F478381

General Info

Members Datasets Scaffolds Average Seq Length
738 553 1476 340

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100076619|Ga0075435_1000766192
Length 363
Sequence MPLWTRRSKDVVTVEERNMIGVAVVGYGYWGPNLVRNFWDTPGARLVSVCDLRKERLAGVQGRYPAVEITDNFSDVLADPRVDAVAIATPVSSHFELAMRALQAGKHVFVEKPMAPTTEQALRLVDEAHRRGLVLAVDHTFVHTGAVKKMRELVDSSLGDVYYYDSVRVNLGLFQHDVSVVWDLAVHDLSIMDYVLPQKPVAVSAMGVSHVAGEPENIAYLNLFYENNLIAHVHVNWLAPVKVRRTLVGGSRKMIVYDDLEPSEKIKVYDKGITLNGDPVKNESKVYQMRVGYRTGDMWAPTLDMREALGVELREFVSCVEQNTAPVADGHAGLRVVQVLEAATESLAQRGRVIDLQPVSVTV

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
84 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
90 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
91 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
158 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
170 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
171 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
263 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
272 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
273 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
274 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
275 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
276 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
277 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
278 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
279 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
280 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
281 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
282 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
283 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
284 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
285 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
286 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
287 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
288 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
289 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
290 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
291 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
292 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
293 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
294 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
295 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
296 2519899620 Rhizobium sp. Pop5 Isolate Nodule
297 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
298 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
299 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
300 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
301 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
302 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
303 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
304 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
305 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
306 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
307 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
308 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
309 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
310 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
311 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
312 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
313 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
314 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
315 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
316 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
317 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
318 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
319 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
320 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
321 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
322 2643221607 Rhizobium sp. Root73 Isolate Unclassified
323 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
324 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
325 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
326 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
327 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
328 2643221718 Rhizobium sp. Root268 Isolate Unclassified
329 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
330 2718217882 Rhizobium sp. N741 Isolate Nodule
331 2718217927 Rhizobium sp. N324 Isolate Nodule
332 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
333 2718218009 Rhizobium sp. N561 Isolate Nodule
334 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
335 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
336 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
337 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
338 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
339 2718218363 Rhizobium sp. N113 Isolate Nodule
340 2718218365 Rhizobium sp. N731 Isolate Nodule
341 2718218366 Rhizobium sp. N621 Isolate Nodule
342 2718218423 Rhizobium sp. N941 Isolate Nodule
343 2721755514 Rhizobium sp. N6212 Isolate Nodule
344 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
345 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
346 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
347 2721755809 Rhizobium sp. N541 Isolate Nodule
348 2721755810 Rhizobium sp. N871 Isolate Nodule
349 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
350 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
351 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
352 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
353 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
354 2728369365 Rhizobium sp. N1341 Isolate Nodule
355 2728369397 Rhizobium sp. N1314 Isolate Nodule
356 2738541293 Rhizobium sp. GV031 Isolate Unclassified
357 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
358 2738543024 Aminobacter sp. AP02 Isolate Unclassified
359 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
360 2791355256 Rhizobium sp. M10 Isolate Nodule
361 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
362 2791355260 Rhizobium sp. L9 Isolate Nodule
363 2791355261 Rhizobium sp. J15 Isolate Nodule
364 2791355262 Rhizobium sp. M1 Isolate Nodule
365 2791355263 Rhizobium chutanense C5 Isolate Nodule
366 2791355264 Rhizobium sp. S9 Isolate Nodule
367 2791355265 Rhizobium sp. H4 Isolate Nodule
368 2791355266 Rhizobium sp. L43 Isolate Nodule
369 2791355267 Rhizobium sp. L18 Isolate Nodule
370 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
371 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
372 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
373 2802429633 Rhizobium anhuiense J3 Isolate Nodule
374 2802429634 Rhizobium anhuiense S10 Isolate Nodule
375 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
376 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
377 2802429637 Rhizobium anhuiense C15 Isolate Nodule
378 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
379 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
380 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
381 2838048938 Rhizobium pisi 27/80 Isolate Nodule
382 2838061910 Rhizobium phaseoli L15 Isolate Nodule
383 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
384 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
385 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
386 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
387 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
388 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
389 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
390 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
391 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
392 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
393 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
394 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
395 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
396 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
397 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
398 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
399 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
400 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
401 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
402 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
403 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
404 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
405 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
406 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
407 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
408 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
409 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
410 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
411 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
412 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
413 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
414 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
415 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
416 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
417 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
418 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
419 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
420 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
421 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
422 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
423 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
424 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
425 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
426 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
427 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
428 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
429 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
430 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
431 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
432 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
433 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
434 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
435 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
436 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
437 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
438 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
439 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
440 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
441 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
442 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
443 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
444 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
445 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
446 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
447 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
448 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
449 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
450 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
451 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
452 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
453 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
454 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
455 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
456 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
457 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
458 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
459 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
460 2933599457 Rhizobium phaseoli M3 Isolate Nodule
461 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
462 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
463 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
464 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
465 2936381700 Rhizobium chutanense C16 Isolate Unclassified
466 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
467 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
468 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
469 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
470 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
471 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
472 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
473 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
474 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
475 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
476 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
477 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
478 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
479 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
480 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
481 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
482 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
483 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
484 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
485 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
486 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
487 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
488 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
489 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
490 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
491 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
492 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
493 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
494 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
495 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
496 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
497 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
498 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
499 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
500 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
501 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
502 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
503 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
504 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
505 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
506 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
507 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
508 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
509 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
510 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
511 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
512 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
513 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
514 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
515 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
516 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
517 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
518 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
519 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
520 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
521 2996893221 Rhizobium sp. R635 Isolate Nodule
522 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
523 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
524 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
525 8005275841 Rhizobium sp. N4311 Isolate Nodule
526 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
527 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
528 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
529 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
530 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
531 8005382845 Rhizobium sp. R634 Isolate Nodule
532 8005395548 Rhizobium sp. R339 Isolate Nodule
533 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
534 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
535 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
536 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
537 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
538 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
539 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
540 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
541 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
542 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
543 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
544 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
545 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
546 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
547 8018176218 Rhizobium sp. N122 Isolate Nodule
548 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
549 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
550 8024501048 Rhizobium sp. H4 Isolate Nodule
551 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
552 8056382006 Rhizobium croatiense 13T Isolate Nodule
553 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.65
Metatranscriptomes 0
Isolates 38.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.12
Nodule 33.33
Rhizoplane 1.36
Rhizosphere 39.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100076619 3300007076 Bacteria 2741
2 JGI25156J39149_1000184 3300002705 Bacteria 45286
3 JGI25162J39368_1000071 3300002737 Bacteria 123224
4 JGI25154J39366_1000034 3300002738 Bacteria 176764
5 JGI25158J39367_1001072 3300002739 Bacteria 4965
6 JGI25157J39369_1000137 3300002741 Bacteria 61333
7 JGI25152J39213_1000087 3300002773 Bacteria 64368
8 JGI25152J39213_1002196 3300002773 Bacteria 7601
9 JGI25152J39213_1004403 3300002773 Bacteria 4440
10 JGI25152J39213_1014873 3300002773 Bacteria 1557
11 JGI25150J39212_1000017 3300002774 Bacteria 150316
12 JGI25150J39212_1009526 3300002774 Bacteria 1841
13 JGI25159J45721_1000493 3300002987 Bacteria 18075
14 JGI25151J46595_10000007 3300003187 Bacteria 411751
15 JGI25151J46595_10000454 3300003187 Bacteria 39665
16 JGI25165J46597_1000134 3300003214 Bacteria 123225
17 JGI25153J46596_10002506 3300003215 Bacteria 10539
18 JGI25153J46596_10023276 3300003215 Bacteria 2262
19 rootH1_10142643 3300003323 Bacteria 3516
20 JGI25160J50197_1000441 3300003354 Bacteria 26017
21 JGI25160J50197_1001866 3300003354 Bacteria 10116
22 JGI25161J50226_1000540 3300003374 Bacteria 16147
23 Ga0055526_1002895 3300003771 Bacteria 11312
24 Ga0055526_1003380 3300003771 Bacteria 10172
25 Ga0055526_1003412 3300003771 Bacteria 10100
26 Ga0055526_1008207 3300003771 Bacteria 5251
27 Ga0055524_1000984 3300003775 Bacteria 17768
28 Ga0055524_1001818 3300003775 Bacteria 11696
29 Ga0055524_1031503 3300003775 Bacteria 1523
30 Ga0055528_1000264 3300003790 Bacteria 44517
31 Ga0055528_1000997 3300003790 Bacteria 18802
32 Ga0055528_1003298 3300003790 Bacteria 8203
33 Ga0055528_1008953 3300003790 Bacteria 4229
34 Ga0055528_1025418 3300003790 Bacteria 1739
35 Ga0055528_1025574 3300003790 Bacteria 1728
36 Ga0055540_1000164 3300003792 Bacteria 66539
37 Ga0055540_1003085 3300003792 Bacteria 8286
38 Ga0055531_10022016 3300003794 Bacteria 2447
39 Ga0055543_1000353 3300004625 Bacteria 31219
40 Ga0055543_1000649 3300004625 Bacteria 18453
41 Ga0065165_1002206 3300005262 Bacteria 17437
42 Ga0065715_10092871 3300005293 Bacteria 4897
43 Ga0065707_10098733 3300005295 Bacteria 3062
44 Ga0070690_100039533 3300005330 Bacteria 2980
45 Ga0070690_100095134 3300005330 Bacteria 1967
46 Ga0070670_100001675 3300005331 Bacteria 17982
47 Ga0070670_100015814 3300005331 Bacteria 6476
48 Ga0068869_100003842 3300005334 Bacteria 9265
49 Ga0068869_100018948 3300005334 Bacteria 4692
50 Ga0068868_100059546 3300005338 Bacteria 3021
51 Ga0068868_100349927 3300005338 Bacteria 1265
52 Ga0070660_100004603 3300005339 Bacteria 9543
53 Ga0070689_100092830 3300005340 Bacteria 2381
54 Ga0070687_100041820 3300005343 Bacteria 2318
55 Ga0070661_100188536 3300005344 Bacteria 1572
56 Ga0070669_100097140 3300005353 Bacteria 2217
57 Ga0070675_100002129 3300005354 Bacteria 14639
58 Ga0070675_100010137 3300005354 Bacteria 7349
59 Ga0070675_100017601 3300005354 Bacteria 5681
60 Ga0070675_100032857 3300005354 Bacteria 4201
61 Ga0070675_100056031 3300005354 Bacteria 3247
62 Ga0070675_100120170 3300005354 Bacteria 2232
63 Ga0070671_100004379 3300005355 Bacteria 11162
64 Ga0070671_100108590 3300005355 Bacteria 2330
65 Ga0070674_100018557 3300005356 Bacteria 4401
66 Ga0070673_100001438 3300005364 Bacteria 13929
67 Ga0070673_100004847 3300005364 Bacteria 8561
68 Ga0070688_100004056 3300005365 Bacteria 7600
69 Ga0070659_100037074 3300005366 Bacteria 3801
70 Ga0070659_100116639 3300005366 Bacteria 2159
71 Ga0070667_100171590 3300005367 Bacteria 1915
72 Ga0070713_100069179 3300005436 Bacteria 2976
73 Ga0070700_100113480 3300005441 Bacteria 1805
74 Ga0070700_100188958 3300005441 Bacteria 1439
75 Ga0070694_100133323 3300005444 Bacteria 1797
76 Ga0070663_100151135 3300005455 Bacteria 1780
77 Ga0070678_100031988 3300005456 Bacteria 3635
78 Ga0070678_100071776 3300005456 Bacteria 2593
79 Ga0070678_100247218 3300005456 Bacteria 1494
80 Ga0068867_100027928 3300005459 Bacteria 4060
81 Ga0068867_100055380 3300005459 Bacteria 2932
82 Ga0068867_100189824 3300005459 Bacteria 1639
83 Ga0068853_100261487 3300005539 Bacteria 1591
84 Ga0070672_100014131 3300005543 Bacteria 5651
85 Ga0070672_100096474 3300005543 Bacteria 2392
86 Ga0070686_100027881 3300005544 Bacteria 3421
87 Ga0070696_100000093 3300005546 Bacteria 44354
88 Ga0070696_100049726 3300005546 Bacteria 2913
89 Ga0070664_100011061 3300005564 Bacteria 7318
90 Ga0070664_100028405 3300005564 Bacteria 4653
91 Ga0068857_100091431 3300005577 Bacteria 2724
92 Ga0068859_100002351 3300005617 Bacteria 19236
93 Ga0068859_100027172 3300005617 Bacteria 5741
94 Ga0068864_100006914 3300005618 Bacteria 9303
95 Ga0068864_100023071 3300005618 Bacteria 5224
96 Ga0068864_100031601 3300005618 Bacteria 4493
97 Ga0068861_100007285 3300005719 Bacteria 7581
98 Ga0068861_100254879 3300005719 Bacteria 1499
99 Ga0068851_10003827 3300005834 Bacteria 6735
100 Ga0068870_10000697 3300005840 Bacteria 12866
101 Ga0068858_100109917 3300005842 Bacteria 2574
102 Ga0068858_100253540 3300005842 Bacteria 1672
103 Ga0068862_100088504 3300005844 Bacteria 2694
104 Ga0068862_100113952 3300005844 Bacteria 2376
105 Ga0081539_10023553 3300005985 Bacteria 4029
106 Ga0075365_10000145 3300006038 Bacteria 22322
107 Ga0075365_10058786 3300006038 Bacteria 2560
108 Ga0075363_100002586 3300006048 Bacteria 7449
109 Ga0075363_100080595 3300006048 Bacteria 1780
110 Ga0075362_10003013 3300006177 Bacteria 5793
111 Ga0075367_10000333 3300006178 Bacteria 16738
112 Ga0075367_10057020 3300006178 Bacteria 2322
113 Ga0075369_10012378 3300006186 Bacteria 3371
114 Ga0075369_10012465 3300006186 Bacteria 3360
115 Ga0075369_10016516 3300006186 Bacteria 2980
116 Ga0075366_10010855 3300006195 Bacteria 5126
117 Ga0075370_10001919 3300006353 Bacteria 9363
118 Ga0068871_100034830 3300006358 Bacteria 3998
119 Ga0075428_100584042 3300006844 Bacteria 1194
120 Ga0075430_100279184 3300006846 Bacteria 1382
121 Ga0075433_10182047 3300006852 Bacteria 1870
122 Ga0075434_100002676 3300006871 Bacteria 15739
123 Ga0075434_100009992 3300006871 Bacteria 8882
124 Ga0075429_100072179 3300006880 Bacteria 3006
125 Ga0068865_100008464 3300006881 Bacteria 6359
126 Ga0097620_100002351 3300006931 Bacteria 19236
127 Ga0097620_100027172 3300006931 Bacteria 5741
128 Ga0079104_1000826 3300006946 Bacteria 25791
129 Ga0111539_10001553 3300009094 Bacteria 30572
130 Ga0111539_10061057 3300009094 Bacteria 4466
131 Ga0111539_10122280 3300009094 Bacteria 3050
132 Ga0111539_10381420 3300009094 Bacteria 1641
133 Ga0114129_10095305 3300009147 Bacteria 4122
134 Ga0105243_10028489 3300009148 Bacteria 4288
135 Ga0105242_10012840 3300009176 Bacteria 6454
136 Ga0105248_10067681 3300009177 Bacteria 4010
137 Ga0105238_10043671 3300009551 Bacteria 4535
138 Ga0105238_10099623 3300009551 Bacteria 2889
139 Ga0123341_1003124 3300009765 Bacteria 14038
140 Ga0123341_1006310 3300009765 Bacteria 10715
141 Ga0123342_1006370 3300009766 Bacteria 16429
142 Ga0123342_1010170 3300009766 Bacteria 10887
143 Ga0123342_1025154 3300009766 Bacteria 3627
144 Ga0163163_10074049 3300014325 Bacteria 3396
145 Ga0157380_10003805 3300014326 Bacteria 10383
146 Ga0157380_10013344 3300014326 Bacteria 5989
147 Ga0157380_10044175 3300014326 Bacteria 3491
148 Ga0157379_10289874 3300014968 Bacteria 1490
149 Ga0163161_10133833 3300017792 Bacteria 1872
150 Ga0228711_1001389 3300022739 Bacteria 35374
151 Ga0228710_1000488 3300022740 Bacteria 50439
152 Ga0209435_100023 3300025206 Bacteria 201972
153 Ga0209436_100025 3300025208 Bacteria 93575
154 Ga0209437_100191 3300025233 Bacteria 123276
155 Ga0207425_1000018 3300025245 Bacteria 411841
156 Ga0207425_1000467 3300025245 Bacteria 25782
157 Ga0207425_1010480 3300025245 Bacteria 2255
158 Ga0207425_1019705 3300025245 Bacteria 1449
159 Ga0209646_1000080 3300025246 Bacteria 201975
160 Ga0209026_1000076 3300025250 Bacteria 201975
161 Ga0209759_1000059 3300025256 Bacteria 201975
162 Ga0209129_1000026 3300025258 Bacteria 411839
163 Ga0209129_1000490 3300025258 Bacteria 28780
164 Ga0209129_1000859 3300025258 Bacteria 19028
165 Ga0209129_1005277 3300025258 Bacteria 4654
166 Ga0209129_1016642 3300025258 Bacteria 1468
167 Ga0209233_1000200 3300025261 Bacteria 123594
168 Ga0209673_1000022 3300025273 Bacteria 413125
169 Ga0209673_1000105 3300025273 Bacteria 186267
170 Ga0209673_1000633 3300025273 Bacteria 53306
171 Ga0209673_1001311 3300025273 Bacteria 25169
172 Ga0209673_1001346 3300025273 Bacteria 24558
173 Ga0209673_1001399 3300025273 Bacteria 23495
174 Ga0209673_1003014 3300025273 Bacteria 10451
175 Ga0209673_1007013 3300025273 Bacteria 5301
176 Ga0209673_1019423 3300025273 Bacteria 2440
177 Ga0209130_1000001 3300025284 Bacteria 831557
178 Ga0209676_1032596 3300025292 Bacteria 1565
179 Ga0209025_1000035 3300025294 Bacteria 411841
180 Ga0209025_1000555 3300025294 Bacteria 69450
181 Ga0209025_1035470 3300025294 Bacteria 2253
182 Ga0209564_1000418 3300025295 Bacteria 74754
183 Ga0209564_1000642 3300025295 Bacteria 53019
184 Ga0209564_1001050 3300025295 Bacteria 33706
185 Ga0209564_1002152 3300025295 Bacteria 16630
186 Ga0209564_1002440 3300025295 Bacteria 14717
187 Ga0209564_1031938 3300025295 Bacteria 1596
188 Ga0209758_1000040 3300025297 Bacteria 411841
189 Ga0209758_1000380 3300025297 Bacteria 77252
190 Ga0209758_1001619 3300025297 Bacteria 25653
191 Ga0209758_1001970 3300025297 Bacteria 22179
192 Ga0209758_1002057 3300025297 Bacteria 21492
193 Ga0209758_1007339 3300025297 Bacteria 7545
194 Ga0209050_1007390 3300025298 Bacteria 6173
195 Ga0209256_1000629 3300025299 Bacteria 48444
196 Ga0209256_1000755 3300025299 Bacteria 42078
197 Ga0209256_1001274 3300025299 Bacteria 27389
198 Ga0209256_1002431 3300025299 Bacteria 15228
199 Ga0209256_1003511 3300025299 Bacteria 10921
200 Ga0209256_1020164 3300025299 Bacteria 2092
201 Ga0207426_1000045 3300025302 Bacteria 422847
202 Ga0207426_1000350 3300025302 Bacteria 84510
203 Ga0207426_1004964 3300025302 Bacteria 6270
204 Ga0209051_1000070 3300025303 Bacteria 215616
205 Ga0209051_1000790 3300025303 Bacteria 33281
206 Ga0209051_1005066 3300025303 Bacteria 7840
207 Ga0209051_1008876 3300025303 Bacteria 5258
208 Ga0209051_1016281 3300025303 Bacteria 3374
209 Ga0209257_1004732 3300025304 Bacteria 10181
210 Ga0209257_1011917 3300025304 Bacteria 4103
211 Ga0207697_10135965 3300025315 Bacteria 1064
212 Ga0207682_10016784 3300025893 Bacteria 2858
213 Ga0207682_10037811 3300025893 Bacteria 1956
214 Ga0207682_10045209 3300025893 Bacteria 1806
215 Ga0207642_10019368 3300025899 Bacteria 2634
216 Ga0207645_10024455 3300025907 Bacteria 3916
217 Ga0207645_10079637 3300025907 Bacteria 2100
218 Ga0207705_10000518 3300025909 Bacteria 32873
219 Ga0207705_10024863 3300025909 Bacteria 4275
220 Ga0207662_10030492 3300025918 Bacteria 3129
221 Ga0207662_10045686 3300025918 Bacteria 2589
222 Ga0207657_10000277 3300025919 Bacteria 54685
223 Ga0207649_10135706 3300025920 Bacteria 1677
224 Ga0207652_10157255 3300025921 Bacteria 2037
225 Ga0207681_10053690 3300025923 Bacteria 2737
226 Ga0207681_10056928 3300025923 Bacteria 2669
227 Ga0207681_10100014 3300025923 Bacteria 2089
228 Ga0207681_10225766 3300025923 Bacteria 1451
229 Ga0207694_10005980 3300025924 Bacteria 9319
230 Ga0207694_10117353 3300025924 Bacteria 2122
231 Ga0207650_10001214 3300025925 Bacteria 18898
232 Ga0207650_10012434 3300025925 Bacteria 5877
233 Ga0207659_10002178 3300025926 Bacteria 11637
234 Ga0207659_10002704 3300025926 Bacteria 10562
235 Ga0207659_10003131 3300025926 Bacteria 9885
236 Ga0207659_10015566 3300025926 Bacteria 4932
237 Ga0207659_10024696 3300025926 Bacteria 4030
238 Ga0207659_10073441 3300025926 Bacteria 2504
239 Ga0207644_10082330 3300025931 Bacteria 2381
240 Ga0207706_10184930 3300025933 Bacteria 1830
241 Ga0207686_10011057 3300025934 Bacteria 4930
242 Ga0207670_10156953 3300025936 Bacteria 1695
243 Ga0207669_10005792 3300025937 Bacteria 5583
244 Ga0207704_10129996 3300025938 Bacteria 1742
245 Ga0207691_10005776 3300025940 Bacteria 11967
246 Ga0207691_10204326 3300025940 Bacteria 1718
247 Ga0207711_10122348 3300025941 Bacteria 2324
248 Ga0207689_10004400 3300025942 Bacteria 12805
249 Ga0207689_10009883 3300025942 Bacteria 8225
250 Ga0207689_10114599 3300025942 Bacteria 2216
251 Ga0207679_10006208 3300025945 Bacteria 7545
252 Ga0207679_10008814 3300025945 Bacteria 6432
253 Ga0207679_10160731 3300025945 Bacteria 1839
254 Ga0207667_10002394 3300025949 Bacteria 23480
255 Ga0207651_10039769 3300025960 Bacteria 3104
256 Ga0207651_10047475 3300025960 Bacteria 2895
257 Ga0207651_10143188 3300025960 Bacteria 1849
258 Ga0207651_10173334 3300025960 Bacteria 1704
259 Ga0207668_10195896 3300025972 Bacteria 1605
260 Ga0207677_10040602 3300026023 Bacteria 3069
261 Ga0207703_10017417 3300026035 Bacteria 5608
262 Ga0207703_10110498 3300026035 Bacteria 2345
263 Ga0207703_10360891 3300026035 Bacteria 1340
264 Ga0207678_10032566 3300026067 Bacteria 4542
265 Ga0207708_10039071 3300026075 Bacteria 3615
266 Ga0207708_10080024 3300026075 Bacteria 2511
267 Ga0207648_10001774 3300026089 Bacteria 23627
268 Ga0207648_10092794 3300026089 Bacteria 2640
269 Ga0207676_10013632 3300026095 Bacteria 5835
270 Ga0207676_10025770 3300026095 Bacteria 4366
271 Ga0207674_10079034 3300026116 Bacteria 3295
272 Ga0207675_100007897 3300026118 Bacteria 10033
273 Ga0207675_100067162 3300026118 Bacteria 3352
274 Ga0207683_10005092 3300026121 Bacteria 11281
275 Ga0207683_10024581 3300026121 Bacteria 5189
276 Ga0207683_10147285 3300026121 Bacteria 2124
277 Ga0207683_10290795 3300026121 Bacteria 1494
278 Ga0209281_1000540 3300027111 Bacteria 47571
279 Ga0209282_1000146 3300027666 Bacteria 41317
280 Ga0209813_10006612 3300027866 Bacteria 2870
281 Ga0268266_10109974 3300028379 Bacteria 2441
282 Ga0268265_10027337 3300028380 Bacteria 4071
283 Ga0268265_10137716 3300028380 Bacteria 2039
284 Ga0268264_10045611 3300028381 Bacteria 3639
285 Ga0268264_10274662 3300028381 Bacteria 1576
286 Ga0307515_10013913 3300028794 Bacteria 14978
287 Ga0307405_10000514 3300031731 Bacteria 14583
288 Ga0307406_10045653 3300031901 Bacteria 2752
289 Ga0315914_1000607 3300031967 Bacteria 47230
290 Ga0307510_10237851 3300033180 Bacteria 1318
291 Ga0315913_1000148 3300033430 Bacteria 47230
292 Ga0315915_1000878 3300033464 Bacteria 33983
293 Ga0373934_0001826 3300035086 Bacteria 7827
294 Ga0373954_0106374 3300035118 Bacteria 1355
295 Ga0373956_0013880 3300035119 Bacteria 3356
296 Ga0373955_0008524 3300035172 Bacteria 4765
297 Ga0373933_0006975 3300035724 Bacteria 6157
298 Ga0373937_0000176 3300036401 Bacteria 62904
299 Ga0395905_0001478 3300037471 Bacteria 28142
300 Ga0436362_0250190 3300039453 Bacteria 2441
301 Ga0439436_0037967 3300041404 Bacteria 1386
302 Ga0439465_0012608 3300041413 Bacteria 2643
303 Ga0451798_0295073 3300041458 Bacteria 2242
304 Ga0451833_1006767 3300041491 Bacteria 5427
305 Ga0451835_0025773 3300041492 Bacteria 2029
306 Ga0451849_0184571 3300041505 Bacteria 2331
307 Ga0451855_1685687 3300041511 Bacteria 1275
308 Ga0451853_0655198 3300041512 Bacteria 1253
309 Ga0439455_0036460 3300042012 Bacteria 1245
310 Ga0495590_0009311 3300046457 Bacteria 3725
311 Ga0495638_0007659 3300046460 Bacteria 7721
312 Ga0495651_0086216 3300046462 Bacteria 2363
313 Ga0495584_0074453 3300046491 Bacteria 1707
314 Ga0495585_0067312 3300046492 Bacteria 1959
315 Ga0495585_0080342 3300046492 Bacteria 1767
316 Ga0495596_0038539 3300046500 Bacteria 1889
317 Ga0495607_0017329 3300046501 Bacteria 4626
318 Ga0495583_0001507 3300046506 Bacteria 23173
319 Ga0495583_0040650 3300046506 Bacteria 2183
320 Ga0495606_0008260 3300046507 Bacteria 9085
321 Ga0495610_0000123 3300046512 Bacteria 87684
322 Ga0495610_0069661 3300046512 Bacteria 1645
323 Ga0495616_0019932 3300046513 Bacteria 3654
324 Ga0495620_0037313 3300046515 Bacteria 2166
325 Ga0495632_0023847 3300046519 Bacteria 3261
326 Ga0495643_0017408 3300046522 Bacteria 4201
327 Ga0495648_0055722 3300046524 Bacteria 2382
328 Ga0495663_0025196 3300046525 Bacteria 1733
329 Ga0495654_0025492 3300046530 Bacteria 3045
330 Ga0495665_0101719 3300046531 Bacteria 1508
331 Ga0495598_0003001 3300046537 Bacteria 3540
332 Ga0495609_0027494 3300046538 Bacteria 2599
333 Ga0495621_0019639 3300046539 Bacteria 2209
334 Ga0495621_0052108 3300046539 Bacteria 1466
335 Ga0495597_0011549 3300046542 Bacteria 4280
336 Ga0495633_0007519 3300046558 Bacteria 6261
337 Ga0495633_0065663 3300046558 Bacteria 1695
338 Ga0495633_0092338 3300046558 Bacteria 1407
339 Ga0495656_0023181 3300046615 Bacteria 2441
340 Ga0495668_0039363 3300046616 Bacteria 2639
341 Ga0495659_0093488 3300046664 Bacteria 1157
342 Ga0495588_0036217 3300046674 Bacteria 2503
343 Ga0495588_0079891 3300046674 Bacteria 1707
344 Ga0495647_0028008 3300046681 Bacteria 2075
345 Ga0495670_0045684 3300046691 Bacteria 2187
346 Ga0495660_0013691 3300046810 Bacteria 4701
347 Ga0495636_0064323 3300047318 Bacteria 1556
348 Ga0495680_0100350 3300047322 Bacteria 2157
349 Ga0495686_0004516 3300047472 Bacteria 11403
350 Ga0495686_0014399 3300047472 Bacteria 5444
351 Ga0495615_0009683 3300048090 Bacteria 1904
352 Ga0496100_0027965 3300048903 Bacteria 3474
353 Ga0496101_0008314 3300048904 Bacteria 6781
354 Ga0496106_0000186 3300048909 Bacteria 44250
355 Ga0496106_0126419 3300048909 Bacteria 2002
356 Ga0496110_0161119 3300048913 Bacteria 2034
357 Ga0496111_0004534 3300048914 Bacteria 8790
358 Ga0496113_0121298 3300048916 Bacteria 2044
359 Ga0496114_0002008 3300048917 Bacteria 15468
360 Ga0496116_0002405 3300048919 Bacteria 19713
361 Ga0496116_0076630 3300048919 Bacteria 2093
362 Ga0496117_0010745 3300048920 Bacteria 8275
363 Ga0496117_0010769 3300048920 Bacteria 8260
364 Ga0496117_0078569 3300048920 Bacteria 2178
365 Ga0496118_0004953 3300048921 Bacteria 15425
366 Ga0496118_0017949 3300048921 Bacteria 6414
367 Ga0496118_0029460 3300048921 Bacteria 4602
368 Ga0496121_0025214 3300048924 Bacteria 5651
369 Ga0496121_0030339 3300048924 Bacteria 4966
370 Ga0496121_0077396 3300048924 Bacteria 2649
371 Ga0496122_0005396 3300048925 Bacteria 15260
372 Ga0496122_0009209 3300048925 Bacteria 10455
373 Ga0496123_0004203 3300048926 Bacteria 15367
374 Ga0496123_0041164 3300048926 Bacteria 3206
375 Ga0496124_0000488 3300048927 Bacteria 67995
376 Ga0496124_0013969 3300048927 Bacteria 7796
377 Ga0496124_0073839 3300048927 Bacteria 2821
378 Ga0496124_0106928 3300048927 Bacteria 2258
379 Ga0496124_0153870 3300048927 Bacteria 1801
380 Ga0496124_0181161 3300048927 Bacteria 1621
381 Ga0496125_0001391 3300048928 Bacteria 35426
382 Ga0496125_0009285 3300048928 Bacteria 10147
383 Ga0496125_0020242 3300048928 Bacteria 6248
384 Ga0496126_0087460 3300048929 Bacteria 2746
385 Ga0495678_038602 3300049459 Bacteria 1931
386 Ga0501031_0017945 3300049568 Bacteria 4603
387 Ga0501033_0043146 3300049570 Bacteria 3360
388 Ga0501034_0316952 3300049571 Bacteria 1493
389 Ga0501036_0035687 3300049572 Bacteria 4207
390 Ga0501036_0307685 3300049572 Bacteria 1325
391 Ga0501037_0040609 3300049573 Bacteria 3424
392 Ga0501037_0081471 3300049573 Bacteria 2346
393 Ga0501037_0089780 3300049573 Bacteria 2223
394 Ga0501038_0033563 3300049574 Bacteria 4520
395 Ga0501038_0046696 3300049574 Bacteria 3754
396 Ga0501039_0051296 3300049575 Bacteria 3192
397 Ga0501041_0069835 3300049577 Bacteria 2155
398 Ga0501042_0050538 3300049578 Bacteria 2965
399 Ga0501043_0037825 3300049579 Bacteria 3796
400 Ga0501043_0119373 3300049579 Bacteria 2068
401 Ga0501046_0030019 3300049580 Bacteria 4416
402 Ga0501046_0045853 3300049580 Bacteria 3470
403 Ga0501047_0012487 3300049581 Bacteria 8045
404 Ga0501047_0046101 3300049581 Bacteria 4214
405 Ga0501047_0142565 3300049581 Bacteria 2274
406 Ga0501068_0062149 3300049584 Bacteria 2270
407 Ga0501068_0134903 3300049584 Bacteria 1545
408 Ga0501073_0038455 3300049589 Bacteria 3394
409 Ga0501073_0048497 3300049589 Bacteria 2981
410 Ga0501249_022416 3300049679 Bacteria 1382
411 Ga0501080_0101982 3300049742 Bacteria 2662
412 Ga0501081_0064142 3300049743 Bacteria 2551
413 Ga0501083_0036498 3300049744 Bacteria 3352
414 Ga0501083_0124887 3300049744 Bacteria 1687
415 Ga0501283_008665 3300049779 Bacteria 1470
416 Ga0501035_0078485 3300049822 Bacteria 2916
417 Ga0501044_0000594 3300049823 Bacteria 43855
418 Ga0501044_0121495 3300049823 Bacteria 2612
419 nmdc:mga03683_6030_c1 3300050489 Bacteria 4129
420 nmdc:mga03n38_19204_c1 3300050490 Bacteria 2712
421 nmdc:mga0yw44_6327_c1 3300050492 Bacteria 5712
422 nmdc:mga0k408_10453_c1 3300050493 Bacteria 5018
423 nmdc:mga07m45_4027_c1 3300050496 Bacteria 7154
424 nmdc:mga08y16_101853_c1 3300050511 Bacteria 2989
425 nmdc:mga08y16_209415_c1 3300050511 Bacteria 2019
426 nmdc:mga0n895_19776_c1 3300050512 Bacteria 6265
427 nmdc:mga0n895_7729_c1 3300050512 Bacteria 9255
428 nmdc:mga0rr50_13715_c1 3300050513 Bacteria 5288
429 nmdc:mga0a205_10315_c1 3300050515 Bacteria 8585
430 nmdc:mga0a205_1428_c2 3300050515 Bacteria 19786
431 nmdc:mga0a205_167517_c1 3300050515 Bacteria 2093
432 nmdc:mga0a205_226082_c1 3300050515 Bacteria 1756
433 nmdc:mga0sz30_1550_c1 3300050516 Bacteria 8191
434 nmdc:mga0sz30_27789_c1 3300050516 Bacteria 2325
435 Ga0495601_0177813 3300053077 Bacteria 1391
436 Ga0495619_0027753 3300053085 Bacteria 3650
437 Ga0500658_0000260 3300053134 Bacteria 24336
438 Ga0500568_0000076 3300053139 Bacteria 94411
439 Ga0500568_0128839 3300053139 Bacteria 941
440 Ga0500573_0002600 3300053140 Bacteria 9085
441 Ga0500577_0007535 3300053142 Bacteria 3059
442 Ga0500616_0017092 3300053153 Bacteria 4118
443 Ga0500622_0000215 3300053156 Bacteria 61272
444 Ga0500622_0002216 3300053156 Bacteria 14334
445 Ga0590071_000008 3300059421 Bacteria 54082
446 Ga0590071_001207 3300059421 Bacteria 6983
447 Ga0590074_000552 3300059423 Bacteria 5611
448 Ga0590074_002808 3300059423 Bacteria 2869
449 Ga0590075_001655 3300059424 Bacteria 5487
450 Ga0590075_002248 3300059424 Bacteria 4638
451 Ga0590077_000226 3300059426 Bacteria 16245
452 Ga0590077_000306 3300059426 Bacteria 13901
453 Ga0501082_0000020 3300060353 Bacteria 109889
454 Ga0501082_0036815 3300060353 Bacteria 4215
455 Ga0501082_0050970 3300060353 Bacteria 3569
456 2509386123 2509276021 Bacteria 7634384
457 2509441551 2509276033 Bacteria 7180565
458 2510137620 2510065019 Bacteria 6903379
459 2510893660 2510461076 Bacteria 8618824
460 2511185914 2510917028 Bacteria 6185411
461 2511193891 2510917030 Bacteria 7460662
462 2513571688 2513237084 Bacteria 7231967
463 2513576231 2513237085 Bacteria 7695351
464 2513595762 2513237088 Bacteria 6927906
465 2513635418 2513237093 Bacteria 7545552
466 2513713446 2513237103 Bacteria 7647401
467 2513869235 2513237138 Bacteria 7368160
468 2513999638 2513237159 Bacteria 6810126
469 2514022590 2513237162 Bacteria 7468464
470 2514039343 2513237164 Bacteria 7563725
471 2515109199 2515075009 Bacteria 7288508
472 2515637447 2515154113 Bacteria 7807172
473 2515644008 2515154114 Bacteria 7848616
474 2515657935 2515154116 Bacteria 7552979
475 2515742344 2515154134 Bacteria 7220242
476 2517042328 2516653077 Bacteria 7555578
477 2517081694 2516653085 Bacteria 7346596
478 2517099499 2517093000 Bacteria 7412387
479 2517411853 2517287029 Bacteria 6905599
480 2517565852 2517487022 Bacteria 7227575
481 2520380938 2519899620 Bacteria 6499161
482 2530649281 2529292951 Bacteria 6916614
483 2535519821 2534681796 Bacteria 7146037
484 2551680843 2551306084 Bacteria 8942552
485 2551684727 2551306085 Bacteria 7347181
486 2551698823 2551306087 Bacteria 7351905
487 2551718422 2551306090 Bacteria 7953713
488 2551739370 2551306093 Bacteria 7064773
489 2585168652 2582581283 Bacteria 6030556
490 2585204766 2582581294 Bacteria 6626667
491 2585227012 2582581298 Bacteria 7315509
492 2585231933 2582581299 Bacteria 6518058
493 2585270470 2582581306 Bacteria 6450535
494 2585386308 2582581865 Bacteria 6644329
495 2585395880 2582581866 Bacteria 6859583
496 2585401300 2582581867 Bacteria 7184437
497 2585528766 2585427526 Bacteria 7258840
498 2585543418 2585427528 Bacteria 6842387
499 2585550427 2585427529 Bacteria 7395659
500 2585821552 2585427590 Bacteria 6824633
501 2585841966 2585427593 Bacteria 7141551
502 2585842773 2585427594 Bacteria 6180594
503 2599718005 2599185236 Bacteria 6875203
504 2616296682 2615840624 Bacteria 6557588
505 2643772339 2643221550 Bacteria 4619371
506 2643838263 2643221564 Bacteria 4193379
507 2644049887 2643221607 Bacteria 6314006
508 2644195534 2643221634 Bacteria 6705461
509 2644203327 2643221636 Bacteria 6583769
510 2644210892 2643221637 Bacteria 5345260
511 2644241007 2643221643 Bacteria 5749658
512 2644485139 2643221686 Bacteria 6310811
513 2644654426 2643221718 Bacteria 5345506
514 2657686238 2657244999 Bacteria 5946535
515 2719180212 2718217882 Bacteria 6556348
516 2719388944 2718217927 Bacteria 6972593
517 2719668547 2718217997 Bacteria 6740740
518 2719730961 2718218009 Bacteria 6478651
519 2720489240 2718218199 Bacteria 6740745
520 2720609921 2718218232 Bacteria 6720332
521 2720617345 2718218233 Bacteria 6662049
522 2720628491 2718218235 Bacteria 6630699
523 2720772440 2718218269 Bacteria 6906114
524 2721146306 2718218363 Bacteria 6524337
525 2721157826 2718218365 Bacteria 6274507
526 2721163185 2718218366 Bacteria 6425255
527 2721402738 2718218423 Bacteria 6438183
528 2722839355 2721755514 Bacteria 6424414
529 2723029876 2721755556 Bacteria 6745503
530 2723564285 2721755684 Bacteria 6859907
531 2723570074 2721755685 Bacteria 6704835
532 2724034804 2721755809 Bacteria 6438790
533 2724043717 2721755810 Bacteria 6479005
534 2724092469 2721755819 Bacteria 6906405
535 2724101621 2721755822 Bacteria 6726041
536 2724112846 2721755823 Bacteria 6752556
537 2725948018 2724679232 Bacteria 7646494
538 2730110409 2728369352 Bacteria 6745171
539 2730163449 2728369365 Bacteria 6555560
540 2730297458 2728369397 Bacteria 6274511
541 2738799722 2738541293 Bacteria 7065685
542 2739035410 2738541333 Bacteria 7106503
543 2739305728 2738543024 Bacteria 5603683
544 2766063555 2765235942 Bacteria 7445910
545 2793297599 2791355256 Bacteria 6798008
546 2793318717 2791355259 Bacteria 7254731
547 2793325336 2791355260 Bacteria 6598818
548 2793326756 2791355261 Bacteria 6661293
549 2793337095 2791355262 Bacteria 6774204
550 2793342749 2791355263 Bacteria 6872478
551 2793347852 2791355264 Bacteria 6429314
552 2793356598 2791355265 Bacteria 6539969
553 2793363378 2791355266 Bacteria 7116587
554 2793368339 2791355267 Bacteria 7222458
555 2802752515 2802428863 Bacteria 6410669
556 2804755065 2802429268 Bacteria 6094027
557 2805928681 2802429605 Bacteria 6875453
558 2806048332 2802429633 Bacteria 7341974
559 2806056117 2802429634 Bacteria 7083200
560 2806062934 2802429635 Bacteria 7650140
561 2806070538 2802429636 Bacteria 7597525
562 2806077449 2802429637 Bacteria 7067217
563 2838016248 2838016132 Bacteria 6577831
564 2838023238 2838022645 Bacteria 6494267
565 2838047520 2838042994 Bacteria 6046894
566 2838049662 2838048938 Bacteria 6044578
567 2838061929 2838061910 Bacteria 6794874
568 2838068781 2838068647 Bacteria 6208656
569 2838668835 2838668709 Bacteria 6671819
570 2838685179 2838680041 Bacteria 6545511
571 2838688190 2838686498 Bacteria 7807632
572 2838700216 2838694306 Bacteria 6853137
573 2838701505 2838701080 Bacteria 6669771
574 2838713319 2838707686 Bacteria 6619912
575 2838732369 2838729681 Bacteria 7400765
576 2838745213 2838742623 Bacteria 7396178
577 2841851930 2841851746 Bacteria 7532261
578 2841869558 2841864319 Bacteria 6742987
579 2842116028 2842110456 Bacteria 7656360
580 2842123684 2842118031 Bacteria 7033875
581 2842146430 2842146304 Bacteria 5957337
582 2842158994 2842156927 Bacteria 6894975
583 2842165890 2842163707 Bacteria 6916235
584 2842182608 2842180545 Bacteria 6888678
585 2842198320 2842192696 Bacteria 6147454
586 2842199666 2842198810 Bacteria 6608673
587 2842210776 2842205361 Bacteria 6340321
588 2842223985 2842217011 Bacteria 7497767
589 2842232971 2842229732 Bacteria 7475766
590 2842242732 2842237096 Bacteria 6620661
591 2842247387 2842243621 Bacteria 7421798
592 2842251340 2842250916 Bacteria 6579627
593 2842261522 2842257432 Bacteria 7401195
594 2842265119 2842264693 Bacteria 6472963
595 2842272860 2842271015 Bacteria 7807131
596 2842284064 2842278818 Bacteria 6340002
597 2842288171 2842285085 Bacteria 6011953
598 2842296799 2842291075 Bacteria 7076806
599 2842307694 2842304105 Bacteria 7023636
600 2842315737 2842311132 Bacteria 6616990
601 2842319587 2842317721 Bacteria 6793725
602 2842346266 2842341865 Bacteria 7003929
603 2842368091 2842363717 Bacteria 6844742
604 2842374522 2842370503 Bacteria 7038661
605 2842383200 2842377471 Bacteria 7140707
606 2842390333 2842384541 Bacteria 7057858
607 2842399343 2842395702 Bacteria 6780583
608 2842405437 2842402390 Bacteria 6681310
609 2842411806 2842409023 Bacteria 6687331
610 2842418667 2842415677 Bacteria 6596907
611 2842422927 2842422224 Bacteria 6239196
612 2842428828 2842428310 Bacteria 6767288
613 2842435441 2842434925 Bacteria 6502746
614 2842441696 2842441272 Bacteria 6769273
615 2842448262 2842447887 Bacteria 6754142
616 2842463252 2842462802 Bacteria 6588055
617 2842469772 2842469257 Bacteria 6752936
618 2842490460 2842489311 Bacteria 6620893
619 2842501491 2842495871 Bacteria 6820686
620 2842525769 2842521101 Bacteria 6569494
621 2844461758 2844454524 Bacteria 7952546
622 2855829189 2855825444 Bacteria 6785811
623 2855844283 2855839649 Bacteria 7135830
624 2857524178 2857516855 Bacteria 7787325
625 2858806330 2858800743 Bacteria 6603254
626 2915991241 2915986958 Bacteria 6739310
627 2916014306 2916007675 Bacteria 6898660
628 2916034622 2916028427 Bacteria 6748433
629 2916061121 2916055098 Bacteria 6758838
630 2916064475 2916061851 Bacteria 6737736
631 2916074730 2916068649 Bacteria 6943657
632 2919107441 2919100787 Bacteria 7710546
633 2921269197 2921263974 Bacteria 6864552
634 2921295264 2921289301 Bacteria 7316391
635 2923560430 2923556063 Bacteria 6793593
636 2924154870 2924150972 Bacteria 7169444
637 2924162328 2924158325 Bacteria 7188855
638 2924179542 2924172951 Bacteria 6749356
639 2924193410 2924186466 Bacteria 6876637
640 2924199313 2924193448 Bacteria 6955718
641 2924216611 2924214083 Bacteria 7080103
642 2924234178 2924228884 Bacteria 6633132
643 2933574146 2933570622 Bacteria 7023390
644 2933592245 2933586486 Bacteria 7667493
645 2933600399 2933599457 Bacteria 5858799
646 2935899690 2935894831 Bacteria 6620579
647 2935906329 2935901341 Bacteria 7341747
648 2936373810 2936367885 Bacteria 7324495
649 2936377336 2936375103 Bacteria 6652732
650 2936387016 2936381700 Bacteria 7006523
651 2937044244 2937042894 Bacteria 6741576
652 2937054954 2937049772 Bacteria 6757901
653 2937068883 2937063883 Bacteria 7199456
654 2937076618 2937071275 Bacteria 6984483
655 2937103310 2937098957 Bacteria 7249374
656 2937118068 2937113482 Bacteria 6505872
657 2937123429 2937119839 Bacteria 6597547
658 2937131212 2937126314 Bacteria 6771275
659 2957379368 2957375807 Bacteria 6425588
660 2957391288 2957388812 Bacteria 6778072
661 2957422929 2957422303 Bacteria 7172205
662 2957431000 2957430029 Bacteria 7022557
663 2957475509 2957471148 Bacteria 6797643
664 2957482253 2957478035 Bacteria 6756658
665 2957490705 2957484790 Bacteria 6703082
666 2957496793 2957491536 Bacteria 6695180
667 2957504328 2957498199 Bacteria 7126688
668 2957512351 2957505466 Bacteria 7253085
669 2960601776 2960597568 Bacteria 6550735
670 2960624116 2960617483 Bacteria 6727748
671 2960632315 2960631154 Bacteria 6732508
672 2960643614 2960637947 Bacteria 7296468
673 2960659568 2960652885 Bacteria 7083688
674 2964631655 2964628898 Bacteria 7083044
675 2964654283 2964649959 Bacteria 6675118
676 2964682144 2964678106 Bacteria 6792020
677 2964702505 2964698721 Bacteria 6765331
678 2964709658 2964705432 Bacteria 7114648
679 2964718531 2964712639 Bacteria 6695970
680 2964724962 2964719344 Bacteria 7286602
681 2967685989 2967678726 Bacteria 7264382
682 2967726416 2967721400 Bacteria 7073753
683 2967752789 2967748971 Bacteria 6733771
684 2967769009 2967762386 Bacteria 6923502
685 2967782792 2967775926 Bacteria 6738189
686 2970023819 2970019648 Bacteria 7072033
687 2970038492 2970033650 Bacteria 7118744
688 2970046433 2970040964 Bacteria 6731123
689 2970050828 2970047711 Bacteria 7088379
690 2970056999 2970054988 Bacteria 6611507
691 2970062094 2970061556 Bacteria 7099761
692 2970073481 2970068827 Bacteria 7123112
693 2970078846 2970076120 Bacteria 6697332
694 2970087230 2970082768 Bacteria 6183754
695 2970114521 2970109326 Bacteria 6863976
696 2970121081 2970116247 Bacteria 6501857
697 2970155052 2970149975 Bacteria 6779706
698 2970161136 2970156795 Bacteria 7168044
699 2970193770 2970191845 Bacteria 7032787
700 2977556504 2977551784 Bacteria 7125765
701 2977576418 2977572785 Bacteria 6763888
702 2977584908 2977579622 Bacteria 6772100
703 2989353475 2989349275 Bacteria 6349068
704 2989774659 2989771324 Bacteria 5605128
705 2996311651 2996310559 Bacteria 6357320
706 2996894548 2996893221 Bacteria 5823108
707 3005412001 3005409236 Bacteria 7188837
708 3005451094 3005445848 Bacteria 6906074
709 639645694 639633055 Bacteria 7751309
710 8005276361 8005275841 Bacteria 6929066
711 8005288623 8005282627 Bacteria 6675747
712 8005290005 8005289223 Bacteria 6634003
713 8005304521 8005301065 Bacteria 6614431
714 8005311769 8005307578 Bacteria 7395396
715 8005382265 8005376324 Bacteria 6590079
716 8005383246 8005382845 Bacteria 6732062
717 8005398848 8005395548 Bacteria 6806915
718 8005431542 8005430974 Bacteria 6689030
719 8005466378 8005460587 Bacteria 7157962
720 8005502796 8005497431 Bacteria 6477605
721 8005547549 8005542996 Bacteria 7077758
722 8005558811 8005556819 Bacteria 6908598
723 8005563782 8005563573 Bacteria 7153261
724 8005571552 8005570704 Bacteria 6957481
725 8005623944 8005619151 Bacteria 7030230
726 8005629209 8005626139 Bacteria 6534237
727 8005674226 8005668836 Bacteria 6953162
728 8005690942 8005688590 Bacteria 6610080
729 8005700424 8005695170 Bacteria 6912330
730 8018131258 8018127388 Bacteria 7351159
731 8018165353 8018163183 Bacteria 7277977
732 8018180337 8018176218 Bacteria 6896178
733 8023685769 8023680758 Bacteria 7729763
734 8024486560 8024479707 Bacteria 6954785
735 8024501989 8024501048 Bacteria 6427847
736 8056376508 8056375014 Bacteria 7006639
737 8056383854 8056382006 Bacteria 6408074
738 8057878314 8057874678 Bacteria 7494653
739 Ga0075435_100076619
740 JGI25156J39149_1000184
741 JGI25162J39368_1000071
742 JGI25154J39366_1000034
743 JGI25158J39367_1001072
744 JGI25157J39369_1000137
745 JGI25152J39213_1000087
746 JGI25152J39213_1002196
747 JGI25152J39213_1004403
748 JGI25152J39213_1014873
749 JGI25150J39212_1000017
750 JGI25150J39212_1009526
751 JGI25159J45721_1000493
752 JGI25151J46595_10000007
753 JGI25151J46595_10000454
754 JGI25165J46597_1000134
755 JGI25153J46596_10002506
756 JGI25153J46596_10023276
757 rootH1_10142643
758 JGI25160J50197_1000441
759 JGI25160J50197_1001866
760 JGI25161J50226_1000540
761 Ga0055526_1002895
762 Ga0055526_1003380
763 Ga0055526_1003412
764 Ga0055526_1008207
765 Ga0055524_1000984
766 Ga0055524_1001818
767 Ga0055524_1031503
768 Ga0055528_1000264
769 Ga0055528_1000997
770 Ga0055528_1003298
771 Ga0055528_1008953
772 Ga0055528_1025418
773 Ga0055528_1025574
774 Ga0055540_1000164
775 Ga0055540_1003085
776 Ga0055531_10022016
777 Ga0055543_1000353
778 Ga0055543_1000649
779 Ga0065165_1002206
780 Ga0065715_10092871
781 Ga0065707_10098733
782 Ga0070690_100039533
783 Ga0070690_100095134
784 Ga0070670_100001675
785 Ga0070670_100015814
786 Ga0068869_100003842
787 Ga0068869_100018948
788 Ga0068868_100059546
789 Ga0068868_100349927
790 Ga0070660_100004603
791 Ga0070689_100092830
792 Ga0070687_100041820
793 Ga0070661_100188536
794 Ga0070669_100097140
795 Ga0070675_100002129
796 Ga0070675_100010137
797 Ga0070675_100017601
798 Ga0070675_100032857
799 Ga0070675_100056031
800 Ga0070675_100120170
801 Ga0070671_100004379
802 Ga0070671_100108590
803 Ga0070674_100018557
804 Ga0070673_100001438
805 Ga0070673_100004847
806 Ga0070688_100004056
807 Ga0070659_100037074
808 Ga0070659_100116639
809 Ga0070667_100171590
810 Ga0070713_100069179
811 Ga0070700_100113480
812 Ga0070700_100188958
813 Ga0070694_100133323
814 Ga0070663_100151135
815 Ga0070678_100031988
816 Ga0070678_100071776
817 Ga0070678_100247218
818 Ga0068867_100027928
819 Ga0068867_100055380
820 Ga0068867_100189824
821 Ga0068853_100261487
822 Ga0070672_100014131
823 Ga0070672_100096474
824 Ga0070686_100027881
825 Ga0070696_100000093
826 Ga0070696_100049726
827 Ga0070664_100011061
828 Ga0070664_100028405
829 Ga0068857_100091431
830 Ga0068859_100002351
831 Ga0068859_100027172
832 Ga0068864_100006914
833 Ga0068864_100023071
834 Ga0068864_100031601
835 Ga0068861_100007285
836 Ga0068861_100254879
837 Ga0068851_10003827
838 Ga0068870_10000697
839 Ga0068858_100109917
840 Ga0068858_100253540
841 Ga0068862_100088504
842 Ga0068862_100113952
843 Ga0081539_10023553
844 Ga0075365_10000145
845 Ga0075365_10058786
846 Ga0075363_100002586
847 Ga0075363_100080595
848 Ga0075362_10003013
849 Ga0075367_10000333
850 Ga0075367_10057020
851 Ga0075369_10012378
852 Ga0075369_10012465
853 Ga0075369_10016516
854 Ga0075366_10010855
855 Ga0075370_10001919
856 Ga0068871_100034830
857 Ga0075428_100584042
858 Ga0075430_100279184
859 Ga0075433_10182047
860 Ga0075434_100002676
861 Ga0075434_100009992
862 Ga0075429_100072179
863 Ga0068865_100008464
864 Ga0097620_100002351
865 Ga0097620_100027172
866 Ga0079104_1000826
867 Ga0111539_10001553
868 Ga0111539_10061057
869 Ga0111539_10122280
870 Ga0111539_10381420
871 Ga0114129_10095305
872 Ga0105243_10028489
873 Ga0105242_10012840
874 Ga0105248_10067681
875 Ga0105238_10043671
876 Ga0105238_10099623
877 Ga0123341_1003124
878 Ga0123341_1006310
879 Ga0123342_1006370
880 Ga0123342_1010170
881 Ga0123342_1025154
882 Ga0163163_10074049
883 Ga0157380_10003805
884 Ga0157380_10013344
885 Ga0157380_10044175
886 Ga0157379_10289874
887 Ga0163161_10133833
888 Ga0228711_1001389
889 Ga0228710_1000488
890 Ga0209435_100023
891 Ga0209436_100025
892 Ga0209437_100191
893 Ga0207425_1000018
894 Ga0207425_1000467
895 Ga0207425_1010480
896 Ga0207425_1019705
897 Ga0209646_1000080
898 Ga0209026_1000076
899 Ga0209759_1000059
900 Ga0209129_1000026
901 Ga0209129_1000490
902 Ga0209129_1000859
903 Ga0209129_1005277
904 Ga0209129_1016642
905 Ga0209233_1000200
906 Ga0209673_1000022
907 Ga0209673_1000105
908 Ga0209673_1000633
909 Ga0209673_1001311
910 Ga0209673_1001346
911 Ga0209673_1001399
912 Ga0209673_1003014
913 Ga0209673_1007013
914 Ga0209673_1019423
915 Ga0209130_1000001
916 Ga0209676_1032596
917 Ga0209025_1000035
918 Ga0209025_1000555
919 Ga0209025_1035470
920 Ga0209564_1000418
921 Ga0209564_1000642
922 Ga0209564_1001050
923 Ga0209564_1002152
924 Ga0209564_1002440
925 Ga0209564_1031938
926 Ga0209758_1000040
927 Ga0209758_1000380
928 Ga0209758_1001619
929 Ga0209758_1001970
930 Ga0209758_1002057
931 Ga0209758_1007339
932 Ga0209050_1007390
933 Ga0209256_1000629
934 Ga0209256_1000755
935 Ga0209256_1001274
936 Ga0209256_1002431
937 Ga0209256_1003511
938 Ga0209256_1020164
939 Ga0207426_1000045
940 Ga0207426_1000350
941 Ga0207426_1004964
942 Ga0209051_1000070
943 Ga0209051_1000790
944 Ga0209051_1005066
945 Ga0209051_1008876
946 Ga0209051_1016281
947 Ga0209257_1004732
948 Ga0209257_1011917
949 Ga0207697_10135965
950 Ga0207682_10016784
951 Ga0207682_10037811
952 Ga0207682_10045209
953 Ga0207642_10019368
954 Ga0207645_10024455
955 Ga0207645_10079637
956 Ga0207705_10000518
957 Ga0207705_10024863
958 Ga0207662_10030492
959 Ga0207662_10045686
960 Ga0207657_10000277
961 Ga0207649_10135706
962 Ga0207652_10157255
963 Ga0207681_10053690
964 Ga0207681_10056928
965 Ga0207681_10100014
966 Ga0207681_10225766
967 Ga0207694_10005980
968 Ga0207694_10117353
969 Ga0207650_10001214
970 Ga0207650_10012434
971 Ga0207659_10002178
972 Ga0207659_10002704
973 Ga0207659_10003131
974 Ga0207659_10015566
975 Ga0207659_10024696
976 Ga0207659_10073441
977 Ga0207644_10082330
978 Ga0207706_10184930
979 Ga0207686_10011057
980 Ga0207670_10156953
981 Ga0207669_10005792
982 Ga0207704_10129996
983 Ga0207691_10005776
984 Ga0207691_10204326
985 Ga0207711_10122348
986 Ga0207689_10004400
987 Ga0207689_10009883
988 Ga0207689_10114599
989 Ga0207679_10006208
990 Ga0207679_10008814
991 Ga0207679_10160731
992 Ga0207667_10002394
993 Ga0207651_10039769
994 Ga0207651_10047475
995 Ga0207651_10143188
996 Ga0207651_10173334
997 Ga0207668_10195896
998 Ga0207677_10040602
999 Ga0207703_10017417
1000 Ga0207703_10110498
1001 Ga0207703_10360891
1002 Ga0207678_10032566
1003 Ga0207708_10039071
1004 Ga0207708_10080024
1005 Ga0207648_10001774
1006 Ga0207648_10092794
1007 Ga0207676_10013632
1008 Ga0207676_10025770
1009 Ga0207674_10079034
1010 Ga0207675_100007897
1011 Ga0207675_100067162
1012 Ga0207683_10005092
1013 Ga0207683_10024581
1014 Ga0207683_10147285
1015 Ga0207683_10290795
1016 Ga0209281_1000540
1017 Ga0209282_1000146
1018 Ga0209813_10006612
1019 Ga0268266_10109974
1020 Ga0268265_10027337
1021 Ga0268265_10137716
1022 Ga0268264_10045611
1023 Ga0268264_10274662
1024 Ga0307515_10013913
1025 Ga0307405_10000514
1026 Ga0307406_10045653
1027 Ga0315914_1000607
1028 Ga0307510_10237851
1029 Ga0315913_1000148
1030 Ga0315915_1000878
1031 Ga0373934_0001826
1032 Ga0373954_0106374
1033 Ga0373956_0013880
1034 Ga0373955_0008524
1035 Ga0373933_0006975
1036 Ga0373937_0000176
1037 Ga0395905_0001478
1038 Ga0436362_0250190
1039 Ga0439436_0037967
1040 Ga0439465_0012608
1041 Ga0451798_0295073
1042 Ga0451833_1006767
1043 Ga0451835_0025773
1044 Ga0451849_0184571
1045 Ga0451855_1685687
1046 Ga0451853_0655198
1047 Ga0439455_0036460
1048 Ga0495590_0009311
1049 Ga0495638_0007659
1050 Ga0495651_0086216
1051 Ga0495584_0074453
1052 Ga0495585_0067312
1053 Ga0495585_0080342
1054 Ga0495596_0038539
1055 Ga0495607_0017329
1056 Ga0495583_0001507
1057 Ga0495583_0040650
1058 Ga0495606_0008260
1059 Ga0495610_0000123
1060 Ga0495610_0069661
1061 Ga0495616_0019932
1062 Ga0495620_0037313
1063 Ga0495632_0023847
1064 Ga0495643_0017408
1065 Ga0495648_0055722
1066 Ga0495663_0025196
1067 Ga0495654_0025492
1068 Ga0495665_0101719
1069 Ga0495598_0003001
1070 Ga0495609_0027494
1071 Ga0495621_0019639
1072 Ga0495621_0052108
1073 Ga0495597_0011549
1074 Ga0495633_0007519
1075 Ga0495633_0065663
1076 Ga0495633_0092338
1077 Ga0495656_0023181
1078 Ga0495668_0039363
1079 Ga0495659_0093488
1080 Ga0495588_0036217
1081 Ga0495588_0079891
1082 Ga0495647_0028008
1083 Ga0495670_0045684
1084 Ga0495660_0013691
1085 Ga0495636_0064323
1086 Ga0495680_0100350
1087 Ga0495686_0004516
1088 Ga0495686_0014399
1089 Ga0495615_0009683
1090 Ga0496100_0027965
1091 Ga0496101_0008314
1092 Ga0496106_0000186
1093 Ga0496106_0126419
1094 Ga0496110_0161119
1095 Ga0496111_0004534
1096 Ga0496113_0121298
1097 Ga0496114_0002008
1098 Ga0496116_0002405
1099 Ga0496116_0076630
1100 Ga0496117_0010745
1101 Ga0496117_0010769
1102 Ga0496117_0078569
1103 Ga0496118_0004953
1104 Ga0496118_0017949
1105 Ga0496118_0029460
1106 Ga0496121_0025214
1107 Ga0496121_0030339
1108 Ga0496121_0077396
1109 Ga0496122_0005396
1110 Ga0496122_0009209
1111 Ga0496123_0004203
1112 Ga0496123_0041164
1113 Ga0496124_0000488
1114 Ga0496124_0013969
1115 Ga0496124_0073839
1116 Ga0496124_0106928
1117 Ga0496124_0153870
1118 Ga0496124_0181161
1119 Ga0496125_0001391
1120 Ga0496125_0009285
1121 Ga0496125_0020242
1122 Ga0496126_0087460
1123 Ga0495678_038602
1124 Ga0501031_0017945
1125 Ga0501033_0043146
1126 Ga0501034_0316952
1127 Ga0501036_0035687
1128 Ga0501036_0307685
1129 Ga0501037_0040609
1130 Ga0501037_0081471
1131 Ga0501037_0089780
1132 Ga0501038_0033563
1133 Ga0501038_0046696
1134 Ga0501039_0051296
1135 Ga0501041_0069835
1136 Ga0501042_0050538
1137 Ga0501043_0037825
1138 Ga0501043_0119373
1139 Ga0501046_0030019
1140 Ga0501046_0045853
1141 Ga0501047_0012487
1142 Ga0501047_0046101
1143 Ga0501047_0142565
1144 Ga0501068_0062149
1145 Ga0501068_0134903
1146 Ga0501073_0038455
1147 Ga0501073_0048497
1148 Ga0501249_022416
1149 Ga0501080_0101982
1150 Ga0501081_0064142
1151 Ga0501083_0036498
1152 Ga0501083_0124887
1153 Ga0501283_008665
1154 Ga0501035_0078485
1155 Ga0501044_0000594
1156 Ga0501044_0121495
1157 nmdc:mga03683_6030_c1
1158 nmdc:mga03n38_19204_c1
1159 nmdc:mga0yw44_6327_c1
1160 nmdc:mga0k408_10453_c1
1161 nmdc:mga07m45_4027_c1
1162 nmdc:mga08y16_101853_c1
1163 nmdc:mga08y16_209415_c1
1164 nmdc:mga0n895_19776_c1
1165 nmdc:mga0n895_7729_c1
1166 nmdc:mga0rr50_13715_c1
1167 nmdc:mga0a205_10315_c1
1168 nmdc:mga0a205_1428_c2
1169 nmdc:mga0a205_167517_c1
1170 nmdc:mga0a205_226082_c1
1171 nmdc:mga0sz30_1550_c1
1172 nmdc:mga0sz30_27789_c1
1173 Ga0495601_0177813
1174 Ga0495619_0027753
1175 Ga0500658_0000260
1176 Ga0500568_0000076
1177 Ga0500568_0128839
1178 Ga0500573_0002600
1179 Ga0500577_0007535
1180 Ga0500616_0017092
1181 Ga0500622_0000215
1182 Ga0500622_0002216
1183 Ga0590071_000008
1184 Ga0590071_001207
1185 Ga0590074_000552
1186 Ga0590074_002808
1187 Ga0590075_001655
1188 Ga0590075_002248
1189 Ga0590077_000226
1190 Ga0590077_000306
1191 Ga0501082_0000020
1192 Ga0501082_0036815
1193 Ga0501082_0050970
1194 2509386123
1195 2509441551
1196 2510137620
1197 2510893660
1198 2511185914
1199 2511193891
1200 2513571688
1201 2513576231
1202 2513595762
1203 2513635418
1204 2513713446
1205 2513869235
1206 2513999638
1207 2514022590
1208 2514039343
1209 2515109199
1210 2515637447
1211 2515644008
1212 2515657935
1213 2515742344
1214 2517042328
1215 2517081694
1216 2517099499
1217 2517411853
1218 2517565852
1219 2520380938
1220 2530649281
1221 2535519821
1222 2551680843
1223 2551684727
1224 2551698823
1225 2551718422
1226 2551739370
1227 2585168652
1228 2585204766
1229 2585227012
1230 2585231933
1231 2585270470
1232 2585386308
1233 2585395880
1234 2585401300
1235 2585528766
1236 2585543418
1237 2585550427
1238 2585821552
1239 2585841966
1240 2585842773
1241 2599718005
1242 2616296682
1243 2643772339
1244 2643838263
1245 2644049887
1246 2644195534
1247 2644203327
1248 2644210892
1249 2644241007
1250 2644485139
1251 2644654426
1252 2657686238
1253 2719180212
1254 2719388944
1255 2719668547
1256 2719730961
1257 2720489240
1258 2720609921
1259 2720617345
1260 2720628491
1261 2720772440
1262 2721146306
1263 2721157826
1264 2721163185
1265 2721402738
1266 2722839355
1267 2723029876
1268 2723564285
1269 2723570074
1270 2724034804
1271 2724043717
1272 2724092469
1273 2724101621
1274 2724112846
1275 2725948018
1276 2730110409
1277 2730163449
1278 2730297458
1279 2738799722
1280 2739035410
1281 2739305728
1282 2766063555
1283 2793297599
1284 2793318717
1285 2793325336
1286 2793326756
1287 2793337095
1288 2793342749
1289 2793347852
1290 2793356598
1291 2793363378
1292 2793368339
1293 2802752515
1294 2804755065
1295 2805928681
1296 2806048332
1297 2806056117
1298 2806062934
1299 2806070538
1300 2806077449
1301 2838016248
1302 2838023238
1303 2838047520
1304 2838049662
1305 2838061929
1306 2838068781
1307 2838668835
1308 2838685179
1309 2838688190
1310 2838700216
1311 2838701505
1312 2838713319
1313 2838732369
1314 2838745213
1315 2841851930
1316 2841869558
1317 2842116028
1318 2842123684
1319 2842146430
1320 2842158994
1321 2842165890
1322 2842182608
1323 2842198320
1324 2842199666
1325 2842210776
1326 2842223985
1327 2842232971
1328 2842242732
1329 2842247387
1330 2842251340
1331 2842261522
1332 2842265119
1333 2842272860
1334 2842284064
1335 2842288171
1336 2842296799
1337 2842307694
1338 2842315737
1339 2842319587
1340 2842346266
1341 2842368091
1342 2842374522
1343 2842383200
1344 2842390333
1345 2842399343
1346 2842405437
1347 2842411806
1348 2842418667
1349 2842422927
1350 2842428828
1351 2842435441
1352 2842441696
1353 2842448262
1354 2842463252
1355 2842469772
1356 2842490460
1357 2842501491
1358 2842525769
1359 2844461758
1360 2855829189
1361 2855844283
1362 2857524178
1363 2858806330
1364 2915991241
1365 2916014306
1366 2916034622
1367 2916061121
1368 2916064475
1369 2916074730
1370 2919107441
1371 2921269197
1372 2921295264
1373 2923560430
1374 2924154870
1375 2924162328
1376 2924179542
1377 2924193410
1378 2924199313
1379 2924216611
1380 2924234178
1381 2933574146
1382 2933592245
1383 2933600399
1384 2935899690
1385 2935906329
1386 2936373810
1387 2936377336
1388 2936387016
1389 2937044244
1390 2937054954
1391 2937068883
1392 2937076618
1393 2937103310
1394 2937118068
1395 2937123429
1396 2937131212
1397 2957379368
1398 2957391288
1399 2957422929
1400 2957431000
1401 2957475509
1402 2957482253
1403 2957490705
1404 2957496793
1405 2957504328
1406 2957512351
1407 2960601776
1408 2960624116
1409 2960632315
1410 2960643614
1411 2960659568
1412 2964631655
1413 2964654283
1414 2964682144
1415 2964702505
1416 2964709658
1417 2964718531
1418 2964724962
1419 2967685989
1420 2967726416
1421 2967752789
1422 2967769009
1423 2967782792
1424 2970023819
1425 2970038492
1426 2970046433
1427 2970050828
1428 2970056999
1429 2970062094
1430 2970073481
1431 2970078846
1432 2970087230
1433 2970114521
1434 2970121081
1435 2970155052
1436 2970161136
1437 2970193770
1438 2977556504
1439 2977576418
1440 2977584908
1441 2989353475
1442 2989774659
1443 2996311651
1444 2996894548
1445 3005412001
1446 3005451094
1447 639645694
1448 8005276361
1449 8005288623
1450 8005290005
1451 8005304521
1452 8005311769
1453 8005382265
1454 8005383246
1455 8005398848
1456 8005431542
1457 8005466378
1458 8005502796
1459 8005547549
1460 8005558811
1461 8005563782
1462 8005571552
1463 8005623944
1464 8005629209
1465 8005674226
1466 8005690942
1467 8005700424
1468 8018131258
1469 8018165353
1470 8018180337
1471 8023685769
1472 8024486560
1473 8024501989
1474 8056376508
1475 8056383854
1476 8057878314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

20

139

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

147

256

0.84

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

151

356

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9393 2 331
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9322 2 331
7bvj-assembly1.cif.gz_A udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9268 2 331
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9184 2 328
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9182 2 331
ID Description Score Start End Superfamily
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9661 2 120 3.40.50.720
3e18A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9602 2 120 3.40.50.720
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.948 2 119 3.90.1150.10
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9464 2 119 3.40.50.720
3fhlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 1 119 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A843ES58-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9793 2 137 GO:0000166
GO:0003824
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9697 1 138 GO:0000166
GO:0003824
AF-A0A536EUE0-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9675 2 86 GO:0000166
AF-A0A7C2Z2A1-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9645 2 137 GO:0000166
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9618 2 137 GO:0000166

Map