F478382

General Info

Members Datasets Scaffolds Average Seq Length
738 403 728 246

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10530235|Ga0105240_105302351
Length 294
Sequence MEGGRRQSPGGGDEIPVCPAAGNPYKRLRQFRHLFYTFIPRLAGVAGLSATSMPDAIILIPARLASTRLPGKPLADLHGAPMIVHVLRHAQAAEIGEAVVATDSEAVAAAVEKAGGRAIMTRSDHVSGSDRIYEALEALDPERQIEIVVNVQGDLPTIAAADIRAALKPLSEPHVDIATLAALITDPAEATNPNVVKVSGPQIAPNRIHAKSFSRRSASGPGPHYHHIGLYAYRRAALERFVKLPPSAGEQRDKLEQLRALENGMRIDAMIVKSVPLGVDTPDDLEKARRQLSG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2643221736 Bosea sp. Root483D1 Isolate Unclassified
4 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
5 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
6 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
7 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
8 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
9 2902330777 Methylobacterium sp. 2A Isolate Unclassified
10 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
11 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
12 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
13 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
14 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
15 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
154 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
246 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
247 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
248 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
271 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
274 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
275 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
373 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
382 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
393 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
394 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
397 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
398 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
399 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
403 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0.14
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0.14
Rhizoplane 5.96
Rhizosphere 88.75
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544930 2209111006 Bacteria 17913
2 2214656054 2209111006 Bacteria 4766
3 ARcpr5yngRDRAFT_c000024 3300000043 Bacteria 25202
4 ARSoilOldRDRAFT_c000034 3300000044 Bacteria 30454
5 ARCol0oldRDRAFT_c00091 3300000045 Bacteria 7612
6 ARCol0yngRDRAFT_1000026 3300000652 Bacteria 26647
7 JGI24739J22299_10011920 3300001989 Bacteria 3199
8 JGI24737J22298_10000377 3300001990 Bacteria 15163
9 JGI24737J22298_10017420 3300001990 Bacteria 2314
10 JGI24750J21931_1000721 3300002070 Bacteria 4744
11 JGI24745J21846_1000072 3300002073 Bacteria 7025
12 JGI24748J21848_1001393 3300002074 Bacteria 2661
13 JGI24738J21930_10001830 3300002075 Bacteria 5763
14 JGI24749J21850_1001077 3300002076 Bacteria 3890
15 JGI24744J21845_10003744 3300002077 Bacteria 3139
16 JGI24035J26624_1000268 3300002126 Bacteria 4844
17 JGI24034J26672_10003945 3300002239 Bacteria 2088
18 JGI24742J22300_10000140 3300002244 Bacteria 10727
19 Ga0065704_10086870 3300005289 Bacteria 3077
20 Ga0065712_10016314 3300005290 Bacteria 2462
21 Ga0065715_10160156 3300005293 Bacteria 1637
22 Ga0070676_10012406 3300005328 Bacteria 4650
23 Ga0070683_100083423 3300005329 Bacteria 2993
24 Ga0070690_100018681 3300005330 Bacteria 4191
25 Ga0070690_100186021 3300005330 Bacteria 1437
26 Ga0070670_100011123 3300005331 Bacteria 7689
27 Ga0070677_10001300 3300005333 Bacteria 8000
28 Ga0068869_100023413 3300005334 Bacteria 4265
29 Ga0070666_10022569 3300005335 Bacteria 4088
30 Ga0070680_100010070 3300005336 Bacteria 7284
31 Ga0070680_100016122 3300005336 Bacteria 5873
32 Ga0070682_100056018 3300005337 Bacteria 2478
33 Ga0068868_100323350 3300005338 Unclassified 1314
34 Ga0070660_100035576 3300005339 Bacteria 3770
35 Ga0070660_100156701 3300005339 Bacteria 1833
36 Ga0070689_100061168 3300005340 Bacteria 2929
37 Ga0070689_100086111 3300005340 Bacteria 2471
38 Ga0070689_100191463 3300005340 Unclassified 1665
39 Ga0070691_10004569 3300005341 Bacteria 6287
40 Ga0070687_100000813 3300005343 Bacteria 10406
41 Ga0070661_100013566 3300005344 Bacteria 5722
42 Ga0070661_100018789 3300005344 Bacteria 4920
43 Ga0070692_10022878 3300005345 Bacteria 3058
44 Ga0070668_100093924 3300005347 Bacteria 2367
45 Ga0070669_100005635 3300005353 Bacteria 9042
46 Ga0070669_100015571 3300005353 Bacteria 5423
47 Ga0070675_100004413 3300005354 Bacteria 10723
48 Ga0070675_100116117 3300005354 Bacteria 2270
49 Ga0070671_100008712 3300005355 Bacteria 8138
50 Ga0070671_100021644 3300005355 Bacteria 5252
51 Ga0070673_100002330 3300005364 Bacteria 11534
52 Ga0070673_100016208 3300005364 Bacteria 5262
53 Ga0070688_100018721 3300005365 Bacteria 4002
54 Ga0070688_100057107 3300005365 Bacteria 2452
55 Ga0070659_100030373 3300005366 Bacteria 4182
56 Ga0070659_100141682 3300005366 Bacteria 1957
57 Ga0070659_100156613 3300005366 Bacteria 1860
58 Ga0070667_100004935 3300005367 Bacteria 11178
59 Ga0070667_100043434 3300005367 Bacteria 3772
60 Ga0070667_100061488 3300005367 Bacteria 3180
61 Ga0070703_10002976 3300005406 Bacteria 4843
62 Ga0070709_10014842 3300005434 Bacteria 4416
63 Ga0070709_10508727 3300005434 Bacteria 916
64 Ga0070714_100018460 3300005435 Bacteria 5666
65 Ga0070713_100001408 3300005436 Bacteria 15419
66 Ga0070713_100017458 3300005436 Bacteria 5428
67 Ga0070710_10136384 3300005437 Bacteria 1501
68 Ga0070701_10001696 3300005438 Bacteria 8277
69 Ga0070701_10234044 3300005438 Bacteria 1102
70 Ga0070711_100008598 3300005439 Bacteria 6261
71 Ga0070711_100127826 3300005439 Bacteria 1888
72 Ga0070711_100193921 3300005439 Bacteria 1563
73 Ga0070705_100103005 3300005440 Unclassified 1806
74 Ga0070705_100167308 3300005440 Bacteria 1476
75 Ga0070700_100002037 3300005441 Bacteria 10273
76 Ga0070700_100002054 3300005441 Bacteria 10228
77 Ga0070694_100017473 3300005444 Bacteria 4535
78 Ga0070694_100026395 3300005444 Bacteria 3763
79 Ga0070708_100041127 3300005445 Bacteria 4052
80 Ga0070663_100011055 3300005455 Bacteria 5651
81 Ga0070663_100069885 3300005455 Bacteria 2553
82 Ga0070678_100014241 3300005456 Bacteria 5010
83 Ga0070662_100035728 3300005457 Bacteria 3511
84 Ga0070662_100043603 3300005457 Bacteria 3210
85 Ga0070681_10005125 3300005458 Bacteria 12644
86 Ga0070681_10067109 3300005458 Bacteria 3556
87 Ga0070681_10102977 3300005458 Bacteria 2799
88 Ga0070681_10169050 3300005458 Bacteria 2108
89 Ga0070681_10197475 3300005458 Bacteria 1930
90 Ga0068867_100049799 3300005459 Bacteria 3084
91 Ga0068867_100118073 3300005459 Bacteria 2046
92 Ga0068867_100330419 3300005459 Bacteria 1266
93 Ga0070685_10001256 3300005466 Bacteria 13462
94 Ga0070685_10355659 3300005466 Bacteria 1003
95 Ga0070679_100032427 3300005530 Bacteria 5167
96 Ga0070679_100038222 3300005530 Bacteria 4771
97 Ga0070684_100022881 3300005535 Bacteria 5218
98 Ga0070684_100119777 3300005535 Bacteria 2367
99 Ga0070697_100147289 3300005536 Bacteria 1983
100 Ga0068853_100038342 3300005539 Bacteria 4081
101 Ga0068853_100110959 3300005539 Bacteria 2436
102 Ga0070672_100024585 3300005543 Bacteria 4455
103 Ga0070672_100072116 3300005543 Bacteria 2749
104 Ga0070686_100025615 3300005544 Bacteria 3551
105 Ga0070686_100114625 3300005544 Bacteria 1842
106 Ga0070695_100025578 3300005545 Bacteria 3646
107 Ga0070695_100049655 3300005545 Bacteria 2686
108 Ga0070696_100034656 3300005546 Bacteria 3473
109 Ga0070696_100050348 3300005546 Bacteria 2895
110 Ga0070696_100136513 3300005546 Unclassified 1788
111 Ga0070693_100017824 3300005547 Bacteria 3699
112 Ga0070693_100179345 3300005547 Bacteria 1363
113 Ga0070665_100127551 3300005548 Bacteria 2547
114 Ga0070704_100012551 3300005549 Bacteria 5235
115 Ga0070704_100178216 3300005549 Bacteria 1697
116 Ga0068855_100025265 3300005563 Bacteria 7110
117 Ga0068855_100030348 3300005563 Bacteria 6466
118 Ga0068855_100053635 3300005563 Bacteria 4742
119 Ga0070664_100031021 3300005564 Bacteria 4463
120 Ga0070664_100742398 3300005564 Bacteria 916
121 Ga0068857_100037204 3300005577 Bacteria 4311
122 Ga0068857_100159616 3300005577 Bacteria 2045
123 Ga0068854_100003787 3300005578 Bacteria 9456
124 Ga0068854_100163745 3300005578 Bacteria 1725
125 Ga0068856_100017870 3300005614 Bacteria 6878
126 Ga0068856_100023277 3300005614 Bacteria 6023
127 Ga0068856_100199086 3300005614 Bacteria 2018
128 Ga0068856_100272412 3300005614 Bacteria 1709
129 Ga0068856_100533468 3300005614 Bacteria 1195
130 Ga0070702_100135118 3300005615 Unclassified 1563
131 Ga0070702_100154732 3300005615 Bacteria 1476
132 Ga0068852_100033497 3300005616 Bacteria 4266
133 Ga0068859_100000920 3300005617 Bacteria 30125
134 Ga0068859_100058508 3300005617 Bacteria 3882
135 Ga0068864_100029360 3300005618 Bacteria 4656
136 Ga0068866_10000295 3300005718 Bacteria 23724
137 Ga0068861_100082305 3300005719 Bacteria 2522
138 Ga0068861_100131739 3300005719 Bacteria 2030
139 Ga0068870_10000803 3300005840 Bacteria 12169
140 Ga0068863_100009214 3300005841 Bacteria 9632
141 Ga0068863_100735281 3300005841 Bacteria 982
142 Ga0068858_100007950 3300005842 Bacteria 10220
143 Ga0068858_100150859 3300005842 Bacteria 2186
144 Ga0068858_100165196 3300005842 Bacteria 2086
145 Ga0068860_100082132 3300005843 Bacteria 3065
146 Ga0068860_100127705 3300005843 Bacteria 2437
147 Ga0068860_100178037 3300005843 Bacteria 2055
148 Ga0068862_100009980 3300005844 Bacteria 7847
149 Ga0068862_100253237 3300005844 Unclassified 1605
150 Ga0081455_10000059 3300005937 Bacteria 119148
151 Ga0081455_10003227 3300005937 Bacteria 18892
152 Ga0081455_10007580 3300005937 Bacteria 11410
153 Ga0081455_10025599 3300005937 Bacteria 5442
154 Ga0081540_1019697 3300005983 Bacteria 4087
155 Ga0070717_10456688 3300006028 Bacteria 1152
156 Ga0075365_10096149 3300006038 Bacteria 2024
157 Ga0075368_10009881 3300006042 Bacteria 3440
158 Ga0075363_100094831 3300006048 Bacteria 1645
159 Ga0075364_10031734 3300006051 Bacteria 3394
160 Ga0075432_10046659 3300006058 Bacteria 1521
161 Ga0070712_100210933 3300006175 Bacteria 1531
162 Ga0075362_10021352 3300006177 Bacteria 2715
163 Ga0075367_10142533 3300006178 Unclassified 1485
164 Ga0075369_10114095 3300006186 Bacteria 1219
165 Ga0097621_100004720 3300006237 Bacteria 9518
166 Ga0068871_100011297 3300006358 Bacteria 6548
167 Ga0075430_100000094 3300006846 Bacteria 52204
168 Ga0075431_100002415 3300006847 Bacteria 17982
169 Ga0075433_10000311 3300006852 Bacteria 29567
170 Ga0075433_10091058 3300006852 Bacteria 2696
171 Ga0075433_10232499 3300006852 Bacteria 1637
172 Ga0075434_100009504 3300006871 Bacteria 9070
173 Ga0075434_100042656 3300006871 Bacteria 4498
174 Ga0075434_100296546 3300006871 Bacteria 1637
175 Ga0075429_100001750 3300006880 Bacteria 17982
176 Ga0068865_100048747 3300006881 Bacteria 2916
177 Ga0075436_100094044 3300006914 Bacteria 2085
178 Ga0097620_100000920 3300006931 Bacteria 30125
179 Ga0097620_100058509 3300006931 Bacteria 3882
180 Ga0075435_100009711 3300007076 Bacteria 6991
181 Ga0075435_100089551 3300007076 Bacteria 2537
182 Ga0105244_10007516 3300009036 Bacteria 6916
183 Ga0105250_10023618 3300009092 Bacteria 2478
184 Ga0105240_10028382 3300009093 Bacteria 7310
185 Ga0105240_10250534 3300009093 Unclassified 2048
186 Ga0105240_10530235 3300009093 Bacteria 1305
187 Ga0111539_10002742 3300009094 Bacteria 23379
188 Ga0111539_10003209 3300009094 Bacteria 21620
189 Ga0111539_10047268 3300009094 Bacteria 5143
190 Ga0105245_10000183 3300009098 Bacteria 59105
191 Ga0105247_10004155 3300009101 Bacteria 9288
192 Ga0105247_10032128 3300009101 Bacteria 3188
193 Ga0114129_10006608 3300009147 Bacteria 16462
194 Ga0114129_10112310 3300009147 Bacteria 3758
195 Ga0105243_10032095 3300009148 Bacteria 4054
196 Ga0105243_10054799 3300009148 Bacteria 3166
197 Ga0105241_10004816 3300009174 Bacteria 9943
198 Ga0105242_10082236 3300009176 Bacteria 2695
199 Ga0105248_10006282 3300009177 Bacteria 13035
200 Ga0105248_10013499 3300009177 Bacteria 8994
201 Ga0105248_10029374 3300009177 Bacteria 6132
202 Ga0105248_10182565 3300009177 Bacteria 2364
203 Ga0105237_10191401 3300009545 Bacteria 2046
204 Ga0105237_10191836 3300009545 Bacteria 2043
205 Ga0105238_10157368 3300009551 Bacteria 2247
206 Ga0105249_10006556 3300009553 Bacteria 10128
207 Ga0105249_10008411 3300009553 Bacteria 8990
208 Ga0105239_10059786 3300010375 Bacteria 4182
209 Ga0105239_10073618 3300010375 Bacteria 3755
210 Ga0105246_10007150 3300011119 Bacteria 6837
211 Ga0157342_1006973 3300012507 Bacteria 1086
212 Ga0157371_10010950 3300013102 Bacteria 7029
213 Ga0157370_10092783 3300013104 Bacteria 2833
214 Ga0157370_10155148 3300013104 Bacteria 2130
215 Ga0157370_10193349 3300013104 Bacteria 1888
216 Ga0157370_10719423 3300013104 Bacteria 911
217 Ga0157369_10917613 3300013105 Bacteria 898
218 Ga0157374_10009979 3300013296 Bacteria 8153
219 Ga0157374_10092180 3300013296 Bacteria 2890
220 Ga0157378_10019352 3300013297 Bacteria 5986
221 Ga0157378_10519932 3300013297 Bacteria 1191
222 Ga0163162_10009250 3300013306 Bacteria 9587
223 Ga0163162_10103180 3300013306 Bacteria 2945
224 Ga0157372_10030572 3300013307 Bacteria 5892
225 Ga0157375_10030035 3300013308 Bacteria 5118
226 Ga0157375_10148393 3300013308 Bacteria 2478
227 Ga0157375_10227698 3300013308 Bacteria 2023
228 Ga0163163_10004815 3300014325 Bacteria 11592
229 Ga0163163_10029832 3300014325 Bacteria 5249
230 Ga0163163_10488192 3300014325 Bacteria 1293
231 Ga0157380_10041631 3300014326 Bacteria 3586
232 Ga0157380_10057365 3300014326 Bacteria 3101
233 Ga0157377_10008318 3300014745 Bacteria 5056
234 Ga0157379_10058621 3300014968 Bacteria 3443
235 Ga0157376_10064236 3300014969 Bacteria 3095
236 Ga0157376_10214536 3300014969 Bacteria 1779
237 Ga0163161_10029219 3300017792 Bacteria 3919
238 Ga0206353_11757508 3300020082 Bacteria 5739
239 Ga0224572_1033053 3300024225 Bacteria 984
240 Ga0207666_1000058 3300025271 Bacteria 19987
241 Ga0207666_1001163 3300025271 Bacteria 3097
242 Ga0207673_1000304 3300025290 Bacteria 4956
243 Ga0207697_10002181 3300025315 Bacteria 10236
244 Ga0207697_10037066 3300025315 Bacteria 1997
245 Ga0207653_10009697 3300025885 Bacteria 3002
246 Ga0207682_10000062 3300025893 Bacteria 46841
247 Ga0207642_10018823 3300025899 Bacteria 2660
248 Ga0207710_10014353 3300025900 Bacteria 3339
249 Ga0207710_10088695 3300025900 Bacteria 1445
250 Ga0207688_10000104 3300025901 Bacteria 33727
251 Ga0207647_10023538 3300025904 Bacteria 4073
252 Ga0207647_10024001 3300025904 Bacteria 4024
253 Ga0207699_10100105 3300025906 Bacteria 1838
254 Ga0207645_10000248 3300025907 Bacteria 44949
255 Ga0207643_10000064 3300025908 Bacteria 70490
256 Ga0207654_10027740 3300025911 Bacteria 3081
257 Ga0207707_10017172 3300025912 Bacteria 6306
258 Ga0207707_10021923 3300025912 Bacteria 5583
259 Ga0207707_10082488 3300025912 Bacteria 2807
260 Ga0207707_10102346 3300025912 Bacteria 2503
261 Ga0207707_10337076 3300025912 Bacteria 1301
262 Ga0207695_10378440 3300025913 Bacteria 1301
263 Ga0207693_10012179 3300025915 Bacteria 6947
264 Ga0207693_10037909 3300025915 Bacteria 3798
265 Ga0207693_10057260 3300025915 Bacteria 3055
266 Ga0207693_10260203 3300025915 Bacteria 1361
267 Ga0207663_10078745 3300025916 Bacteria 2150
268 Ga0207663_10100609 3300025916 Bacteria 1940
269 Ga0207660_10031484 3300025917 Bacteria 3654
270 Ga0207662_10000134 3300025918 Bacteria 35725
271 Ga0207662_10013070 3300025918 Bacteria 4638
272 Ga0207657_10001575 3300025919 Bacteria 24490
273 Ga0207657_10012774 3300025919 Bacteria 8269
274 Ga0207649_10058832 3300025920 Bacteria 2408
275 Ga0207652_10018868 3300025921 Bacteria 5661
276 Ga0207652_10057841 3300025921 Bacteria 3340
277 Ga0207681_10050723 3300025923 Bacteria 2808
278 Ga0207681_10083028 3300025923 Bacteria 2266
279 Ga0207694_10060989 3300025924 Bacteria 2935
280 Ga0207650_10036151 3300025925 Bacteria 3591
281 Ga0207659_10001851 3300025926 Bacteria 12533
282 Ga0207659_10051095 3300025926 Bacteria 2939
283 Ga0207687_10002717 3300025927 Bacteria 11972
284 Ga0207687_10064367 3300025927 Bacteria 2600
285 Ga0207700_10030080 3300025928 Bacteria 3841
286 Ga0207700_10081002 3300025928 Bacteria 2534
287 Ga0207664_10332895 3300025929 Bacteria 1341
288 Ga0207644_10004656 3300025931 Bacteria 8915
289 Ga0207690_10038716 3300025932 Bacteria 3105
290 Ga0207706_10007687 3300025933 Bacteria 9953
291 Ga0207706_10033234 3300025933 Bacteria 4592
292 Ga0207706_10040480 3300025933 Bacteria 4130
293 Ga0207686_10030432 3300025934 Bacteria 3196
294 Ga0207709_10031872 3300025935 Bacteria 3083
295 Ga0207709_10031873 3300025935 Bacteria 3083
296 Ga0207709_10051583 3300025935 Bacteria 2522
297 Ga0207670_10038449 3300025936 Bacteria 3125
298 Ga0207670_10066251 3300025936 Bacteria 2481
299 Ga0207670_10077466 3300025936 Bacteria 2316
300 Ga0207669_10010545 3300025937 Bacteria 4452
301 Ga0207704_10022978 3300025938 Bacteria 3352
302 Ga0207665_10079262 3300025939 Bacteria 2258
303 Ga0207665_10170781 3300025939 Bacteria 1570
304 Ga0207691_10004339 3300025940 Bacteria 13762
305 Ga0207691_10159730 3300025940 Bacteria 1978
306 Ga0207711_10008358 3300025941 Bacteria 8662
307 Ga0207689_10001739 3300025942 Bacteria 20560
308 Ga0207661_10000098 3300025944 Bacteria 55518
309 Ga0207679_10000174 3300025945 Bacteria 53051
310 Ga0207679_10122262 3300025945 Bacteria 2074
311 Ga0207667_10062587 3300025949 Bacteria 3890
312 Ga0207651_10000786 3300025960 Bacteria 13625
313 Ga0207651_10058567 3300025960 Bacteria 2663
314 Ga0207712_10021461 3300025961 Bacteria 4240
315 Ga0207668_10530956 3300025972 Unclassified 1016
316 Ga0207640_10008270 3300025981 Bacteria 5774
317 Ga0207658_10060993 3300025986 Bacteria 2816
318 Ga0207658_10221421 3300025986 Bacteria 1592
319 Ga0207677_10019916 3300026023 Bacteria 4062
320 Ga0207703_10001605 3300026035 Bacteria 20452
321 Ga0207703_10058384 3300026035 Bacteria 3149
322 Ga0207703_10178928 3300026035 Bacteria 1871
323 Ga0207639_10082617 3300026041 Bacteria 2547
324 Ga0207678_10029099 3300026067 Bacteria 4821
325 Ga0207708_10022585 3300026075 Bacteria 4751
326 Ga0207702_10120281 3300026078 Bacteria 2349
327 Ga0207641_10052471 3300026088 Bacteria 3453
328 Ga0207648_10004808 3300026089 Bacteria 13780
329 Ga0207648_10028161 3300026089 Bacteria 4983
330 Ga0207648_10270515 3300026089 Bacteria 1518
331 Ga0207676_10070191 3300026095 Bacteria 2808
332 Ga0207674_10011184 3300026116 Bacteria 10091
333 Ga0207674_10099929 3300026116 Bacteria 2883
334 Ga0207675_100001176 3300026118 Bacteria 26064
335 Ga0207675_100032335 3300026118 Bacteria 4873
336 Ga0207683_10007909 3300026121 Bacteria 9096
337 Ga0207683_10443334 3300026121 Bacteria 1196
338 Ga0207698_11023976 3300026142 Bacteria 837
339 Ga0210002_1002216 3300027617 Bacteria 2809
340 Ga0209971_1009754 3300027682 Bacteria 2274
341 Ga0209971_1064312 3300027682 Bacteria 889
342 Ga0209966_1002673 3300027695 Bacteria 2982
343 Ga0209998_10002525 3300027717 Bacteria 4168
344 Ga0209998_10002759 3300027717 Bacteria 3964
345 Ga0209813_10003725 3300027866 Bacteria 3591
346 Ga0209974_10026056 3300027876 Bacteria 1936
347 Ga0207428_10000075 3300027907 Bacteria 137887
348 Ga0207428_10000513 3300027907 Bacteria 46311
349 Ga0207428_10001650 3300027907 Bacteria 23209
350 Ga0268266_10145078 3300028379 Bacteria 2133
351 Ga0268265_10233338 3300028380 Bacteria 1618
352 Ga0268264_10077515 3300028381 Bacteria 2831
353 Ga0268264_10115664 3300028381 Bacteria 2356
354 Ga0265337_1001558 3300028556 Bacteria 11236
355 Ga0265338_10056280 3300028800 Bacteria 3489
356 Ga0265338_10094758 3300028800 Bacteria 2455
357 Ga0265330_10131359 3300031235 Bacteria 1065
358 Ga0265325_10000398 3300031241 Bacteria 30875
359 Ga0265325_10049082 3300031241 Bacteria 2180
360 Ga0265325_10080091 3300031241 Bacteria 1625
361 Ga0265339_10002964 3300031249 Bacteria 11989
362 Ga0265339_10061509 3300031249 Bacteria 2021
363 Ga0265339_10106907 3300031249 Bacteria 1451
364 Ga0265316_10153918 3300031344 Bacteria 1721
365 Ga0265316_10263032 3300031344 Bacteria 1264
366 Ga0265313_10006372 3300031595 Bacteria 8386
367 Ga0265313_10018880 3300031595 Bacteria 3858
368 Ga0265313_10104208 3300031595 Bacteria 1255
369 Ga0265313_10124610 3300031595 Bacteria 1121
370 Ga0316579_10162430 3300031691 Bacteria 1079
371 Ga0265314_10053795 3300031711 Bacteria 2790
372 Ga0265342_10011396 3300031712 Bacteria 6090
373 Ga0373930_0005168 3300034816 Bacteria 2158
374 Ga0373950_0018326 3300034818 Bacteria 1214
375 Ga0373958_0000115 3300034819 Bacteria 8645
376 Ga0373958_0006733 3300034819 Unclassified 1803
377 Ga0373959_0000953 3300034820 Bacteria 4846
378 Ga0373959_0015328 3300034820 Bacteria 1406
379 Ga0373938_0000029 3300034957 Bacteria 18778
380 Ga0373938_0002765 3300034957 Bacteria 2831
381 Ga0373928_0000121 3300035084 Bacteria 14499
382 Ga0373928_0001807 3300035084 Bacteria 4166
383 Ga0373929_0001284 3300035085 Bacteria 4849
384 Ga0373929_0053344 3300035085 Bacteria 929
385 Ga0373934_0072016 3300035086 Bacteria 1383
386 Ga0373940_0000632 3300035088 Bacteria 5634
387 Ga0373940_0010069 3300035088 Bacteria 2213
388 Ga0373949_0002317 3300035090 Bacteria 4946
389 Ga0373949_0010686 3300035090 Bacteria 2013
390 Ga0373951_0000245 3300035091 Bacteria 18132
391 Ga0373951_0009551 3300035091 Bacteria 2182
392 Ga0373951_0010395 3300035091 Bacteria 2089
393 Ga0373952_0000027 3300035092 Bacteria 16625
394 Ga0373952_0002479 3300035092 Bacteria 3328
395 Ga0373923_0057499 3300035111 Bacteria 1645
396 Ga0373932_0000184 3300035112 Bacteria 18145
397 Ga0373932_0008264 3300035112 Bacteria 2486
398 Ga0373939_0002514 3300035114 Bacteria 4316
399 Ga0373939_0013344 3300035114 Bacteria 2112
400 Ga0373941_0001231 3300035115 Bacteria 5371
401 Ga0373953_0019775 3300035117 Bacteria 2509
402 Ga0373953_0093834 3300035117 Bacteria 1257
403 Ga0373954_0011707 3300035118 Bacteria 3892
404 Ga0373954_0014085 3300035118 Bacteria 3565
405 Ga0373956_0017813 3300035119 Bacteria 3001
406 Ga0373956_0196156 3300035119 Bacteria 956
407 Ga0373957_0012150 3300035120 Bacteria 2892
408 Ga0373957_0046677 3300035120 Bacteria 1645
409 Ga0373957_0048552 3300035120 Bacteria 1618
410 Ga0373960_0000954 3300035121 Bacteria 6212
411 Ga0373960_0011280 3300035121 Bacteria 2199
412 Ga0373960_0012254 3300035121 Bacteria 2127
413 Ga0373943_0102588 3300035170 Bacteria 1498
414 Ga0373955_0009584 3300035172 Bacteria 4544
415 Ga0373942_0000413 3300035207 Bacteria 11943
416 Ga0373942_0003298 3300035207 Bacteria 3800
417 Ga0373961_0006713 3300035241 Bacteria 2767
418 Ga0373962_0019611 3300035242 Bacteria 1770
419 Ga0373924_0025238 3300035410 Bacteria 2349
420 Ga0373931_0017929 3300035691 Bacteria 3511
421 Ga0373931_0019490 3300035691 Bacteria 3386
422 Ga0373935_0199320 3300035692 Bacteria 1382
423 Ga0373927_0028383 3300035695 Bacteria 3649
424 Ga0373933_0001260 3300035724 Bacteria 14949
425 Ga0373933_0001594 3300035724 Bacteria 13285
426 Ga0373933_0055454 3300035724 Bacteria 2378
427 Ga0373947_0011238 3300035725 Bacteria 5137
428 Ga0373937_0002059 3300036401 Bacteria 16802
429 Ga0373937_0005468 3300036401 Bacteria 10879
430 Ga0373937_0011313 3300036401 Bacteria 7827
431 Ga0373937_0025330 3300036401 Bacteria 5355
432 Ga0373937_0634331 3300036401 Bacteria 1014
433 Ga0373925_0058527 3300037068 Bacteria 2890
434 Ga0373925_0153626 3300037068 Bacteria 1809
435 Ga0373925_0236795 3300037068 Bacteria 1461
436 Ga0242419_000779 3300038698 Bacteria 1817
437 Ga0242420_009034 3300038996 Bacteria 1629
438 Ga0436365_0592838 3300039437 Bacteria 5457
439 Ga0451789_0289166 3300041443 Bacteria 820
440 Ga0439464_0051376 3300042439 Unclassified 1193
441 Ga0439460_0018060 3300042461 Bacteria 1896
442 Ga0451577_0099082 3300042876 Bacteria 2603
443 Ga0466966_0075655 3300044684 Bacteria 2103
444 Ga0466961_0037785 3300044693 Bacteria 3097
445 Ga0466963_0139045 3300044694 Bacteria 1681
446 Ga0466957_0060726 3300044842 Bacteria 2318
447 Ga0466959_0144643 3300045049 Bacteria 1678
448 Ga0451576_0013919 3300045051 Bacteria 8983
449 Ga0495592_0000977 3300046454 Bacteria 19838
450 Ga0495592_0005236 3300046454 Bacteria 9564
451 Ga0495592_0064072 3300046454 Bacteria 2695
452 Ga0495592_0083431 3300046454 Bacteria 2307
453 Ga0495592_0175888 3300046454 Bacteria 1462
454 Ga0495603_0235693 3300046455 Bacteria 1055
455 Ga0495603_0256376 3300046455 Bacteria 1007
456 Ga0495629_0012459 3300046459 Bacteria 6159
457 Ga0495651_0001229 3300046462 Bacteria 19817
458 Ga0495651_0063577 3300046462 Bacteria 2820
459 Ga0495651_0093622 3300046462 Bacteria 2249
460 Ga0495653_0008785 3300046463 Bacteria 8274
461 Ga0495653_0017398 3300046463 Bacteria 5846
462 Ga0495653_0058844 3300046463 Bacteria 2920
463 Ga0495639_0019558 3300046475 Bacteria 2957
464 Ga0495662_0080669 3300046476 Bacteria 1582
465 Ga0495664_0092553 3300046477 Bacteria 1818
466 Ga0495664_0198053 3300046477 Bacteria 1217
467 Ga0495584_0009511 3300046491 Bacteria 5005
468 Ga0495584_0114429 3300046491 Unclassified 1365
469 Ga0495608_0002079 3300046511 Bacteria 14419
470 Ga0495608_0010323 3300046511 Bacteria 6517
471 Ga0495618_0006214 3300046514 Bacteria 7248
472 Ga0495618_0066540 3300046514 Bacteria 2290
473 Ga0495618_0263552 3300046514 Bacteria 1078
474 Ga0495628_0002874 3300046516 Bacteria 15429
475 Ga0495628_0058341 3300046516 Bacteria 3033
476 Ga0495628_0070950 3300046516 Bacteria 2715
477 Ga0495630_0162156 3300046517 Bacteria 1702
478 Ga0495630_0251416 3300046517 Bacteria 1350
479 Ga0495648_0025233 3300046524 Bacteria 4028
480 Ga0495652_0011201 3300046529 Bacteria 8120
481 Ga0495652_0015643 3300046529 Bacteria 6790
482 Ga0495652_0064134 3300046529 Bacteria 3091
483 Ga0495640_0012149 3300046533 Bacteria 6592
484 Ga0495640_0032609 3300046533 Bacteria 3710
485 Ga0495586_0059313 3300046535 Bacteria 2079
486 Ga0495587_0001517 3300046536 Bacteria 15420
487 Ga0495587_0013260 3300046536 Bacteria 5182
488 Ga0495645_0001520 3300046543 Bacteria 15645
489 Ga0495645_0033460 3300046543 Bacteria 3750
490 Ga0495645_0052120 3300046543 Bacteria 2977
491 Ga0495667_0003504 3300046559 Bacteria 10524
492 Ga0495667_0006970 3300046559 Bacteria 7666
493 Ga0495667_0010321 3300046559 Bacteria 6317
494 Ga0495667_0081150 3300046559 Bacteria 2108
495 Ga0495634_0013659 3300046642 Bacteria 5864
496 Ga0495634_0056342 3300046642 Bacteria 2626
497 Ga0495634_0064248 3300046642 Bacteria 2434
498 Ga0495634_0175633 3300046642 Bacteria 1344
499 Ga0495611_0131437 3300046648 Bacteria 1168
500 Ga0495635_0009233 3300046663 Bacteria 6888
501 Ga0495635_0011873 3300046663 Bacteria 6105
502 Ga0495635_0033017 3300046663 Bacteria 3591
503 Ga0495659_0074672 3300046664 Bacteria 1276
504 Ga0495657_0013755 3300046675 Bacteria 5958
505 Ga0495657_0022880 3300046675 Bacteria 4472
506 Ga0495599_0002791 3300046678 Bacteria 10181
507 Ga0495623_0001343 3300046679 Bacteria 16663
508 Ga0495623_0015018 3300046679 Bacteria 5006
509 Ga0495623_0023847 3300046679 Bacteria 3947
510 Ga0495646_0006053 3300046680 Bacteria 7671
511 Ga0495646_0022295 3300046680 Bacteria 3996
512 Ga0495646_0032748 3300046680 Bacteria 3233
513 Ga0495658_0018993 3300046683 Bacteria 3582
514 Ga0495658_0118916 3300046683 Bacteria 1596
515 Ga0495669_0125200 3300046684 Unclassified 1207
516 Ga0495613_0038390 3300046689 Bacteria 3550
517 Ga0495613_0086225 3300046689 Bacteria 2277
518 Ga0495624_0077419 3300046690 Bacteria 2063
519 Ga0495600_0004399 3300046809 Bacteria 8427
520 Ga0495600_0013400 3300046809 Bacteria 5152
521 Ga0495600_0052295 3300046809 Bacteria 2667
522 Ga0495600_0193655 3300046809 Bacteria 1306
523 Ga0495581_0068701 3300047315 Bacteria 2049
524 Ga0495604_0005068 3300047317 Bacteria 10428
525 Ga0495604_0021395 3300047317 Bacteria 5164
526 Ga0495604_0032301 3300047317 Bacteria 4150
527 Ga0495604_0096216 3300047317 Bacteria 2186
528 Ga0495674_0008197 3300047319 Bacteria 9970
529 Ga0495674_0073545 3300047319 Bacteria 2946
530 Ga0495674_0086510 3300047319 Bacteria 2683
531 Ga0495674_0096932 3300047319 Bacteria 2512
532 Ga0495674_0280727 3300047319 Bacteria 1364
533 Ga0495676_0167434 3300047321 Bacteria 1549
534 Ga0495680_0003398 3300047322 Bacteria 15707
535 Ga0495680_0003788 3300047322 Bacteria 14702
536 Ga0495680_0006593 3300047322 Bacteria 10770
537 Ga0495680_0094179 3300047322 Bacteria 2241
538 Ga0495675_0002111 3300047444 Bacteria 11859
539 Ga0495684_0036214 3300047471 Bacteria 3784
540 Ga0495686_0049876 3300047472 Bacteria 2632
541 Ga0495686_0102437 3300047472 Bacteria 1725
542 Ga0495593_0134252 3300047673 Bacteria 1255
543 Ga0495593_0259270 3300047673 Bacteria 870
544 Ga0495602_0008143 3300048088 Bacteria 10943
545 Ga0495602_0036984 3300048088 Bacteria 4536
546 Ga0495614_0265880 3300048089 Bacteria 787
547 Ga0496100_0004065 3300048903 Bacteria 7713
548 Ga0496101_0017402 3300048904 Bacteria 4875
549 Ga0496101_0026633 3300048904 Bacteria 4020
550 Ga0496102_0285516 3300048905 Unclassified 1555
551 Ga0496103_0028447 3300048906 Bacteria 3392
552 Ga0496103_0029611 3300048906 Bacteria 3328
553 Ga0496103_0066812 3300048906 Bacteria 2244
554 Ga0496104_0000126 3300048907 Bacteria 70488
555 Ga0496104_0041050 3300048907 Bacteria 4337
556 Ga0496104_0045945 3300048907 Bacteria 4109
557 Ga0496104_0186823 3300048907 Bacteria 1983
558 Ga0496105_0001562 3300048908 Bacteria 16224
559 Ga0496105_0009019 3300048908 Bacteria 7783
560 Ga0496106_0018040 3300048909 Bacteria 5217
561 Ga0496106_0019136 3300048909 Bacteria 5076
562 Ga0496106_0074272 3300048909 Bacteria 2602
563 Ga0496107_0015179 3300048910 Bacteria 5396
564 Ga0496107_0051373 3300048910 Bacteria 2973
565 Ga0496107_0061807 3300048910 Bacteria 2712
566 Ga0496107_0079988 3300048910 Bacteria 2383
567 Ga0496107_0292030 3300048910 Bacteria 1213
568 Ga0496108_0004643 3300048911 Bacteria 11074
569 Ga0496108_0032262 3300048911 Bacteria 4350
570 Ga0496109_0000188 3300048912 Bacteria 61633
571 Ga0496109_0000831 3300048912 Bacteria 25758
572 Ga0496109_0045459 3300048912 Bacteria 3985
573 Ga0496110_0018071 3300048913 Bacteria 5907
574 Ga0496110_0107676 3300048913 Bacteria 2502
575 Ga0496110_0232069 3300048913 Bacteria 1678
576 Ga0496111_0005732 3300048914 Bacteria 8009
577 Ga0496111_0051979 3300048914 Bacteria 2959
578 Ga0496111_0087931 3300048914 Bacteria 2275
579 Ga0496111_0428973 3300048914 Bacteria 976
580 Ga0496112_0053867 3300048915 Bacteria 3952
581 Ga0496113_0000478 3300048916 Bacteria 19609
582 Ga0496113_0110473 3300048916 Bacteria 2139
583 Ga0496114_0029292 3300048917 Bacteria 4523
584 Ga0496114_0058254 3300048917 Bacteria 3225
585 Ga0496114_0078927 3300048917 Bacteria 2777
586 Ga0496115_0007975 3300048918 Bacteria 7818
587 Ga0496115_0096288 3300048918 Bacteria 2423
588 Ga0496115_0117874 3300048918 Bacteria 2184
589 Ga0496115_0356921 3300048918 Bacteria 1191
590 Ga0501031_0021508 3300049568 Bacteria 4204
591 Ga0501032_0007580 3300049569 Bacteria 7922
592 Ga0501032_0065423 3300049569 Bacteria 2431
593 Ga0501032_0126039 3300049569 Bacteria 1691
594 Ga0501033_0012528 3300049570 Bacteria 6471
595 Ga0501034_0047775 3300049571 Bacteria 4320
596 Ga0501034_0078675 3300049571 Bacteria 3301
597 Ga0501034_0105996 3300049571 Bacteria 2803
598 Ga0501034_0158358 3300049571 Bacteria 2237
599 Ga0501034_0616440 3300049571 Bacteria 989
600 Ga0501036_0145056 3300049572 Bacteria 2002
601 Ga0501036_0261549 3300049572 Bacteria 1449
602 Ga0501037_0003014 3300049573 Bacteria 12233
603 Ga0501037_0012452 3300049573 Bacteria 6266
604 Ga0501037_0025758 3300049573 Bacteria 4343
605 Ga0501037_0139396 3300049573 Bacteria 1736
606 Ga0501038_0006074 3300049574 Bacteria 11174
607 Ga0501038_0006400 3300049574 Bacteria 10906
608 Ga0501039_0025227 3300049575 Bacteria 4567
609 Ga0501039_0064571 3300049575 Bacteria 2838
610 Ga0501039_0318156 3300049575 Bacteria 1223
611 Ga0501039_0382720 3300049575 Bacteria 1105
612 Ga0501040_0199648 3300049576 Bacteria 1420
613 Ga0501043_0017718 3300049579 Bacteria 5584
614 Ga0501043_0295893 3300049579 Bacteria 1238
615 Ga0501043_0297196 3300049579 Bacteria 1235
616 Ga0501043_0310301 3300049579 Bacteria 1204
617 Ga0501046_0006409 3300049580 Bacteria 10433
618 Ga0501046_0054232 3300049580 Bacteria 3154
619 Ga0501046_0131055 3300049580 Bacteria 1902
620 Ga0501046_0207297 3300049580 Bacteria 1456
621 Ga0501047_0008130 3300049581 Bacteria 9900
622 Ga0501047_0040003 3300049581 Bacteria 4534
623 Ga0501047_0040364 3300049581 Bacteria 4513
624 Ga0501047_0123765 3300049581 Bacteria 2466
625 Ga0501047_0194974 3300049581 Bacteria 1888
626 Ga0501047_0466162 3300049581 Bacteria 1092
627 Ga0501048_0009463 3300049582 Bacteria 7313
628 Ga0501067_0008646 3300049583 Bacteria 5645
629 Ga0501068_0003025 3300049584 Bacteria 8971
630 Ga0501068_0238773 3300049584 Bacteria 1156
631 Ga0501069_0070407 3300049585 Bacteria 1959
632 Ga0501070_0018855 3300049586 Bacteria 5788
633 Ga0501070_0035258 3300049586 Bacteria 4182
634 Ga0501070_0283869 3300049586 Bacteria 1350
635 Ga0501070_0290737 3300049586 Bacteria 1332
636 Ga0501071_0067429 3300049587 Bacteria 2602
637 Ga0501071_0104047 3300049587 Bacteria 2095
638 Ga0501072_0268873 3300049588 Bacteria 1357
639 Ga0501072_0447098 3300049588 Bacteria 1024
640 Ga0501073_0012248 3300049589 Bacteria 6259
641 Ga0501073_0163021 3300049589 Bacteria 1544
642 Ga0501073_0490506 3300049589 Bacteria 850
643 Ga0501074_0019331 3300049590 Bacteria 4948
644 Ga0501074_0169367 3300049590 Bacteria 1559
645 Ga0501075_0216270 3300049591 Bacteria 1462
646 Ga0501076_0055308 3300049592 Bacteria 3147
647 Ga0501077_0036288 3300049593 Bacteria 3140
648 Ga0501080_0015340 3300049742 Bacteria 7061
649 Ga0501080_0037678 3300049742 Bacteria 4515
650 Ga0501080_0068717 3300049742 Bacteria 3295
651 Ga0501083_0030430 3300049744 Bacteria 3709
652 Ga0501083_0044224 3300049744 Bacteria 3015
653 Ga0501083_0176162 3300049744 Bacteria 1397
654 Ga0501035_0009635 3300049822 Bacteria 8983
655 Ga0501035_0388756 3300049822 Bacteria 1162
656 Ga0501035_0457917 3300049822 Bacteria 1054
657 Ga0501035_0607976 3300049822 Bacteria 890
658 Ga0501044_0034371 3300049823 Bacteria 5316
659 Ga0501044_0099753 3300049823 Bacteria 2922
660 Ga0501044_0215223 3300049823 Bacteria 1874
661 Ga0501044_0277177 3300049823 Bacteria 1611
662 Ga0501044_0386085 3300049823 Bacteria 1315
663 Ga0501044_0433333 3300049823 Bacteria 1223
664 Ga0501045_0025005 3300049824 Bacteria 4290
665 nmdc:mga03683_125930_c1 3300050489 Bacteria 1143
666 nmdc:mga03n38_50030_c1 3300050490 Bacteria 1861
667 nmdc:mga00v17_116628_c1 3300050491 Bacteria 1698
668 nmdc:mga00v17_20175_c1 3300050491 Bacteria 2119
669 nmdc:mga0yw44_137254_c2 3300050492 Bacteria 1056
670 nmdc:mga0k408_485526_c1 3300050493 Bacteria 733
671 nmdc:mga06z11_33142_c1 3300050494 Bacteria 2525
672 nmdc:mga06z11_59148_c1 3300050494 Bacteria 1991
673 nmdc:mga04h51_33140_c1 3300050495 Bacteria 1643
674 nmdc:mga07m45_12942_c1 3300050496 Bacteria 4415
675 nmdc:mga07m45_26313_c1 3300050496 Bacteria 3197
676 nmdc:mga07m45_41994_c2 3300050496 Bacteria 2208
677 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
678 nmdc:mga05p37_7430_c1 3300050507 Bacteria 12928
679 nmdc:mga09592_1665_c1 3300050508 Bacteria 17906
680 nmdc:mga0qj67_12610_c1 3300050509 Bacteria 6373
681 nmdc:mga06r32_16533_c1 3300050510 Bacteria 6726
682 nmdc:mga08y16_684_c1 3300050511 Bacteria 32082
683 nmdc:mga08y16_83672_c1 3300050511 Bacteria 3326
684 nmdc:mga0n895_46646_c1 3300050512 Bacteria 4234
685 nmdc:mga0n895_824_c1 3300050512 Bacteria 22214
686 nmdc:mga0n895_9017_c1 3300050512 Bacteria 8700
687 nmdc:mga0rr50_134223_c1 3300050513 Bacteria 1985
688 nmdc:mga0rr50_19008_c1 3300050513 Bacteria 4628
689 nmdc:mga0rr50_265161_c1 3300050513 Bacteria 1430
690 nmdc:mga0rr50_670517_c1 3300050513 Unclassified 885
691 nmdc:mga0a205_109041_c1 3300050515 Bacteria 2667
692 nmdc:mga0a205_2160_c1 3300050515 Bacteria 17293
693 nmdc:mga0a205_216234_c1 3300050515 Bacteria 1803
694 nmdc:mga0a205_31621_c1 3300050515 Bacteria 5072
695 Ga0495601_0000159 3300053077 Bacteria 37216
696 Ga0495601_0004646 3300053077 Bacteria 7952
697 Ga0495601_0004928 3300053077 Bacteria 7748
698 Ga0495601_0029443 3300053077 Bacteria 3405
699 Ga0495601_0040605 3300053077 Bacteria 2914
700 Ga0495612_0000689 3300053078 Bacteria 13637
701 Ga0495612_0004359 3300053078 Bacteria 5870
702 Ga0495612_0015211 3300053078 Bacteria 3085
703 Ga0495595_0000974 3300053084 Bacteria 11030
704 Ga0495595_0014772 3300053084 Bacteria 3319
705 Ga0495595_0017832 3300053084 Bacteria 3058
706 Ga0495619_0000016 3300053085 Bacteria 231442
707 Ga0495619_0001290 3300053085 Bacteria 16473
708 Ga0495619_0048530 3300053085 Bacteria 2798
709 Ga0500578_0104062 3300053086 Bacteria 1794
710 Ga0500643_015552 3300053087 Bacteria 2605
711 Ga0500644_0000552 3300053088 Bacteria 15075
712 Ga0500651_0182986 3300053093 Bacteria 1244
713 Ga0500641_0060664 3300053096 Bacteria 1574
714 Ga0500562_057999 3300053108 Bacteria 1039
715 Ga0500595_000010 3300053119 Bacteria 275806
716 Ga0500595_008002 3300053119 Bacteria 4342
717 Ga0500595_015324 3300053119 Bacteria 2881
718 Ga0500616_0000001 3300053153 Bacteria 1986011
719 Ga0500616_0142151 3300053153 Bacteria 1120
720 Ga0500645_000559 3300053730 Bacteria 24493
721 Ga0501084_0126764 3300054114 Bacteria 2148
722 Ga0501084_0210818 3300054114 Bacteria 1639
723 Ga0501082_0060360 3300060353 Bacteria 3265
724 Ga0501082_0070745 3300060353 Bacteria 3004
725 Ga0501082_0106231 3300060353 Bacteria 2429
726 Ga0501082_0169003 3300060353 Bacteria 1901
727 Ga0466962_0071453 3300061719 Bacteria 1658
728 Ga0466962_0112881 3300061719 Bacteria 1309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046514 Ga0495618_0263552 Ga0495618_0263552_10_642 208
2 3300050493 nmdc:mga0k408_485526_c1 nmdc:mga0k408_485526_c1_20_667 213
3 3300049590 Ga0501074_0019331 Ga0501074_0019331_32_727 230
4 3300005439 Ga0070711_100193921 Ga0070711_1001939211 231
5 3300006038 Ga0075365_10096149 Ga0075365_100961492 231
6 3300035170 Ga0373943_0102588 Ga0373943_0102588_787_1488 231
7 3300049581 Ga0501047_0194974 Ga0501047_0194974_868_1566 231
8 3300049580 Ga0501046_0131055 Ga0501046_0131055_328_1077 232
9 iso_pu_bacteria 2757320392 2757570139 236
10 3300005434 Ga0070709_10014842 Ga0070709_100148422 237
11 3300005436 Ga0070713_100001408 Ga0070713_10000140810 237
12 3300005439 Ga0070711_100008598 Ga0070711_1000085985 237
13 3300025916 Ga0207663_10100609 Ga0207663_101006092 237
14 3300025928 Ga0207700_10030080 Ga0207700_100300803 237
15 3300025939 Ga0207665_10170781 Ga0207665_101707812 237
16 3300039437 Ga0436365_0592838 Ga0436365_0592838_918_1667 237
17 3300046689 Ga0495613_0086225 Ga0495613_0086225_1220_1942 237
18 3300049581 Ga0501047_0466162 Ga0501047_0466162_62_790 237
19 iso_pu_bacteria 2937843397 2937844710 237
20 3300053119 Ga0500595_015324 Ga0500595_015324_136_864 238
21 iso_pu_bacteria 2643221736 2644742495 238
22 iso_pu_bacteria 2738543032 2739356454 238
23 iso_pu_bacteria 2829745981 2829750485 238
24 iso_pu_bacteria 2861691609 2861695928 238
25 iso_pu_bacteria 2902330777 2902331292 238
26 3300005458 Ga0070681_10005125 Ga0070681_1000512511 239
27 3300013104 Ga0157370_10155148 Ga0157370_101551482 239
28 3300053086 Ga0500578_0104062 Ga0500578_0104062_239_982 239
29 3300005340 Ga0070689_100061168 Ga0070689_1000611683 240
30 3300025936 Ga0207670_10066251 Ga0207670_100662512 240
31 3300048914 Ga0496111_0428973 Ga0496111_0428973_39_764 240
32 3300049579 Ga0501043_0310301 Ga0501043_0310301_163_894 240
33 3300049823 Ga0501044_0099753 Ga0501044_0099753_191_922 240
34 3300053153 Ga0500616_0142151 Ga0500616_0142151_179_910 240
35 iso_pu_bacteria 2891048133 2891049593 240
36 iso_pu_bacteria 2995392953 2995396371 240
37 3300047472 Ga0495686_0049876 Ga0495686_0049876_1221_1982 241
38 3300047472 Ga0495686_0102437 Ga0495686_0102437_269_1018 241
39 3300049571 Ga0501034_0105996 Ga0501034_0105996_1201_1932 241
40 3300049574 Ga0501038_0006400 Ga0501038_0006400_4232_4963 241
41 3300049582 Ga0501048_0009463 Ga0501048_0009463_274_1005 241
42 3300049587 Ga0501071_0067429 Ga0501071_0067429_967_1698 241
43 3300049589 Ga0501073_0012248 Ga0501073_0012248_313_1044 241
44 3300049822 Ga0501035_0457917 Ga0501035_0457917_11_742 241
45 3300049824 Ga0501045_0025005 Ga0501045_0025005_1051_1782 241
46 3300053730 Ga0500645_000559 Ga0500645_000559_880_1611 241
47 3300054114 Ga0501084_0126764 Ga0501084_0126764_1106_1837 241
48 3300000043 ARcpr5yngRDRAFT_c000024 ARcpr5yngRDRAFT_0000249 242
49 3300000044 ARSoilOldRDRAFT_c000034 ARSoilOldRDRAFT_00003414 242
50 3300000652 ARCol0yngRDRAFT_1000026 ARCol0yngRDRAFT_100002612 242
51 3300001989 JGI24739J22299_10011920 JGI24739J22299_100119203 242
52 3300001990 JGI24737J22298_10000377 JGI24737J22298_1000037710 242
53 3300002070 JGI24750J21931_1000721 JGI24750J21931_10007213 242
54 3300002073 JGI24745J21846_1000072 JGI24745J21846_10000723 242
55 3300002074 JGI24748J21848_1001393 JGI24748J21848_10013933 242
56 3300002075 JGI24738J21930_10001830 JGI24738J21930_100018303 242
57 3300002076 JGI24749J21850_1001077 JGI24749J21850_10010774 242
58 3300002077 JGI24744J21845_10003744 JGI24744J21845_100037443 242
59 3300002126 JGI24035J26624_1000268 JGI24035J26624_10002684 242
60 3300002239 JGI24034J26672_10003945 JGI24034J26672_100039453 242
61 3300002244 JGI24742J22300_10000140 JGI24742J22300_100001403 242
62 3300005293 Ga0065715_10160156 Ga0065715_101601562 242
63 3300005328 Ga0070676_10012406 Ga0070676_100124064 242
64 3300005329 Ga0070683_100083423 Ga0070683_1000834232 242
65 3300005330 Ga0070690_100018681 Ga0070690_1000186813 242
66 3300005330 Ga0070690_100186021 Ga0070690_1001860212 242
67 3300005331 Ga0070670_100011123 Ga0070670_1000111237 242
68 3300005333 Ga0070677_10001300 Ga0070677_100013002 242
69 3300005334 Ga0068869_100023413 Ga0068869_1000234132 242
70 3300005335 Ga0070666_10022569 Ga0070666_100225694 242
71 3300005336 Ga0070680_100010070 Ga0070680_1000100706 242
72 3300005336 Ga0070680_100016122 Ga0070680_1000161223 242
73 3300005337 Ga0070682_100056018 Ga0070682_1000560181 242
74 3300005338 Ga0068868_100323350 Ga0068868_1003233502 242
75 3300005339 Ga0070660_100035576 Ga0070660_1000355763 242
76 3300005339 Ga0070660_100156701 Ga0070660_1001567011 242
77 3300005340 Ga0070689_100191463 Ga0070689_1001914632 242
78 3300005341 Ga0070691_10004569 Ga0070691_100045693 242
79 3300005343 Ga0070687_100000813 Ga0070687_1000008133 242
80 3300005344 Ga0070661_100013566 Ga0070661_1000135663 242
81 3300005344 Ga0070661_100018789 Ga0070661_1000187893 242
82 3300005347 Ga0070668_100093924 Ga0070668_1000939242 242
83 3300005353 Ga0070669_100005635 Ga0070669_1000056353 242
84 3300005354 Ga0070675_100004413 Ga0070675_1000044138 242
85 3300005355 Ga0070671_100008712 Ga0070671_1000087125 242
86 3300005355 Ga0070671_100021644 Ga0070671_1000216444 242
87 3300005364 Ga0070673_100002330 Ga0070673_1000023305 242
88 3300005364 Ga0070673_100016208 Ga0070673_1000162083 242
89 3300005365 Ga0070688_100018721 Ga0070688_1000187213 242
90 3300005366 Ga0070659_100030373 Ga0070659_1000303733 242
91 3300005366 Ga0070659_100156613 Ga0070659_1001566132 242
92 3300005367 Ga0070667_100004935 Ga0070667_1000049358 242
93 3300005367 Ga0070667_100061488 Ga0070667_1000614883 242
94 3300005406 Ga0070703_10002976 Ga0070703_100029764 242
95 3300005435 Ga0070714_100018460 Ga0070714_1000184603 242
96 3300005436 Ga0070713_100017458 Ga0070713_1000174583 242
97 3300005437 Ga0070710_10136384 Ga0070710_101363842 242
98 3300005438 Ga0070701_10001696 Ga0070701_100016964 242
99 3300005439 Ga0070711_100127826 Ga0070711_1001278262 242
100 3300005440 Ga0070705_100103005 Ga0070705_1001030052 242
101 3300005441 Ga0070700_100002054 Ga0070700_1000020546 242
102 3300005444 Ga0070694_100026395 Ga0070694_1000263953 242
103 3300005445 Ga0070708_100041127 Ga0070708_1000411273 242
104 3300005455 Ga0070663_100011055 Ga0070663_1000110554 242
105 3300005456 Ga0070678_100014241 Ga0070678_1000142414 242
106 3300005457 Ga0070662_100043603 Ga0070662_1000436033 242
107 3300005458 Ga0070681_10067109 Ga0070681_100671093 242
108 3300005458 Ga0070681_10102977 Ga0070681_101029773 242
109 3300005458 Ga0070681_10169050 Ga0070681_101690502 242
110 3300005459 Ga0068867_100049799 Ga0068867_1000497992 242
111 3300005459 Ga0068867_100330419 Ga0068867_1003304191 242
112 3300005466 Ga0070685_10001256 Ga0070685_1000125610 242
113 3300005466 Ga0070685_10355659 Ga0070685_103556591 242
114 3300005530 Ga0070679_100032427 Ga0070679_1000324272 242
115 3300005530 Ga0070679_100038222 Ga0070679_1000382222 242
116 3300005535 Ga0070684_100119777 Ga0070684_1001197773 242
117 3300005536 Ga0070697_100147289 Ga0070697_1001472892 242
118 3300005539 Ga0068853_100038342 Ga0068853_1000383423 242
119 3300005543 Ga0070672_100024585 Ga0070672_1000245853 242
120 3300005544 Ga0070686_100025615 Ga0070686_1000256153 242
121 3300005544 Ga0070686_100114625 Ga0070686_1001146252 242
122 3300005545 Ga0070695_100025578 Ga0070695_1000255783 242
123 3300005546 Ga0070696_100034656 Ga0070696_1000346563 242
124 3300005546 Ga0070696_100050348 Ga0070696_1000503483 242
125 3300005546 Ga0070696_100136513 Ga0070696_1001365132 242
126 3300005547 Ga0070693_100017824 Ga0070693_1000178242 242
127 3300005547 Ga0070693_100179345 Ga0070693_1001793452 242
128 3300005548 Ga0070665_100127551 Ga0070665_1001275512 242
129 3300005549 Ga0070704_100012551 Ga0070704_1000125513 242
130 3300005563 Ga0068855_100025265 Ga0068855_1000252651 242
131 3300005563 Ga0068855_100030348 Ga0068855_1000303482 242
132 3300005563 Ga0068855_100053635 Ga0068855_1000536354 242
133 3300005564 Ga0070664_100031021 Ga0070664_1000310213 242
134 3300005564 Ga0070664_100742398 Ga0070664_1007423981 242
135 3300005577 Ga0068857_100037204 Ga0068857_1000372042 242
136 3300005578 Ga0068854_100003787 Ga0068854_1000037876 242
137 3300005578 Ga0068854_100163745 Ga0068854_1001637452 242
138 3300005614 Ga0068856_100017870 Ga0068856_1000178704 242
139 3300005614 Ga0068856_100023277 Ga0068856_1000232772 242
140 3300005614 Ga0068856_100199086 Ga0068856_1001990862 242
141 3300005614 Ga0068856_100272412 Ga0068856_1002724121 242
142 3300005615 Ga0070702_100135118 Ga0070702_1001351182 242
143 3300005615 Ga0070702_100154732 Ga0070702_1001547322 242
144 3300005616 Ga0068852_100033497 Ga0068852_1000334972 242
145 3300005617 Ga0068859_100000920 Ga0068859_10000092022 242
146 3300005618 Ga0068864_100029360 Ga0068864_1000293602 242
147 3300005718 Ga0068866_10000295 Ga0068866_100002953 242
148 3300005719 Ga0068861_100082305 Ga0068861_1000823053 242
149 3300005840 Ga0068870_10000803 Ga0068870_100008038 242
150 3300005841 Ga0068863_100009214 Ga0068863_1000092146 242
151 3300005842 Ga0068858_100007950 Ga0068858_1000079505 242
152 3300005842 Ga0068858_100150859 Ga0068858_1001508593 242
153 3300005843 Ga0068860_100082132 Ga0068860_1000821322 242
154 3300005843 Ga0068860_100178037 Ga0068860_1001780372 242
155 3300005844 Ga0068862_100253237 Ga0068862_1002532372 242
156 3300005937 Ga0081455_10000059 Ga0081455_1000005976 242
157 3300005937 Ga0081455_10003227 Ga0081455_100032273 242
158 3300005937 Ga0081455_10007580 Ga0081455_100075802 242
159 3300005937 Ga0081455_10025599 Ga0081455_100255992 242
160 3300005983 Ga0081540_1019697 Ga0081540_10196973 242
161 3300006028 Ga0070717_10456688 Ga0070717_104566882 242
162 3300006048 Ga0075363_100094831 Ga0075363_1000948312 242
163 3300006051 Ga0075364_10031734 Ga0075364_100317344 242
164 3300006175 Ga0070712_100210933 Ga0070712_1002109332 242
165 3300006177 Ga0075362_10021352 Ga0075362_100213522 242
166 3300006178 Ga0075367_10142533 Ga0075367_101425332 242
167 3300006237 Ga0097621_100004720 Ga0097621_1000047206 242
168 3300006358 Ga0068871_100011297 Ga0068871_1000112974 242
169 3300006846 Ga0075430_100000094 Ga0075430_1000000943 242
170 3300006847 Ga0075431_100002415 Ga0075431_10000241515 242
171 3300006852 Ga0075433_10000311 Ga0075433_1000031129 242
172 3300006852 Ga0075433_10091058 Ga0075433_100910583 242
173 3300006871 Ga0075434_100009504 Ga0075434_1000095045 242
174 3300006871 Ga0075434_100042656 Ga0075434_1000426562 242
175 3300006880 Ga0075429_100001750 Ga0075429_10000175015 242
176 3300006881 Ga0068865_100048747 Ga0068865_1000487473 242
177 3300006914 Ga0075436_100094044 Ga0075436_1000940442 242
178 3300006931 Ga0097620_100000920 Ga0097620_10000092022 242
179 3300007076 Ga0075435_100089551 Ga0075435_1000895511 242
180 3300009036 Ga0105244_10007516 Ga0105244_100075163 242
181 3300009092 Ga0105250_10023618 Ga0105250_100236183 242
182 3300009093 Ga0105240_10028382 Ga0105240_100283826 242
183 3300009093 Ga0105240_10250534 Ga0105240_102505341 242
184 3300009094 Ga0111539_10002742 Ga0111539_100027426 242
185 3300009094 Ga0111539_10003209 Ga0111539_100032095 242
186 3300009094 Ga0111539_10047268 Ga0111539_100472684 242
187 3300009098 Ga0105245_10000183 Ga0105245_100001834 242
188 3300009101 Ga0105247_10004155 Ga0105247_100041557 242
189 3300009101 Ga0105247_10032128 Ga0105247_100321283 242
190 3300009147 Ga0114129_10006608 Ga0114129_1000660812 242
191 3300009147 Ga0114129_10112310 Ga0114129_101123104 242
192 3300009148 Ga0105243_10032095 Ga0105243_100320953 242
193 3300009148 Ga0105243_10054799 Ga0105243_100547993 242
194 3300009174 Ga0105241_10004816 Ga0105241_100048163 242
195 3300009176 Ga0105242_10082236 Ga0105242_100822362 242
196 3300009177 Ga0105248_10006282 Ga0105248_100062824 242
197 3300009177 Ga0105248_10013499 Ga0105248_100134994 242
198 3300009177 Ga0105248_10029374 Ga0105248_100293744 242
199 3300009177 Ga0105248_10182565 Ga0105248_101825653 242
200 3300009545 Ga0105237_10191401 Ga0105237_101914011 242
201 3300009545 Ga0105237_10191836 Ga0105237_101918362 242
202 3300009551 Ga0105238_10157368 Ga0105238_101573683 242
203 3300009553 Ga0105249_10006556 Ga0105249_100065561 242
204 3300009553 Ga0105249_10008411 Ga0105249_100084116 242
205 3300010375 Ga0105239_10059786 Ga0105239_100597863 242
206 3300010375 Ga0105239_10073618 Ga0105239_100736183 242
207 3300011119 Ga0105246_10007150 Ga0105246_100071503 242
208 3300012507 Ga0157342_1006973 Ga0157342_10069731 242
209 3300013102 Ga0157371_10010950 Ga0157371_100109504 242
210 3300013104 Ga0157370_10092783 Ga0157370_100927832 242
211 3300013104 Ga0157370_10193349 Ga0157370_101933492 242
212 3300013105 Ga0157369_10917613 Ga0157369_109176132 242
213 3300013296 Ga0157374_10009979 Ga0157374_100099793 242
214 3300013296 Ga0157374_10092180 Ga0157374_100921802 242
215 3300013297 Ga0157378_10019352 Ga0157378_100193523 242
216 3300013297 Ga0157378_10519932 Ga0157378_105199322 242
217 3300013306 Ga0163162_10009250 Ga0163162_100092507 242
218 3300013306 Ga0163162_10103180 Ga0163162_101031803 242
219 3300013307 Ga0157372_10030572 Ga0157372_100305723 242
220 3300013308 Ga0157375_10030035 Ga0157375_100300354 242
221 3300013308 Ga0157375_10148393 Ga0157375_101483933 242
222 3300013308 Ga0157375_10227698 Ga0157375_102276983 242
223 3300014325 Ga0163163_10004815 Ga0163163_100048157 242
224 3300014325 Ga0163163_10029832 Ga0163163_100298322 242
225 3300014325 Ga0163163_10488192 Ga0163163_104881922 242
226 3300014326 Ga0157380_10041631 Ga0157380_100416313 242
227 3300014326 Ga0157380_10057365 Ga0157380_100573653 242
228 3300014745 Ga0157377_10008318 Ga0157377_100083183 242
229 3300014968 Ga0157379_10058621 Ga0157379_100586213 242
230 3300014969 Ga0157376_10064236 Ga0157376_100642363 242
231 3300014969 Ga0157376_10214536 Ga0157376_102145362 242
232 3300017792 Ga0163161_10029219 Ga0163161_100292194 242
233 3300020082 Ga0206353_11757508 Ga0206353_117575082 242
234 3300024225 Ga0224572_1033053 Ga0224572_10330531 242
235 3300025271 Ga0207666_1000058 Ga0207666_100005814 242
236 3300025290 Ga0207673_1000304 Ga0207673_10003044 242
237 3300025315 Ga0207697_10002181 Ga0207697_100021817 242
238 3300025885 Ga0207653_10009697 Ga0207653_100096973 242
239 3300025893 Ga0207682_10000062 Ga0207682_1000006243 242
240 3300025899 Ga0207642_10018823 Ga0207642_100188233 242
241 3300025900 Ga0207710_10014353 Ga0207710_100143533 242
242 3300025900 Ga0207710_10088695 Ga0207710_100886952 242
243 3300025901 Ga0207688_10000104 Ga0207688_100001049 242
244 3300025904 Ga0207647_10023538 Ga0207647_100235383 242
245 3300025906 Ga0207699_10100105 Ga0207699_101001052 242
246 3300025907 Ga0207645_10000248 Ga0207645_1000024842 242
247 3300025908 Ga0207643_10000064 Ga0207643_1000006423 242
248 3300025911 Ga0207654_10027740 Ga0207654_100277403 242
249 3300025912 Ga0207707_10017172 Ga0207707_100171726 242
250 3300025912 Ga0207707_10082488 Ga0207707_100824882 242
251 3300025912 Ga0207707_10102346 Ga0207707_101023463 242
252 3300025912 Ga0207707_10337076 Ga0207707_103370762 242
253 3300025915 Ga0207693_10012179 Ga0207693_100121796 242
254 3300025915 Ga0207693_10037909 Ga0207693_100379093 242
255 3300025915 Ga0207693_10260203 Ga0207693_102602031 242
256 3300025916 Ga0207663_10078745 Ga0207663_100787452 242
257 3300025917 Ga0207660_10031484 Ga0207660_100314843 242
258 3300025918 Ga0207662_10000134 Ga0207662_1000013422 242
259 3300025919 Ga0207657_10001575 Ga0207657_100015754 242
260 3300025919 Ga0207657_10012774 Ga0207657_100127745 242
261 3300025920 Ga0207649_10058832 Ga0207649_100588322 242
262 3300025921 Ga0207652_10018868 Ga0207652_100188686 242
263 3300025921 Ga0207652_10057841 Ga0207652_100578413 242
264 3300025923 Ga0207681_10050723 Ga0207681_100507232 242
265 3300025924 Ga0207694_10060989 Ga0207694_100609892 242
266 3300025925 Ga0207650_10036151 Ga0207650_100361512 242
267 3300025926 Ga0207659_10001851 Ga0207659_100018514 242
268 3300025926 Ga0207659_10051095 Ga0207659_100510952 242
269 3300025927 Ga0207687_10002717 Ga0207687_100027174 242
270 3300025927 Ga0207687_10064367 Ga0207687_100643673 242
271 3300025928 Ga0207700_10081002 Ga0207700_100810023 242
272 3300025929 Ga0207664_10332895 Ga0207664_103328952 242
273 3300025931 Ga0207644_10004656 Ga0207644_100046565 242
274 3300025932 Ga0207690_10038716 Ga0207690_100387163 242
275 3300025933 Ga0207706_10007687 Ga0207706_100076873 242
276 3300025933 Ga0207706_10040480 Ga0207706_100404802 242
277 3300025934 Ga0207686_10030432 Ga0207686_100304323 242
278 3300025935 Ga0207709_10031872 Ga0207709_100318722 242
279 3300025935 Ga0207709_10031873 Ga0207709_100318732 242
280 3300025936 Ga0207670_10077466 Ga0207670_100774663 242
281 3300025937 Ga0207669_10010545 Ga0207669_100105453 242
282 3300025938 Ga0207704_10022978 Ga0207704_100229783 242
283 3300025939 Ga0207665_10079262 Ga0207665_100792622 242
284 3300025940 Ga0207691_10004339 Ga0207691_100043398 242
285 3300025941 Ga0207711_10008358 Ga0207711_100083584 242
286 3300025942 Ga0207689_10001739 Ga0207689_1000173912 242
287 3300025944 Ga0207661_10000098 Ga0207661_1000009849 242
288 3300025945 Ga0207679_10000174 Ga0207679_1000017450 242
289 3300025945 Ga0207679_10122262 Ga0207679_101222623 242
290 3300025949 Ga0207667_10062587 Ga0207667_100625874 242
291 3300025960 Ga0207651_10000786 Ga0207651_100007865 242
292 3300025960 Ga0207651_10058567 Ga0207651_100585672 242
293 3300025961 Ga0207712_10021461 Ga0207712_100214613 242
294 3300025972 Ga0207668_10530956 Ga0207668_105309562 242
295 3300025981 Ga0207640_10008270 Ga0207640_100082704 242
296 3300025986 Ga0207658_10060993 Ga0207658_100609932 242
297 3300026023 Ga0207677_10019916 Ga0207677_100199164 242
298 3300026035 Ga0207703_10001605 Ga0207703_100016053 242
299 3300026035 Ga0207703_10058384 Ga0207703_100583843 242
300 3300026041 Ga0207639_10082617 Ga0207639_100826172 242
301 3300026067 Ga0207678_10029099 Ga0207678_100290994 242
302 3300026075 Ga0207708_10022585 Ga0207708_100225853 242
303 3300026078 Ga0207702_10120281 Ga0207702_101202813 242
304 3300026088 Ga0207641_10052471 Ga0207641_100524712 242
305 3300026089 Ga0207648_10004808 Ga0207648_100048089 242
306 3300026089 Ga0207648_10270515 Ga0207648_102705151 242
307 3300026095 Ga0207676_10070191 Ga0207676_100701913 242
308 3300026116 Ga0207674_10011184 Ga0207674_100111843 242
309 3300026118 Ga0207675_100001176 Ga0207675_10000117615 242
310 3300026121 Ga0207683_10007909 Ga0207683_100079097 242
311 3300026121 Ga0207683_10443334 Ga0207683_104433341 242
312 3300026142 Ga0207698_11023976 Ga0207698_110239761 242
313 3300027617 Ga0210002_1002216 Ga0210002_10022163 242
314 3300027682 Ga0209971_1064312 Ga0209971_10643121 242
315 3300027695 Ga0209966_1002673 Ga0209966_10026732 242
316 3300027717 Ga0209998_10002759 Ga0209998_100027594 242
317 3300027876 Ga0209974_10026056 Ga0209974_100260562 242
318 3300027907 Ga0207428_10000075 Ga0207428_1000007519 242
319 3300027907 Ga0207428_10000513 Ga0207428_100005134 242
320 3300028379 Ga0268266_10145078 Ga0268266_101450782 242
321 3300028381 Ga0268264_10077515 Ga0268264_100775153 242
322 3300028556 Ga0265337_1001558 Ga0265337_10015585 242
323 3300028800 Ga0265338_10056280 Ga0265338_100562803 242
324 3300028800 Ga0265338_10094758 Ga0265338_100947582 242
325 3300031235 Ga0265330_10131359 Ga0265330_101313591 242
326 3300031241 Ga0265325_10000398 Ga0265325_1000039822 242
327 3300031241 Ga0265325_10049082 Ga0265325_100490822 242
328 3300031241 Ga0265325_10080091 Ga0265325_100800911 242
329 3300031249 Ga0265339_10002964 Ga0265339_100029643 242
330 3300031249 Ga0265339_10061509 Ga0265339_100615092 242
331 3300031249 Ga0265339_10106907 Ga0265339_101069072 242
332 3300031344 Ga0265316_10153918 Ga0265316_101539182 242
333 3300031344 Ga0265316_10263032 Ga0265316_102630322 242
334 3300031595 Ga0265313_10006372 Ga0265313_1000637210 242
335 3300031595 Ga0265313_10018880 Ga0265313_100188803 242
336 3300031595 Ga0265313_10104208 Ga0265313_101042082 242
337 3300031595 Ga0265313_10124610 Ga0265313_101246101 242
338 3300031691 Ga0316579_10162430 Ga0316579_101624301 242
339 3300031711 Ga0265314_10053795 Ga0265314_100537953 242
340 3300031712 Ga0265342_10011396 Ga0265342_100113965 242
341 3300034816 Ga0373930_0005168 Ga0373930_0005168_1291_2019 242
342 3300034818 Ga0373950_0018326 Ga0373950_0018326_429_1157 242
343 3300034819 Ga0373958_0000115 Ga0373958_0000115_5344_6072 242
344 3300034819 Ga0373958_0006733 Ga0373958_0006733_594_1322 242
345 3300034820 Ga0373959_0000953 Ga0373959_0000953_1743_2471 242
346 3300034820 Ga0373959_0015328 Ga0373959_0015328_14_742 242
347 3300034957 Ga0373938_0000029 Ga0373938_0000029_1355_2083 242
348 3300034957 Ga0373938_0002765 Ga0373938_0002765_644_1372 242
349 3300035084 Ga0373928_0000121 Ga0373928_0000121_10629_11357 242
350 3300035084 Ga0373928_0001807 Ga0373928_0001807_2172_2900 242
351 3300035085 Ga0373929_0001284 Ga0373929_0001284_2240_2968 242
352 3300035085 Ga0373929_0053344 Ga0373929_0053344_64_792 242
353 3300035086 Ga0373934_0072016 Ga0373934_0072016_35_772 242
354 3300035088 Ga0373940_0000632 Ga0373940_0000632_1386_2114 242
355 3300035088 Ga0373940_0010069 Ga0373940_0010069_377_1105 242
356 3300035090 Ga0373949_0002317 Ga0373949_0002317_2295_3023 242
357 3300035090 Ga0373949_0010686 Ga0373949_0010686_19_747 242
358 3300035091 Ga0373951_0000245 Ga0373951_0000245_6008_6736 242
359 3300035091 Ga0373951_0009551 Ga0373951_0009551_459_1187 242
360 3300035091 Ga0373951_0010395 Ga0373951_0010395_709_1437 242
361 3300035092 Ga0373952_0000027 Ga0373952_0000027_7112_7840 242
362 3300035092 Ga0373952_0002479 Ga0373952_0002479_1400_2128 242
363 3300035111 Ga0373923_0057499 Ga0373923_0057499_886_1623 242
364 3300035112 Ga0373932_0000184 Ga0373932_0000184_6698_7426 242
365 3300035112 Ga0373932_0008264 Ga0373932_0008264_1335_2063 242
366 3300035114 Ga0373939_0002514 Ga0373939_0002514_2587_3315 242
367 3300035114 Ga0373939_0013344 Ga0373939_0013344_649_1377 242
368 3300035115 Ga0373941_0001231 Ga0373941_0001231_638_1366 242
369 3300035117 Ga0373953_0019775 Ga0373953_0019775_1694_2422 242
370 3300035117 Ga0373953_0093834 Ga0373953_0093834_27_764 242
371 3300035118 Ga0373954_0011707 Ga0373954_0011707_1662_2399 242
372 3300035118 Ga0373954_0014085 Ga0373954_0014085_438_1166 242
373 3300035119 Ga0373956_0017813 Ga0373956_0017813_1240_1968 242
374 3300035119 Ga0373956_0196156 Ga0373956_0196156_104_832 242
375 3300035120 Ga0373957_0012150 Ga0373957_0012150_2116_2844 242
376 3300035120 Ga0373957_0046677 Ga0373957_0046677_818_1546 242
377 3300035120 Ga0373957_0048552 Ga0373957_0048552_735_1472 242
378 3300035121 Ga0373960_0000954 Ga0373960_0000954_3222_3950 242
379 3300035121 Ga0373960_0011280 Ga0373960_0011280_1107_1835 242
380 3300035121 Ga0373960_0012254 Ga0373960_0012254_1274_2002 242
381 3300035172 Ga0373955_0009584 Ga0373955_0009584_2472_3209 242
382 3300035207 Ga0373942_0000413 Ga0373942_0000413_2425_3153 242
383 3300035207 Ga0373942_0003298 Ga0373942_0003298_2186_2914 242
384 3300035241 Ga0373961_0006713 Ga0373961_0006713_162_890 242
385 3300035242 Ga0373962_0019611 Ga0373962_0019611_311_1039 242
386 3300035410 Ga0373924_0025238 Ga0373924_0025238_717_1454 242
387 3300035691 Ga0373931_0017929 Ga0373931_0017929_733_1461 242
388 3300035691 Ga0373931_0019490 Ga0373931_0019490_1303_2031 242
389 3300035692 Ga0373935_0199320 Ga0373935_0199320_185_922 242
390 3300035695 Ga0373927_0028383 Ga0373927_0028383_621_1358 242
391 3300035724 Ga0373933_0001260 Ga0373933_0001260_7189_7917 242
392 3300035724 Ga0373933_0001594 Ga0373933_0001594_9624_10361 242
393 3300035725 Ga0373947_0011238 Ga0373947_0011238_1620_2357 242
394 3300036401 Ga0373937_0002059 Ga0373937_0002059_4686_5423 242
395 3300036401 Ga0373937_0005468 Ga0373937_0005468_8560_9288 242
396 3300036401 Ga0373937_0011313 Ga0373937_0011313_1278_2006 242
397 3300036401 Ga0373937_0025330 Ga0373937_0025330_3395_4123 242
398 3300036401 Ga0373937_0634331 Ga0373937_0634331_243_971 242
399 3300037068 Ga0373925_0058527 Ga0373925_0058527_554_1282 242
400 3300037068 Ga0373925_0153626 Ga0373925_0153626_514_1251 242
401 3300038698 Ga0242419_000779 Ga0242419_000779_958_1686 242
402 3300038996 Ga0242420_009034 Ga0242420_009034_390_1118 242
403 3300041443 Ga0451789_0289166 Ga0451789_0289166_42_782 242
404 3300042439 Ga0439464_0051376 Ga0439464_0051376_181_909 242
405 3300042461 Ga0439460_0018060 Ga0439460_0018060_364_1092 242
406 3300042876 Ga0451577_0099082 Ga0451577_0099082_1774_2502 242
407 3300044684 Ga0466966_0075655 Ga0466966_0075655_117_866 242
408 3300044693 Ga0466961_0037785 Ga0466961_0037785_731_1480 242
409 3300044694 Ga0466963_0139045 Ga0466963_0139045_897_1634 242
410 3300044842 Ga0466957_0060726 Ga0466957_0060726_1519_2256 242
411 3300045049 Ga0466959_0144643 Ga0466959_0144643_131_880 242
412 3300045051 Ga0451576_0013919 Ga0451576_0013919_2571_3338 242
413 3300046454 Ga0495592_0000977 Ga0495592_0000977_2858_3586 242
414 3300046454 Ga0495592_0005236 Ga0495592_0005236_7131_7868 242
415 3300046454 Ga0495592_0064072 Ga0495592_0064072_296_1033 242
416 3300046454 Ga0495592_0083431 Ga0495592_0083431_51_779 242
417 3300046455 Ga0495603_0235693 Ga0495603_0235693_69_806 242
418 3300046455 Ga0495603_0256376 Ga0495603_0256376_113_850 242
419 3300046459 Ga0495629_0012459 Ga0495629_0012459_3601_4338 242
420 3300046462 Ga0495651_0001229 Ga0495651_0001229_8237_8974 242
421 3300046462 Ga0495651_0063577 Ga0495651_0063577_1837_2565 242
422 3300046462 Ga0495651_0093622 Ga0495651_0093622_1069_1797 242
423 3300046463 Ga0495653_0008785 Ga0495653_0008785_4719_5456 242
424 3300046463 Ga0495653_0017398 Ga0495653_0017398_50_778 242
425 3300046463 Ga0495653_0058844 Ga0495653_0058844_2170_2898 242
426 3300046475 Ga0495639_0019558 Ga0495639_0019558_705_1442 242
427 3300046476 Ga0495662_0080669 Ga0495662_0080669_480_1217 242
428 3300046477 Ga0495664_0092553 Ga0495664_0092553_655_1383 242
429 3300046477 Ga0495664_0198053 Ga0495664_0198053_147_884 242
430 3300046491 Ga0495584_0009511 Ga0495584_0009511_1149_1886 242
431 3300046491 Ga0495584_0114429 Ga0495584_0114429_494_1222 242
432 3300046511 Ga0495608_0002079 Ga0495608_0002079_11216_11953 242
433 3300046511 Ga0495608_0010323 Ga0495608_0010323_2875_3603 242
434 3300046514 Ga0495618_0006214 Ga0495618_0006214_5177_5914 242
435 3300046514 Ga0495618_0066540 Ga0495618_0066540_1386_2114 242
436 3300046516 Ga0495628_0002874 Ga0495628_0002874_10495_11223 242
437 3300046516 Ga0495628_0058341 Ga0495628_0058341_1738_2475 242
438 3300046516 Ga0495628_0070950 Ga0495628_0070950_1529_2257 242
439 3300046517 Ga0495630_0162156 Ga0495630_0162156_30_767 242
440 3300046517 Ga0495630_0251416 Ga0495630_0251416_261_998 242
441 3300046524 Ga0495648_0025233 Ga0495648_0025233_1836_2573 242
442 3300046529 Ga0495652_0011201 Ga0495652_0011201_6962_7699 242
443 3300046529 Ga0495652_0015643 Ga0495652_0015643_3122_3850 242
444 3300046533 Ga0495640_0012149 Ga0495640_0012149_3585_4313 242
445 3300046533 Ga0495640_0032609 Ga0495640_0032609_1149_1886 242
446 3300046535 Ga0495586_0059313 Ga0495586_0059313_631_1359 242
447 3300046536 Ga0495587_0001517 Ga0495587_0001517_5494_6222 242
448 3300046536 Ga0495587_0013260 Ga0495587_0013260_1701_2438 242
449 3300046543 Ga0495645_0001520 Ga0495645_0001520_916_1644 242
450 3300046543 Ga0495645_0033460 Ga0495645_0033460_2967_3704 242
451 3300046543 Ga0495645_0052120 Ga0495645_0052120_970_1698 242
452 3300046559 Ga0495667_0003504 Ga0495667_0003504_1761_2498 242
453 3300046559 Ga0495667_0006970 Ga0495667_0006970_3571_4299 242
454 3300046559 Ga0495667_0010321 Ga0495667_0010321_1318_2046 242
455 3300046642 Ga0495634_0013659 Ga0495634_0013659_2406_3143 242
456 3300046642 Ga0495634_0056342 Ga0495634_0056342_872_1600 242
457 3300046642 Ga0495634_0064248 Ga0495634_0064248_1423_2160 242
458 3300046648 Ga0495611_0131437 Ga0495611_0131437_126_863 242
459 3300046663 Ga0495635_0009233 Ga0495635_0009233_4857_5585 242
460 3300046663 Ga0495635_0011873 Ga0495635_0011873_2245_2982 242
461 3300046664 Ga0495659_0074672 Ga0495659_0074672_211_939 242
462 3300046675 Ga0495657_0013755 Ga0495657_0013755_5163_5891 242
463 3300046675 Ga0495657_0022880 Ga0495657_0022880_1233_1970 242
464 3300046678 Ga0495599_0002791 Ga0495599_0002791_5436_6164 242
465 3300046679 Ga0495623_0001343 Ga0495623_0001343_8221_8958 242
466 3300046679 Ga0495623_0015018 Ga0495623_0015018_780_1508 242
467 3300046679 Ga0495623_0023847 Ga0495623_0023847_1691_2419 242
468 3300046680 Ga0495646_0006053 Ga0495646_0006053_3368_4096 242
469 3300046680 Ga0495646_0022295 Ga0495646_0022295_158_886 242
470 3300046680 Ga0495646_0032748 Ga0495646_0032748_671_1408 242
471 3300046683 Ga0495658_0118916 Ga0495658_0118916_741_1478 242
472 3300046684 Ga0495669_0125200 Ga0495669_0125200_214_942 242
473 3300046689 Ga0495613_0038390 Ga0495613_0038390_1762_2499 242
474 3300046690 Ga0495624_0077419 Ga0495624_0077419_450_1187 242
475 3300046809 Ga0495600_0004399 Ga0495600_0004399_343_1071 242
476 3300046809 Ga0495600_0013400 Ga0495600_0013400_2875_3612 242
477 3300046809 Ga0495600_0052295 Ga0495600_0052295_1095_1823 242
478 3300047315 Ga0495581_0068701 Ga0495581_0068701_921_1658 242
479 3300047317 Ga0495604_0005068 Ga0495604_0005068_1455_2192 242
480 3300047317 Ga0495604_0032301 Ga0495604_0032301_2241_2969 242
481 3300047317 Ga0495604_0096216 Ga0495604_0096216_1214_1942 242
482 3300047319 Ga0495674_0008197 Ga0495674_0008197_4510_5247 242
483 3300047319 Ga0495674_0086510 Ga0495674_0086510_1635_2372 242
484 3300047319 Ga0495674_0096932 Ga0495674_0096932_1519_2247 242
485 3300047319 Ga0495674_0280727 Ga0495674_0280727_50_778 242
486 3300047321 Ga0495676_0167434 Ga0495676_0167434_52_789 242
487 3300047322 Ga0495680_0003398 Ga0495680_0003398_10712_11449 242
488 3300047322 Ga0495680_0003788 Ga0495680_0003788_11920_12648 242
489 3300047322 Ga0495680_0006593 Ga0495680_0006593_2924_3652 242
490 3300047444 Ga0495675_0002111 Ga0495675_0002111_2150_2887 242
491 3300047471 Ga0495684_0036214 Ga0495684_0036214_2270_3007 242
492 3300047673 Ga0495593_0134252 Ga0495593_0134252_390_1127 242
493 3300047673 Ga0495593_0259270 Ga0495593_0259270_121_849 242
494 3300048088 Ga0495602_0008143 Ga0495602_0008143_1644_2381 242
495 3300048088 Ga0495602_0036984 Ga0495602_0036984_3699_4427 242
496 3300048089 Ga0495614_0265880 Ga0495614_0265880_21_758 242
497 3300048903 Ga0496100_0004065 Ga0496100_0004065_5540_6268 242
498 3300048904 Ga0496101_0017402 Ga0496101_0017402_1476_2204 242
499 3300048904 Ga0496101_0026633 Ga0496101_0026633_149_877 242
500 3300048905 Ga0496102_0285516 Ga0496102_0285516_86_814 242
501 3300048906 Ga0496103_0028447 Ga0496103_0028447_606_1334 242
502 3300048906 Ga0496103_0029611 Ga0496103_0029611_2356_3084 242
503 3300048906 Ga0496103_0066812 Ga0496103_0066812_524_1252 242
504 3300048907 Ga0496104_0000126 Ga0496104_0000126_61904_62632 242
505 3300048907 Ga0496104_0041050 Ga0496104_0041050_776_1504 242
506 3300048907 Ga0496104_0045945 Ga0496104_0045945_2369_3097 242
507 3300048907 Ga0496104_0186823 Ga0496104_0186823_73_801 242
508 3300048908 Ga0496105_0001562 Ga0496105_0001562_13379_14107 242
509 3300048908 Ga0496105_0009019 Ga0496105_0009019_5027_5755 242
510 3300048909 Ga0496106_0018040 Ga0496106_0018040_4398_5126 242
511 3300048909 Ga0496106_0019136 Ga0496106_0019136_3400_4128 242
512 3300048909 Ga0496106_0074272 Ga0496106_0074272_268_996 242
513 3300048910 Ga0496107_0015179 Ga0496107_0015179_3138_3866 242
514 3300048910 Ga0496107_0051373 Ga0496107_0051373_1988_2716 242
515 3300048910 Ga0496107_0061807 Ga0496107_0061807_1371_2099 242
516 3300048910 Ga0496107_0079988 Ga0496107_0079988_713_1441 242
517 3300048910 Ga0496107_0292030 Ga0496107_0292030_329_1057 242
518 3300048911 Ga0496108_0004643 Ga0496108_0004643_6806_7534 242
519 3300048911 Ga0496108_0032262 Ga0496108_0032262_1282_2010 242
520 3300048912 Ga0496109_0000188 Ga0496109_0000188_51608_52336 242
521 3300048912 Ga0496109_0000831 Ga0496109_0000831_7219_7947 242
522 3300048912 Ga0496109_0045459 Ga0496109_0045459_2626_3354 242
523 3300048913 Ga0496110_0018071 Ga0496110_0018071_2873_3601 242
524 3300048913 Ga0496110_0107676 Ga0496110_0107676_1265_1993 242
525 3300048913 Ga0496110_0232069 Ga0496110_0232069_818_1546 242
526 3300048914 Ga0496111_0005732 Ga0496111_0005732_1883_2611 242
527 3300048914 Ga0496111_0051979 Ga0496111_0051979_1794_2522 242
528 3300048914 Ga0496111_0087931 Ga0496111_0087931_1262_1990 242
529 3300048915 Ga0496112_0053867 Ga0496112_0053867_1741_2469 242
530 3300048916 Ga0496113_0000478 Ga0496113_0000478_16587_17315 242
531 3300048916 Ga0496113_0110473 Ga0496113_0110473_225_953 242
532 3300048917 Ga0496114_0029292 Ga0496114_0029292_2571_3299 242
533 3300048917 Ga0496114_0058254 Ga0496114_0058254_1072_1800 242
534 3300048917 Ga0496114_0078927 Ga0496114_0078927_1838_2566 242
535 3300048918 Ga0496115_0007975 Ga0496115_0007975_394_1122 242
536 3300048918 Ga0496115_0096288 Ga0496115_0096288_935_1663 242
537 3300048918 Ga0496115_0117874 Ga0496115_0117874_1384_2124 242
538 3300048918 Ga0496115_0356921 Ga0496115_0356921_25_753 242
539 3300049568 Ga0501031_0021508 Ga0501031_0021508_992_1720 242
540 3300049569 Ga0501032_0065423 Ga0501032_0065423_774_1502 242
541 3300049569 Ga0501032_0126039 Ga0501032_0126039_700_1443 242
542 3300049570 Ga0501033_0012528 Ga0501033_0012528_32_760 242
543 3300049571 Ga0501034_0047775 Ga0501034_0047775_1224_1952 242
544 3300049571 Ga0501034_0078675 Ga0501034_0078675_1840_2568 242
545 3300049571 Ga0501034_0158358 Ga0501034_0158358_1015_1752 242
546 3300049571 Ga0501034_0616440 Ga0501034_0616440_198_956 242
547 3300049572 Ga0501036_0145056 Ga0501036_0145056_1063_1791 242
548 3300049572 Ga0501036_0261549 Ga0501036_0261549_674_1402 242
549 3300049573 Ga0501037_0012452 Ga0501037_0012452_2423_3151 242
550 3300049573 Ga0501037_0025758 Ga0501037_0025758_340_1074 242
551 3300049573 Ga0501037_0139396 Ga0501037_0139396_559_1287 242
552 3300049574 Ga0501038_0006074 Ga0501038_0006074_72_806 242
553 3300049575 Ga0501039_0025227 Ga0501039_0025227_801_1529 242
554 3300049575 Ga0501039_0064571 Ga0501039_0064571_1581_2315 242
555 3300049575 Ga0501039_0382720 Ga0501039_0382720_302_1036 242
556 3300049576 Ga0501040_0199648 Ga0501040_0199648_184_912 242
557 3300049579 Ga0501043_0017718 Ga0501043_0017718_4411_5145 242
558 3300049579 Ga0501043_0295893 Ga0501043_0295893_79_807 242
559 3300049579 Ga0501043_0297196 Ga0501043_0297196_32_775 242
560 3300049580 Ga0501046_0054232 Ga0501046_0054232_871_1605 242
561 3300049580 Ga0501046_0207297 Ga0501046_0207297_421_1155 242
562 3300049581 Ga0501047_0008130 Ga0501047_0008130_1815_2549 242
563 3300049581 Ga0501047_0040003 Ga0501047_0040003_3439_4182 242
564 3300049581 Ga0501047_0040364 Ga0501047_0040364_2725_3453 242
565 3300049581 Ga0501047_0123765 Ga0501047_0123765_289_1023 242
566 3300049584 Ga0501068_0238773 Ga0501068_0238773_366_1100 242
567 3300049585 Ga0501069_0070407 Ga0501069_0070407_944_1672 242
568 3300049586 Ga0501070_0018855 Ga0501070_0018855_2423_3151 242
569 3300049586 Ga0501070_0035258 Ga0501070_0035258_2199_2927 242
570 3300049586 Ga0501070_0283869 Ga0501070_0283869_134_877 242
571 3300049586 Ga0501070_0290737 Ga0501070_0290737_151_885 242
572 3300049587 Ga0501071_0104047 Ga0501071_0104047_1159_1887 242
573 3300049589 Ga0501073_0163021 Ga0501073_0163021_137_871 242
574 3300049589 Ga0501073_0490506 Ga0501073_0490506_90_818 242
575 3300049590 Ga0501074_0169367 Ga0501074_0169367_496_1230 242
576 3300049591 Ga0501075_0216270 Ga0501075_0216270_615_1343 242
577 3300049592 Ga0501076_0055308 Ga0501076_0055308_1151_1879 242
578 3300049593 Ga0501077_0036288 Ga0501077_0036288_1497_2225 242
579 3300049742 Ga0501080_0037678 Ga0501080_0037678_518_1252 242
580 3300049742 Ga0501080_0068717 Ga0501080_0068717_2531_3265 242
581 3300049744 Ga0501083_0030430 Ga0501083_0030430_2542_3276 242
582 3300049744 Ga0501083_0044224 Ga0501083_0044224_1707_2441 242
583 3300049822 Ga0501035_0009635 Ga0501035_0009635_5649_6377 242
584 3300049822 Ga0501035_0388756 Ga0501035_0388756_54_797 242
585 3300049822 Ga0501035_0607976 Ga0501035_0607976_67_801 242
586 3300049823 Ga0501044_0034371 Ga0501044_0034371_3736_4464 242
587 3300049823 Ga0501044_0215223 Ga0501044_0215223_734_1477 242
588 3300049823 Ga0501044_0277177 Ga0501044_0277177_57_791 242
589 3300049823 Ga0501044_0433333 Ga0501044_0433333_170_904 242
590 3300050489 nmdc:mga03683_125930_c1 nmdc:mga03683_125930_c1_245_982 242
591 3300050490 nmdc:mga03n38_50030_c1 nmdc:mga03n38_50030_c1_373_1110 242
592 3300050491 nmdc:mga00v17_116628_c1 nmdc:mga00v17_116628_c1_315_1052 242
593 3300050491 nmdc:mga00v17_20175_c1 nmdc:mga00v17_20175_c1_385_1128 242
594 3300050492 nmdc:mga0yw44_137254_c2 nmdc:mga0yw44_137254_c2_86_823 242
595 3300050494 nmdc:mga06z11_33142_c1 nmdc:mga06z11_33142_c1_1362_2099 242
596 3300050494 nmdc:mga06z11_59148_c1 nmdc:mga06z11_59148_c1_626_1354 242
597 3300050495 nmdc:mga04h51_33140_c1 nmdc:mga04h51_33140_c1_745_1482 242
598 3300050496 nmdc:mga07m45_12942_c1 nmdc:mga07m45_12942_c1_2887_3624 242
599 3300050496 nmdc:mga07m45_41994_c2 nmdc:mga07m45_41994_c2_640_1368 242
600 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_108506_109234 242
601 3300050508 nmdc:mga09592_1665_c1 nmdc:mga09592_1665_c1_16241_16969 242
602 3300050509 nmdc:mga0qj67_12610_c1 nmdc:mga0qj67_12610_c1_552_1280 242
603 3300050510 nmdc:mga06r32_16533_c1 nmdc:mga06r32_16533_c1_3981_4709 242
604 3300050511 nmdc:mga08y16_684_c1 nmdc:mga08y16_684_c1_19739_20467 242
605 3300050511 nmdc:mga08y16_83672_c1 nmdc:mga08y16_83672_c1_2341_3069 242
606 3300050512 nmdc:mga0n895_824_c1 nmdc:mga0n895_824_c1_20076_20804 242
607 3300050512 nmdc:mga0n895_9017_c1 nmdc:mga0n895_9017_c1_4120_4848 242
608 3300050513 nmdc:mga0rr50_134223_c1 nmdc:mga0rr50_134223_c1_1102_1830 242
609 3300050513 nmdc:mga0rr50_670517_c1 nmdc:mga0rr50_670517_c1_108_836 242
610 3300050515 nmdc:mga0a205_2160_c1 nmdc:mga0a205_2160_c1_2391_3119 242
611 3300050515 nmdc:mga0a205_216234_c1 nmdc:mga0a205_216234_c1_241_969 242
612 3300050515 nmdc:mga0a205_31621_c1 nmdc:mga0a205_31621_c1_1564_2292 242
613 3300053077 Ga0495601_0000159 Ga0495601_0000159_5372_6100 242
614 3300053077 Ga0495601_0004646 Ga0495601_0004646_2144_2881 242
615 3300053077 Ga0495601_0029443 Ga0495601_0029443_621_1349 242
616 3300053077 Ga0495601_0040605 Ga0495601_0040605_1866_2603 242
617 3300053078 Ga0495612_0000689 Ga0495612_0000689_2281_3018 242
618 3300053078 Ga0495612_0004359 Ga0495612_0004359_2465_3193 242
619 3300053084 Ga0495595_0000974 Ga0495595_0000974_9460_10197 242
620 3300053084 Ga0495595_0014772 Ga0495595_0014772_2476_3204 242
621 3300053084 Ga0495595_0017832 Ga0495595_0017832_459_1187 242
622 3300053085 Ga0495619_0001290 Ga0495619_0001290_6189_6926 242
623 3300053085 Ga0495619_0048530 Ga0495619_0048530_1284_2012 242
624 3300053087 Ga0500643_015552 Ga0500643_015552_1537_2265 242
625 3300053088 Ga0500644_0000552 Ga0500644_0000552_10706_11434 242
626 3300053093 Ga0500651_0182986 Ga0500651_0182986_279_1007 242
627 3300053096 Ga0500641_0060664 Ga0500641_0060664_753_1481 242
628 3300053108 Ga0500562_057999 Ga0500562_057999_250_987 242
629 3300053119 Ga0500595_000010 Ga0500595_000010_198245_198973 242
630 3300053119 Ga0500595_008002 Ga0500595_008002_2898_3635 242
631 3300053153 Ga0500616_0000001 Ga0500616_0000001_629056_629784 242
632 3300054114 Ga0501084_0210818 Ga0501084_0210818_177_905 242
633 3300060353 Ga0501082_0070745 Ga0501082_0070745_1780_2514 242
634 3300060353 Ga0501082_0106231 Ga0501082_0106231_1503_2231 242
635 3300060353 Ga0501082_0169003 Ga0501082_0169003_170_898 242
636 3300061719 Ga0466962_0071453 Ga0466962_0071453_314_1042 242
637 3300061719 Ga0466962_0112881 Ga0466962_0112881_82_819 242
638 iso_pu_bacteria 2643221547 2643758766 242
639 3300049569 Ga0501032_0007580 Ga0501032_0007580_5857_6594 243
640 3300049573 Ga0501037_0003014 Ga0501037_0003014_307_1044 243
641 3300049575 Ga0501039_0318156 Ga0501039_0318156_365_1102 243
642 3300049580 Ga0501046_0006409 Ga0501046_0006409_657_1394 243
643 3300049583 Ga0501067_0008646 Ga0501067_0008646_258_995 243
644 3300049584 Ga0501068_0003025 Ga0501068_0003025_5576_6313 243
645 3300049588 Ga0501072_0447098 Ga0501072_0447098_165_902 243
646 3300049742 Ga0501080_0015340 Ga0501080_0015340_5855_6592 243
647 3300060353 Ga0501082_0060360 Ga0501082_0060360_341_1078 243
648 3300050496 nmdc:mga07m45_26313_c1 nmdc:mga07m45_26313_c1_591_1325 244
649 3300049823 Ga0501044_0386085 Ga0501044_0386085_289_1047 245
650 3300005434 Ga0070709_10508727 Ga0070709_105087271 246
651 3300049588 Ga0501072_0268873 Ga0501072_0268873_489_1247 249
652 3300049744 Ga0501083_0176162 Ga0501083_0176162_486_1244 249
653 3300006042 Ga0075368_10009881 Ga0075368_100098813 256
654 3300006186 Ga0075369_10114095 Ga0075369_101140952 256
655 3300025915 Ga0207693_10057260 Ga0207693_100572603 256
656 3300027866 Ga0209813_10003725 Ga0209813_100037252 256
657 3300009093 Ga0105240_10530235 Ga0105240_105302351 261
658 3300013104 Ga0157370_10719423 Ga0157370_107194231 261
659 3300025913 Ga0207695_10378440 Ga0207695_103784402 261
660 3300006058 Ga0075432_10046659 Ga0075432_100466591 262
661 3300006852 Ga0075433_10232499 Ga0075433_102324992 262
662 3300006871 Ga0075434_100296546 Ga0075434_1002965462 262
663 3300007076 Ga0075435_100009711 Ga0075435_1000097115 262
664 3300050507 nmdc:mga05p37_7430_c1 nmdc:mga05p37_7430_c1_1429_2226 262
665 3300050512 nmdc:mga0n895_46646_c1 nmdc:mga0n895_46646_c1_1984_2781 262
666 3300050513 nmdc:mga0rr50_19008_c1 nmdc:mga0rr50_19008_c1_2525_3322 262
667 3300050513 nmdc:mga0rr50_265161_c1 nmdc:mga0rr50_265161_c1_328_1125 262
668 3300050515 nmdc:mga0a205_109041_c1 nmdc:mga0a205_109041_c1_300_1097 262
669 3300005438 Ga0070701_10234044 Ga0070701_102340441 271
670 2209111006 2214544930 2213593606 273
671 2209111006 2214656054 2213681326 273
672 3300000045 ARCol0oldRDRAFT_c00091 ARCol0oldRDRAFT_000912 273
673 3300001990 JGI24737J22298_10017420 JGI24737J22298_100174203 273
674 3300005289 Ga0065704_10086870 Ga0065704_100868703 273
675 3300005290 Ga0065712_10016314 Ga0065712_100163143 273
676 3300005340 Ga0070689_100086111 Ga0070689_1000861112 273
677 3300005345 Ga0070692_10022878 Ga0070692_100228783 273
678 3300005353 Ga0070669_100015571 Ga0070669_1000155713 273
679 3300005354 Ga0070675_100116117 Ga0070675_1001161173 273
680 3300005365 Ga0070688_100057107 Ga0070688_1000571073 273
681 3300005366 Ga0070659_100141682 Ga0070659_1001416821 273
682 3300005367 Ga0070667_100043434 Ga0070667_1000434343 273
683 3300005440 Ga0070705_100167308 Ga0070705_1001673082 273
684 3300005441 Ga0070700_100002037 Ga0070700_1000020374 273
685 3300005444 Ga0070694_100017473 Ga0070694_1000174734 273
686 3300005455 Ga0070663_100069885 Ga0070663_1000698852 273
687 3300005457 Ga0070662_100035728 Ga0070662_1000357283 273
688 3300005458 Ga0070681_10197475 Ga0070681_101974752 273
689 3300005459 Ga0068867_100118073 Ga0068867_1001180733 273
690 3300005535 Ga0070684_100022881 Ga0070684_1000228814 273
691 3300005539 Ga0068853_100110959 Ga0068853_1001109592 273
692 3300005543 Ga0070672_100072116 Ga0070672_1000721162 273
693 3300005545 Ga0070695_100049655 Ga0070695_1000496553 273
694 3300005549 Ga0070704_100178216 Ga0070704_1001782163 273
695 3300005577 Ga0068857_100159616 Ga0068857_1001596161 273
696 3300005614 Ga0068856_100533468 Ga0068856_1005334682 273
697 3300005617 Ga0068859_100058508 Ga0068859_1000585084 273
698 3300005719 Ga0068861_100131739 Ga0068861_1001317391 273
699 3300005841 Ga0068863_100735281 Ga0068863_1007352811 273
700 3300005842 Ga0068858_100165196 Ga0068858_1001651962 273
701 3300005843 Ga0068860_100127705 Ga0068860_1001277053 273
702 3300005844 Ga0068862_100009980 Ga0068862_1000099804 273
703 3300006931 Ga0097620_100058509 Ga0097620_1000585092 273
704 3300025271 Ga0207666_1001163 Ga0207666_10011633 273
705 3300025315 Ga0207697_10037066 Ga0207697_100370662 273
706 3300025904 Ga0207647_10024001 Ga0207647_100240013 273
707 3300025912 Ga0207707_10021923 Ga0207707_100219235 273
708 3300025918 Ga0207662_10013070 Ga0207662_100130703 273
709 3300025923 Ga0207681_10083028 Ga0207681_100830283 273
710 3300025933 Ga0207706_10033234 Ga0207706_100332343 273
711 3300025935 Ga0207709_10051583 Ga0207709_100515832 273
712 3300025936 Ga0207670_10038449 Ga0207670_100384493 273
713 3300025940 Ga0207691_10159730 Ga0207691_101597303 273
714 3300025986 Ga0207658_10221421 Ga0207658_102214212 273
715 3300026035 Ga0207703_10178928 Ga0207703_101789282 273
716 3300026089 Ga0207648_10028161 Ga0207648_100281613 273
717 3300026116 Ga0207674_10099929 Ga0207674_100999292 273
718 3300026118 Ga0207675_100032335 Ga0207675_1000323353 273
719 3300027682 Ga0209971_1009754 Ga0209971_10097542 273
720 3300027717 Ga0209998_10002525 Ga0209998_100025253 273
721 3300027907 Ga0207428_10001650 Ga0207428_100016509 273
722 3300028380 Ga0268265_10233338 Ga0268265_102333382 273
723 3300028381 Ga0268264_10115664 Ga0268264_101156642 273
724 3300035724 Ga0373933_0055454 Ga0373933_0055454_1101_1949 273
725 3300037068 Ga0373925_0236795 Ga0373925_0236795_228_1052 273
726 3300046454 Ga0495592_0175888 Ga0495592_0175888_99_923 273
727 3300046529 Ga0495652_0064134 Ga0495652_0064134_447_1271 273
728 3300046559 Ga0495667_0081150 Ga0495667_0081150_1136_1960 273
729 3300046642 Ga0495634_0175633 Ga0495634_0175633_116_940 273
730 3300046663 Ga0495635_0033017 Ga0495635_0033017_1835_2659 273
731 3300046683 Ga0495658_0018993 Ga0495658_0018993_607_1431 273
732 3300046809 Ga0495600_0193655 Ga0495600_0193655_261_1085 273
733 3300047317 Ga0495604_0021395 Ga0495604_0021395_928_1752 273
734 3300047319 Ga0495674_0073545 Ga0495674_0073545_524_1348 273
735 3300047322 Ga0495680_0094179 Ga0495680_0094179_35_859 273
736 3300053077 Ga0495601_0004928 Ga0495601_0004928_2239_3063 273
737 3300053078 Ga0495612_0015211 Ga0495612_0015211_1363_2187 273
738 3300053085 Ga0495619_0000016 Ga0495619_0000016_146499_147323 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02348

CTP_transf_3

Cytidylyltransferase

57

267

0.92

PF12804

NTP_transf_3

MobA-like NTP transferase domain

63

260

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gq9-assembly1.cif.gz_B the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase complexed with ctp at 100k 0.9176 34 272
3oam-assembly2.cif.gz_D crystal structure of cytidylyltransferase from vibrio cholerae 0.9175 34 272
2y6p-assembly2.cif.gz_C-2 evidence for a two-metal-ion-mechanism in the kdo- cytidylyltransferase kdsb 0.9169 36 270
4xwi-assembly1.cif.gz_A x-ray crystal structure of cmp-kdo synthase from pseudomonas aeruginosa 0.9063 34 273
3k8e-assembly2.cif.gz_A crystal structure of e. coli lipopolysaccharide specific cmp-kdo synthetase 0.9056 34 269
ID Description Score Start End Superfamily
af_I1LT34_51_301_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9207 29 271 3.90.550.10
1h7eA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9187 34 272 3.90.550.10
2y6pC00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9169 36 270 3.90.550.10
2y6pC00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9054 36 270 3.90.550.10
3k8eD00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8911 36 270 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A527Y7C8-F1-model_v4 3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38) 0.9937 34 247 GO:0005829
GO:0008690
GO:0009103
AF-A0A357CHF1-F1-model_v4 3-deoxy-manno-octulosonate cytidylyltransferase 0.9898 35 140 GO:0005829
GO:0008690
GO:0009103
AF-A0A528WT37-F1-model_v4 3-deoxy-manno-octulosonate cytidylyltransferase 0.9895 34 193 GO:0005829
GO:0008690
GO:0009103
AF-A0A1C2AHU6-F1-model_v4 3-deoxy-manno-octulosonate cytidylyltransferase 0.983 36 119 GO:0005829
GO:0008690
GO:0009103
AF-A0A847ZQZ3-F1-model_v4 NTP transferase domain-containing protein 0.9821 32 147 GO:0005829
GO:0008690
GO:0009103

Feature Viewer

pLDDT pTM Quality
87.29 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map