27458_c1 3300050493 Bacteria 3233
690 nmdc:mga0k408_370_c1 3300050493 Bacteria 24649
691 nmdc:mga0k408_388903_c1 3300050493 Bacteria 831
692 nmdc:mga0k408_76051_c1 3300050493 Bacteria 1962
693 nmdc:mga0k408_89405_c1 3300050493 Bacteria 1809
694 nmdc:mga06z11_34181_c1 3300050494 Bacteria 2494
695 nmdc:mga04h51_128057_c1 3300050495 Bacteria 952
696 nmdc:mga04h51_9044_c1 3300050495 Bacteria 2685
697 nmdc:mga07m45_13490_c1 3300050496 Bacteria 4337
698 nmdc:mga07m45_14825_c1 3300050496 Bacteria 2056
699 nmdc:mga07m45_162824_c1 3300050496 Bacteria 1295
700 nmdc:mga07m45_32728_c1 3300050496 Bacteria 2884
701 nmdc:mga07m45_54331_c1 3300050496 Bacteria 2264
702 nmdc:mga05p37_166227_c1 3300050507 Bacteria 2692
703 nmdc:mga09592_819_c1 3300050508 Bacteria 24059
704 nmdc:mga0qj67_92436_c1 3300050509 Bacteria 2432
705 nmdc:mga08y16_802744_c1 3300050511 Bacteria 934
706 Ga0495601_0055940 3300053077 Bacteria 2498
707 Ga0495612_0063621 3300053078 Bacteria 1530
708 Ga0495595_0101362 3300053084 Bacteria 1390
709 Ga0495595_0113770 3300053084 Bacteria 1314
710 Ga0500578_0000417 3300053086 Bacteria 52045
711 Ga0500644_0079282 3300053088 Unclassified 1203
712 Ga0500646_0003560 3300053090 Bacteria 3988
713 Ga0500651_0228772 3300053093 Bacteria 1088
714 Ga0500555_003846 3300053103 Bacteria 4270
715 Ga0500556_0001557 3300053104 Bacteria 9327
716 Ga0500628_000141 3300053129 Bacteria 13888
717 Ga0500652_000499 3300053131 Bacteria 13784
718 Ga0500655_014770 3300053133 Bacteria 1430
719 Ga0500658_0008109 3300053134 Bacteria 3883
720 Ga0500568_0034616 3300053139 Bacteria 2065
721 Ga0500616_0005867 3300053153 Bacteria 8223
722 Ga0500619_000069 3300053154 Bacteria 30933
723 Ga0500622_0000701 3300053156 Bacteria 29448
724 Ga0501084_0016827 3300054114 Bacteria 6075
725 Ga0501084_0392754 3300054114 Bacteria 1172
726 Ga0501082_0051606 3300060353 Bacteria 3545
727 Ga0501082_0061139 3300060353 Bacteria 3243
728 Ga0466962_0018635 3300061719 Bacteria 3338
729 Ga0466962_0036062 3300061719 Bacteria 2366
730 2587725982 2585428057 Bacteria 6737412
731 2587735644 2585428058 Bacteria 6853932
732 2587759281 2585428062 Bacteria 6842168
733 2588292809 2588253510 Bacteria 6901809
734 2643967917 2643221592 Bacteria 6608788
735 2644143183 2643221625 Bacteria 6512927
736 2644271729 2643221648 Bacteria 6521465
737 2928117989 2928115317 Bacteria 6477646
738 nmdc:mga0k408_180338_c1
739 JGI24736J21556_1003772
740 JGI24740J21852_10013184
741 JGI25153J46596_10008423
742 rootH1_10010451
743 Ga0055526_1002246
744 Ga0055530_10014921
745 Ga0065712_10132044
746 Ga0070658_10027022
747 Ga0070658_10158905
748 Ga0070676_10000434
749 Ga0070676_10005544
750 Ga0070676_10076348
751 Ga0070676_10135586
752 Ga0070676_10463154
753 Ga0070683_100110394
754 Ga0070690_100001931
755 Ga0070670_100011920
756 Ga0070670_100057768
757 Ga0070670_100139592
758 Ga0070670_100220135
759 Ga0070670_100253181
760 Ga0070677_10002998
761 Ga0070677_10217885
762 Ga0068869_100035950
763 Ga0068869_100052968
764 Ga0068869_100073084
765 Ga0070666_10000203
766 Ga0070666_10002319
767 Ga0070666_10332801
768 Ga0070680_100001090
769 Ga0070682_100011294
770 Ga0068868_100002885
771 Ga0068868_100022383
772 Ga0068868_100045059
773 Ga0068868_100133866
774 Ga0068868_100223005
775 Ga0068868_100371744
776 Ga0070660_100062262
777 Ga0070660_100143292
778 Ga0070689_100140805
779 Ga0070687_100097414
780 Ga0070661_100144055
781 Ga0070661_100158470
782 Ga0070661_100289946
783 Ga0070661_100445597
784 Ga0070692_10110649
785 Ga0070668_100000210
786 Ga0070668_100134892
787 Ga0070669_100000370
788 Ga0070669_100395568
789 Ga0070669_100396394
790 Ga0070669_100664447
791 Ga0070675_100000692
792 Ga0070675_100024652
793 Ga0070675_100112076
794 Ga0070675_100183008
795 Ga0070675_100211102
796 Ga0070675_100564094
797 Ga0070671_100001030
798 Ga0070671_100025332
799 Ga0070671_100103137
800 Ga0070671_100189936
801 Ga0070671_100450194
802 Ga0070674_100017826
803 Ga0070674_100280459
804 Ga0070674_100363375
805 Ga0070673_100005042
806 Ga0070673_100017993
807 Ga0070673_100044461
808 Ga0070673_100165374
809 Ga0070673_100313731
810 Ga0070673_100381498
811 Ga0070688_100072165
812 Ga0070688_100205646
813 Ga0070659_100002668
814 Ga0070659_100077082
815 Ga0070659_100227019
816 Ga0070659_100235666
817 Ga0070667_100000294
818 Ga0070667_100003264
819 Ga0070667_100441377
820 Ga0070705_100106817
821 Ga0070663_100080353
822 Ga0070663_100233373
823 Ga0070678_100004854
824 Ga0070678_100046438
825 Ga0070678_100064650
826 Ga0070678_100131988
827 Ga0070678_100221017
828 Ga0070678_100223385
829 Ga0070678_100364205
830 Ga0070662_100046171
831 Ga0070662_100235123
832 Ga0070662_100342851
833 Ga0070662_100421132
834 Ga0070681_10353482
835 Ga0068867_100001702
836 Ga0068867_100002661
837 Ga0068867_100008359
838 Ga0068867_100191965
839 Ga0070706_100003301
840 Ga0070707_100035771
841 Ga0070699_100429763
842 Ga0070679_100147594
843 Ga0070684_100200687
844 Ga0070684_100551644
845 Ga0068853_100065642
846 Ga0068853_100168511
847 Ga0068853_100175584
848 Ga0068853_100528699
849 Ga0070672_100000286
850 Ga0070672_100000712
851 Ga0070672_100018646
852 Ga0070672_100088674
853 Ga0070672_100137000
854 Ga0070672_100223953
855 Ga0070672_100247339
856 Ga0070672_100488852
857 Ga0070672_100517523
858 Ga0070672_100615512
859 Ga0070686_100161839
860 Ga0070693_100032105
861 Ga0070693_100239374
862 Ga0070665_100316608
863 Ga0070665_100526144
864 Ga0070665_100620059
865 Ga0068855_100299632
866 Ga0068855_100379772
867 Ga0070664_100000246
868 Ga0070664_100244563
869 Ga0068857_100048044
870 Ga0068857_100122293
871 Ga0068857_100199148
872 Ga0068854_100061897
873 Ga0068854_100095200
874 Ga0068854_100260804
875 Ga0068854_100607285
876 Ga0068856_100147504
877 Ga0068856_100249190
878 Ga0068852_100005256
879 Ga0068852_100006988
880 Ga0068852_100170213
881 Ga0068852_100280025
882 Ga0068852_100422966
883 Ga0068852_100740493
884 Ga0068859_100000038
885 Ga0068859_100120053
886 Ga0068859_100243573
887 Ga0068864_100000417
888 Ga0068864_100018136
889 Ga0068864_100137085
890 Ga0068864_100163058
891 Ga0068864_100211600
892 Ga0068864_100341832
893 Ga0068866_10005226
894 Ga0068866_10130237
895 Ga0068861_100000398
896 Ga0068861_100009093
897 Ga0068861_100010875
898 Ga0068851_10008763
899 Ga0068851_10063995
900 Ga0068851_10094524
901 Ga0068851_10175439
902 Ga0068870_10055112
903 Ga0068863_100000638
904 Ga0068863_100021605
905 Ga0068863_100095002
906 Ga0068863_100116242
907 Ga0068863_100227981
908 Ga0068863_100316059
909 Ga0068863_100371010
910 Ga0068858_100000623
911 Ga0068858_100042716
912 Ga0068858_100141853
913 Ga0068860_100001020
914 Ga0068860_100447002
915 Ga0068860_100528861
916 Ga0068860_100684632
917 Ga0068862_100003087
918 Ga0068862_100098908
919 Ga0075365_10014450
920 Ga0075368_10010902
921 Ga0075368_10015811
922 Ga0075363_100049829
923 Ga0075363_100227806
924 Ga0075364_10067075
925 Ga0070715_10146492
926 Ga0075362_10018818
927 Ga0075362_10047564
928 Ga0075362_10095777
929 Ga0075362_10174433
930 Ga0075367_10027649
931 Ga0075367_10048135
932 Ga0075367_10115657
933 Ga0075367_10152737
934 Ga0075369_10026509
935 Ga0075366_10003944
936 Ga0075366_10004375
937 Ga0075366_10016373
938 Ga0075366_10124656
939 Ga0075366_10260556
940 Ga0097621_100010671
941 Ga0097621_100031314
942 Ga0097621_100138552
943 Ga0097621_100401975
944 Ga0075370_10000291
945 Ga0075370_10005245
946 Ga0075370_10006650
947 Ga0075370_10041151
948 Ga0075370_10041291
949 Ga0075370_10077198
950 Ga0075370_10146945
951 Ga0075370_10147874
952 Ga0068871_100094720
953 Ga0068871_100095347
954 Ga0068871_100397639
955 Ga0075429_100000224
956 Ga0068865_100000504
957 Ga0068865_100104594
958 Ga0097620_100000038
959 Ga0097620_100120048
960 Ga0097620_100243566
961 Ga0075435_100265258
962 Ga0075435_100290719
963 Ga0105240_10013327
964 Ga0105240_10615354
965 Ga0111539_10499082
966 Ga0111539_10720735
967 Ga0111539_10769616
968 Ga0105245_10012144
969 Ga0105245_10448488
970 Ga0105245_10518996
971 Ga0105245_10571141
972 Ga0114129_10098725
973 Ga0105243_10119821
974 Ga0105243_10611909
975 Ga0105241_10181444
976 Ga0105248_10027320
977 Ga0105248_10150457
978 Ga0105248_10750176
979 Ga0105237_10018202
980 Ga0105237_10080569
981 Ga0105238_10007405
982 Ga0105238_10095502
983 Ga0105238_10318949
984 Ga0105249_10002938
985 Ga0105239_10006326
986 Ga0105239_10237568
987 Ga0105239_10408146
988 Ga0157373_10079106
989 Ga0157371_10168501
990 Ga0157371_10506467
991 Ga0157374_10024366
992 Ga0157374_10202519
993 Ga0163162_10000701
994 Ga0157372_10377364
995 Ga0157372_10483270
996 Ga0157375_10006514
997 Ga0157375_10009924
998 Ga0157375_10246281
999 Ga0157375_10298117
1000 Ga0157375_10398608
1001 Ga0157375_10789217
1002 Ga0163163_10007184
1003 Ga0163163_10195108
1004 Ga0163163_10205725
1005 Ga0163163_10231195
1006 Ga0163163_10302973
1007 Ga0163163_10431752
1008 Ga0157380_10000472
1009 Ga0157380_10131982
1010 Ga0157380_10415018
1011 Ga0157380_10572194
1012 Ga0157377_10039116
1013 Ga0157377_10229276
1014 Ga0157379_10001128
1015 Ga0157379_10005918
1016 Ga0157379_10050097
1017 Ga0157379_10072142
1018 Ga0157376_10213596
1019 Ga0157376_10422517
1020 Ga0157376_10442945
1021 Ga0163161_10001102
1022 Ga0163161_10012016
1023 Ga0163161_10327339
1024 Ga0163161_10475135
1025 Ga0207425_1000871
1026 Ga0209129_1000185
1027 Ga0209673_1013671
1028 Ga0209673_1017348
1029 Ga0209564_1000349
1030 Ga0209758_1000339
1031 Ga0209050_1000223
1032 Ga0209257_1021536
1033 Ga0209257_1026564
1034 Ga0207656_10007965
1035 Ga0207656_10068232
1036 Ga0207656_10076876
1037 Ga0207656_10117045
1038 Ga0207682_10001283
1039 Ga0207682_10030869
1040 Ga0207682_10044282
1041 Ga0207682_10058670
1042 Ga0207682_10086925
1043 Ga0207682_10128588
1044 Ga0207642_10005579
1045 Ga0207642_10113219
1046 Ga0207688_10055694
1047 Ga0207680_10000121
1048 Ga0207680_10002133
1049 Ga0207680_10048731
1050 Ga0207647_10000003
1051 Ga0207645_10001321
1052 Ga0207645_10002041
1053 Ga0207645_10004182
1054 Ga0207645_10034575
1055 Ga0207645_10162002
1056 Ga0207645_10236658
1057 Ga0207645_10247273
1058 Ga0207643_10104403
1059 Ga0207705_10053592
1060 Ga0207705_10103283
1061 Ga0207705_10391875
1062 Ga0207684_10012702
1063 Ga0207654_10174644
1064 Ga0207695_10009656
1065 Ga0207695_10357203
1066 Ga0207660_10006825
1067 Ga0207662_10103584
1068 Ga0207662_10223684
1069 Ga0207657_10100062
1070 Ga0207657_10127064
1071 Ga0207657_10138999
1072 Ga0207649_10018725
1073 Ga0207649_10037495
1074 Ga0207649_10095109
1075 Ga0207681_10001157
1076 Ga0207681_10012075
1077 Ga0207694_10046107
1078 Ga0207650_10000603
1079 Ga0207650_10001006
1080 Ga0207650_10006557
1081 Ga0207650_10242884
1082 Ga0207650_10446112
1083 Ga0207659_10000488
1084 Ga0207659_10003135
1085 Ga0207659_10033524
1086 Ga0207659_10038095
1087 Ga0207659_10089763
1088 Ga0207659_10178091
1089 Ga0207659_10228763
1090 Ga0207687_10019791
1091 Ga0207687_10399252
1092 Ga0207644_10019134
1093 Ga0207644_10021105
1094 Ga0207644_10043820
1095 Ga0207644_10134366
1096 Ga0207644_10149637
1097 Ga0207644_10207993
1098 Ga0207644_10292193
1099 Ga0207644_10451193
1100 Ga0207690_10028043
1101 Ga0207690_10061546
1102 Ga0207690_10197954
1103 Ga0207706_10005604
1104 Ga0207706_10190301
1105 Ga0207706_10243977
1106 Ga0207706_10290454
1107 Ga0207709_10339056
1108 Ga0207709_10380336
1109 Ga0207670_10137243
1110 Ga0207670_10137759
1111 Ga0207669_10010185
1112 Ga0207669_10153484
1113 Ga0207704_10002511
1114 Ga0207704_10190113
1115 Ga0207691_10001925
1116 Ga0207691_10002589
1117 Ga0207691_10026069
1118 Ga0207691_10044567
1119 Ga0207691_10105579
1120 Ga0207691_10120897
1121 Ga0207691_10210590
1122 Ga0207691_10239485
1123 Ga0207691_10506269
1124 Ga0207691_10597388
1125 Ga0207711_10009121
1126 Ga0207711_10057113
1127 Ga0207711_10512957
1128 Ga0207711_10672907
1129 Ga0207689_10000415
1130 Ga0207689_10132148
1131 Ga0207689_10144222
1132 Ga0207661_10067617
1133 Ga0207679_10000077
1134 Ga0207679_10072028
1135 Ga0207679_10197301
1136 Ga0207679_10431431
1137 Ga0207667_10339780
1138 Ga0207651_10009589
1139 Ga0207651_10031644
1140 Ga0207651_10062810
1141 Ga0207651_10164580
1142 Ga0207651_10198415
1143 Ga0207651_10258465
1144 Ga0207651_10326450
1145 Ga0207712_10002826
1146 Ga0207668_10002671
1147 Ga0207668_10212535
1148 Ga0207640_10168510
1149 Ga0207640_10194258
1150 Ga0207658_10000212
1151 Ga0207658_10006064
1152 Ga0207658_10012558
1153 Ga0207677_10007613
1154 Ga0207677_10086434
1155 Ga0207677_10107251
1156 Ga0207677_10193621
1157 Ga0207677_10255171
1158 Ga0207677_10413726
1159 Ga0207703_10002429
1160 Ga0207703_10009710
1161 Ga0207639_10044767
1162 Ga0207639_10308072
1163 Ga0207639_10483237
1164 Ga0207678_10109883
1165 Ga0207678_10188659
1166 Ga0207678_10273941
1167 Ga0207678_10351265
1168 Ga0207678_10530087
1169 Ga0207708_10254097
1170 Ga0207702_10183995
1171 Ga0207641_10009276
1172 Ga0207641_10097769
1173 Ga0207641_10153136
1174 Ga0207641_10163664
1175 Ga0207641_10313487
1176 Ga0207641_10354971
1177 Ga0207648_10005336
1178 Ga0207648_10008160
1179 Ga0207676_10044261
1180 Ga0207676_10057970
1181 Ga0207676_10075167
1182 Ga0207676_10078899
1183 Ga0207676_10083234
1184 Ga0207676_10358186
1185 Ga0207676_10579162
1186 Ga0207674_10010925
1187 Ga0207674_10068252
1188 Ga0207674_10113917
1189 Ga0207675_100000177
1190 Ga0207675_100002649
1191 Ga0207675_100006737
1192 Ga0207683_10011037
1193 Ga0207683_10125588
1194 Ga0207683_10234972
1195 Ga0207683_10247283
1196 Ga0207683_10280319
1197 Ga0207683_10387224
1198 Ga0207698_10005873
1199 Ga0207698_10056932
1200 Ga0207698_10104678
1201 Ga0207698_10337985
1202 Ga0207698_10564213
1203 Ga0268266_10356358
1204 Ga0268266_10499439
1205 Ga0268265_10089362
1206 Ga0268265_10103325
1207 Ga0268265_10242308
1208 Ga0268264_10004985
1209 Ga0268264_10136682
1210 Ga0268264_10511284
1211 Ga0268264_10601761
1212 Ga0307517_10012331
1213 Ga0307517_10092799
1214 Ga0307515_10000139
1215 Ga0307515_10014127
1216 Ga0307515_10018130
1217 Ga0307515_10114598
1218 Ga0307515_10229052
1219 Ga0307512_10051922
1220 Ga0307512_10061828
1221 Ga0307512_10088326
1222 Ga0265325_10012636
1223 Ga0307513_10016545
1224 Ga0307513_10072430
1225 Ga0307513_10266887
1226 Ga0307509_10006706
1227 Ga0307509_10013664
1228 Ga0307509_10168499
1229 Ga0307509_10221211
1230 Ga0307509_10312047
1231 Ga0307408_100037196
1232 Ga0307408_100049670
1233 Ga0307408_100090349
1234 Ga0307508_10000028
1235 Ga0307508_10001315
1236 Ga0307508_10001377
1237 Ga0307508_10065069
1238 Ga0307508_10329147
1239 Ga0307508_10410429
1240 Ga0307514_10000369
1241 Ga0307514_10011232
1242 Ga0307514_10244086
1243 Ga0316576_10012989
1244 Ga0307516_10002125
1245 Ga0307516_10250876
1246 Ga0307405_10089539
1247 Ga0307413_10072875
1248 Ga0307410_10426181
1249 Ga0307406_10106443
1250 Ga0307406_10206122
1251 Ga0307407_10074559
1252 Ga0307407_10265430
1253 Ga0307407_10434002
1254 Ga0307409_100019603
1255 Ga0307409_100084584
1256 Ga0307416_100032323
1257 Ga0316583_10000332
1258 Ga0307507_10078003
1259 Ga0307507_10131326
1260 Ga0307507_10137247
1261 Ga0373941_0161429
1262 Ga0373946_0415267
1263 Ga0373942_0031871
1264 Ga0373962_0029923
1265 Ga0316574_0078576
1266 Ga0373931_0048610
1267 Ga0373933_0154521
1268 Ga0373947_0043758
1269 Ga0373937_0073412
1270 Ga0373925_0013041
1271 Ga0373925_0342337
1272 Ga0373925_0554374
1273 Ga0395899_0004383
1274 Ga0395900_0013773
1275 Ga0395900_0249843
1276 Ga0395900_0277530
1277 Ga0395898_0012659
1278 Ga0395905_0000027
1279 Ga0395905_0001424
1280 Ga0395905_0023196
1281 Ga0395905_0141334
1282 Ga0395901_0007843
1283 Ga0395901_0035527
1284 Ga0395901_0452309
1285 Ga0451789_0893179
1286 Ga0451798_0987518
1287 Ga0451800_0588886
1288 Ga0451802_1642668
1289 Ga0451804_0944280
1290 Ga0451807_2361489
1291 Ga0451835_1125021
1292 Ga0451841_0066929
1293 Ga0451843_1560734
1294 Ga0439455_0050189
1295 Ga0439458_0123101
1296 Ga0439464_0024582
1297 Ga0439460_0104113
1298 Ga0451577_0000503
1299 Ga0451577_0031175
1300 Ga0451577_0039921
1301 Ga0451577_0607229
1302 Ga0451577_0729077
1303 Ga0466969_0003153
1304 Ga0466969_0018727
1305 Ga0453683_0184343
1306 Ga0466965_0035913
1307 Ga0466966_0001081
1308 Ga0466966_0038987
1309 Ga0466966_0090564
1310 Ga0466961_0006686
1311 Ga0466961_0008463
1312 Ga0466961_0078539
1313 Ga0466964_0001581
1314 Ga0453684_0000014
1315 Ga0453684_0000080
1316 Ga0453684_0000142
1317 Ga0453684_0001597
1318 Ga0453684_0042904
1319 Ga0453684_0205778
1320 Ga0453684_0862948
1321 Ga0466968_0004214
1322 Ga0466970_0005780
1323 Ga0466970_0046921
1324 Ga0466957_0009229
1325 Ga0466960_0039586
1326 Ga0466960_0402907
1327 Ga0466959_0004233
1328 Ga0466959_0056971
1329 Ga0466959_0229121
1330 Ga0451576_0000272
1331 Ga0451576_0021486
1332 Ga0451576_0503230
1333 Ga0466958_0392775
1334 Ga0466967_0293312
1335 Ga0495603_0110380
1336 Ga0495603_0118136
1337 Ga0495629_0047432
1338 Ga0495638_0120472
1339 Ga0495650_0024295
1340 Ga0495580_0048626
1341 Ga0495608_0275794
1342 Ga0495610_0089226
1343 Ga0495628_0207960
1344 Ga0495628_0283486
1345 Ga0495631_0162790
1346 Ga0495632_0001574
1347 Ga0495632_0009387
1348 Ga0495643_0110135
1349 Ga0495643_0150960
1350 Ga0495597_0012048
1351 Ga0495645_0026599
1352 Ga0495645_0136103
1353 Ga0495611_0162472
1354 Ga0495625_0020973
1355 Ga0495625_0033839
1356 Ga0495635_0061843
1357 Ga0495646_0142718
1358 Ga0495647_0030816
1359 Ga0495647_0143598
1360 Ga0495658_0072161
1361 Ga0495624_0189888
1362 Ga0495649_0000541
1363 Ga0495674_0419673
1364 Ga0495680_0344243
1365 Ga0495687_001991
1366 Ga0495687_006560
1367 Ga0495687_014896
1368 Ga0495675_0262506
1369 Ga0495684_0062323
1370 Ga0495686_0007111
1371 Ga0496100_0023701
1372 Ga0496100_0359354
1373 Ga0496101_0013511
1374 Ga0496102_0002998
1375 Ga0496102_0477350
1376 Ga0496104_0418679
1377 Ga0496105_0110051
1378 Ga0496106_0006072
1379 Ga0496107_0141916
1380 Ga0496107_0391241
1381 Ga0496108_0017021
1382 Ga0496108_0082980
1383 Ga0496108_0133201
1384 Ga0496108_0252291
1385 Ga0496109_0126960
1386 Ga0496109_0129150
1387 Ga0496109_0226707
1388 Ga0496109_0622561
1389 Ga0496110_0007472
1390 Ga0496113_0232465
1391 Ga0496114_0285242
1392 Ga0496114_0386048
1393 Ga0496114_0394701
1394 Ga0496115_0007917
1395 Ga0496121_0003335
1396 Ga0496123_0126856
1397 Ga0496124_0000733
1398 Ga0496125_0007614
1399 Ga0501032_0684540
1400 Ga0501037_0050620
1401 Ga0501038_0123731
1402 Ga0501038_0295363
1403 Ga0501043_0117687
1404 Ga0501047_0377630
1405 Ga0501047_0477085
1406 Ga0501067_0020229
1407 Ga0501067_0045124
1408 Ga0501073_0210288
1409 Ga0501074_0067576
1410 Ga0501076_0075420
1411 Ga0501076_0467804
1412 Ga0501077_0029657
1413 Ga0501198_000007
1414 Ga0501222_000005
1415 Ga0501083_0066784
1416 nmdc:mga03683_154391_c1
1417 nmdc:mga03n38_228910_c1
1418 nmdc:mga03n38_68180_c1
1419 nmdc:mga0yw44_49506_c1
1420 nmdc:mga0k408_111157_c2
1421 nmdc:mga0k408_133666_c1
1422 nmdc:mga0k408_153256_c1
1423 nmdc:mga0k408_20391_c1
1424 nmdc:mga0k408_23723_c1
1425 nmdc:mga0k408_264670_c1
1426 nmdc:mga0k408_27458_c1
1427 nmdc:mga0k408_370_c1
1428 nmdc:mga0k408_388903_c1
1429 nmdc:mga0k408_76051_c1
1430 nmdc:mga0k408_89405_c1
1431 nmdc:mga06z11_34181_c1
1432 nmdc:mga04h51_128057_c1
1433 nmdc:mga04h51_9044_c1
1434 nmdc:mga07m45_13490_c1
1435 nmdc:mga07m45_14825_c1
1436 nmdc:mga07m45_162824_c1
1437 nmdc:mga07m45_32728_c1
1438 nmdc:mga07m45_54331_c1
1439 nmdc:mga05p37_166227_c1
1440 nmdc:mga09592_819_c1
1441 nmdc:mga0qj67_92436_c1
1442 nmdc:mga08y16_802744_c1
1443 Ga0495601_0055940
1444 Ga0495612_0063621
1445 Ga0495595_0101362
1446 Ga0495595_0113770
1447 Ga0500578_0000417
1448 Ga0500644_0079282
1449 Ga0500646_0003560
1450 Ga0500651_0228772
1451 Ga0500555_003846
1452 Ga0500556_0001557
1453 Ga0500628_000141
1454 Ga0500652_000499
1455 Ga0500655_014770
1456 Ga0500658_0008109
1457 Ga0500568_0034616
1458 Ga0500616_0005867
1459 Ga0500619_000069
1460 Ga0500622_0000701
1461 Ga0501084_0016827
1462 Ga0501084_0392754
1463 Ga0501082_0051606
1464 Ga0501082_0061139
1465 Ga0466962_0018635
1466 Ga0466962_0036062
1467 2587725982
1468 2587735644
1469 2587759281
1470 2588292809
1471 2643967917
1472 2644143183
1473 2644271729
1474 2928117989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

24

52

0.97

PF01728

FtsJ

FtsJ-like methyltransferase

85

268

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mq9-assembly1.cif.gz_LZ cryo-em structure of the human ssu processome, state pre-a1* 0.9562 4 42
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9529 3 45
8ccs-assembly1.cif.gz_m 80s s. cerevisiae ribosome with ligands in hybrid-1 pre-translocation (pre-h1) complex 0.9398 4 42
8ove-assembly1.cif.gz_A6 cryo-em structure of trypanosoma brucei procyclic form 80s ribosome : tb11cs6h1 snorna mutant 0.9396 4 44
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9321 55 237
ID Description Score Start End Superfamily
af_Q54XG2_112_174_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9632 8 42 3.10.290.10
af_P02355_88_184_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9608 4 45 3.10.290.10
af_O60063_95_238_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9442 4 45 3.10.290.10
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9434 65 239 3.40.50.150
5o5jD02 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9242 5 45 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A3B8MMG2-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.962 54 183 GO:0008168
GO:0032259
AF-A0A258BSD3-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9612 76 240 GO:0008168
GO:0032259
AF-A0A7V1MXT0-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9582 55 178 GO:0008168
GO:0032259
AF-A0A287NBN3-F1-model_v4 deleted 0.9575 62 183
AF-A0A258BSD3-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9555 76 240 GO:0008168
GO:0032259

Map