F478366

General Info

Members Datasets Scaffolds Average Seq Length
737 386 1474 203

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221547|2643754966
Length 238
Sequence QNLKATVRPKAGKGASRAARFSGRVPGVVYGDNQSPLLVLLDHDELKQRIYAGRFTTTLYELDVDGKKHRVIPRDFQLDAIKDLPMHVDFLRVPEGATIRVKVAVHVLNGETAPGVKRGGAVNIVTHTINLECPADRIPRSIDVDIGDLDINHSKHLSDVKLPEGVRVLAQGDITLVTVVPPSGYAEELKQQAAAAASAAAAAAAPAAAAPATGGTAAPGAAPAAGAAPAAGAAPAKK

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
94 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
95 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
112 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
243 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
244 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
245 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
246 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
247 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
248 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
378 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
379 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
382 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
386 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 5.29
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10001065 3300002077 Bacteria 5305
2 JGI24034J26672_10011273 3300002239 Bacteria 1337
3 Ga0070658_10045516 3300005327 Bacteria 3548
4 Ga0070658_10294924 3300005327 Bacteria 1382
5 Ga0070676_10110307 3300005328 Bacteria 1712
6 Ga0070683_100071308 3300005329 Bacteria 3242
7 Ga0070683_100281939 3300005329 Bacteria 1580
8 Ga0070690_100010169 3300005330 Bacteria 5466
9 Ga0070690_100046888 3300005330 Bacteria 2748
10 Ga0070670_100003926 3300005331 Bacteria 12402
11 Ga0070677_10001233 3300005333 Bacteria 8211
12 Ga0070666_10013033 3300005335 Bacteria 5264
13 Ga0070680_100025931 3300005336 Bacteria 4687
14 Ga0070680_100075581 3300005336 Bacteria 2773
15 Ga0070680_100320522 3300005336 Bacteria 1316
16 Ga0070682_100031300 3300005337 Bacteria 3217
17 Ga0070682_100211783 3300005337 Bacteria 1374
18 Ga0068868_100043832 3300005338 Bacteria 3495
19 Ga0070660_100021115 3300005339 Bacteria 4797
20 Ga0070687_100014500 3300005343 Bacteria 3540
21 Ga0070661_100027394 3300005344 Bacteria 4103
22 Ga0070661_100135390 3300005344 Bacteria 1853
23 Ga0070692_10286820 3300005345 Bacteria 1000
24 Ga0070675_100149359 3300005354 Bacteria 2002
25 Ga0070671_100067499 3300005355 Bacteria 2982
26 Ga0070674_100058922 3300005356 Bacteria 2671
27 Ga0070673_100022646 3300005364 Bacteria 4576
28 Ga0070673_100368996 3300005364 Bacteria 1278
29 Ga0070688_100015921 3300005365 Bacteria 4288
30 Ga0070659_100065802 3300005366 Bacteria 2871
31 Ga0070659_100078059 3300005366 Bacteria 2642
32 Ga0070667_100049507 3300005367 Bacteria 3539
33 Ga0070667_100066283 3300005367 Bacteria 3067
34 Ga0070667_100143734 3300005367 Bacteria 2091
35 Ga0070709_10036741 3300005434 Bacteria 2987
36 Ga0070709_10039706 3300005434 Bacteria 2889
37 Ga0070709_10089638 3300005434 Bacteria 2025
38 Ga0070714_100038357 3300005435 Bacteria 4028
39 Ga0070714_100105676 3300005435 Bacteria 2486
40 Ga0070713_100233617 3300005436 Bacteria 1672
41 Ga0070713_100427347 3300005436 Bacteria 1241
42 Ga0070710_10127166 3300005437 Bacteria 1549
43 Ga0070710_10180439 3300005437 Bacteria 1321
44 Ga0070711_100285363 3300005439 Bacteria 1308
45 Ga0070705_100235401 3300005440 Bacteria 1276
46 Ga0070705_100409269 3300005440 Bacteria 1007
47 Ga0070700_100049650 3300005441 Bacteria 2606
48 Ga0070663_100016023 3300005455 Bacteria 4854
49 Ga0070663_100147422 3300005455 Bacteria 1801
50 Ga0070678_100041566 3300005456 Bacteria 3260
51 Ga0070681_10048764 3300005458 Bacteria 4231
52 Ga0070681_10113759 3300005458 Bacteria 2645
53 Ga0070681_10219210 3300005458 Bacteria 1818
54 Ga0070681_10221895 3300005458 Bacteria 1805
55 Ga0070681_10363512 3300005458 Bacteria 1357
56 Ga0070681_10590887 3300005458 Bacteria 1024
57 Ga0068867_100100804 3300005459 Bacteria 2205
58 Ga0068867_100119241 3300005459 Bacteria 2037
59 Ga0070685_10039316 3300005466 Bacteria 2686
60 Ga0070698_100313360 3300005471 Bacteria 1500
61 Ga0070679_100045107 3300005530 Bacteria 4392
62 Ga0070679_100074695 3300005530 Bacteria 3380
63 Ga0070679_100098270 3300005530 Bacteria 2915
64 Ga0070679_100123213 3300005530 Bacteria 2576
65 Ga0070697_100195748 3300005536 Bacteria 1717
66 Ga0070672_100107008 3300005543 Bacteria 2276
67 Ga0070686_100121230 3300005544 Bacteria 1796
68 Ga0070693_100132926 3300005547 Bacteria 1558
69 Ga0070693_100264491 3300005547 Bacteria 1145
70 Ga0070704_100543810 3300005549 Bacteria 1014
71 Ga0068855_100077098 3300005563 Bacteria 3867
72 Ga0068855_100095501 3300005563 Bacteria 3426
73 Ga0070664_100057416 3300005564 Bacteria 3309
74 Ga0070664_100158450 3300005564 Bacteria 2001
75 Ga0068857_100002095 3300005577 Bacteria 16205
76 Ga0068857_100137309 3300005577 Bacteria 2208
77 Ga0068856_100046052 3300005614 Bacteria 4296
78 Ga0068856_100046477 3300005614 Bacteria 4275
79 Ga0070702_100080387 3300005615 Bacteria 1950
80 Ga0068852_100106647 3300005616 Bacteria 2540
81 Ga0068859_100524464 3300005617 Bacteria 1279
82 Ga0068864_100001534 3300005618 Bacteria 19014
83 Ga0068864_100160002 3300005618 Bacteria 2046
84 Ga0068866_10002030 3300005718 Bacteria 8431
85 Ga0068866_10018406 3300005718 Bacteria 3159
86 Ga0068851_10089551 3300005834 Bacteria 1618
87 Ga0068870_10013282 3300005840 Bacteria 3868
88 Ga0068863_100135924 3300005841 Bacteria 2349
89 Ga0068858_100221902 3300005842 Bacteria 1790
90 Ga0068860_100348153 3300005843 Bacteria 1458
91 Ga0068860_100622998 3300005843 Bacteria 1085
92 Ga0068862_100004584 3300005844 Bacteria 11654
93 Ga0081455_10008649 3300005937 Bacteria 10552
94 Ga0081455_10024396 3300005937 Bacteria 5601
95 Ga0070717_10002945 3300006028 Bacteria 12093
96 Ga0070717_10041442 3300006028 Bacteria 3754
97 Ga0070717_10235308 3300006028 Bacteria 1614
98 Ga0075432_10004302 3300006058 Bacteria 4849
99 Ga0075432_10027156 3300006058 Bacteria 1970
100 Ga0070716_100047671 3300006173 Bacteria 2418
101 Ga0070716_100075159 3300006173 Bacteria 1999
102 Ga0070712_100320766 3300006175 Bacteria 1260
103 Ga0075362_10102872 3300006177 Bacteria 1337
104 Ga0075367_10065237 3300006178 Bacteria 2180
105 Ga0075367_10079858 3300006178 Bacteria 1977
106 Ga0075367_10206671 3300006178 Bacteria 1227
107 Ga0075369_10012816 3300006186 Bacteria 3315
108 Ga0075427_10000953 3300006194 Bacteria 3570
109 Ga0097621_100013993 3300006237 Bacteria 5993
110 Ga0097621_100015096 3300006237 Bacteria 5800
111 Ga0075370_10037259 3300006353 Bacteria 2734
112 Ga0075370_10194263 3300006353 Bacteria 1196
113 Ga0075370_10262368 3300006353 Bacteria 1025
114 Ga0068871_100018875 3300006358 Bacteria 5254
115 Ga0068871_100056437 3300006358 Bacteria 3192
116 Ga0075428_100004320 3300006844 Bacteria 15659
117 Ga0075430_100000275 3300006846 Bacteria 36030
118 Ga0075430_100000426 3300006846 Bacteria 31396
119 Ga0075431_100020560 3300006847 Bacteria 6745
120 Ga0075433_10000029 3300006852 Bacteria 55893
121 Ga0075433_10549952 3300006852 Bacteria 1015
122 Ga0075434_100000208 3300006871 Bacteria 39868
123 Ga0075434_100001333 3300006871 Bacteria 20677
124 Ga0075434_100286635 3300006871 Bacteria 1667
125 Ga0075429_100000734 3300006880 Bacteria 25672
126 Ga0068865_100099074 3300006881 Bacteria 2130
127 Ga0068865_100281288 3300006881 Bacteria 1325
128 Ga0075436_100029960 3300006914 Bacteria 3743
129 Ga0075436_100188824 3300006914 Bacteria 1458
130 Ga0075436_100315984 3300006914 Bacteria 1122
131 Ga0097620_100524507 3300006931 Bacteria 1279
132 Ga0075435_100046941 3300007076 Bacteria 3466
133 Ga0075435_100095474 3300007076 Bacteria 2459
134 Ga0105251_10005445 3300009011 Bacteria 8312
135 Ga0105240_10069867 3300009093 Bacteria 4346
136 Ga0105240_10109147 3300009093 Bacteria 3352
137 Ga0105240_10853712 3300009093 Bacteria 982
138 Ga0111539_10000345 3300009094 Bacteria 57093
139 Ga0111539_10108778 3300009094 Bacteria 3253
140 Ga0111539_10261937 3300009094 Bacteria 2013
141 Ga0105247_10029287 3300009101 Bacteria 3336
142 Ga0105247_10288663 3300009101 Bacteria 1134
143 Ga0114129_10003572 3300009147 Bacteria 21879
144 Ga0105243_10116370 3300009148 Bacteria 2246
145 Ga0105243_10156681 3300009148 Bacteria 1959
146 Ga0105243_10242456 3300009148 Bacteria 1605
147 Ga0105241_10012966 3300009174 Bacteria 6113
148 Ga0105242_10109212 3300009176 Bacteria 2355
149 Ga0105242_10181924 3300009176 Bacteria 1855
150 Ga0105242_10206864 3300009176 Bacteria 1746
151 Ga0105237_10034469 3300009545 Bacteria 5125
152 Ga0105237_10067254 3300009545 Bacteria 3577
153 Ga0105237_10100286 3300009545 Bacteria 2887
154 Ga0105238_10025119 3300009551 Bacteria 6072
155 Ga0105238_10028682 3300009551 Bacteria 5670
156 Ga0105238_10136040 3300009551 Bacteria 2435
157 Ga0105238_10475692 3300009551 Bacteria 1248
158 Ga0105249_10119394 3300009553 Bacteria 2504
159 Ga0105239_10109546 3300010375 Bacteria 3060
160 Ga0105246_10112198 3300011119 Bacteria 2005
161 Ga0157340_1001339 3300012473 Bacteria 1116
162 Ga0157339_1003319 3300012505 Bacteria 1154
163 Ga0157316_1006246 3300012510 Bacteria 971
164 Ga0157373_10164715 3300013100 Bacteria 1560
165 Ga0157371_10238339 3300013102 Bacteria 1308
166 Ga0157370_10056299 3300013104 Bacteria 3742
167 Ga0157370_10058433 3300013104 Bacteria 3666
168 Ga0157370_10202959 3300013104 Bacteria 1839
169 Ga0157369_10834923 3300013105 Bacteria 946
170 Ga0157369_11094281 3300013105 Bacteria 815
171 Ga0157374_10272671 3300013296 Bacteria 1669
172 Ga0157378_10069624 3300013297 Bacteria 3157
173 Ga0163162_11221534 3300013306 Bacteria 853
174 Ga0163163_10001710 3300014325 Bacteria 18534
175 Ga0157380_10065474 3300014326 Bacteria 2921
176 Ga0182008_10096947 3300014497 Bacteria 1455
177 Ga0157377_10003804 3300014745 Bacteria 6857
178 Ga0157379_10190381 3300014968 Bacteria 1854
179 Ga0157379_10380040 3300014968 Bacteria 1296
180 Ga0157376_10008671 3300014969 Bacteria 7351
181 Ga0157376_10037869 3300014969 Bacteria 3920
182 Ga0157376_10214471 3300014969 Bacteria 1779
183 Ga0163161_10001476 3300017792 Bacteria 17368
184 Ga0163161_10065350 3300017792 Bacteria 2655
185 Ga0213876_10047692 3300021384 Bacteria 2264
186 Ga0224572_1001585 3300024225 Bacteria 3417
187 Ga0228598_1014536 3300024227 Bacteria 1557
188 Ga0207673_1000232 3300025290 Bacteria 5664
189 Ga0207697_10002797 3300025315 Bacteria 8890
190 Ga0207653_10014160 3300025885 Bacteria 2501
191 Ga0207682_10000056 3300025893 Bacteria 48265
192 Ga0207692_10011767 3300025898 Bacteria 3737
193 Ga0207692_10032532 3300025898 Bacteria 2507
194 Ga0207692_10103770 3300025898 Bacteria 1566
195 Ga0207692_10193538 3300025898 Bacteria 1191
196 Ga0207710_10001206 3300025900 Bacteria 13122
197 Ga0207710_10062498 3300025900 Bacteria 1692
198 Ga0207680_10006395 3300025903 Bacteria 5695
199 Ga0207647_10011486 3300025904 Bacteria 6209
200 Ga0207685_10052223 3300025905 Bacteria 1583
201 Ga0207699_10016764 3300025906 Bacteria 3840
202 Ga0207699_10047203 3300025906 Bacteria 2524
203 Ga0207699_10187115 3300025906 Bacteria 1395
204 Ga0207645_10000249 3300025907 Bacteria 44921
205 Ga0207645_10076117 3300025907 Bacteria 2149
206 Ga0207643_10000187 3300025908 Bacteria 42567
207 Ga0207705_10322986 3300025909 Bacteria 1186
208 Ga0207705_10340141 3300025909 Bacteria 1155
209 Ga0207705_10468241 3300025909 Bacteria 978
210 Ga0207654_10141539 3300025911 Bacteria 1535
211 Ga0207654_10239987 3300025911 Bacteria 1211
212 Ga0207707_10035389 3300025912 Bacteria 4367
213 Ga0207707_10038851 3300025912 Bacteria 4160
214 Ga0207695_10169713 3300025913 Bacteria 2108
215 Ga0207695_10354509 3300025913 Bacteria 1354
216 Ga0207695_10571334 3300025913 Bacteria 1012
217 Ga0207671_10199873 3300025914 Bacteria 1561
218 Ga0207671_10381922 3300025914 Bacteria 1119
219 Ga0207693_10004402 3300025915 Bacteria 11913
220 Ga0207693_10027666 3300025915 Bacteria 4482
221 Ga0207693_10308346 3300025915 Bacteria 1239
222 Ga0207663_10007931 3300025916 Bacteria 5539
223 Ga0207663_10046657 3300025916 Bacteria 2670
224 Ga0207660_10007537 3300025917 Bacteria 7045
225 Ga0207660_10009967 3300025917 Bacteria 6155
226 Ga0207662_10082578 3300025918 Bacteria 1963
227 Ga0207662_10347431 3300025918 Bacteria 995
228 Ga0207657_10012303 3300025919 Bacteria 8456
229 Ga0207657_10036760 3300025919 Bacteria 4381
230 Ga0207657_10046279 3300025919 Bacteria 3812
231 Ga0207649_10000852 3300025920 Bacteria 19557
232 Ga0207649_10063353 3300025920 Bacteria 2334
233 Ga0207649_10147106 3300025920 Bacteria 1618
234 Ga0207652_10078097 3300025921 Bacteria 2889
235 Ga0207652_10100350 3300025921 Bacteria 2555
236 Ga0207652_10250411 3300025921 Bacteria 1597
237 Ga0207694_10018888 3300025924 Bacteria 5211
238 Ga0207694_10174373 3300025924 Bacteria 1742
239 Ga0207694_10284615 3300025924 Bacteria 1358
240 Ga0207659_10001325 3300025926 Bacteria 14791
241 Ga0207687_10018841 3300025927 Bacteria 4563
242 Ga0207687_10028412 3300025927 Bacteria 3757
243 Ga0207687_10168823 3300025927 Bacteria 1686
244 Ga0207700_10000623 3300025928 Bacteria 20712
245 Ga0207700_10136114 3300025928 Bacteria 2012
246 Ga0207664_10068339 3300025929 Bacteria 2854
247 Ga0207664_10550414 3300025929 Bacteria 1035
248 Ga0207644_10008645 3300025931 Bacteria 6659
249 Ga0207644_10057454 3300025931 Bacteria 2809
250 Ga0207644_10118703 3300025931 Bacteria 2010
251 Ga0207690_10001793 3300025932 Bacteria 13192
252 Ga0207706_10017303 3300025933 Bacteria 6495
253 Ga0207706_10041807 3300025933 Bacteria 4063
254 Ga0207686_10000898 3300025934 Bacteria 17933
255 Ga0207709_10003144 3300025935 Bacteria 9924
256 Ga0207709_10178383 3300025935 Bacteria 1498
257 Ga0207670_10018372 3300025936 Bacteria 4250
258 Ga0207704_10031431 3300025938 Bacteria 2991
259 Ga0207665_10001669 3300025939 Bacteria 14935
260 Ga0207665_10353646 3300025939 Bacteria 1109
261 Ga0207691_10042188 3300025940 Bacteria 4206
262 Ga0207691_10053344 3300025940 Bacteria 3691
263 Ga0207691_10352009 3300025940 Bacteria 1260
264 Ga0207711_10014151 3300025941 Bacteria 6628
265 Ga0207711_10041241 3300025941 Bacteria 3930
266 Ga0207711_10228839 3300025941 Bacteria 1702
267 Ga0207689_10007833 3300025942 Bacteria 9338
268 Ga0207661_10002538 3300025944 Bacteria 12565
269 Ga0207679_10000187 3300025945 Bacteria 49895
270 Ga0207667_10016532 3300025949 Bacteria 8334
271 Ga0207667_10082569 3300025949 Bacteria 3328
272 Ga0207651_10127001 3300025960 Bacteria 1945
273 Ga0207712_10006029 3300025961 Bacteria 7648
274 Ga0207640_10071065 3300025981 Bacteria 2343
275 Ga0207658_10057325 3300025986 Bacteria 2894
276 Ga0207658_10065697 3300025986 Bacteria 2726
277 Ga0207658_10095816 3300025986 Bacteria 2313
278 Ga0207677_10372145 3300026023 Bacteria 1203
279 Ga0207677_10714629 3300026023 Bacteria 890
280 Ga0207703_10087739 3300026035 Bacteria 2609
281 Ga0207639_10089022 3300026041 Bacteria 2465
282 Ga0207678_10007624 3300026067 Bacteria 9559
283 Ga0207678_10015613 3300026067 Bacteria 6677
284 Ga0207678_10043789 3300026067 Bacteria 3873
285 Ga0207702_10054324 3300026078 Bacteria 3394
286 Ga0207702_10830076 3300026078 Bacteria 914
287 Ga0207641_10143683 3300026088 Bacteria 2155
288 Ga0207641_10640019 3300026088 Bacteria 1044
289 Ga0207648_10001031 3300026089 Bacteria 31313
290 Ga0207648_10174077 3300026089 Bacteria 1903
291 Ga0207676_10134624 3300026095 Bacteria 2106
292 Ga0207676_10333146 3300026095 Bacteria 1397
293 Ga0207674_10000686 3300026116 Bacteria 44016
294 Ga0207674_10180152 3300026116 Bacteria 2064
295 Ga0207674_10694744 3300026116 Bacteria 982
296 Ga0207675_100048378 3300026118 Bacteria 3969
297 Ga0207683_10000727 3300026121 Bacteria 29910
298 Ga0207683_10004115 3300026121 Bacteria 12577
299 Ga0207683_10041162 3300026121 Bacteria 4033
300 Ga0207698_10672089 3300026142 Bacteria 1028
301 Ga0209970_1002946 3300027614 Bacteria 2871
302 Ga0209983_1001199 3300027665 Bacteria 5741
303 Ga0209971_1001243 3300027682 Bacteria 6384
304 Ga0209966_1000714 3300027695 Bacteria 7077
305 Ga0209998_10064008 3300027717 Bacteria 870
306 Ga0209998_10067826 3300027717 Bacteria 849
307 Ga0209813_10011774 3300027866 Bacteria 2295
308 Ga0209974_10010473 3300027876 Bacteria 3129
309 Ga0207428_10000150 3300027907 Bacteria 94699
310 Ga0207428_10000360 3300027907 Bacteria 58478
311 Ga0207428_10000556 3300027907 Bacteria 44098
312 Ga0268266_10004404 3300028379 Bacteria 13495
313 Ga0268266_10281305 3300028379 Bacteria 1547
314 Ga0268266_10666268 3300028379 Bacteria 1002
315 Ga0268265_10000526 3300028380 Bacteria 39043
316 Ga0268264_10002038 3300028381 Bacteria 18063
317 Ga0268264_10122323 3300028381 Bacteria 2295
318 Ga0268264_10557975 3300028381 Bacteria 1124
319 Ga0265337_1019818 3300028556 Bacteria 2115
320 Ga0265336_10043542 3300028666 Bacteria 1368
321 Ga0265338_10085845 3300028800 Bacteria 2622
322 Ga0265338_10115103 3300028800 Bacteria 2156
323 Ga0265330_10046345 3300031235 Bacteria 1915
324 Ga0265332_10000812 3300031238 Bacteria 18981
325 Ga0265332_10082336 3300031238 Bacteria 1365
326 Ga0265325_10000030 3300031241 Bacteria 103532
327 Ga0265325_10017849 3300031241 Bacteria 3941
328 Ga0265325_10108720 3300031241 Bacteria 1350
329 Ga0265340_10002134 3300031247 Bacteria 11343
330 Ga0265340_10005177 3300031247 Bacteria 7250
331 Ga0265340_10065466 3300031247 Bacteria 1730
332 Ga0265340_10099641 3300031247 Bacteria 1351
333 Ga0265339_10000669 3300031249 Bacteria 26471
334 Ga0265339_10008520 3300031249 Bacteria 6519
335 Ga0265339_10077030 3300031249 Bacteria 1767
336 Ga0265331_10194498 3300031250 Bacteria 914
337 Ga0307513_10143091 3300031456 Bacteria 2314
338 Ga0265313_10003681 3300031595 Bacteria 12245
339 Ga0265313_10006110 3300031595 Bacteria 8665
340 Ga0265313_10030904 3300031595 Bacteria 2751
341 Ga0265313_10082256 3300031595 Bacteria 1460
342 Ga0316579_10027180 3300031691 Bacteria 2596
343 Ga0265314_10004041 3300031711 Bacteria 13864
344 Ga0265314_10009643 3300031711 Bacteria 8132
345 Ga0265314_10030010 3300031711 Bacteria 4030
346 Ga0265314_10249456 3300031711 Bacteria 1020
347 Ga0265342_10000281 3300031712 Bacteria 57398
348 Ga0265342_10004069 3300031712 Bacteria 11662
349 Ga0265342_10110551 3300031712 Bacteria 1555
350 Ga0307415_100250089 3300032126 Bacteria 1440
351 Ga0316583_10000116 3300032133 Bacteria 18613
352 Ga0373930_0000129 3300034816 Bacteria 8362
353 Ga0373930_0003062 3300034816 Bacteria 2631
354 Ga0373948_0007773 3300034817 Bacteria 1812
355 Ga0373950_0000820 3300034818 Bacteria 3906
356 Ga0373959_0001750 3300034820 Bacteria 3469
357 Ga0373959_0001950 3300034820 Bacteria 3288
358 Ga0373938_0002546 3300034957 Bacteria 2941
359 Ga0373938_0006708 3300034957 Bacteria 2000
360 Ga0373926_0006649 3300035083 Bacteria 3838
361 Ga0373926_0023880 3300035083 Bacteria 2125
362 Ga0373926_0032415 3300035083 Bacteria 1843
363 Ga0373928_0000375 3300035084 Bacteria 8963
364 Ga0373929_0000146 3300035085 Bacteria 12154
365 Ga0373929_0001869 3300035085 Bacteria 3946
366 Ga0373940_0008049 3300035088 Bacteria 2404
367 Ga0373940_0058780 3300035088 Bacteria 1095
368 Ga0373944_0005274 3300035089 Bacteria 3400
369 Ga0373944_0006918 3300035089 Bacteria 3028
370 Ga0373944_0015430 3300035089 Bacteria 2144
371 Ga0373949_0010201 3300035090 Bacteria 2057
372 Ga0373951_0000214 3300035091 Bacteria 20411
373 Ga0373952_0001494 3300035092 Bacteria 4252
374 Ga0373923_0000187 3300035111 Bacteria 12538
375 Ga0373932_0000473 3300035112 Bacteria 12328
376 Ga0373932_0000584 3300035112 Bacteria 11134
377 Ga0373939_0000602 3300035114 Bacteria 8943
378 Ga0373939_0003756 3300035114 Bacteria 3579
379 Ga0373941_0004906 3300035115 Bacteria 3117
380 Ga0373945_0000395 3300035116 Bacteria 12509
381 Ga0373945_0003626 3300035116 Bacteria 4864
382 Ga0373945_0040494 3300035116 Bacteria 1682
383 Ga0373953_0006040 3300035117 Bacteria 3968
384 Ga0373954_0003581 3300035118 Bacteria 6602
385 Ga0373954_0006846 3300035118 Bacteria 4975
386 Ga0373954_0103932 3300035118 Bacteria 1371
387 Ga0373954_0104203 3300035118 Bacteria 1369
388 Ga0373956_0003765 3300035119 Bacteria 6107
389 Ga0373956_0040778 3300035119 Bacteria 2060
390 Ga0373957_0019755 3300035120 Bacteria 2374
391 Ga0373960_0001283 3300035121 Bacteria 5530
392 Ga0373943_0003892 3300035170 Bacteria 6797
393 Ga0373943_0005034 3300035170 Bacteria 5960
394 Ga0373943_0008480 3300035170 Bacteria 4610
395 Ga0373943_0031860 3300035170 Bacteria 2503
396 Ga0373946_0024257 3300035171 Bacteria 2375
397 Ga0373946_0074135 3300035171 Bacteria 1476
398 Ga0373955_0024147 3300035172 Bacteria 3105
399 Ga0373955_0070304 3300035172 Bacteria 1955
400 Ga0373955_0083295 3300035172 Bacteria 1811
401 Ga0373955_0101614 3300035172 Bacteria 1651
402 Ga0373942_0008104 3300035207 Bacteria 2444
403 Ga0373942_0017422 3300035207 Bacteria 1770
404 Ga0373961_0000749 3300035241 Bacteria 11204
405 Ga0373924_0022179 3300035410 Bacteria 2481
406 Ga0373931_0109680 3300035691 Bacteria 1564
407 Ga0373935_0004894 3300035692 Bacteria 7873
408 Ga0373935_0179646 3300035692 Bacteria 1452
409 Ga0373927_0006438 3300035695 Bacteria 8002
410 Ga0373927_0064286 3300035695 Bacteria 2373
411 Ga0373927_0081759 3300035695 Bacteria 2093
412 Ga0373927_0095756 3300035695 Bacteria 1929
413 Ga0373927_0283154 3300035695 Bacteria 1091
414 Ga0373933_0001082 3300035724 Bacteria 16333
415 Ga0373933_0008751 3300035724 Bacteria 5518
416 Ga0373933_0009814 3300035724 Bacteria 5238
417 Ga0373933_0035906 3300035724 Bacteria 2898
418 Ga0373933_0173498 3300035724 Bacteria 1373
419 Ga0373947_0001922 3300035725 Bacteria 12704
420 Ga0373947_0016251 3300035725 Bacteria 4277
421 Ga0373947_0040243 3300035725 Bacteria 2783
422 Ga0373947_0069790 3300035725 Bacteria 2152
423 Ga0373937_0002931 3300036401 Bacteria 14272
424 Ga0373937_0007191 3300036401 Bacteria 9629
425 Ga0373937_0124163 3300036401 Bacteria 2407
426 Ga0373925_0001686 3300037068 Bacteria 18583
427 Ga0373925_0009753 3300037068 Bacteria 6975
428 Ga0373925_0050437 3300037068 Bacteria 3103
429 Ga0395899_0006936 3300037312 Bacteria 8776
430 Ga0395899_0257309 3300037312 Bacteria 1195
431 Ga0395900_0012710 3300037418 Bacteria 8602
432 Ga0395900_0122362 3300037418 Bacteria 2669
433 Ga0395898_0012047 3300037466 Bacteria 8951
434 Ga0436364_0168099 3300037853 Bacteria 818
435 Ga0436364_1441472 3300037853 Bacteria 3831
436 Ga0395901_0007158 3300038443 Bacteria 11258
437 Ga0395901_0109021 3300038443 Bacteria 2906
438 Ga0436365_0769383 3300039437 Bacteria 9423
439 Ga0436365_0983586 3300039437 Bacteria 1050
440 Ga0436362_0869149 3300039453 Bacteria 2119
441 Ga0451791_0612931 3300041451 Bacteria 2017
442 Ga0451802_1957638 3300041460 Bacteria 1306
443 Ga0451807_2314777 3300041486 Bacteria 1759
444 Ga0451841_0706006 3300041498 Bacteria 1038
445 Ga0439463_012770 3300042016 Bacteria 2065
446 Ga0439446_0063715 3300042156 Bacteria 1118
447 Ga0439459_0015823 3300042438 Bacteria 1387
448 Ga0451577_0127376 3300042876 Bacteria 2282
449 Ga0466965_0113074 3300044683 Bacteria 1397
450 Ga0466965_0299891 3300044683 Bacteria 872
451 Ga0466963_0370252 3300044694 Bacteria 1009
452 Ga0451576_0018136 3300045051 Bacteria 7721
453 Ga0466967_0094290 3300045976 Bacteria 2725
454 Ga0495603_0001272 3300046455 Bacteria 14676
455 Ga0495603_0082254 3300046455 Bacteria 1886
456 Ga0495629_0000026 3300046459 Bacteria 134719
457 Ga0495629_0015488 3300046459 Bacteria 5474
458 Ga0495629_0036259 3300046459 Bacteria 3482
459 Ga0495638_0013371 3300046460 Bacteria 5590
460 Ga0495641_0018469 3300046461 Bacteria 3597
461 Ga0495651_0017093 3300046462 Bacteria 5621
462 Ga0495651_0220127 3300046462 Bacteria 1314
463 Ga0495651_0256863 3300046462 Bacteria 1190
464 Ga0495651_0301221 3300046462 Bacteria 1075
465 Ga0495653_0017706 3300046463 Bacteria 5793
466 Ga0495653_0227717 3300046463 Bacteria 1249
467 Ga0495653_0239184 3300046463 Bacteria 1211
468 Ga0495580_0013840 3300046472 Bacteria 6142
469 Ga0495580_0068647 3300046472 Bacteria 2478
470 Ga0495582_0014383 3300046473 Bacteria 4350
471 Ga0495639_0006240 3300046475 Bacteria 5120
472 Ga0495639_0009341 3300046475 Bacteria 4205
473 Ga0495639_0024784 3300046475 Bacteria 2642
474 Ga0495662_0002967 3300046476 Bacteria 8560
475 Ga0495662_0086545 3300046476 Bacteria 1526
476 Ga0495664_0002862 3300046477 Bacteria 9299
477 Ga0495664_0027670 3300046477 Bacteria 3307
478 Ga0495584_0040128 3300046491 Bacteria 2364
479 Ga0495585_0002078 3300046492 Bacteria 14696
480 Ga0495594_0030525 3300046499 Bacteria 2917
481 Ga0495607_0004674 3300046501 Bacteria 10022
482 Ga0495606_0169337 3300046507 Bacteria 1268
483 Ga0495608_0003087 3300046511 Bacteria 11890
484 Ga0495608_0041050 3300046511 Bacteria 3098
485 Ga0495608_0056482 3300046511 Bacteria 2592
486 Ga0495608_0105750 3300046511 Bacteria 1812
487 Ga0495616_0038691 3300046513 Bacteria 2448
488 Ga0495618_0015090 3300046514 Bacteria 4712
489 Ga0495628_0019066 3300046516 Bacteria 5673
490 Ga0495628_0073293 3300046516 Bacteria 2668
491 Ga0495628_0090285 3300046516 Bacteria 2372
492 Ga0495630_0026726 3300046517 Bacteria 4275
493 Ga0495630_0087010 3300046517 Bacteria 2360
494 Ga0495644_0000312 3300046523 Bacteria 22452
495 Ga0495666_0001337 3300046526 Bacteria 11947
496 Ga0495652_0011840 3300046529 Bacteria 7883
497 Ga0495652_0022671 3300046529 Bacteria 5571
498 Ga0495652_0026811 3300046529 Bacteria 5084
499 Ga0495652_0101928 3300046529 Bacteria 2326
500 Ga0495665_0006056 3300046531 Bacteria 6524
501 Ga0495665_0127196 3300046531 Bacteria 1334
502 Ga0495640_0006356 3300046533 Bacteria 9360
503 Ga0495586_0008435 3300046535 Bacteria 5484
504 Ga0495586_0008693 3300046535 Bacteria 5407
505 Ga0495587_0001048 3300046536 Bacteria 18208
506 Ga0495587_0021036 3300046536 Bacteria 4024
507 Ga0495587_0199300 3300046536 Bacteria 1132
508 Ga0495598_0031147 3300046537 Bacteria 1499
509 Ga0495609_0020209 3300046538 Bacteria 3078
510 Ga0495645_0002634 3300046543 Bacteria 12204
511 Ga0495645_0014085 3300046543 Bacteria 5667
512 Ga0495645_0087093 3300046543 Bacteria 2234
513 Ga0495645_0113346 3300046543 Bacteria 1917
514 Ga0495622_0016292 3300046557 Bacteria 3459
515 Ga0495622_0092083 3300046557 Bacteria 1392
516 Ga0495633_0001295 3300046558 Bacteria 19775
517 Ga0495667_0003431 3300046559 Bacteria 10630
518 Ga0495667_0011221 3300046559 Bacteria 6068
519 Ga0495667_0014036 3300046559 Bacteria 5408
520 Ga0495667_0039048 3300046559 Bacteria 3159
521 Ga0495656_0000338 3300046615 Bacteria 16110
522 Ga0495611_0102403 3300046648 Bacteria 1330
523 Ga0495611_0162183 3300046648 Bacteria 1045
524 Ga0495635_0048853 3300046663 Bacteria 2916
525 Ga0495635_0118183 3300046663 Bacteria 1809
526 Ga0495635_0144080 3300046663 Bacteria 1622
527 Ga0495661_0113218 3300046665 Bacteria 1509
528 Ga0495588_0017196 3300046674 Bacteria 3507
529 Ga0495588_0030675 3300046674 Bacteria 2703
530 Ga0495657_0023571 3300046675 Bacteria 4395
531 Ga0495657_0051023 3300046675 Bacteria 2779
532 Ga0495599_0191987 3300046678 Bacteria 1256
533 Ga0495599_0405502 3300046678 Unclassified 811
534 Ga0495623_0000394 3300046679 Bacteria 28821
535 Ga0495623_0030999 3300046679 Bacteria 3440
536 Ga0495623_0031891 3300046679 Bacteria 3387
537 Ga0495646_0002685 3300046680 Bacteria 11010
538 Ga0495646_0024348 3300046680 Bacteria 3812
539 Ga0495647_0002213 3300046681 Bacteria 6085
540 Ga0495647_0003379 3300046681 Bacteria 5113
541 Ga0495647_0005918 3300046681 Bacteria 4025
542 Ga0495658_0054247 3300046683 Bacteria 2279
543 Ga0495669_0183046 3300046684 Bacteria 999
544 Ga0495613_0040648 3300046689 Bacteria 3445
545 Ga0495613_0106636 3300046689 Bacteria 2021
546 Ga0495613_0122963 3300046689 Bacteria 1862
547 Ga0495624_0038263 3300046690 Bacteria 3082
548 Ga0495670_0000232 3300046691 Bacteria 25466
549 Ga0495600_0002491 3300046809 Bacteria 10572
550 Ga0495600_0011998 3300046809 Bacteria 5410
551 Ga0495600_0014421 3300046809 Bacteria 4981
552 Ga0495600_0019514 3300046809 Bacteria 4330
553 Ga0495581_0021531 3300047315 Bacteria 3735
554 Ga0495581_0027479 3300047315 Bacteria 3299
555 Ga0495581_0150574 3300047315 Bacteria 1359
556 Ga0495604_0009413 3300047317 Bacteria 7727
557 Ga0495604_0010035 3300047317 Bacteria 7498
558 Ga0495604_0105379 3300047317 Bacteria 2064
559 Ga0495674_0009887 3300047319 Bacteria 9054
560 Ga0495674_0015538 3300047319 Bacteria 7114
561 Ga0495674_0059871 3300047319 Bacteria 3325
562 Ga0495676_0117383 3300047321 Bacteria 1941
563 Ga0495676_0167932 3300047321 Bacteria 1546
564 Ga0495680_0008836 3300047322 Bacteria 9116
565 Ga0495680_0009493 3300047322 Bacteria 8743
566 Ga0495680_0015460 3300047322 Bacteria 6585
567 Ga0495680_0031980 3300047322 Bacteria 4276
568 Ga0495675_0001159 3300047444 Bacteria 15992
569 Ga0495675_0030865 3300047444 Bacteria 3419
570 Ga0495675_0058767 3300047444 Bacteria 2438
571 Ga0495675_0060449 3300047444 Bacteria 2402
572 Ga0495684_0018338 3300047471 Bacteria 5394
573 Ga0495684_0066340 3300047471 Bacteria 2744
574 Ga0495593_0060211 3300047673 Bacteria 1988
575 Ga0495593_0219300 3300047673 Bacteria 954
576 Ga0495602_0001877 3300048088 Bacteria 21025
577 Ga0495602_0005817 3300048088 Bacteria 12942
578 Ga0495602_0012468 3300048088 Bacteria 8734
579 Ga0495602_0025567 3300048088 Bacteria 5712
580 Ga0495602_0065563 3300048088 Bacteria 3134
581 Ga0495614_0032344 3300048089 Bacteria 2251
582 Ga0496100_0080900 3300048903 Bacteria 2193
583 Ga0496101_0003343 3300048904 Bacteria 9991
584 Ga0496101_0356708 3300048904 Bacteria 1149
585 Ga0496101_0469356 3300048904 Bacteria 993
586 Ga0496102_0056996 3300048905 Bacteria 3565
587 Ga0496102_0401554 3300048905 Bacteria 1288
588 Ga0496103_0000963 3300048906 Bacteria 20444
589 Ga0496103_0072687 3300048906 Bacteria 2154
590 Ga0496104_0000065 3300048907 Bacteria 108770
591 Ga0496104_0066037 3300048907 Bacteria 3435
592 Ga0496104_0335672 3300048907 Bacteria 1424
593 Ga0496104_0374549 3300048907 Bacteria 1336
594 Ga0496105_0000170 3300048908 Bacteria 43535
595 Ga0496105_0012481 3300048908 Bacteria 6727
596 Ga0496106_0007782 3300048909 Bacteria 7928
597 Ga0496106_0428517 3300048909 Bacteria 1063
598 Ga0496107_0077413 3300048910 Bacteria 2422
599 Ga0496107_0156602 3300048910 Bacteria 1687
600 Ga0496108_0001681 3300048911 Bacteria 17532
601 Ga0496108_0009662 3300048911 Bacteria 7818
602 Ga0496108_0012623 3300048911 Bacteria 6884
603 Ga0496108_0305784 3300048911 Bacteria 1385
604 Ga0496109_0009805 3300048912 Bacteria 8175
605 Ga0496109_0010944 3300048912 Bacteria 7771
606 Ga0496109_0042701 3300048912 Bacteria 4108
607 Ga0496111_0002766 3300048914 Bacteria 10673
608 Ga0496111_0029265 3300048914 Bacteria 3911
609 Ga0496111_0065887 3300048914 Bacteria 2629
610 Ga0496112_0021287 3300048915 Bacteria 6164
611 Ga0496112_0072154 3300048915 Bacteria 3412
612 Ga0496113_0000329 3300048916 Bacteria 22567
613 Ga0496113_0054565 3300048916 Bacteria 2991
614 Ga0496114_0005283 3300048917 Bacteria 10089
615 Ga0496115_0001117 3300048918 Bacteria 19364
616 Ga0496115_0030109 3300048918 Bacteria 4268
617 Ga0496115_0051087 3300048918 Bacteria 3314
618 Ga0496121_0062764 3300048924 Bacteria 3040
619 Ga0501032_0039459 3300049569 Bacteria 3211
620 Ga0501033_0016861 3300049570 Bacteria 5522
621 Ga0501033_0279975 3300049570 Bacteria 1177
622 Ga0501034_0009382 3300049571 Bacteria 10250
623 Ga0501034_0018508 3300049571 Bacteria 7141
624 Ga0501034_0144973 3300049571 Bacteria 2352
625 Ga0501034_0263481 3300049571 Bacteria 1666
626 Ga0501034_0295917 3300049571 Bacteria 1556
627 Ga0501036_0006023 3300049572 Bacteria 9830
628 Ga0501036_0190174 3300049572 Bacteria 1727
629 Ga0501037_0001187 3300049573 Bacteria 19240
630 Ga0501037_0035912 3300049573 Bacteria 3652
631 Ga0501038_0018527 3300049574 Bacteria 6286
632 Ga0501038_0064453 3300049574 Bacteria 3124
633 Ga0501038_0243949 3300049574 Bacteria 1425
634 Ga0501039_0177062 3300049575 Bacteria 1677
635 Ga0501039_0181280 3300049575 Bacteria 1656
636 Ga0501042_0011666 3300049578 Bacteria 5938
637 Ga0501043_0001872 3300049579 Bacteria 18031
638 Ga0501043_0005568 3300049579 Bacteria 10150
639 Ga0501043_0326338 3300049579 Bacteria 1169
640 Ga0501046_0010184 3300049580 Bacteria 8089
641 Ga0501046_0120583 3300049580 Bacteria 1995
642 Ga0501047_0007248 3300049581 Bacteria 10425
643 Ga0501047_0010049 3300049581 Bacteria 8944
644 Ga0501047_0114621 3300049581 Bacteria 2577
645 Ga0501047_0229953 3300049581 Bacteria 1708
646 Ga0501047_0587082 3300049581 Bacteria 936
647 Ga0501048_0000039 3300049582 Bacteria 63521
648 Ga0501048_0207496 3300049582 Bacteria 1389
649 Ga0501067_0006870 3300049583 Bacteria 6313
650 Ga0501067_0099590 3300049583 Bacteria 1614
651 Ga0501068_0003533 3300049584 Bacteria 8445
652 Ga0501068_0005646 3300049584 Bacteria 6853
653 Ga0501069_0015022 3300049585 Bacteria 4147
654 Ga0501069_0018212 3300049585 Bacteria 3788
655 Ga0501072_0385604 3300049588 Bacteria 1112
656 Ga0501073_0138955 3300049589 Bacteria 1683
657 Ga0501073_0197021 3300049589 Bacteria 1393
658 Ga0501074_0127621 3300049590 Bacteria 1820
659 Ga0501074_0451795 3300049590 Bacteria 911
660 Ga0501076_0196459 3300049592 Bacteria 1647
661 Ga0501079_0366796 3300049741 Bacteria 1129
662 Ga0501080_0000022 3300049742 Bacteria 90630
663 Ga0501080_0006329 3300049742 Bacteria 10625
664 Ga0501080_0254760 3300049742 Bacteria 1600
665 Ga0501080_0487711 3300049742 Bacteria 1102
666 Ga0501080_0580421 3300049742 Bacteria 996
667 Ga0501083_0015876 3300049744 Bacteria 5271
668 Ga0501083_0040545 3300049744 Bacteria 3160
669 Ga0501035_0000655 3300049822 Bacteria 38162
670 Ga0501035_0020097 3300049822 Bacteria 6133
671 Ga0501044_0000255 3300049823 Bacteria 67530
672 Ga0501044_0003019 3300049823 Bacteria 19039
673 Ga0501044_0009346 3300049823 Bacteria 10692
674 Ga0501044_0027373 3300049823 Bacteria 6026
675 Ga0501044_0028439 3300049823 Bacteria 5901
676 Ga0501044_0041488 3300049823 Bacteria 4791
677 Ga0501044_0228464 3300049823 Bacteria 1809
678 Ga0501045_0036447 3300049824 Bacteria 3571
679 Ga0501045_0060639 3300049824 Bacteria 2773
680 nmdc:mga00v17_30150_c1 3300050491 Bacteria 3190
681 nmdc:mga0yw44_251197_c1 3300050492 Bacteria 1177
682 nmdc:mga06z11_127471_c1 3300050494 Bacteria 1426
683 nmdc:mga06z11_40821_c1 3300050494 Bacteria 2318
684 nmdc:mga06z11_8072_c1 3300050494 Bacteria 4367
685 nmdc:mga04h51_43209_c1 3300050495 Bacteria 1482
686 nmdc:mga07m45_21541_c1 3300050496 Bacteria 3511
687 nmdc:mga07m45_24981_c1 3300050496 Bacteria 3275
688 nmdc:mga05p37_786_c1 3300050507 Bacteria 35281
689 nmdc:mga09592_4641_c1 3300050508 Bacteria 11128
690 nmdc:mga0qj67_4_c1 3300050509 Bacteria 176711
691 nmdc:mga0qj67_537_c1 3300050509 Bacteria 25810
692 nmdc:mga06r32_121_c1 3300050510 Bacteria 55968
693 nmdc:mga08y16_13767_c1 3300050511 Bacteria 8515
694 nmdc:mga08y16_224205_c1 3300050511 Bacteria 1945
695 nmdc:mga08y16_309_c1 3300050511 Bacteria 44098
696 nmdc:mga08y16_3336_c1 3300050511 Bacteria 16629
697 nmdc:mga08y16_33889_c1 3300050511 Bacteria 5364
698 nmdc:mga0n895_104_c1 3300050512 Bacteria 49584
699 nmdc:mga0n895_409756_c1 3300050512 Bacteria 1371
700 nmdc:mga0n895_670434_c1 3300050512 Bacteria 1034
701 nmdc:mga0rr50_2087_c1 3300050513 Bacteria 11168
702 nmdc:mga0rr50_23711_c1 3300050513 Bacteria 4238
703 nmdc:mga08x19_178012_c1 3300050514 Bacteria 1451
704 nmdc:mga0a205_121530_c1 3300050515 Bacteria 2511
705 nmdc:mga0a205_94045_c1 3300050515 Bacteria 2896
706 nmdc:mga0sz30_77639_c1 3300050516 Bacteria 1435
707 Ga0495601_0000225 3300053077 Bacteria 30328
708 Ga0495601_0011337 3300053077 Bacteria 5328
709 Ga0495601_0066002 3300053077 Bacteria 2303
710 Ga0495601_0283737 3300053077 Bacteria 1079
711 Ga0495612_0000405 3300053078 Bacteria 17265
712 Ga0495595_0000616 3300053084 Bacteria 13570
713 Ga0495595_0003158 3300053084 Bacteria 6535
714 Ga0495595_0130032 3300053084 Bacteria 1230
715 Ga0495619_0000360 3300053085 Bacteria 31637
716 Ga0495619_0001284 3300053085 Bacteria 16486
717 Ga0495619_0004668 3300053085 Bacteria 8728
718 Ga0495619_0236589 3300053085 Bacteria 1266
719 Ga0495619_0285443 3300053085 Bacteria 1143
720 Ga0500646_0103030 3300053090 Bacteria 898
721 Ga0500651_0104067 3300053093 Bacteria 1738
722 Ga0500566_0001157 3300053094 Bacteria 15353
723 Ga0500562_072749 3300053108 Bacteria 928
724 Ga0500593_002128 3300053117 Bacteria 7200
725 Ga0500595_000003 3300053119 Bacteria 419332
726 Ga0500642_0064805 3300053130 Bacteria 1650
727 Ga0500604_0081051 3300053151 Bacteria 1048
728 Ga0500616_0000002 3300053153 Bacteria 1611257
729 Ga0500616_0077288 3300053153 Bacteria 1681
730 Ga0501084_0012665 3300054114 Bacteria 6988
731 Ga0501084_0105557 3300054114 Bacteria 2366
732 Ga0501082_0022695 3300060353 Bacteria 5404
733 Ga0501082_0032432 3300060353 Bacteria 4506
734 Ga0501082_0225986 3300060353 Bacteria 1629
735 Ga0466962_0069631 3300061719 Bacteria 1680
736 Ga0466962_0115370 3300061719 Bacteria 1294
737 2643754966 2643221547 Bacteria 4740017
738 JGI24744J21845_10001065
739 JGI24034J26672_10011273
740 Ga0070658_10045516
741 Ga0070658_10294924
742 Ga0070676_10110307
743 Ga0070683_100071308
744 Ga0070683_100281939
745 Ga0070690_100010169
746 Ga0070690_100046888
747 Ga0070670_100003926
748 Ga0070677_10001233
749 Ga0070666_10013033
750 Ga0070680_100025931
751 Ga0070680_100075581
752 Ga0070680_100320522
753 Ga0070682_100031300
754 Ga0070682_100211783
755 Ga0068868_100043832
756 Ga0070660_100021115
757 Ga0070687_100014500
758 Ga0070661_100027394
759 Ga0070661_100135390
760 Ga0070692_10286820
761 Ga0070675_100149359
762 Ga0070671_100067499
763 Ga0070674_100058922
764 Ga0070673_100022646
765 Ga0070673_100368996
766 Ga0070688_100015921
767 Ga0070659_100065802
768 Ga0070659_100078059
769 Ga0070667_100049507
770 Ga0070667_100066283
771 Ga0070667_100143734
772 Ga0070709_10036741
773 Ga0070709_10039706
774 Ga0070709_10089638
775 Ga0070714_100038357
776 Ga0070714_100105676
777 Ga0070713_100233617
778 Ga0070713_100427347
779 Ga0070710_10127166
780 Ga0070710_10180439
781 Ga0070711_100285363
782 Ga0070705_100235401
783 Ga0070705_100409269
784 Ga0070700_100049650
785 Ga0070663_100016023
786 Ga0070663_100147422
787 Ga0070678_100041566
788 Ga0070681_10048764
789 Ga0070681_10113759
790 Ga0070681_10219210
791 Ga0070681_10221895
792 Ga0070681_10363512
793 Ga0070681_10590887
794 Ga0068867_100100804
795 Ga0068867_100119241
796 Ga0070685_10039316
797 Ga0070698_100313360
798 Ga0070679_100045107
799 Ga0070679_100074695
800 Ga0070679_100098270
801 Ga0070679_100123213
802 Ga0070697_100195748
803 Ga0070672_100107008
804 Ga0070686_100121230
805 Ga0070693_100132926
806 Ga0070693_100264491
807 Ga0070704_100543810
808 Ga0068855_100077098
809 Ga0068855_100095501
810 Ga0070664_100057416
811 Ga0070664_100158450
812 Ga0068857_100002095
813 Ga0068857_100137309
814 Ga0068856_100046052
815 Ga0068856_100046477
816 Ga0070702_100080387
817 Ga0068852_100106647
818 Ga0068859_100524464
819 Ga0068864_100001534
820 Ga0068864_100160002
821 Ga0068866_10002030
822 Ga0068866_10018406
823 Ga0068851_10089551
824 Ga0068870_10013282
825 Ga0068863_100135924
826 Ga0068858_100221902
827 Ga0068860_100348153
828 Ga0068860_100622998
829 Ga0068862_100004584
830 Ga0081455_10008649
831 Ga0081455_10024396
832 Ga0070717_10002945
833 Ga0070717_10041442
834 Ga0070717_10235308
835 Ga0075432_10004302
836 Ga0075432_10027156
837 Ga0070716_100047671
838 Ga0070716_100075159
839 Ga0070712_100320766
840 Ga0075362_10102872
841 Ga0075367_10065237
842 Ga0075367_10079858
843 Ga0075367_10206671
844 Ga0075369_10012816
845 Ga0075427_10000953
846 Ga0097621_100013993
847 Ga0097621_100015096
848 Ga0075370_10037259
849 Ga0075370_10194263
850 Ga0075370_10262368
851 Ga0068871_100018875
852 Ga0068871_100056437
853 Ga0075428_100004320
854 Ga0075430_100000275
855 Ga0075430_100000426
856 Ga0075431_100020560
857 Ga0075433_10000029
858 Ga0075433_10549952
859 Ga0075434_100000208
860 Ga0075434_100001333
861 Ga0075434_100286635
862 Ga0075429_100000734
863 Ga0068865_100099074
864 Ga0068865_100281288
865 Ga0075436_100029960
866 Ga0075436_100188824
867 Ga0075436_100315984
868 Ga0097620_100524507
869 Ga0075435_100046941
870 Ga0075435_100095474
871 Ga0105251_10005445
872 Ga0105240_10069867
873 Ga0105240_10109147
874 Ga0105240_10853712
875 Ga0111539_10000345
876 Ga0111539_10108778
877 Ga0111539_10261937
878 Ga0105247_10029287
879 Ga0105247_10288663
880 Ga0114129_10003572
881 Ga0105243_10116370
882 Ga0105243_10156681
883 Ga0105243_10242456
884 Ga0105241_10012966
885 Ga0105242_10109212
886 Ga0105242_10181924
887 Ga0105242_10206864
888 Ga0105237_10034469
889 Ga0105237_10067254
890 Ga0105237_10100286
891 Ga0105238_10025119
892 Ga0105238_10028682
893 Ga0105238_10136040
894 Ga0105238_10475692
895 Ga0105249_10119394
896 Ga0105239_10109546
897 Ga0105246_10112198
898 Ga0157340_1001339
899 Ga0157339_1003319
900 Ga0157316_1006246
901 Ga0157373_10164715
902 Ga0157371_10238339
903 Ga0157370_10056299
904 Ga0157370_10058433
905 Ga0157370_10202959
906 Ga0157369_10834923
907 Ga0157369_11094281
908 Ga0157374_10272671
909 Ga0157378_10069624
910 Ga0163162_11221534
911 Ga0163163_10001710
912 Ga0157380_10065474
913 Ga0182008_10096947
914 Ga0157377_10003804
915 Ga0157379_10190381
916 Ga0157379_10380040
917 Ga0157376_10008671
918 Ga0157376_10037869
919 Ga0157376_10214471
920 Ga0163161_10001476
921 Ga0163161_10065350
922 Ga0213876_10047692
923 Ga0224572_1001585
924 Ga0228598_1014536
925 Ga0207673_1000232
926 Ga0207697_10002797
927 Ga0207653_10014160
928 Ga0207682_10000056
929 Ga0207692_10011767
930 Ga0207692_10032532
931 Ga0207692_10103770
932 Ga0207692_10193538
933 Ga0207710_10001206
934 Ga0207710_10062498
935 Ga0207680_10006395
936 Ga0207647_10011486
937 Ga0207685_10052223
938 Ga0207699_10016764
939 Ga0207699_10047203
940 Ga0207699_10187115
941 Ga0207645_10000249
942 Ga0207645_10076117
943 Ga0207643_10000187
944 Ga0207705_10322986
945 Ga0207705_10340141
946 Ga0207705_10468241
947 Ga0207654_10141539
948 Ga0207654_10239987
949 Ga0207707_10035389
950 Ga0207707_10038851
951 Ga0207695_10169713
952 Ga0207695_10354509
953 Ga0207695_10571334
954 Ga0207671_10199873
955 Ga0207671_10381922
956 Ga0207693_10004402
957 Ga0207693_10027666
958 Ga0207693_10308346
959 Ga0207663_10007931
960 Ga0207663_10046657
961 Ga0207660_10007537
962 Ga0207660_10009967
963 Ga0207662_10082578
964 Ga0207662_10347431
965 Ga0207657_10012303
966 Ga0207657_10036760
967 Ga0207657_10046279
968 Ga0207649_10000852
969 Ga0207649_10063353
970 Ga0207649_10147106
971 Ga0207652_10078097
972 Ga0207652_10100350
973 Ga0207652_10250411
974 Ga0207694_10018888
975 Ga0207694_10174373
976 Ga0207694_10284615
977 Ga0207659_10001325
978 Ga0207687_10018841
979 Ga0207687_10028412
980 Ga0207687_10168823
981 Ga0207700_10000623
982 Ga0207700_10136114
983 Ga0207664_10068339
984 Ga0207664_10550414
985 Ga0207644_10008645
986 Ga0207644_10057454
987 Ga0207644_10118703
988 Ga0207690_10001793
989 Ga0207706_10017303
990 Ga0207706_10041807
991 Ga0207686_10000898
992 Ga0207709_10003144
993 Ga0207709_10178383
994 Ga0207670_10018372
995 Ga0207704_10031431
996 Ga0207665_10001669
997 Ga0207665_10353646
998 Ga0207691_10042188
999 Ga0207691_10053344
1000 Ga0207691_10352009
1001 Ga0207711_10014151
1002 Ga0207711_10041241
1003 Ga0207711_10228839
1004 Ga0207689_10007833
1005 Ga0207661_10002538
1006 Ga0207679_10000187
1007 Ga0207667_10016532
1008 Ga0207667_10082569
1009 Ga0207651_10127001
1010 Ga0207712_10006029
1011 Ga0207640_10071065
1012 Ga0207658_10057325
1013 Ga0207658_10065697
1014 Ga0207658_10095816
1015 Ga0207677_10372145
1016 Ga0207677_10714629
1017 Ga0207703_10087739
1018 Ga0207639_10089022
1019 Ga0207678_10007624
1020 Ga0207678_10015613
1021 Ga0207678_10043789
1022 Ga0207702_10054324
1023 Ga0207702_10830076
1024 Ga0207641_10143683
1025 Ga0207641_10640019
1026 Ga0207648_10001031
1027 Ga0207648_10174077
1028 Ga0207676_10134624
1029 Ga0207676_10333146
1030 Ga0207674_10000686
1031 Ga0207674_10180152
1032 Ga0207674_10694744
1033 Ga0207675_100048378
1034 Ga0207683_10000727
1035 Ga0207683_10004115
1036 Ga0207683_10041162
1037 Ga0207698_10672089
1038 Ga0209970_1002946
1039 Ga0209983_1001199
1040 Ga0209971_1001243
1041 Ga0209966_1000714
1042 Ga0209998_10064008
1043 Ga0209998_10067826
1044 Ga0209813_10011774
1045 Ga0209974_10010473
1046 Ga0207428_10000150
1047 Ga0207428_10000360
1048 Ga0207428_10000556
1049 Ga0268266_10004404
1050 Ga0268266_10281305
1051 Ga0268266_10666268
1052 Ga0268265_10000526
1053 Ga0268264_10002038
1054 Ga0268264_10122323
1055 Ga0268264_10557975
1056 Ga0265337_1019818
1057 Ga0265336_10043542
1058 Ga0265338_10085845
1059 Ga0265338_10115103
1060 Ga0265330_10046345
1061 Ga0265332_10000812
1062 Ga0265332_10082336
1063 Ga0265325_10000030
1064 Ga0265325_10017849
1065 Ga0265325_10108720
1066 Ga0265340_10002134
1067 Ga0265340_10005177
1068 Ga0265340_10065466
1069 Ga0265340_10099641
1070 Ga0265339_10000669
1071 Ga0265339_10008520
1072 Ga0265339_10077030
1073 Ga0265331_10194498
1074 Ga0307513_10143091
1075 Ga0265313_10003681
1076 Ga0265313_10006110
1077 Ga0265313_10030904
1078 Ga0265313_10082256
1079 Ga0316579_10027180
1080 Ga0265314_10004041
1081 Ga0265314_10009643
1082 Ga0265314_10030010
1083 Ga0265314_10249456
1084 Ga0265342_10000281
1085 Ga0265342_10004069
1086 Ga0265342_10110551
1087 Ga0307415_100250089
1088 Ga0316583_10000116
1089 Ga0373930_0000129
1090 Ga0373930_0003062
1091 Ga0373948_0007773
1092 Ga0373950_0000820
1093 Ga0373959_0001750
1094 Ga0373959_0001950
1095 Ga0373938_0002546
1096 Ga0373938_0006708
1097 Ga0373926_0006649
1098 Ga0373926_0023880
1099 Ga0373926_0032415
1100 Ga0373928_0000375
1101 Ga0373929_0000146
1102 Ga0373929_0001869
1103 Ga0373940_0008049
1104 Ga0373940_0058780
1105 Ga0373944_0005274
1106 Ga0373944_0006918
1107 Ga0373944_0015430
1108 Ga0373949_0010201
1109 Ga0373951_0000214
1110 Ga0373952_0001494
1111 Ga0373923_0000187
1112 Ga0373932_0000473
1113 Ga0373932_0000584
1114 Ga0373939_0000602
1115 Ga0373939_0003756
1116 Ga0373941_0004906
1117 Ga0373945_0000395
1118 Ga0373945_0003626
1119 Ga0373945_0040494
1120 Ga0373953_0006040
1121 Ga0373954_0003581
1122 Ga0373954_0006846
1123 Ga0373954_0103932
1124 Ga0373954_0104203
1125 Ga0373956_0003765
1126 Ga0373956_0040778
1127 Ga0373957_0019755
1128 Ga0373960_0001283
1129 Ga0373943_0003892
1130 Ga0373943_0005034
1131 Ga0373943_0008480
1132 Ga0373943_0031860
1133 Ga0373946_0024257
1134 Ga0373946_0074135
1135 Ga0373955_0024147
1136 Ga0373955_0070304
1137 Ga0373955_0083295
1138 Ga0373955_0101614
1139 Ga0373942_0008104
1140 Ga0373942_0017422
1141 Ga0373961_0000749
1142 Ga0373924_0022179
1143 Ga0373931_0109680
1144 Ga0373935_0004894
1145 Ga0373935_0179646
1146 Ga0373927_0006438
1147 Ga0373927_0064286
1148 Ga0373927_0081759
1149 Ga0373927_0095756
1150 Ga0373927_0283154
1151 Ga0373933_0001082
1152 Ga0373933_0008751
1153 Ga0373933_0009814
1154 Ga0373933_0035906
1155 Ga0373933_0173498
1156 Ga0373947_0001922
1157 Ga0373947_0016251
1158 Ga0373947_0040243
1159 Ga0373947_0069790
1160 Ga0373937_0002931
1161 Ga0373937_0007191
1162 Ga0373937_0124163
1163 Ga0373925_0001686
1164 Ga0373925_0009753
1165 Ga0373925_0050437
1166 Ga0395899_0006936
1167 Ga0395899_0257309
1168 Ga0395900_0012710
1169 Ga0395900_0122362
1170 Ga0395898_0012047
1171 Ga0436364_0168099
1172 Ga0436364_1441472
1173 Ga0395901_0007158
1174 Ga0395901_0109021
1175 Ga0436365_0769383
1176 Ga0436365_0983586
1177 Ga0436362_0869149
1178 Ga0451791_0612931
1179 Ga0451802_1957638
1180 Ga0451807_2314777
1181 Ga0451841_0706006
1182 Ga0439463_012770
1183 Ga0439446_0063715
1184 Ga0439459_0015823
1185 Ga0451577_0127376
1186 Ga0466965_0113074
1187 Ga0466965_0299891
1188 Ga0466963_0370252
1189 Ga0451576_0018136
1190 Ga0466967_0094290
1191 Ga0495603_0001272
1192 Ga0495603_0082254
1193 Ga0495629_0000026
1194 Ga0495629_0015488
1195 Ga0495629_0036259
1196 Ga0495638_0013371
1197 Ga0495641_0018469
1198 Ga0495651_0017093
1199 Ga0495651_0220127
1200 Ga0495651_0256863
1201 Ga0495651_0301221
1202 Ga0495653_0017706
1203 Ga0495653_0227717
1204 Ga0495653_0239184
1205 Ga0495580_0013840
1206 Ga0495580_0068647
1207 Ga0495582_0014383
1208 Ga0495639_0006240
1209 Ga0495639_0009341
1210 Ga0495639_0024784
1211 Ga0495662_0002967
1212 Ga0495662_0086545
1213 Ga0495664_0002862
1214 Ga0495664_0027670
1215 Ga0495584_0040128
1216 Ga0495585_0002078
1217 Ga0495594_0030525
1218 Ga0495607_0004674
1219 Ga0495606_0169337
1220 Ga0495608_0003087
1221 Ga0495608_0041050
1222 Ga0495608_0056482
1223 Ga0495608_0105750
1224 Ga0495616_0038691
1225 Ga0495618_0015090
1226 Ga0495628_0019066
1227 Ga0495628_0073293
1228 Ga0495628_0090285
1229 Ga0495630_0026726
1230 Ga0495630_0087010
1231 Ga0495644_0000312
1232 Ga0495666_0001337
1233 Ga0495652_0011840
1234 Ga0495652_0022671
1235 Ga0495652_0026811
1236 Ga0495652_0101928
1237 Ga0495665_0006056
1238 Ga0495665_0127196
1239 Ga0495640_0006356
1240 Ga0495586_0008435
1241 Ga0495586_0008693
1242 Ga0495587_0001048
1243 Ga0495587_0021036
1244 Ga0495587_0199300
1245 Ga0495598_0031147
1246 Ga0495609_0020209
1247 Ga0495645_0002634
1248 Ga0495645_0014085
1249 Ga0495645_0087093
1250 Ga0495645_0113346
1251 Ga0495622_0016292
1252 Ga0495622_0092083
1253 Ga0495633_0001295
1254 Ga0495667_0003431
1255 Ga0495667_0011221
1256 Ga0495667_0014036
1257 Ga0495667_0039048
1258 Ga0495656_0000338
1259 Ga0495611_0102403
1260 Ga0495611_0162183
1261 Ga0495635_0048853
1262 Ga0495635_0118183
1263 Ga0495635_0144080
1264 Ga0495661_0113218
1265 Ga0495588_0017196
1266 Ga0495588_0030675
1267 Ga0495657_0023571
1268 Ga0495657_0051023
1269 Ga0495599_0191987
1270 Ga0495599_0405502
1271 Ga0495623_0000394
1272 Ga0495623_0030999
1273 Ga0495623_0031891
1274 Ga0495646_0002685
1275 Ga0495646_0024348
1276 Ga0495647_0002213
1277 Ga0495647_0003379
1278 Ga0495647_0005918
1279 Ga0495658_0054247
1280 Ga0495669_0183046
1281 Ga0495613_0040648
1282 Ga0495613_0106636
1283 Ga0495613_0122963
1284 Ga0495624_0038263
1285 Ga0495670_0000232
1286 Ga0495600_0002491
1287 Ga0495600_0011998
1288 Ga0495600_0014421
1289 Ga0495600_0019514
1290 Ga0495581_0021531
1291 Ga0495581_0027479
1292 Ga0495581_0150574
1293 Ga0495604_0009413
1294 Ga0495604_0010035
1295 Ga0495604_0105379
1296 Ga0495674_0009887
1297 Ga0495674_0015538
1298 Ga0495674_0059871
1299 Ga0495676_0117383
1300 Ga0495676_0167932
1301 Ga0495680_0008836
1302 Ga0495680_0009493
1303 Ga0495680_0015460
1304 Ga0495680_0031980
1305 Ga0495675_0001159
1306 Ga0495675_0030865
1307 Ga0495675_0058767
1308 Ga0495675_0060449
1309 Ga0495684_0018338
1310 Ga0495684_0066340
1311 Ga0495593_0060211
1312 Ga0495593_0219300
1313 Ga0495602_0001877
1314 Ga0495602_0005817
1315 Ga0495602_0012468
1316 Ga0495602_0025567
1317 Ga0495602_0065563
1318 Ga0495614_0032344
1319 Ga0496100_0080900
1320 Ga0496101_0003343
1321 Ga0496101_0356708
1322 Ga0496101_0469356
1323 Ga0496102_0056996
1324 Ga0496102_0401554
1325 Ga0496103_0000963
1326 Ga0496103_0072687
1327 Ga0496104_0000065
1328 Ga0496104_0066037
1329 Ga0496104_0335672
1330 Ga0496104_0374549
1331 Ga0496105_0000170
1332 Ga0496105_0012481
1333 Ga0496106_0007782
1334 Ga0496106_0428517
1335 Ga0496107_0077413
1336 Ga0496107_0156602
1337 Ga0496108_0001681
1338 Ga0496108_0009662
1339 Ga0496108_0012623
1340 Ga0496108_0305784
1341 Ga0496109_0009805
1342 Ga0496109_0010944
1343 Ga0496109_0042701
1344 Ga0496111_0002766
1345 Ga0496111_0029265
1346 Ga0496111_0065887
1347 Ga0496112_0021287
1348 Ga0496112_0072154
1349 Ga0496113_0000329
1350 Ga0496113_0054565
1351 Ga0496114_0005283
1352 Ga0496115_0001117
1353 Ga0496115_0030109
1354 Ga0496115_0051087
1355 Ga0496121_0062764
1356 Ga0501032_0039459
1357 Ga0501033_0016861
1358 Ga0501033_0279975
1359 Ga0501034_0009382
1360 Ga0501034_0018508
1361 Ga0501034_0144973
1362 Ga0501034_0263481
1363 Ga0501034_0295917
1364 Ga0501036_0006023
1365 Ga0501036_0190174
1366 Ga0501037_0001187
1367 Ga0501037_0035912
1368 Ga0501038_0018527
1369 Ga0501038_0064453
1370 Ga0501038_0243949
1371 Ga0501039_0177062
1372 Ga0501039_0181280
1373 Ga0501042_0011666
1374 Ga0501043_0001872
1375 Ga0501043_0005568
1376 Ga0501043_0326338
1377 Ga0501046_0010184
1378 Ga0501046_0120583
1379 Ga0501047_0007248
1380 Ga0501047_0010049
1381 Ga0501047_0114621
1382 Ga0501047_0229953
1383 Ga0501047_0587082
1384 Ga0501048_0000039
1385 Ga0501048_0207496
1386 Ga0501067_0006870
1387 Ga0501067_0099590
1388 Ga0501068_0003533
1389 Ga0501068_0005646
1390 Ga0501069_0015022
1391 Ga0501069_0018212
1392 Ga0501072_0385604
1393 Ga0501073_0138955
1394 Ga0501073_0197021
1395 Ga0501074_0127621
1396 Ga0501074_0451795
1397 Ga0501076_0196459
1398 Ga0501079_0366796
1399 Ga0501080_0000022
1400 Ga0501080_0006329
1401 Ga0501080_0254760
1402 Ga0501080_0487711
1403 Ga0501080_0580421
1404 Ga0501083_0015876
1405 Ga0501083_0040545
1406 Ga0501035_0000655
1407 Ga0501035_0020097
1408 Ga0501044_0000255
1409 Ga0501044_0003019
1410 Ga0501044_0009346
1411 Ga0501044_0027373
1412 Ga0501044_0028439
1413 Ga0501044_0041488
1414 Ga0501044_0228464
1415 Ga0501045_0036447
1416 Ga0501045_0060639
1417 nmdc:mga00v17_30150_c1
1418 nmdc:mga0yw44_251197_c1
1419 nmdc:mga06z11_127471_c1
1420 nmdc:mga06z11_40821_c1
1421 nmdc:mga06z11_8072_c1
1422 nmdc:mga04h51_43209_c1
1423 nmdc:mga07m45_21541_c1
1424 nmdc:mga07m45_24981_c1
1425 nmdc:mga05p37_786_c1
1426 nmdc:mga09592_4641_c1
1427 nmdc:mga0qj67_4_c1
1428 nmdc:mga0qj67_537_c1
1429 nmdc:mga06r32_121_c1
1430 nmdc:mga08y16_13767_c1
1431 nmdc:mga08y16_224205_c1
1432 nmdc:mga08y16_309_c1
1433 nmdc:mga08y16_3336_c1
1434 nmdc:mga08y16_33889_c1
1435 nmdc:mga0n895_104_c1
1436 nmdc:mga0n895_409756_c1
1437 nmdc:mga0n895_670434_c1
1438 nmdc:mga0rr50_2087_c1
1439 nmdc:mga0rr50_23711_c1
1440 nmdc:mga08x19_178012_c1
1441 nmdc:mga0a205_121530_c1
1442 nmdc:mga0a205_94045_c1
1443 nmdc:mga0sz30_77639_c1
1444 Ga0495601_0000225
1445 Ga0495601_0011337
1446 Ga0495601_0066002
1447 Ga0495601_0283737
1448 Ga0495612_0000405
1449 Ga0495595_0000616
1450 Ga0495595_0003158
1451 Ga0495595_0130032
1452 Ga0495619_0000360
1453 Ga0495619_0001284
1454 Ga0495619_0004668
1455 Ga0495619_0236589
1456 Ga0495619_0285443
1457 Ga0500646_0103030
1458 Ga0500651_0104067
1459 Ga0500566_0001157
1460 Ga0500562_072749
1461 Ga0500593_002128
1462 Ga0500595_000003
1463 Ga0500642_0064805
1464 Ga0500604_0081051
1465 Ga0500616_0000002
1466 Ga0500616_0077288
1467 Ga0501084_0012665
1468 Ga0501084_0105557
1469 Ga0501082_0022695
1470 Ga0501082_0032432
1471 Ga0501082_0225986
1472 Ga0466962_0069631
1473 Ga0466962_0115370
1474 2643754966

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14693

Ribosomal_TL5_C

Ribosomal protein TL5, C-terminal domain

98

183

0.98

PF01386

Ribosomal_L25p

Ribosomal L25p family

3

90

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ysi-assembly1.cif.gz_R acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9498 5 97
6dnc-assembly1.cif.gz_Z e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon 0.9429 6 97
7m4v-assembly1.cif.gz_U a. baumannii ribosome-eravacycline complex: 50s 0.9406 5 97
6ogg-assembly1.cif.gz_v 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). 0.9377 4 97
7unw-assembly1.cif.gz_X pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9356 6 187
ID Description Score Start End Superfamily
af_K7MM89_88_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9371 100 186 2.170.120.20
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9333 98 180 2.170.120.20
af_P9WHB5_5_98_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9286 3 97 2.40.240.10
af_F4JPA3_178_267_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9239 103 187 2.170.120.20
af_A0A0P0W059_2_141_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9228 4 100 2.40.240.10
ID Description Score Start End GO Terms
AF-A0A529L0H0-F1-model_v4 50S ribosomal protein L25 0.9768 1 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7W8EQU1-F1-model_v4 50S ribosomal protein L25 0.9749 1 98 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A4Q2XX94-F1-model_v4 50S ribosomal protein L25 0.9679 1 110 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A5J5I0L3-F1-model_v4 Large ribosomal subunit protein bL25 (General stress protein CTC) 0.9657 1 194 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7W8EQU1-F1-model_v4 50S ribosomal protein L25 0.9653 1 98 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Map