F478382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 403 | 728 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10530235|Ga0105240_105302351 |
| Length | 294 |
| Sequence | MEGGRRQSPGGGDEIPVCPAAGNPYKRLRQFRHLFYTFIPRLAGVAGLSATSMPDAIILIPARLASTRLPGKPLADLHGAPMIVHVLRHAQAAEIGEAVVATDSEAVAAAVEKAGGRAIMTRSDHVSGSDRIYEALEALDPERQIEIVVNVQGDLPTIAAADIRAALKPLSEPHVDIATLAALITDPAEATNPNVVKVSGPQIAPNRIHAKSFSRRSASGPGPHYHHIGLYAYRRAALERFVKLPPSAGEQRDKLEQLRALENGMRIDAMIVKSVPLGVDTPDDLEKARRQLSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 4 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 5 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 6 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 7 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 8 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 9 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 10 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 11 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 12 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 14 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 25 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 26 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 154 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 234 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 271 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 274 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 275 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 393 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 396 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 397 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 398 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.51 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.34 |
| Nodule | 0.14 |
| Rhizoplane | 5.96 |
| Rhizosphere | 88.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544930 | 2209111006 | Bacteria | 17913 |
| 2 | 2214656054 | 2209111006 | Bacteria | 4766 |
| 3 | ARcpr5yngRDRAFT_c000024 | 3300000043 | Bacteria | 25202 |
| 4 | ARSoilOldRDRAFT_c000034 | 3300000044 | Bacteria | 30454 |
| 5 | ARCol0oldRDRAFT_c00091 | 3300000045 | Bacteria | 7612 |
| 6 | ARCol0yngRDRAFT_1000026 | 3300000652 | Bacteria | 26647 |
| 7 | JGI24739J22299_10011920 | 3300001989 | Bacteria | 3199 |
| 8 | JGI24737J22298_10000377 | 3300001990 | Bacteria | 15163 |
| 9 | JGI24737J22298_10017420 | 3300001990 | Bacteria | 2314 |
| 10 | JGI24750J21931_1000721 | 3300002070 | Bacteria | 4744 |
| 11 | JGI24745J21846_1000072 | 3300002073 | Bacteria | 7025 |
| 12 | JGI24748J21848_1001393 | 3300002074 | Bacteria | 2661 |
| 13 | JGI24738J21930_10001830 | 3300002075 | Bacteria | 5763 |
| 14 | JGI24749J21850_1001077 | 3300002076 | Bacteria | 3890 |
| 15 | JGI24744J21845_10003744 | 3300002077 | Bacteria | 3139 |
| 16 | JGI24035J26624_1000268 | 3300002126 | Bacteria | 4844 |
| 17 | JGI24034J26672_10003945 | 3300002239 | Bacteria | 2088 |
| 18 | JGI24742J22300_10000140 | 3300002244 | Bacteria | 10727 |
| 19 | Ga0065704_10086870 | 3300005289 | Bacteria | 3077 |
| 20 | Ga0065712_10016314 | 3300005290 | Bacteria | 2462 |
| 21 | Ga0065715_10160156 | 3300005293 | Bacteria | 1637 |
| 22 | Ga0070676_10012406 | 3300005328 | Bacteria | 4650 |
| 23 | Ga0070683_100083423 | 3300005329 | Bacteria | 2993 |
| 24 | Ga0070690_100018681 | 3300005330 | Bacteria | 4191 |
| 25 | Ga0070690_100186021 | 3300005330 | Bacteria | 1437 |
| 26 | Ga0070670_100011123 | 3300005331 | Bacteria | 7689 |
| 27 | Ga0070677_10001300 | 3300005333 | Bacteria | 8000 |
| 28 | Ga0068869_100023413 | 3300005334 | Bacteria | 4265 |
| 29 | Ga0070666_10022569 | 3300005335 | Bacteria | 4088 |
| 30 | Ga0070680_100010070 | 3300005336 | Bacteria | 7284 |
| 31 | Ga0070680_100016122 | 3300005336 | Bacteria | 5873 |
| 32 | Ga0070682_100056018 | 3300005337 | Bacteria | 2478 |
| 33 | Ga0068868_100323350 | 3300005338 | Unclassified | 1314 |
| 34 | Ga0070660_100035576 | 3300005339 | Bacteria | 3770 |
| 35 | Ga0070660_100156701 | 3300005339 | Bacteria | 1833 |
| 36 | Ga0070689_100061168 | 3300005340 | Bacteria | 2929 |
| 37 | Ga0070689_100086111 | 3300005340 | Bacteria | 2471 |
| 38 | Ga0070689_100191463 | 3300005340 | Unclassified | 1665 |
| 39 | Ga0070691_10004569 | 3300005341 | Bacteria | 6287 |
| 40 | Ga0070687_100000813 | 3300005343 | Bacteria | 10406 |
| 41 | Ga0070661_100013566 | 3300005344 | Bacteria | 5722 |
| 42 | Ga0070661_100018789 | 3300005344 | Bacteria | 4920 |
| 43 | Ga0070692_10022878 | 3300005345 | Bacteria | 3058 |
| 44 | Ga0070668_100093924 | 3300005347 | Bacteria | 2367 |
| 45 | Ga0070669_100005635 | 3300005353 | Bacteria | 9042 |
| 46 | Ga0070669_100015571 | 3300005353 | Bacteria | 5423 |
| 47 | Ga0070675_100004413 | 3300005354 | Bacteria | 10723 |
| 48 | Ga0070675_100116117 | 3300005354 | Bacteria | 2270 |
| 49 | Ga0070671_100008712 | 3300005355 | Bacteria | 8138 |
| 50 | Ga0070671_100021644 | 3300005355 | Bacteria | 5252 |
| 51 | Ga0070673_100002330 | 3300005364 | Bacteria | 11534 |
| 52 | Ga0070673_100016208 | 3300005364 | Bacteria | 5262 |
| 53 | Ga0070688_100018721 | 3300005365 | Bacteria | 4002 |
| 54 | Ga0070688_100057107 | 3300005365 | Bacteria | 2452 |
| 55 | Ga0070659_100030373 | 3300005366 | Bacteria | 4182 |
| 56 | Ga0070659_100141682 | 3300005366 | Bacteria | 1957 |
| 57 | Ga0070659_100156613 | 3300005366 | Bacteria | 1860 |
| 58 | Ga0070667_100004935 | 3300005367 | Bacteria | 11178 |
| 59 | Ga0070667_100043434 | 3300005367 | Bacteria | 3772 |
| 60 | Ga0070667_100061488 | 3300005367 | Bacteria | 3180 |
| 61 | Ga0070703_10002976 | 3300005406 | Bacteria | 4843 |
| 62 | Ga0070709_10014842 | 3300005434 | Bacteria | 4416 |
| 63 | Ga0070709_10508727 | 3300005434 | Bacteria | 916 |
| 64 | Ga0070714_100018460 | 3300005435 | Bacteria | 5666 |
| 65 | Ga0070713_100001408 | 3300005436 | Bacteria | 15419 |
| 66 | Ga0070713_100017458 | 3300005436 | Bacteria | 5428 |
| 67 | Ga0070710_10136384 | 3300005437 | Bacteria | 1501 |
| 68 | Ga0070701_10001696 | 3300005438 | Bacteria | 8277 |
| 69 | Ga0070701_10234044 | 3300005438 | Bacteria | 1102 |
| 70 | Ga0070711_100008598 | 3300005439 | Bacteria | 6261 |
| 71 | Ga0070711_100127826 | 3300005439 | Bacteria | 1888 |
| 72 | Ga0070711_100193921 | 3300005439 | Bacteria | 1563 |
| 73 | Ga0070705_100103005 | 3300005440 | Unclassified | 1806 |
| 74 | Ga0070705_100167308 | 3300005440 | Bacteria | 1476 |
| 75 | Ga0070700_100002037 | 3300005441 | Bacteria | 10273 |
| 76 | Ga0070700_100002054 | 3300005441 | Bacteria | 10228 |
| 77 | Ga0070694_100017473 | 3300005444 | Bacteria | 4535 |
| 78 | Ga0070694_100026395 | 3300005444 | Bacteria | 3763 |
| 79 | Ga0070708_100041127 | 3300005445 | Bacteria | 4052 |
| 80 | Ga0070663_100011055 | 3300005455 | Bacteria | 5651 |
| 81 | Ga0070663_100069885 | 3300005455 | Bacteria | 2553 |
| 82 | Ga0070678_100014241 | 3300005456 | Bacteria | 5010 |
| 83 | Ga0070662_100035728 | 3300005457 | Bacteria | 3511 |
| 84 | Ga0070662_100043603 | 3300005457 | Bacteria | 3210 |
| 85 | Ga0070681_10005125 | 3300005458 | Bacteria | 12644 |
| 86 | Ga0070681_10067109 | 3300005458 | Bacteria | 3556 |
| 87 | Ga0070681_10102977 | 3300005458 | Bacteria | 2799 |
| 88 | Ga0070681_10169050 | 3300005458 | Bacteria | 2108 |
| 89 | Ga0070681_10197475 | 3300005458 | Bacteria | 1930 |
| 90 | Ga0068867_100049799 | 3300005459 | Bacteria | 3084 |
| 91 | Ga0068867_100118073 | 3300005459 | Bacteria | 2046 |
| 92 | Ga0068867_100330419 | 3300005459 | Bacteria | 1266 |
| 93 | Ga0070685_10001256 | 3300005466 | Bacteria | 13462 |
| 94 | Ga0070685_10355659 | 3300005466 | Bacteria | 1003 |
| 95 | Ga0070679_100032427 | 3300005530 | Bacteria | 5167 |
| 96 | Ga0070679_100038222 | 3300005530 | Bacteria | 4771 |
| 97 | Ga0070684_100022881 | 3300005535 | Bacteria | 5218 |
| 98 | Ga0070684_100119777 | 3300005535 | Bacteria | 2367 |
| 99 | Ga0070697_100147289 | 3300005536 | Bacteria | 1983 |
| 100 | Ga0068853_100038342 | 3300005539 | Bacteria | 4081 |
| 101 | Ga0068853_100110959 | 3300005539 | Bacteria | 2436 |
| 102 | Ga0070672_100024585 | 3300005543 | Bacteria | 4455 |
| 103 | Ga0070672_100072116 | 3300005543 | Bacteria | 2749 |
| 104 | Ga0070686_100025615 | 3300005544 | Bacteria | 3551 |
| 105 | Ga0070686_100114625 | 3300005544 | Bacteria | 1842 |
| 106 | Ga0070695_100025578 | 3300005545 | Bacteria | 3646 |
| 107 | Ga0070695_100049655 | 3300005545 | Bacteria | 2686 |
| 108 | Ga0070696_100034656 | 3300005546 | Bacteria | 3473 |
| 109 | Ga0070696_100050348 | 3300005546 | Bacteria | 2895 |
| 110 | Ga0070696_100136513 | 3300005546 | Unclassified | 1788 |
| 111 | Ga0070693_100017824 | 3300005547 | Bacteria | 3699 |
| 112 | Ga0070693_100179345 | 3300005547 | Bacteria | 1363 |
| 113 | Ga0070665_100127551 | 3300005548 | Bacteria | 2547 |
| 114 | Ga0070704_100012551 | 3300005549 | Bacteria | 5235 |
| 115 | Ga0070704_100178216 | 3300005549 | Bacteria | 1697 |
| 116 | Ga0068855_100025265 | 3300005563 | Bacteria | 7110 |
| 117 | Ga0068855_100030348 | 3300005563 | Bacteria | 6466 |
| 118 | Ga0068855_100053635 | 3300005563 | Bacteria | 4742 |
| 119 | Ga0070664_100031021 | 3300005564 | Bacteria | 4463 |
| 120 | Ga0070664_100742398 | 3300005564 | Bacteria | 916 |
| 121 | Ga0068857_100037204 | 3300005577 | Bacteria | 4311 |
| 122 | Ga0068857_100159616 | 3300005577 | Bacteria | 2045 |
| 123 | Ga0068854_100003787 | 3300005578 | Bacteria | 9456 |
| 124 | Ga0068854_100163745 | 3300005578 | Bacteria | 1725 |
| 125 | Ga0068856_100017870 | 3300005614 | Bacteria | 6878 |
| 126 | Ga0068856_100023277 | 3300005614 | Bacteria | 6023 |
| 127 | Ga0068856_100199086 | 3300005614 | Bacteria | 2018 |
| 128 | Ga0068856_100272412 | 3300005614 | Bacteria | 1709 |
| 129 | Ga0068856_100533468 | 3300005614 | Bacteria | 1195 |
| 130 | Ga0070702_100135118 | 3300005615 | Unclassified | 1563 |
| 131 | Ga0070702_100154732 | 3300005615 | Bacteria | 1476 |
| 132 | Ga0068852_100033497 | 3300005616 | Bacteria | 4266 |
| 133 | Ga0068859_100000920 | 3300005617 | Bacteria | 30125 |
| 134 | Ga0068859_100058508 | 3300005617 | Bacteria | 3882 |
| 135 | Ga0068864_100029360 | 3300005618 | Bacteria | 4656 |
| 136 | Ga0068866_10000295 | 3300005718 | Bacteria | 23724 |
| 137 | Ga0068861_100082305 | 3300005719 | Bacteria | 2522 |
| 138 | Ga0068861_100131739 | 3300005719 | Bacteria | 2030 |
| 139 | Ga0068870_10000803 | 3300005840 | Bacteria | 12169 |
| 140 | Ga0068863_100009214 | 3300005841 | Bacteria | 9632 |
| 141 | Ga0068863_100735281 | 3300005841 | Bacteria | 982 |
| 142 | Ga0068858_100007950 | 3300005842 | Bacteria | 10220 |
| 143 | Ga0068858_100150859 | 3300005842 | Bacteria | 2186 |
| 144 | Ga0068858_100165196 | 3300005842 | Bacteria | 2086 |
| 145 | Ga0068860_100082132 | 3300005843 | Bacteria | 3065 |
| 146 | Ga0068860_100127705 | 3300005843 | Bacteria | 2437 |
| 147 | Ga0068860_100178037 | 3300005843 | Bacteria | 2055 |
| 148 | Ga0068862_100009980 | 3300005844 | Bacteria | 7847 |
| 149 | Ga0068862_100253237 | 3300005844 | Unclassified | 1605 |
| 150 | Ga0081455_10000059 | 3300005937 | Bacteria | 119148 |
| 151 | Ga0081455_10003227 | 3300005937 | Bacteria | 18892 |
| 152 | Ga0081455_10007580 | 3300005937 | Bacteria | 11410 |
| 153 | Ga0081455_10025599 | 3300005937 | Bacteria | 5442 |
| 154 | Ga0081540_1019697 | 3300005983 | Bacteria | 4087 |
| 155 | Ga0070717_10456688 | 3300006028 | Bacteria | 1152 |
| 156 | Ga0075365_10096149 | 3300006038 | Bacteria | 2024 |
| 157 | Ga0075368_10009881 | 3300006042 | Bacteria | 3440 |
| 158 | Ga0075363_100094831 | 3300006048 | Bacteria | 1645 |
| 159 | Ga0075364_10031734 | 3300006051 | Bacteria | 3394 |
| 160 | Ga0075432_10046659 | 3300006058 | Bacteria | 1521 |
| 161 | Ga0070712_100210933 | 3300006175 | Bacteria | 1531 |
| 162 | Ga0075362_10021352 | 3300006177 | Bacteria | 2715 |
| 163 | Ga0075367_10142533 | 3300006178 | Unclassified | 1485 |
| 164 | Ga0075369_10114095 | 3300006186 | Bacteria | 1219 |
| 165 | Ga0097621_100004720 | 3300006237 | Bacteria | 9518 |
| 166 | Ga0068871_100011297 | 3300006358 | Bacteria | 6548 |
| 167 | Ga0075430_100000094 | 3300006846 | Bacteria | 52204 |
| 168 | Ga0075431_100002415 | 3300006847 | Bacteria | 17982 |
| 169 | Ga0075433_10000311 | 3300006852 | Bacteria | 29567 |
| 170 | Ga0075433_10091058 | 3300006852 | Bacteria | 2696 |
| 171 | Ga0075433_10232499 | 3300006852 | Bacteria | 1637 |
| 172 | Ga0075434_100009504 | 3300006871 | Bacteria | 9070 |
| 173 | Ga0075434_100042656 | 3300006871 | Bacteria | 4498 |
| 174 | Ga0075434_100296546 | 3300006871 | Bacteria | 1637 |
| 175 | Ga0075429_100001750 | 3300006880 | Bacteria | 17982 |
| 176 | Ga0068865_100048747 | 3300006881 | Bacteria | 2916 |
| 177 | Ga0075436_100094044 | 3300006914 | Bacteria | 2085 |
| 178 | Ga0097620_100000920 | 3300006931 | Bacteria | 30125 |
| 179 | Ga0097620_100058509 | 3300006931 | Bacteria | 3882 |
| 180 | Ga0075435_100009711 | 3300007076 | Bacteria | 6991 |
| 181 | Ga0075435_100089551 | 3300007076 | Bacteria | 2537 |
| 182 | Ga0105244_10007516 | 3300009036 | Bacteria | 6916 |
| 183 | Ga0105250_10023618 | 3300009092 | Bacteria | 2478 |
| 184 | Ga0105240_10028382 | 3300009093 | Bacteria | 7310 |
| 185 | Ga0105240_10250534 | 3300009093 | Unclassified | 2048 |
| 186 | Ga0105240_10530235 | 3300009093 | Bacteria | 1305 |
| 187 | Ga0111539_10002742 | 3300009094 | Bacteria | 23379 |
| 188 | Ga0111539_10003209 | 3300009094 | Bacteria | 21620 |
| 189 | Ga0111539_10047268 | 3300009094 | Bacteria | 5143 |
| 190 | Ga0105245_10000183 | 3300009098 | Bacteria | 59105 |
| 191 | Ga0105247_10004155 | 3300009101 | Bacteria | 9288 |
| 192 | Ga0105247_10032128 | 3300009101 | Bacteria | 3188 |
| 193 | Ga0114129_10006608 | 3300009147 | Bacteria | 16462 |
| 194 | Ga0114129_10112310 | 3300009147 | Bacteria | 3758 |
| 195 | Ga0105243_10032095 | 3300009148 | Bacteria | 4054 |
| 196 | Ga0105243_10054799 | 3300009148 | Bacteria | 3166 |
| 197 | Ga0105241_10004816 | 3300009174 | Bacteria | 9943 |
| 198 | Ga0105242_10082236 | 3300009176 | Bacteria | 2695 |
| 199 | Ga0105248_10006282 | 3300009177 | Bacteria | 13035 |
| 200 | Ga0105248_10013499 | 3300009177 | Bacteria | 8994 |
| 201 | Ga0105248_10029374 | 3300009177 | Bacteria | 6132 |
| 202 | Ga0105248_10182565 | 3300009177 | Bacteria | 2364 |
| 203 | Ga0105237_10191401 | 3300009545 | Bacteria | 2046 |
| 204 | Ga0105237_10191836 | 3300009545 | Bacteria | 2043 |
| 205 | Ga0105238_10157368 | 3300009551 | Bacteria | 2247 |
| 206 | Ga0105249_10006556 | 3300009553 | Bacteria | 10128 |
| 207 | Ga0105249_10008411 | 3300009553 | Bacteria | 8990 |
| 208 | Ga0105239_10059786 | 3300010375 | Bacteria | 4182 |
| 209 | Ga0105239_10073618 | 3300010375 | Bacteria | 3755 |
| 210 | Ga0105246_10007150 | 3300011119 | Bacteria | 6837 |
| 211 | Ga0157342_1006973 | 3300012507 | Bacteria | 1086 |
| 212 | Ga0157371_10010950 | 3300013102 | Bacteria | 7029 |
| 213 | Ga0157370_10092783 | 3300013104 | Bacteria | 2833 |
| 214 | Ga0157370_10155148 | 3300013104 | Bacteria | 2130 |
| 215 | Ga0157370_10193349 | 3300013104 | Bacteria | 1888 |
| 216 | Ga0157370_10719423 | 3300013104 | Bacteria | 911 |
| 217 | Ga0157369_10917613 | 3300013105 | Bacteria | 898 |
| 218 | Ga0157374_10009979 | 3300013296 | Bacteria | 8153 |
| 219 | Ga0157374_10092180 | 3300013296 | Bacteria | 2890 |
| 220 | Ga0157378_10019352 | 3300013297 | Bacteria | 5986 |
| 221 | Ga0157378_10519932 | 3300013297 | Bacteria | 1191 |
| 222 | Ga0163162_10009250 | 3300013306 | Bacteria | 9587 |
| 223 | Ga0163162_10103180 | 3300013306 | Bacteria | 2945 |
| 224 | Ga0157372_10030572 | 3300013307 | Bacteria | 5892 |
| 225 | Ga0157375_10030035 | 3300013308 | Bacteria | 5118 |
| 226 | Ga0157375_10148393 | 3300013308 | Bacteria | 2478 |
| 227 | Ga0157375_10227698 | 3300013308 | Bacteria | 2023 |
| 228 | Ga0163163_10004815 | 3300014325 | Bacteria | 11592 |
| 229 | Ga0163163_10029832 | 3300014325 | Bacteria | 5249 |
| 230 | Ga0163163_10488192 | 3300014325 | Bacteria | 1293 |
| 231 | Ga0157380_10041631 | 3300014326 | Bacteria | 3586 |
| 232 | Ga0157380_10057365 | 3300014326 | Bacteria | 3101 |
| 233 | Ga0157377_10008318 | 3300014745 | Bacteria | 5056 |
| 234 | Ga0157379_10058621 | 3300014968 | Bacteria | 3443 |
| 235 | Ga0157376_10064236 | 3300014969 | Bacteria | 3095 |
| 236 | Ga0157376_10214536 | 3300014969 | Bacteria | 1779 |
| 237 | Ga0163161_10029219 | 3300017792 | Bacteria | 3919 |
| 238 | Ga0206353_11757508 | 3300020082 | Bacteria | 5739 |
| 239 | Ga0224572_1033053 | 3300024225 | Bacteria | 984 |
| 240 | Ga0207666_1000058 | 3300025271 | Bacteria | 19987 |
| 241 | Ga0207666_1001163 | 3300025271 | Bacteria | 3097 |
| 242 | Ga0207673_1000304 | 3300025290 | Bacteria | 4956 |
| 243 | Ga0207697_10002181 | 3300025315 | Bacteria | 10236 |
| 244 | Ga0207697_10037066 | 3300025315 | Bacteria | 1997 |
| 245 | Ga0207653_10009697 | 3300025885 | Bacteria | 3002 |
| 246 | Ga0207682_10000062 | 3300025893 | Bacteria | 46841 |
| 247 | Ga0207642_10018823 | 3300025899 | Bacteria | 2660 |
| 248 | Ga0207710_10014353 | 3300025900 | Bacteria | 3339 |
| 249 | Ga0207710_10088695 | 3300025900 | Bacteria | 1445 |
| 250 | Ga0207688_10000104 | 3300025901 | Bacteria | 33727 |
| 251 | Ga0207647_10023538 | 3300025904 | Bacteria | 4073 |
| 252 | Ga0207647_10024001 | 3300025904 | Bacteria | 4024 |
| 253 | Ga0207699_10100105 | 3300025906 | Bacteria | 1838 |
| 254 | Ga0207645_10000248 | 3300025907 | Bacteria | 44949 |
| 255 | Ga0207643_10000064 | 3300025908 | Bacteria | 70490 |
| 256 | Ga0207654_10027740 | 3300025911 | Bacteria | 3081 |
| 257 | Ga0207707_10017172 | 3300025912 | Bacteria | 6306 |
| 258 | Ga0207707_10021923 | 3300025912 | Bacteria | 5583 |
| 259 | Ga0207707_10082488 | 3300025912 | Bacteria | 2807 |
| 260 | Ga0207707_10102346 | 3300025912 | Bacteria | 2503 |
| 261 | Ga0207707_10337076 | 3300025912 | Bacteria | 1301 |
| 262 | Ga0207695_10378440 | 3300025913 | Bacteria | 1301 |
| 263 | Ga0207693_10012179 | 3300025915 | Bacteria | 6947 |
| 264 | Ga0207693_10037909 | 3300025915 | Bacteria | 3798 |
| 265 | Ga0207693_10057260 | 3300025915 | Bacteria | 3055 |
| 266 | Ga0207693_10260203 | 3300025915 | Bacteria | 1361 |
| 267 | Ga0207663_10078745 | 3300025916 | Bacteria | 2150 |
| 268 | Ga0207663_10100609 | 3300025916 | Bacteria | 1940 |
| 269 | Ga0207660_10031484 | 3300025917 | Bacteria | 3654 |
| 270 | Ga0207662_10000134 | 3300025918 | Bacteria | 35725 |
| 271 | Ga0207662_10013070 | 3300025918 | Bacteria | 4638 |
| 272 | Ga0207657_10001575 | 3300025919 | Bacteria | 24490 |
| 273 | Ga0207657_10012774 | 3300025919 | Bacteria | 8269 |
| 274 | Ga0207649_10058832 | 3300025920 | Bacteria | 2408 |
| 275 | Ga0207652_10018868 | 3300025921 | Bacteria | 5661 |
| 276 | Ga0207652_10057841 | 3300025921 | Bacteria | 3340 |
| 277 | Ga0207681_10050723 | 3300025923 | Bacteria | 2808 |
| 278 | Ga0207681_10083028 | 3300025923 | Bacteria | 2266 |
| 279 | Ga0207694_10060989 | 3300025924 | Bacteria | 2935 |
| 280 | Ga0207650_10036151 | 3300025925 | Bacteria | 3591 |
| 281 | Ga0207659_10001851 | 3300025926 | Bacteria | 12533 |
| 282 | Ga0207659_10051095 | 3300025926 | Bacteria | 2939 |
| 283 | Ga0207687_10002717 | 3300025927 | Bacteria | 11972 |
| 284 | Ga0207687_10064367 | 3300025927 | Bacteria | 2600 |
| 285 | Ga0207700_10030080 | 3300025928 | Bacteria | 3841 |
| 286 | Ga0207700_10081002 | 3300025928 | Bacteria | 2534 |
| 287 | Ga0207664_10332895 | 3300025929 | Bacteria | 1341 |
| 288 | Ga0207644_10004656 | 3300025931 | Bacteria | 8915 |
| 289 | Ga0207690_10038716 | 3300025932 | Bacteria | 3105 |
| 290 | Ga0207706_10007687 | 3300025933 | Bacteria | 9953 |
| 291 | Ga0207706_10033234 | 3300025933 | Bacteria | 4592 |
| 292 | Ga0207706_10040480 | 3300025933 | Bacteria | 4130 |
| 293 | Ga0207686_10030432 | 3300025934 | Bacteria | 3196 |
| 294 | Ga0207709_10031872 | 3300025935 | Bacteria | 3083 |
| 295 | Ga0207709_10031873 | 3300025935 | Bacteria | 3083 |
| 296 | Ga0207709_10051583 | 3300025935 | Bacteria | 2522 |
| 297 | Ga0207670_10038449 | 3300025936 | Bacteria | 3125 |
| 298 | Ga0207670_10066251 | 3300025936 | Bacteria | 2481 |
| 299 | Ga0207670_10077466 | 3300025936 | Bacteria | 2316 |
| 300 | Ga0207669_10010545 | 3300025937 | Bacteria | 4452 |
| 301 | Ga0207704_10022978 | 3300025938 | Bacteria | 3352 |
| 302 | Ga0207665_10079262 | 3300025939 | Bacteria | 2258 |
| 303 | Ga0207665_10170781 | 3300025939 | Bacteria | 1570 |
| 304 | Ga0207691_10004339 | 3300025940 | Bacteria | 13762 |
| 305 | Ga0207691_10159730 | 3300025940 | Bacteria | 1978 |
| 306 | Ga0207711_10008358 | 3300025941 | Bacteria | 8662 |
| 307 | Ga0207689_10001739 | 3300025942 | Bacteria | 20560 |
| 308 | Ga0207661_10000098 | 3300025944 | Bacteria | 55518 |
| 309 | Ga0207679_10000174 | 3300025945 | Bacteria | 53051 |
| 310 | Ga0207679_10122262 | 3300025945 | Bacteria | 2074 |
| 311 | Ga0207667_10062587 | 3300025949 | Bacteria | 3890 |
| 312 | Ga0207651_10000786 | 3300025960 | Bacteria | 13625 |
| 313 | Ga0207651_10058567 | 3300025960 | Bacteria | 2663 |
| 314 | Ga0207712_10021461 | 3300025961 | Bacteria | 4240 |
| 315 | Ga0207668_10530956 | 3300025972 | Unclassified | 1016 |
| 316 | Ga0207640_10008270 | 3300025981 | Bacteria | 5774 |
| 317 | Ga0207658_10060993 | 3300025986 | Bacteria | 2816 |
| 318 | Ga0207658_10221421 | 3300025986 | Bacteria | 1592 |
| 319 | Ga0207677_10019916 | 3300026023 | Bacteria | 4062 |
| 320 | Ga0207703_10001605 | 3300026035 | Bacteria | 20452 |
| 321 | Ga0207703_10058384 | 3300026035 | Bacteria | 3149 |
| 322 | Ga0207703_10178928 | 3300026035 | Bacteria | 1871 |
| 323 | Ga0207639_10082617 | 3300026041 | Bacteria | 2547 |
| 324 | Ga0207678_10029099 | 3300026067 | Bacteria | 4821 |
| 325 | Ga0207708_10022585 | 3300026075 | Bacteria | 4751 |
| 326 | Ga0207702_10120281 | 3300026078 | Bacteria | 2349 |
| 327 | Ga0207641_10052471 | 3300026088 | Bacteria | 3453 |
| 328 | Ga0207648_10004808 | 3300026089 | Bacteria | 13780 |
| 329 | Ga0207648_10028161 | 3300026089 | Bacteria | 4983 |
| 330 | Ga0207648_10270515 | 3300026089 | Bacteria | 1518 |
| 331 | Ga0207676_10070191 | 3300026095 | Bacteria | 2808 |
| 332 | Ga0207674_10011184 | 3300026116 | Bacteria | 10091 |
| 333 | Ga0207674_10099929 | 3300026116 | Bacteria | 2883 |
| 334 | Ga0207675_100001176 | 3300026118 | Bacteria | 26064 |
| 335 | Ga0207675_100032335 | 3300026118 | Bacteria | 4873 |
| 336 | Ga0207683_10007909 | 3300026121 | Bacteria | 9096 |
| 337 | Ga0207683_10443334 | 3300026121 | Bacteria | 1196 |
| 338 | Ga0207698_11023976 | 3300026142 | Bacteria | 837 |
| 339 | Ga0210002_1002216 | 3300027617 | Bacteria | 2809 |
| 340 | Ga0209971_1009754 | 3300027682 | Bacteria | 2274 |
| 341 | Ga0209971_1064312 | 3300027682 | Bacteria | 889 |
| 342 | Ga0209966_1002673 | 3300027695 | Bacteria | 2982 |
| 343 | Ga0209998_10002525 | 3300027717 | Bacteria | 4168 |
| 344 | Ga0209998_10002759 | 3300027717 | Bacteria | 3964 |
| 345 | Ga0209813_10003725 | 3300027866 | Bacteria | 3591 |
| 346 | Ga0209974_10026056 | 3300027876 | Bacteria | 1936 |
| 347 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 348 | Ga0207428_10000513 | 3300027907 | Bacteria | 46311 |
| 349 | Ga0207428_10001650 | 3300027907 | Bacteria | 23209 |
| 350 | Ga0268266_10145078 | 3300028379 | Bacteria | 2133 |
| 351 | Ga0268265_10233338 | 3300028380 | Bacteria | 1618 |
| 352 | Ga0268264_10077515 | 3300028381 | Bacteria | 2831 |
| 353 | Ga0268264_10115664 | 3300028381 | Bacteria | 2356 |
| 354 | Ga0265337_1001558 | 3300028556 | Bacteria | 11236 |
| 355 | Ga0265338_10056280 | 3300028800 | Bacteria | 3489 |
| 356 | Ga0265338_10094758 | 3300028800 | Bacteria | 2455 |
| 357 | Ga0265330_10131359 | 3300031235 | Bacteria | 1065 |
| 358 | Ga0265325_10000398 | 3300031241 | Bacteria | 30875 |
| 359 | Ga0265325_10049082 | 3300031241 | Bacteria | 2180 |
| 360 | Ga0265325_10080091 | 3300031241 | Bacteria | 1625 |
| 361 | Ga0265339_10002964 | 3300031249 | Bacteria | 11989 |
| 362 | Ga0265339_10061509 | 3300031249 | Bacteria | 2021 |
| 363 | Ga0265339_10106907 | 3300031249 | Bacteria | 1451 |
| 364 | Ga0265316_10153918 | 3300031344 | Bacteria | 1721 |
| 365 | Ga0265316_10263032 | 3300031344 | Bacteria | 1264 |
| 366 | Ga0265313_10006372 | 3300031595 | Bacteria | 8386 |
| 367 | Ga0265313_10018880 | 3300031595 | Bacteria | 3858 |
| 368 | Ga0265313_10104208 | 3300031595 | Bacteria | 1255 |
| 369 | Ga0265313_10124610 | 3300031595 | Bacteria | 1121 |
| 370 | Ga0316579_10162430 | 3300031691 | Bacteria | 1079 |
| 371 | Ga0265314_10053795 | 3300031711 | Bacteria | 2790 |
| 372 | Ga0265342_10011396 | 3300031712 | Bacteria | 6090 |
| 373 | Ga0373930_0005168 | 3300034816 | Bacteria | 2158 |
| 374 | Ga0373950_0018326 | 3300034818 | Bacteria | 1214 |
| 375 | Ga0373958_0000115 | 3300034819 | Bacteria | 8645 |
| 376 | Ga0373958_0006733 | 3300034819 | Unclassified | 1803 |
| 377 | Ga0373959_0000953 | 3300034820 | Bacteria | 4846 |
| 378 | Ga0373959_0015328 | 3300034820 | Bacteria | 1406 |
| 379 | Ga0373938_0000029 | 3300034957 | Bacteria | 18778 |
| 380 | Ga0373938_0002765 | 3300034957 | Bacteria | 2831 |
| 381 | Ga0373928_0000121 | 3300035084 | Bacteria | 14499 |
| 382 | Ga0373928_0001807 | 3300035084 | Bacteria | 4166 |
| 383 | Ga0373929_0001284 | 3300035085 | Bacteria | 4849 |
| 384 | Ga0373929_0053344 | 3300035085 | Bacteria | 929 |
| 385 | Ga0373934_0072016 | 3300035086 | Bacteria | 1383 |
| 386 | Ga0373940_0000632 | 3300035088 | Bacteria | 5634 |
| 387 | Ga0373940_0010069 | 3300035088 | Bacteria | 2213 |
| 388 | Ga0373949_0002317 | 3300035090 | Bacteria | 4946 |
| 389 | Ga0373949_0010686 | 3300035090 | Bacteria | 2013 |
| 390 | Ga0373951_0000245 | 3300035091 | Bacteria | 18132 |
| 391 | Ga0373951_0009551 | 3300035091 | Bacteria | 2182 |
| 392 | Ga0373951_0010395 | 3300035091 | Bacteria | 2089 |
| 393 | Ga0373952_0000027 | 3300035092 | Bacteria | 16625 |
| 394 | Ga0373952_0002479 | 3300035092 | Bacteria | 3328 |
| 395 | Ga0373923_0057499 | 3300035111 | Bacteria | 1645 |
| 396 | Ga0373932_0000184 | 3300035112 | Bacteria | 18145 |
| 397 | Ga0373932_0008264 | 3300035112 | Bacteria | 2486 |
| 398 | Ga0373939_0002514 | 3300035114 | Bacteria | 4316 |
| 399 | Ga0373939_0013344 | 3300035114 | Bacteria | 2112 |
| 400 | Ga0373941_0001231 | 3300035115 | Bacteria | 5371 |
| 401 | Ga0373953_0019775 | 3300035117 | Bacteria | 2509 |
| 402 | Ga0373953_0093834 | 3300035117 | Bacteria | 1257 |
| 403 | Ga0373954_0011707 | 3300035118 | Bacteria | 3892 |
| 404 | Ga0373954_0014085 | 3300035118 | Bacteria | 3565 |
| 405 | Ga0373956_0017813 | 3300035119 | Bacteria | 3001 |
| 406 | Ga0373956_0196156 | 3300035119 | Bacteria | 956 |
| 407 | Ga0373957_0012150 | 3300035120 | Bacteria | 2892 |
| 408 | Ga0373957_0046677 | 3300035120 | Bacteria | 1645 |
| 409 | Ga0373957_0048552 | 3300035120 | Bacteria | 1618 |
| 410 | Ga0373960_0000954 | 3300035121 | Bacteria | 6212 |
| 411 | Ga0373960_0011280 | 3300035121 | Bacteria | 2199 |
| 412 | Ga0373960_0012254 | 3300035121 | Bacteria | 2127 |
| 413 | Ga0373943_0102588 | 3300035170 | Bacteria | 1498 |
| 414 | Ga0373955_0009584 | 3300035172 | Bacteria | 4544 |
| 415 | Ga0373942_0000413 | 3300035207 | Bacteria | 11943 |
| 416 | Ga0373942_0003298 | 3300035207 | Bacteria | 3800 |
| 417 | Ga0373961_0006713 | 3300035241 | Bacteria | 2767 |
| 418 | Ga0373962_0019611 | 3300035242 | Bacteria | 1770 |
| 419 | Ga0373924_0025238 | 3300035410 | Bacteria | 2349 |
| 420 | Ga0373931_0017929 | 3300035691 | Bacteria | 3511 |
| 421 | Ga0373931_0019490 | 3300035691 | Bacteria | 3386 |
| 422 | Ga0373935_0199320 | 3300035692 | Bacteria | 1382 |
| 423 | Ga0373927_0028383 | 3300035695 | Bacteria | 3649 |
| 424 | Ga0373933_0001260 | 3300035724 | Bacteria | 14949 |
| 425 | Ga0373933_0001594 | 3300035724 | Bacteria | 13285 |
| 426 | Ga0373933_0055454 | 3300035724 | Bacteria | 2378 |
| 427 | Ga0373947_0011238 | 3300035725 | Bacteria | 5137 |
| 428 | Ga0373937_0002059 | 3300036401 | Bacteria | 16802 |
| 429 | Ga0373937_0005468 | 3300036401 | Bacteria | 10879 |
| 430 | Ga0373937_0011313 | 3300036401 | Bacteria | 7827 |
| 431 | Ga0373937_0025330 | 3300036401 | Bacteria | 5355 |
| 432 | Ga0373937_0634331 | 3300036401 | Bacteria | 1014 |
| 433 | Ga0373925_0058527 | 3300037068 | Bacteria | 2890 |
| 434 | Ga0373925_0153626 | 3300037068 | Bacteria | 1809 |
| 435 | Ga0373925_0236795 | 3300037068 | Bacteria | 1461 |
| 436 | Ga0242419_000779 | 3300038698 | Bacteria | 1817 |
| 437 | Ga0242420_009034 | 3300038996 | Bacteria | 1629 |
| 438 | Ga0436365_0592838 | 3300039437 | Bacteria | 5457 |
| 439 | Ga0451789_0289166 | 3300041443 | Bacteria | 820 |
| 440 | Ga0439464_0051376 | 3300042439 | Unclassified | 1193 |
| 441 | Ga0439460_0018060 | 3300042461 | Bacteria | 1896 |
| 442 | Ga0451577_0099082 | 3300042876 | Bacteria | 2603 |
| 443 | Ga0466966_0075655 | 3300044684 | Bacteria | 2103 |
| 444 | Ga0466961_0037785 | 3300044693 | Bacteria | 3097 |
| 445 | Ga0466963_0139045 | 3300044694 | Bacteria | 1681 |
| 446 | Ga0466957_0060726 | 3300044842 | Bacteria | 2318 |
| 447 | Ga0466959_0144643 | 3300045049 | Bacteria | 1678 |
| 448 | Ga0451576_0013919 | 3300045051 | Bacteria | 8983 |
| 449 | Ga0495592_0000977 | 3300046454 | Bacteria | 19838 |
| 450 | Ga0495592_0005236 | 3300046454 | Bacteria | 9564 |
| 451 | Ga0495592_0064072 | 3300046454 | Bacteria | 2695 |
| 452 | Ga0495592_0083431 | 3300046454 | Bacteria | 2307 |
| 453 | Ga0495592_0175888 | 3300046454 | Bacteria | 1462 |
| 454 | Ga0495603_0235693 | 3300046455 | Bacteria | 1055 |
| 455 | Ga0495603_0256376 | 3300046455 | Bacteria | 1007 |
| 456 | Ga0495629_0012459 | 3300046459 | Bacteria | 6159 |
| 457 | Ga0495651_0001229 | 3300046462 | Bacteria | 19817 |
| 458 | Ga0495651_0063577 | 3300046462 | Bacteria | 2820 |
| 459 | Ga0495651_0093622 | 3300046462 | Bacteria | 2249 |
| 460 | Ga0495653_0008785 | 3300046463 | Bacteria | 8274 |
| 461 | Ga0495653_0017398 | 3300046463 | Bacteria | 5846 |
| 462 | Ga0495653_0058844 | 3300046463 | Bacteria | 2920 |
| 463 | Ga0495639_0019558 | 3300046475 | Bacteria | 2957 |
| 464 | Ga0495662_0080669 | 3300046476 | Bacteria | 1582 |
| 465 | Ga0495664_0092553 | 3300046477 | Bacteria | 1818 |
| 466 | Ga0495664_0198053 | 3300046477 | Bacteria | 1217 |
| 467 | Ga0495584_0009511 | 3300046491 | Bacteria | 5005 |
| 468 | Ga0495584_0114429 | 3300046491 | Unclassified | 1365 |
| 469 | Ga0495608_0002079 | 3300046511 | Bacteria | 14419 |
| 470 | Ga0495608_0010323 | 3300046511 | Bacteria | 6517 |
| 471 | Ga0495618_0006214 | 3300046514 | Bacteria | 7248 |
| 472 | Ga0495618_0066540 | 3300046514 | Bacteria | 2290 |
| 473 | Ga0495618_0263552 | 3300046514 | Bacteria | 1078 |
| 474 | Ga0495628_0002874 | 3300046516 | Bacteria | 15429 |
| 475 | Ga0495628_0058341 | 3300046516 | Bacteria | 3033 |
| 476 | Ga0495628_0070950 | 3300046516 | Bacteria | 2715 |
| 477 | Ga0495630_0162156 | 3300046517 | Bacteria | 1702 |
| 478 | Ga0495630_0251416 | 3300046517 | Bacteria | 1350 |
| 479 | Ga0495648_0025233 | 3300046524 | Bacteria | 4028 |
| 480 | Ga0495652_0011201 | 3300046529 | Bacteria | 8120 |
| 481 | Ga0495652_0015643 | 3300046529 | Bacteria | 6790 |
| 482 | Ga0495652_0064134 | 3300046529 | Bacteria | 3091 |
| 483 | Ga0495640_0012149 | 3300046533 | Bacteria | 6592 |
| 484 | Ga0495640_0032609 | 3300046533 | Bacteria | 3710 |
| 485 | Ga0495586_0059313 | 3300046535 | Bacteria | 2079 |
| 486 | Ga0495587_0001517 | 3300046536 | Bacteria | 15420 |
| 487 | Ga0495587_0013260 | 3300046536 | Bacteria | 5182 |
| 488 | Ga0495645_0001520 | 3300046543 | Bacteria | 15645 |
| 489 | Ga0495645_0033460 | 3300046543 | Bacteria | 3750 |
| 490 | Ga0495645_0052120 | 3300046543 | Bacteria | 2977 |
| 491 | Ga0495667_0003504 | 3300046559 | Bacteria | 10524 |
| 492 | Ga0495667_0006970 | 3300046559 | Bacteria | 7666 |
| 493 | Ga0495667_0010321 | 3300046559 | Bacteria | 6317 |
| 494 | Ga0495667_0081150 | 3300046559 | Bacteria | 2108 |
| 495 | Ga0495634_0013659 | 3300046642 | Bacteria | 5864 |
| 496 | Ga0495634_0056342 | 3300046642 | Bacteria | 2626 |
| 497 | Ga0495634_0064248 | 3300046642 | Bacteria | 2434 |
| 498 | Ga0495634_0175633 | 3300046642 | Bacteria | 1344 |
| 499 | Ga0495611_0131437 | 3300046648 | Bacteria | 1168 |
| 500 | Ga0495635_0009233 | 3300046663 | Bacteria | 6888 |
| 501 | Ga0495635_0011873 | 3300046663 | Bacteria | 6105 |
| 502 | Ga0495635_0033017 | 3300046663 | Bacteria | 3591 |
| 503 | Ga0495659_0074672 | 3300046664 | Bacteria | 1276 |
| 504 | Ga0495657_0013755 | 3300046675 | Bacteria | 5958 |
| 505 | Ga0495657_0022880 | 3300046675 | Bacteria | 4472 |
| 506 | Ga0495599_0002791 | 3300046678 | Bacteria | 10181 |
| 507 | Ga0495623_0001343 | 3300046679 | Bacteria | 16663 |
| 508 | Ga0495623_0015018 | 3300046679 | Bacteria | 5006 |
| 509 | Ga0495623_0023847 | 3300046679 | Bacteria | 3947 |
| 510 | Ga0495646_0006053 | 3300046680 | Bacteria | 7671 |
| 511 | Ga0495646_0022295 | 3300046680 | Bacteria | 3996 |
| 512 | Ga0495646_0032748 | 3300046680 | Bacteria | 3233 |
| 513 | Ga0495658_0018993 | 3300046683 | Bacteria | 3582 |
| 514 | Ga0495658_0118916 | 3300046683 | Bacteria | 1596 |
| 515 | Ga0495669_0125200 | 3300046684 | Unclassified | 1207 |
| 516 | Ga0495613_0038390 | 3300046689 | Bacteria | 3550 |
| 517 | Ga0495613_0086225 | 3300046689 | Bacteria | 2277 |
| 518 | Ga0495624_0077419 | 3300046690 | Bacteria | 2063 |
| 519 | Ga0495600_0004399 | 3300046809 | Bacteria | 8427 |
| 520 | Ga0495600_0013400 | 3300046809 | Bacteria | 5152 |
| 521 | Ga0495600_0052295 | 3300046809 | Bacteria | 2667 |
| 522 | Ga0495600_0193655 | 3300046809 | Bacteria | 1306 |
| 523 | Ga0495581_0068701 | 3300047315 | Bacteria | 2049 |
| 524 | Ga0495604_0005068 | 3300047317 | Bacteria | 10428 |
| 525 | Ga0495604_0021395 | 3300047317 | Bacteria | 5164 |
| 526 | Ga0495604_0032301 | 3300047317 | Bacteria | 4150 |
| 527 | Ga0495604_0096216 | 3300047317 | Bacteria | 2186 |
| 528 | Ga0495674_0008197 | 3300047319 | Bacteria | 9970 |
| 529 | Ga0495674_0073545 | 3300047319 | Bacteria | 2946 |
| 530 | Ga0495674_0086510 | 3300047319 | Bacteria | 2683 |
| 531 | Ga0495674_0096932 | 3300047319 | Bacteria | 2512 |
| 532 | Ga0495674_0280727 | 3300047319 | Bacteria | 1364 |
| 533 | Ga0495676_0167434 | 3300047321 | Bacteria | 1549 |
| 534 | Ga0495680_0003398 | 3300047322 | Bacteria | 15707 |
| 535 | Ga0495680_0003788 | 3300047322 | Bacteria | 14702 |
| 536 | Ga0495680_0006593 | 3300047322 | Bacteria | 10770 |
| 537 | Ga0495680_0094179 | 3300047322 | Bacteria | 2241 |
| 538 | Ga0495675_0002111 | 3300047444 | Bacteria | 11859 |
| 539 | Ga0495684_0036214 | 3300047471 | Bacteria | 3784 |
| 540 | Ga0495686_0049876 | 3300047472 | Bacteria | 2632 |
| 541 | Ga0495686_0102437 | 3300047472 | Bacteria | 1725 |
| 542 | Ga0495593_0134252 | 3300047673 | Bacteria | 1255 |
| 543 | Ga0495593_0259270 | 3300047673 | Bacteria | 870 |
| 544 | Ga0495602_0008143 | 3300048088 | Bacteria | 10943 |
| 545 | Ga0495602_0036984 | 3300048088 | Bacteria | 4536 |
| 546 | Ga0495614_0265880 | 3300048089 | Bacteria | 787 |
| 547 | Ga0496100_0004065 | 3300048903 | Bacteria | 7713 |
| 548 | Ga0496101_0017402 | 3300048904 | Bacteria | 4875 |
| 549 | Ga0496101_0026633 | 3300048904 | Bacteria | 4020 |
| 550 | Ga0496102_0285516 | 3300048905 | Unclassified | 1555 |
| 551 | Ga0496103_0028447 | 3300048906 | Bacteria | 3392 |
| 552 | Ga0496103_0029611 | 3300048906 | Bacteria | 3328 |
| 553 | Ga0496103_0066812 | 3300048906 | Bacteria | 2244 |
| 554 | Ga0496104_0000126 | 3300048907 | Bacteria | 70488 |
| 555 | Ga0496104_0041050 | 3300048907 | Bacteria | 4337 |
| 556 | Ga0496104_0045945 | 3300048907 | Bacteria | 4109 |
| 557 | Ga0496104_0186823 | 3300048907 | Bacteria | 1983 |
| 558 | Ga0496105_0001562 | 3300048908 | Bacteria | 16224 |
| 559 | Ga0496105_0009019 | 3300048908 | Bacteria | 7783 |
| 560 | Ga0496106_0018040 | 3300048909 | Bacteria | 5217 |
| 561 | Ga0496106_0019136 | 3300048909 | Bacteria | 5076 |
| 562 | Ga0496106_0074272 | 3300048909 | Bacteria | 2602 |
| 563 | Ga0496107_0015179 | 3300048910 | Bacteria | 5396 |
| 564 | Ga0496107_0051373 | 3300048910 | Bacteria | 2973 |
| 565 | Ga0496107_0061807 | 3300048910 | Bacteria | 2712 |
| 566 | Ga0496107_0079988 | 3300048910 | Bacteria | 2383 |
| 567 | Ga0496107_0292030 | 3300048910 | Bacteria | 1213 |
| 568 | Ga0496108_0004643 | 3300048911 | Bacteria | 11074 |
| 569 | Ga0496108_0032262 | 3300048911 | Bacteria | 4350 |
| 570 | Ga0496109_0000188 | 3300048912 | Bacteria | 61633 |
| 571 | Ga0496109_0000831 | 3300048912 | Bacteria | 25758 |
| 572 | Ga0496109_0045459 | 3300048912 | Bacteria | 3985 |
| 573 | Ga0496110_0018071 | 3300048913 | Bacteria | 5907 |
| 574 | Ga0496110_0107676 | 3300048913 | Bacteria | 2502 |
| 575 | Ga0496110_0232069 | 3300048913 | Bacteria | 1678 |
| 576 | Ga0496111_0005732 | 3300048914 | Bacteria | 8009 |
| 577 | Ga0496111_0051979 | 3300048914 | Bacteria | 2959 |
| 578 | Ga0496111_0087931 | 3300048914 | Bacteria | 2275 |
| 579 | Ga0496111_0428973 | 3300048914 | Bacteria | 976 |
| 580 | Ga0496112_0053867 | 3300048915 | Bacteria | 3952 |
| 581 | Ga0496113_0000478 | 3300048916 | Bacteria | 19609 |
| 582 | Ga0496113_0110473 | 3300048916 | Bacteria | 2139 |
| 583 | Ga0496114_0029292 | 3300048917 | Bacteria | 4523 |
| 584 | Ga0496114_0058254 | 3300048917 | Bacteria | 3225 |
| 585 | Ga0496114_0078927 | 3300048917 | Bacteria | 2777 |
| 586 | Ga0496115_0007975 | 3300048918 | Bacteria | 7818 |
| 587 | Ga0496115_0096288 | 3300048918 | Bacteria | 2423 |
| 588 | Ga0496115_0117874 | 3300048918 | Bacteria | 2184 |
| 589 | Ga0496115_0356921 | 3300048918 | Bacteria | 1191 |
| 590 | Ga0501031_0021508 | 3300049568 | Bacteria | 4204 |
| 591 | Ga0501032_0007580 | 3300049569 | Bacteria | 7922 |
| 592 | Ga0501032_0065423 | 3300049569 | Bacteria | 2431 |
| 593 | Ga0501032_0126039 | 3300049569 | Bacteria | 1691 |
| 594 | Ga0501033_0012528 | 3300049570 | Bacteria | 6471 |
| 595 | Ga0501034_0047775 | 3300049571 | Bacteria | 4320 |
| 596 | Ga0501034_0078675 | 3300049571 | Bacteria | 3301 |
| 597 | Ga0501034_0105996 | 3300049571 | Bacteria | 2803 |
| 598 | Ga0501034_0158358 | 3300049571 | Bacteria | 2237 |
| 599 | Ga0501034_0616440 | 3300049571 | Bacteria | 989 |
| 600 | Ga0501036_0145056 | 3300049572 | Bacteria | 2002 |
| 601 | Ga0501036_0261549 | 3300049572 | Bacteria | 1449 |
| 602 | Ga0501037_0003014 | 3300049573 | Bacteria | 12233 |
| 603 | Ga0501037_0012452 | 3300049573 | Bacteria | 6266 |
| 604 | Ga0501037_0025758 | 3300049573 | Bacteria | 4343 |
| 605 | Ga0501037_0139396 | 3300049573 | Bacteria | 1736 |
| 606 | Ga0501038_0006074 | 3300049574 | Bacteria | 11174 |
| 607 | Ga0501038_0006400 | 3300049574 | Bacteria | 10906 |
| 608 | Ga0501039_0025227 | 3300049575 | Bacteria | 4567 |
| 609 | Ga0501039_0064571 | 3300049575 | Bacteria | 2838 |
| 610 | Ga0501039_0318156 | 3300049575 | Bacteria | 1223 |
| 611 | Ga0501039_0382720 | 3300049575 | Bacteria | 1105 |
| 612 | Ga0501040_0199648 | 3300049576 | Bacteria | 1420 |
| 613 | Ga0501043_0017718 | 3300049579 | Bacteria | 5584 |
| 614 | Ga0501043_0295893 | 3300049579 | Bacteria | 1238 |
| 615 | Ga0501043_0297196 | 3300049579 | Bacteria | 1235 |
| 616 | Ga0501043_0310301 | 3300049579 | Bacteria | 1204 |
| 617 | Ga0501046_0006409 | 3300049580 | Bacteria | 10433 |
| 618 | Ga0501046_0054232 | 3300049580 | Bacteria | 3154 |
| 619 | Ga0501046_0131055 | 3300049580 | Bacteria | 1902 |
| 620 | Ga0501046_0207297 | 3300049580 | Bacteria | 1456 |
| 621 | Ga0501047_0008130 | 3300049581 | Bacteria | 9900 |
| 622 | Ga0501047_0040003 | 3300049581 | Bacteria | 4534 |
| 623 | Ga0501047_0040364 | 3300049581 | Bacteria | 4513 |
| 624 | Ga0501047_0123765 | 3300049581 | Bacteria | 2466 |
| 625 | Ga0501047_0194974 | 3300049581 | Bacteria | 1888 |
| 626 | Ga0501047_0466162 | 3300049581 | Bacteria | 1092 |
| 627 | Ga0501048_0009463 | 3300049582 | Bacteria | 7313 |
| 628 | Ga0501067_0008646 | 3300049583 | Bacteria | 5645 |
| 629 | Ga0501068_0003025 | 3300049584 | Bacteria | 8971 |
| 630 | Ga0501068_0238773 | 3300049584 | Bacteria | 1156 |
| 631 | Ga0501069_0070407 | 3300049585 | Bacteria | 1959 |
| 632 | Ga0501070_0018855 | 3300049586 | Bacteria | 5788 |
| 633 | Ga0501070_0035258 | 3300049586 | Bacteria | 4182 |
| 634 | Ga0501070_0283869 | 3300049586 | Bacteria | 1350 |
| 635 | Ga0501070_0290737 | 3300049586 | Bacteria | 1332 |
| 636 | Ga0501071_0067429 | 3300049587 | Bacteria | 2602 |
| 637 | Ga0501071_0104047 | 3300049587 | Bacteria | 2095 |
| 638 | Ga0501072_0268873 | 3300049588 | Bacteria | 1357 |
| 639 | Ga0501072_0447098 | 3300049588 | Bacteria | 1024 |
| 640 | Ga0501073_0012248 | 3300049589 | Bacteria | 6259 |
| 641 | Ga0501073_0163021 | 3300049589 | Bacteria | 1544 |
| 642 | Ga0501073_0490506 | 3300049589 | Bacteria | 850 |
| 643 | Ga0501074_0019331 | 3300049590 | Bacteria | 4948 |
| 644 | Ga0501074_0169367 | 3300049590 | Bacteria | 1559 |
| 645 | Ga0501075_0216270 | 3300049591 | Bacteria | 1462 |
| 646 | Ga0501076_0055308 | 3300049592 | Bacteria | 3147 |
| 647 | Ga0501077_0036288 | 3300049593 | Bacteria | 3140 |
| 648 | Ga0501080_0015340 | 3300049742 | Bacteria | 7061 |
| 649 | Ga0501080_0037678 | 3300049742 | Bacteria | 4515 |
| 650 | Ga0501080_0068717 | 3300049742 | Bacteria | 3295 |
| 651 | Ga0501083_0030430 | 3300049744 | Bacteria | 3709 |
| 652 | Ga0501083_0044224 | 3300049744 | Bacteria | 3015 |
| 653 | Ga0501083_0176162 | 3300049744 | Bacteria | 1397 |
| 654 | Ga0501035_0009635 | 3300049822 | Bacteria | 8983 |
| 655 | Ga0501035_0388756 | 3300049822 | Bacteria | 1162 |
| 656 | Ga0501035_0457917 | 3300049822 | Bacteria | 1054 |
| 657 | Ga0501035_0607976 | 3300049822 | Bacteria | 890 |
| 658 | Ga0501044_0034371 | 3300049823 | Bacteria | 5316 |
| 659 | Ga0501044_0099753 | 3300049823 | Bacteria | 2922 |
| 660 | Ga0501044_0215223 | 3300049823 | Bacteria | 1874 |
| 661 | Ga0501044_0277177 | 3300049823 | Bacteria | 1611 |
| 662 | Ga0501044_0386085 | 3300049823 | Bacteria | 1315 |
| 663 | Ga0501044_0433333 | 3300049823 | Bacteria | 1223 |
| 664 | Ga0501045_0025005 | 3300049824 | Bacteria | 4290 |
| 665 | nmdc:mga03683_125930_c1 | 3300050489 | Bacteria | 1143 |
| 666 | nmdc:mga03n38_50030_c1 | 3300050490 | Bacteria | 1861 |
| 667 | nmdc:mga00v17_116628_c1 | 3300050491 | Bacteria | 1698 |
| 668 | nmdc:mga00v17_20175_c1 | 3300050491 | Bacteria | 2119 |
| 669 | nmdc:mga0yw44_137254_c2 | 3300050492 | Bacteria | 1056 |
| 670 | nmdc:mga0k408_485526_c1 | 3300050493 | Bacteria | 733 |
| 671 | nmdc:mga06z11_33142_c1 | 3300050494 | Bacteria | 2525 |
| 672 | nmdc:mga06z11_59148_c1 | 3300050494 | Bacteria | 1991 |
| 673 | nmdc:mga04h51_33140_c1 | 3300050495 | Bacteria | 1643 |
| 674 | nmdc:mga07m45_12942_c1 | 3300050496 | Bacteria | 4415 |
| 675 | nmdc:mga07m45_26313_c1 | 3300050496 | Bacteria | 3197 |
| 676 | nmdc:mga07m45_41994_c2 | 3300050496 | Bacteria | 2208 |
| 677 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 678 | nmdc:mga05p37_7430_c1 | 3300050507 | Bacteria | 12928 |
| 679 | nmdc:mga09592_1665_c1 | 3300050508 | Bacteria | 17906 |
| 680 | nmdc:mga0qj67_12610_c1 | 3300050509 | Bacteria | 6373 |
| 681 | nmdc:mga06r32_16533_c1 | 3300050510 | Bacteria | 6726 |
| 682 | nmdc:mga08y16_684_c1 | 3300050511 | Bacteria | 32082 |
| 683 | nmdc:mga08y16_83672_c1 | 3300050511 | Bacteria | 3326 |
| 684 | nmdc:mga0n895_46646_c1 | 3300050512 | Bacteria | 4234 |
| 685 | nmdc:mga0n895_824_c1 | 3300050512 | Bacteria | 22214 |
| 686 | nmdc:mga0n895_9017_c1 | 3300050512 | Bacteria | 8700 |
| 687 | nmdc:mga0rr50_134223_c1 | 3300050513 | Bacteria | 1985 |
| 688 | nmdc:mga0rr50_19008_c1 | 3300050513 | Bacteria | 4628 |
| 689 | nmdc:mga0rr50_265161_c1 | 3300050513 | Bacteria | 1430 |
| 690 | nmdc:mga0rr50_670517_c1 | 3300050513 | Unclassified | 885 |
| 691 | nmdc:mga0a205_109041_c1 | 3300050515 | Bacteria | 2667 |
| 692 | nmdc:mga0a205_2160_c1 | 3300050515 | Bacteria | 17293 |
| 693 | nmdc:mga0a205_216234_c1 | 3300050515 | Bacteria | 1803 |
| 694 | nmdc:mga0a205_31621_c1 | 3300050515 | Bacteria | 5072 |
| 695 | Ga0495601_0000159 | 3300053077 | Bacteria | 37216 |
| 696 | Ga0495601_0004646 | 3300053077 | Bacteria | 7952 |
| 697 | Ga0495601_0004928 | 3300053077 | Bacteria | 7748 |
| 698 | Ga0495601_0029443 | 3300053077 | Bacteria | 3405 |
| 699 | Ga0495601_0040605 | 3300053077 | Bacteria | 2914 |
| 700 | Ga0495612_0000689 | 3300053078 | Bacteria | 13637 |
| 701 | Ga0495612_0004359 | 3300053078 | Bacteria | 5870 |
| 702 | Ga0495612_0015211 | 3300053078 | Bacteria | 3085 |
| 703 | Ga0495595_0000974 | 3300053084 | Bacteria | 11030 |
| 704 | Ga0495595_0014772 | 3300053084 | Bacteria | 3319 |
| 705 | Ga0495595_0017832 | 3300053084 | Bacteria | 3058 |
| 706 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 707 | Ga0495619_0001290 | 3300053085 | Bacteria | 16473 |
| 708 | Ga0495619_0048530 | 3300053085 | Bacteria | 2798 |
| 709 | Ga0500578_0104062 | 3300053086 | Bacteria | 1794 |
| 710 | Ga0500643_015552 | 3300053087 | Bacteria | 2605 |
| 711 | Ga0500644_0000552 | 3300053088 | Bacteria | 15075 |
| 712 | Ga0500651_0182986 | 3300053093 | Bacteria | 1244 |
| 713 | Ga0500641_0060664 | 3300053096 | Bacteria | 1574 |
| 714 | Ga0500562_057999 | 3300053108 | Bacteria | 1039 |
| 715 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 716 | Ga0500595_008002 | 3300053119 | Bacteria | 4342 |
| 717 | Ga0500595_015324 | 3300053119 | Bacteria | 2881 |
| 718 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 719 | Ga0500616_0142151 | 3300053153 | Bacteria | 1120 |
| 720 | Ga0500645_000559 | 3300053730 | Bacteria | 24493 |
| 721 | Ga0501084_0126764 | 3300054114 | Bacteria | 2148 |
| 722 | Ga0501084_0210818 | 3300054114 | Bacteria | 1639 |
| 723 | Ga0501082_0060360 | 3300060353 | Bacteria | 3265 |
| 724 | Ga0501082_0070745 | 3300060353 | Bacteria | 3004 |
| 725 | Ga0501082_0106231 | 3300060353 | Bacteria | 2429 |
| 726 | Ga0501082_0169003 | 3300060353 | Bacteria | 1901 |
| 727 | Ga0466962_0071453 | 3300061719 | Bacteria | 1658 |
| 728 | Ga0466962_0112881 | 3300061719 | Bacteria | 1309 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046514 | Ga0495618_0263552 | Ga0495618_0263552_10_642 | 208 |
| 2 | 3300050493 | nmdc:mga0k408_485526_c1 | nmdc:mga0k408_485526_c1_20_667 | 213 |
| 3 | 3300049590 | Ga0501074_0019331 | Ga0501074_0019331_32_727 | 230 |
| 4 | 3300005439 | Ga0070711_100193921 | Ga0070711_1001939211 | 231 |
| 5 | 3300006038 | Ga0075365_10096149 | Ga0075365_100961492 | 231 |
| 6 | 3300035170 | Ga0373943_0102588 | Ga0373943_0102588_787_1488 | 231 |
| 7 | 3300049581 | Ga0501047_0194974 | Ga0501047_0194974_868_1566 | 231 |
| 8 | 3300049580 | Ga0501046_0131055 | Ga0501046_0131055_328_1077 | 232 |
| 9 | iso_pu_bacteria | 2757320392 | 2757570139 | 236 |
| 10 | 3300005434 | Ga0070709_10014842 | Ga0070709_100148422 | 237 |
| 11 | 3300005436 | Ga0070713_100001408 | Ga0070713_10000140810 | 237 |
| 12 | 3300005439 | Ga0070711_100008598 | Ga0070711_1000085985 | 237 |
| 13 | 3300025916 | Ga0207663_10100609 | Ga0207663_101006092 | 237 |
| 14 | 3300025928 | Ga0207700_10030080 | Ga0207700_100300803 | 237 |
| 15 | 3300025939 | Ga0207665_10170781 | Ga0207665_101707812 | 237 |
| 16 | 3300039437 | Ga0436365_0592838 | Ga0436365_0592838_918_1667 | 237 |
| 17 | 3300046689 | Ga0495613_0086225 | Ga0495613_0086225_1220_1942 | 237 |
| 18 | 3300049581 | Ga0501047_0466162 | Ga0501047_0466162_62_790 | 237 |
| 19 | iso_pu_bacteria | 2937843397 | 2937844710 | 237 |
| 20 | 3300053119 | Ga0500595_015324 | Ga0500595_015324_136_864 | 238 |
| 21 | iso_pu_bacteria | 2643221736 | 2644742495 | 238 |
| 22 | iso_pu_bacteria | 2738543032 | 2739356454 | 238 |
| 23 | iso_pu_bacteria | 2829745981 | 2829750485 | 238 |
| 24 | iso_pu_bacteria | 2861691609 | 2861695928 | 238 |
| 25 | iso_pu_bacteria | 2902330777 | 2902331292 | 238 |
| 26 | 3300005458 | Ga0070681_10005125 | Ga0070681_1000512511 | 239 |
| 27 | 3300013104 | Ga0157370_10155148 | Ga0157370_101551482 | 239 |
| 28 | 3300053086 | Ga0500578_0104062 | Ga0500578_0104062_239_982 | 239 |
| 29 | 3300005340 | Ga0070689_100061168 | Ga0070689_1000611683 | 240 |
| 30 | 3300025936 | Ga0207670_10066251 | Ga0207670_100662512 | 240 |
| 31 | 3300048914 | Ga0496111_0428973 | Ga0496111_0428973_39_764 | 240 |
| 32 | 3300049579 | Ga0501043_0310301 | Ga0501043_0310301_163_894 | 240 |
| 33 | 3300049823 | Ga0501044_0099753 | Ga0501044_0099753_191_922 | 240 |
| 34 | 3300053153 | Ga0500616_0142151 | Ga0500616_0142151_179_910 | 240 |
| 35 | iso_pu_bacteria | 2891048133 | 2891049593 | 240 |
| 36 | iso_pu_bacteria | 2995392953 | 2995396371 | 240 |
| 37 | 3300047472 | Ga0495686_0049876 | Ga0495686_0049876_1221_1982 | 241 |
| 38 | 3300047472 | Ga0495686_0102437 | Ga0495686_0102437_269_1018 | 241 |
| 39 | 3300049571 | Ga0501034_0105996 | Ga0501034_0105996_1201_1932 | 241 |
| 40 | 3300049574 | Ga0501038_0006400 | Ga0501038_0006400_4232_4963 | 241 |
| 41 | 3300049582 | Ga0501048_0009463 | Ga0501048_0009463_274_1005 | 241 |
| 42 | 3300049587 | Ga0501071_0067429 | Ga0501071_0067429_967_1698 | 241 |
| 43 | 3300049589 | Ga0501073_0012248 | Ga0501073_0012248_313_1044 | 241 |
| 44 | 3300049822 | Ga0501035_0457917 | Ga0501035_0457917_11_742 | 241 |
| 45 | 3300049824 | Ga0501045_0025005 | Ga0501045_0025005_1051_1782 | 241 |
| 46 | 3300053730 | Ga0500645_000559 | Ga0500645_000559_880_1611 | 241 |
| 47 | 3300054114 | Ga0501084_0126764 | Ga0501084_0126764_1106_1837 | 241 |
| 48 | 3300000043 | ARcpr5yngRDRAFT_c000024 | ARcpr5yngRDRAFT_0000249 | 242 |
| 49 | 3300000044 | ARSoilOldRDRAFT_c000034 | ARSoilOldRDRAFT_00003414 | 242 |
| 50 | 3300000652 | ARCol0yngRDRAFT_1000026 | ARCol0yngRDRAFT_100002612 | 242 |
| 51 | 3300001989 | JGI24739J22299_10011920 | JGI24739J22299_100119203 | 242 |
| 52 | 3300001990 | JGI24737J22298_10000377 | JGI24737J22298_1000037710 | 242 |
| 53 | 3300002070 | JGI24750J21931_1000721 | JGI24750J21931_10007213 | 242 |
| 54 | 3300002073 | JGI24745J21846_1000072 | JGI24745J21846_10000723 | 242 |
| 55 | 3300002074 | JGI24748J21848_1001393 | JGI24748J21848_10013933 | 242 |
| 56 | 3300002075 | JGI24738J21930_10001830 | JGI24738J21930_100018303 | 242 |
| 57 | 3300002076 | JGI24749J21850_1001077 | JGI24749J21850_10010774 | 242 |
| 58 | 3300002077 | JGI24744J21845_10003744 | JGI24744J21845_100037443 | 242 |
| 59 | 3300002126 | JGI24035J26624_1000268 | JGI24035J26624_10002684 | 242 |
| 60 | 3300002239 | JGI24034J26672_10003945 | JGI24034J26672_100039453 | 242 |
| 61 | 3300002244 | JGI24742J22300_10000140 | JGI24742J22300_100001403 | 242 |
| 62 | 3300005293 | Ga0065715_10160156 | Ga0065715_101601562 | 242 |
| 63 | 3300005328 | Ga0070676_10012406 | Ga0070676_100124064 | 242 |
| 64 | 3300005329 | Ga0070683_100083423 | Ga0070683_1000834232 | 242 |
| 65 | 3300005330 | Ga0070690_100018681 | Ga0070690_1000186813 | 242 |
| 66 | 3300005330 | Ga0070690_100186021 | Ga0070690_1001860212 | 242 |
| 67 | 3300005331 | Ga0070670_100011123 | Ga0070670_1000111237 | 242 |
| 68 | 3300005333 | Ga0070677_10001300 | Ga0070677_100013002 | 242 |
| 69 | 3300005334 | Ga0068869_100023413 | Ga0068869_1000234132 | 242 |
| 70 | 3300005335 | Ga0070666_10022569 | Ga0070666_100225694 | 242 |
| 71 | 3300005336 | Ga0070680_100010070 | Ga0070680_1000100706 | 242 |
| 72 | 3300005336 | Ga0070680_100016122 | Ga0070680_1000161223 | 242 |
| 73 | 3300005337 | Ga0070682_100056018 | Ga0070682_1000560181 | 242 |
| 74 | 3300005338 | Ga0068868_100323350 | Ga0068868_1003233502 | 242 |
| 75 | 3300005339 | Ga0070660_100035576 | Ga0070660_1000355763 | 242 |
| 76 | 3300005339 | Ga0070660_100156701 | Ga0070660_1001567011 | 242 |
| 77 | 3300005340 | Ga0070689_100191463 | Ga0070689_1001914632 | 242 |
| 78 | 3300005341 | Ga0070691_10004569 | Ga0070691_100045693 | 242 |
| 79 | 3300005343 | Ga0070687_100000813 | Ga0070687_1000008133 | 242 |
| 80 | 3300005344 | Ga0070661_100013566 | Ga0070661_1000135663 | 242 |
| 81 | 3300005344 | Ga0070661_100018789 | Ga0070661_1000187893 | 242 |
| 82 | 3300005347 | Ga0070668_100093924 | Ga0070668_1000939242 | 242 |
| 83 | 3300005353 | Ga0070669_100005635 | Ga0070669_1000056353 | 242 |
| 84 | 3300005354 | Ga0070675_100004413 | Ga0070675_1000044138 | 242 |
| 85 | 3300005355 | Ga0070671_100008712 | Ga0070671_1000087125 | 242 |
| 86 | 3300005355 | Ga0070671_100021644 | Ga0070671_1000216444 | 242 |
| 87 | 3300005364 | Ga0070673_100002330 | Ga0070673_1000023305 | 242 |
| 88 | 3300005364 | Ga0070673_100016208 | Ga0070673_1000162083 | 242 |
| 89 | 3300005365 | Ga0070688_100018721 | Ga0070688_1000187213 | 242 |
| 90 | 3300005366 | Ga0070659_100030373 | Ga0070659_1000303733 | 242 |
| 91 | 3300005366 | Ga0070659_100156613 | Ga0070659_1001566132 | 242 |
| 92 | 3300005367 | Ga0070667_100004935 | Ga0070667_1000049358 | 242 |
| 93 | 3300005367 | Ga0070667_100061488 | Ga0070667_1000614883 | 242 |
| 94 | 3300005406 | Ga0070703_10002976 | Ga0070703_100029764 | 242 |
| 95 | 3300005435 | Ga0070714_100018460 | Ga0070714_1000184603 | 242 |
| 96 | 3300005436 | Ga0070713_100017458 | Ga0070713_1000174583 | 242 |
| 97 | 3300005437 | Ga0070710_10136384 | Ga0070710_101363842 | 242 |
| 98 | 3300005438 | Ga0070701_10001696 | Ga0070701_100016964 | 242 |
| 99 | 3300005439 | Ga0070711_100127826 | Ga0070711_1001278262 | 242 |
| 100 | 3300005440 | Ga0070705_100103005 | Ga0070705_1001030052 | 242 |
| 101 | 3300005441 | Ga0070700_100002054 | Ga0070700_1000020546 | 242 |
| 102 | 3300005444 | Ga0070694_100026395 | Ga0070694_1000263953 | 242 |
| 103 | 3300005445 | Ga0070708_100041127 | Ga0070708_1000411273 | 242 |
| 104 | 3300005455 | Ga0070663_100011055 | Ga0070663_1000110554 | 242 |
| 105 | 3300005456 | Ga0070678_100014241 | Ga0070678_1000142414 | 242 |
| 106 | 3300005457 | Ga0070662_100043603 | Ga0070662_1000436033 | 242 |
| 107 | 3300005458 | Ga0070681_10067109 | Ga0070681_100671093 | 242 |
| 108 | 3300005458 | Ga0070681_10102977 | Ga0070681_101029773 | 242 |
| 109 | 3300005458 | Ga0070681_10169050 | Ga0070681_101690502 | 242 |
| 110 | 3300005459 | Ga0068867_100049799 | Ga0068867_1000497992 | 242 |
| 111 | 3300005459 | Ga0068867_100330419 | Ga0068867_1003304191 | 242 |
| 112 | 3300005466 | Ga0070685_10001256 | Ga0070685_1000125610 | 242 |
| 113 | 3300005466 | Ga0070685_10355659 | Ga0070685_103556591 | 242 |
| 114 | 3300005530 | Ga0070679_100032427 | Ga0070679_1000324272 | 242 |
| 115 | 3300005530 | Ga0070679_100038222 | Ga0070679_1000382222 | 242 |
| 116 | 3300005535 | Ga0070684_100119777 | Ga0070684_1001197773 | 242 |
| 117 | 3300005536 | Ga0070697_100147289 | Ga0070697_1001472892 | 242 |
| 118 | 3300005539 | Ga0068853_100038342 | Ga0068853_1000383423 | 242 |
| 119 | 3300005543 | Ga0070672_100024585 | Ga0070672_1000245853 | 242 |
| 120 | 3300005544 | Ga0070686_100025615 | Ga0070686_1000256153 | 242 |
| 121 | 3300005544 | Ga0070686_100114625 | Ga0070686_1001146252 | 242 |
| 122 | 3300005545 | Ga0070695_100025578 | Ga0070695_1000255783 | 242 |
| 123 | 3300005546 | Ga0070696_100034656 | Ga0070696_1000346563 | 242 |
| 124 | 3300005546 | Ga0070696_100050348 | Ga0070696_1000503483 | 242 |
| 125 | 3300005546 | Ga0070696_100136513 | Ga0070696_1001365132 | 242 |
| 126 | 3300005547 | Ga0070693_100017824 | Ga0070693_1000178242 | 242 |
| 127 | 3300005547 | Ga0070693_100179345 | Ga0070693_1001793452 | 242 |
| 128 | 3300005548 | Ga0070665_100127551 | Ga0070665_1001275512 | 242 |
| 129 | 3300005549 | Ga0070704_100012551 | Ga0070704_1000125513 | 242 |
| 130 | 3300005563 | Ga0068855_100025265 | Ga0068855_1000252651 | 242 |
| 131 | 3300005563 | Ga0068855_100030348 | Ga0068855_1000303482 | 242 |
| 132 | 3300005563 | Ga0068855_100053635 | Ga0068855_1000536354 | 242 |
| 133 | 3300005564 | Ga0070664_100031021 | Ga0070664_1000310213 | 242 |
| 134 | 3300005564 | Ga0070664_100742398 | Ga0070664_1007423981 | 242 |
| 135 | 3300005577 | Ga0068857_100037204 | Ga0068857_1000372042 | 242 |
| 136 | 3300005578 | Ga0068854_100003787 | Ga0068854_1000037876 | 242 |
| 137 | 3300005578 | Ga0068854_100163745 | Ga0068854_1001637452 | 242 |
| 138 | 3300005614 | Ga0068856_100017870 | Ga0068856_1000178704 | 242 |
| 139 | 3300005614 | Ga0068856_100023277 | Ga0068856_1000232772 | 242 |
| 140 | 3300005614 | Ga0068856_100199086 | Ga0068856_1001990862 | 242 |
| 141 | 3300005614 | Ga0068856_100272412 | Ga0068856_1002724121 | 242 |
| 142 | 3300005615 | Ga0070702_100135118 | Ga0070702_1001351182 | 242 |
| 143 | 3300005615 | Ga0070702_100154732 | Ga0070702_1001547322 | 242 |
| 144 | 3300005616 | Ga0068852_100033497 | Ga0068852_1000334972 | 242 |
| 145 | 3300005617 | Ga0068859_100000920 | Ga0068859_10000092022 | 242 |
| 146 | 3300005618 | Ga0068864_100029360 | Ga0068864_1000293602 | 242 |
| 147 | 3300005718 | Ga0068866_10000295 | Ga0068866_100002953 | 242 |
| 148 | 3300005719 | Ga0068861_100082305 | Ga0068861_1000823053 | 242 |
| 149 | 3300005840 | Ga0068870_10000803 | Ga0068870_100008038 | 242 |
| 150 | 3300005841 | Ga0068863_100009214 | Ga0068863_1000092146 | 242 |
| 151 | 3300005842 | Ga0068858_100007950 | Ga0068858_1000079505 | 242 |
| 152 | 3300005842 | Ga0068858_100150859 | Ga0068858_1001508593 | 242 |
| 153 | 3300005843 | Ga0068860_100082132 | Ga0068860_1000821322 | 242 |
| 154 | 3300005843 | Ga0068860_100178037 | Ga0068860_1001780372 | 242 |
| 155 | 3300005844 | Ga0068862_100253237 | Ga0068862_1002532372 | 242 |
| 156 | 3300005937 | Ga0081455_10000059 | Ga0081455_1000005976 | 242 |
| 157 | 3300005937 | Ga0081455_10003227 | Ga0081455_100032273 | 242 |
| 158 | 3300005937 | Ga0081455_10007580 | Ga0081455_100075802 | 242 |
| 159 | 3300005937 | Ga0081455_10025599 | Ga0081455_100255992 | 242 |
| 160 | 3300005983 | Ga0081540_1019697 | Ga0081540_10196973 | 242 |
| 161 | 3300006028 | Ga0070717_10456688 | Ga0070717_104566882 | 242 |
| 162 | 3300006048 | Ga0075363_100094831 | Ga0075363_1000948312 | 242 |
| 163 | 3300006051 | Ga0075364_10031734 | Ga0075364_100317344 | 242 |
| 164 | 3300006175 | Ga0070712_100210933 | Ga0070712_1002109332 | 242 |
| 165 | 3300006177 | Ga0075362_10021352 | Ga0075362_100213522 | 242 |
| 166 | 3300006178 | Ga0075367_10142533 | Ga0075367_101425332 | 242 |
| 167 | 3300006237 | Ga0097621_100004720 | Ga0097621_1000047206 | 242 |
| 168 | 3300006358 | Ga0068871_100011297 | Ga0068871_1000112974 | 242 |
| 169 | 3300006846 | Ga0075430_100000094 | Ga0075430_1000000943 | 242 |
| 170 | 3300006847 | Ga0075431_100002415 | Ga0075431_10000241515 | 242 |
| 171 | 3300006852 | Ga0075433_10000311 | Ga0075433_1000031129 | 242 |
| 172 | 3300006852 | Ga0075433_10091058 | Ga0075433_100910583 | 242 |
| 173 | 3300006871 | Ga0075434_100009504 | Ga0075434_1000095045 | 242 |
| 174 | 3300006871 | Ga0075434_100042656 | Ga0075434_1000426562 | 242 |
| 175 | 3300006880 | Ga0075429_100001750 | Ga0075429_10000175015 | 242 |
| 176 | 3300006881 | Ga0068865_100048747 | Ga0068865_1000487473 | 242 |
| 177 | 3300006914 | Ga0075436_100094044 | Ga0075436_1000940442 | 242 |
| 178 | 3300006931 | Ga0097620_100000920 | Ga0097620_10000092022 | 242 |
| 179 | 3300007076 | Ga0075435_100089551 | Ga0075435_1000895511 | 242 |
| 180 | 3300009036 | Ga0105244_10007516 | Ga0105244_100075163 | 242 |
| 181 | 3300009092 | Ga0105250_10023618 | Ga0105250_100236183 | 242 |
| 182 | 3300009093 | Ga0105240_10028382 | Ga0105240_100283826 | 242 |
| 183 | 3300009093 | Ga0105240_10250534 | Ga0105240_102505341 | 242 |
| 184 | 3300009094 | Ga0111539_10002742 | Ga0111539_100027426 | 242 |
| 185 | 3300009094 | Ga0111539_10003209 | Ga0111539_100032095 | 242 |
| 186 | 3300009094 | Ga0111539_10047268 | Ga0111539_100472684 | 242 |
| 187 | 3300009098 | Ga0105245_10000183 | Ga0105245_100001834 | 242 |
| 188 | 3300009101 | Ga0105247_10004155 | Ga0105247_100041557 | 242 |
| 189 | 3300009101 | Ga0105247_10032128 | Ga0105247_100321283 | 242 |
| 190 | 3300009147 | Ga0114129_10006608 | Ga0114129_1000660812 | 242 |
| 191 | 3300009147 | Ga0114129_10112310 | Ga0114129_101123104 | 242 |
| 192 | 3300009148 | Ga0105243_10032095 | Ga0105243_100320953 | 242 |
| 193 | 3300009148 | Ga0105243_10054799 | Ga0105243_100547993 | 242 |
| 194 | 3300009174 | Ga0105241_10004816 | Ga0105241_100048163 | 242 |
| 195 | 3300009176 | Ga0105242_10082236 | Ga0105242_100822362 | 242 |
| 196 | 3300009177 | Ga0105248_10006282 | Ga0105248_100062824 | 242 |
| 197 | 3300009177 | Ga0105248_10013499 | Ga0105248_100134994 | 242 |
| 198 | 3300009177 | Ga0105248_10029374 | Ga0105248_100293744 | 242 |
| 199 | 3300009177 | Ga0105248_10182565 | Ga0105248_101825653 | 242 |
| 200 | 3300009545 | Ga0105237_10191401 | Ga0105237_101914011 | 242 |
| 201 | 3300009545 | Ga0105237_10191836 | Ga0105237_101918362 | 242 |
| 202 | 3300009551 | Ga0105238_10157368 | Ga0105238_101573683 | 242 |
| 203 | 3300009553 | Ga0105249_10006556 | Ga0105249_100065561 | 242 |
| 204 | 3300009553 | Ga0105249_10008411 | Ga0105249_100084116 | 242 |
| 205 | 3300010375 | Ga0105239_10059786 | Ga0105239_100597863 | 242 |
| 206 | 3300010375 | Ga0105239_10073618 | Ga0105239_100736183 | 242 |
| 207 | 3300011119 | Ga0105246_10007150 | Ga0105246_100071503 | 242 |
| 208 | 3300012507 | Ga0157342_1006973 | Ga0157342_10069731 | 242 |
| 209 | 3300013102 | Ga0157371_10010950 | Ga0157371_100109504 | 242 |
| 210 | 3300013104 | Ga0157370_10092783 | Ga0157370_100927832 | 242 |
| 211 | 3300013104 | Ga0157370_10193349 | Ga0157370_101933492 | 242 |
| 212 | 3300013105 | Ga0157369_10917613 | Ga0157369_109176132 | 242 |
| 213 | 3300013296 | Ga0157374_10009979 | Ga0157374_100099793 | 242 |
| 214 | 3300013296 | Ga0157374_10092180 | Ga0157374_100921802 | 242 |
| 215 | 3300013297 | Ga0157378_10019352 | Ga0157378_100193523 | 242 |
| 216 | 3300013297 | Ga0157378_10519932 | Ga0157378_105199322 | 242 |
| 217 | 3300013306 | Ga0163162_10009250 | Ga0163162_100092507 | 242 |
| 218 | 3300013306 | Ga0163162_10103180 | Ga0163162_101031803 | 242 |
| 219 | 3300013307 | Ga0157372_10030572 | Ga0157372_100305723 | 242 |
| 220 | 3300013308 | Ga0157375_10030035 | Ga0157375_100300354 | 242 |
| 221 | 3300013308 | Ga0157375_10148393 | Ga0157375_101483933 | 242 |
| 222 | 3300013308 | Ga0157375_10227698 | Ga0157375_102276983 | 242 |
| 223 | 3300014325 | Ga0163163_10004815 | Ga0163163_100048157 | 242 |
| 224 | 3300014325 | Ga0163163_10029832 | Ga0163163_100298322 | 242 |
| 225 | 3300014325 | Ga0163163_10488192 | Ga0163163_104881922 | 242 |
| 226 | 3300014326 | Ga0157380_10041631 | Ga0157380_100416313 | 242 |
| 227 | 3300014326 | Ga0157380_10057365 | Ga0157380_100573653 | 242 |
| 228 | 3300014745 | Ga0157377_10008318 | Ga0157377_100083183 | 242 |
| 229 | 3300014968 | Ga0157379_10058621 | Ga0157379_100586213 | 242 |
| 230 | 3300014969 | Ga0157376_10064236 | Ga0157376_100642363 | 242 |
| 231 | 3300014969 | Ga0157376_10214536 | Ga0157376_102145362 | 242 |
| 232 | 3300017792 | Ga0163161_10029219 | Ga0163161_100292194 | 242 |
| 233 | 3300020082 | Ga0206353_11757508 | Ga0206353_117575082 | 242 |
| 234 | 3300024225 | Ga0224572_1033053 | Ga0224572_10330531 | 242 |
| 235 | 3300025271 | Ga0207666_1000058 | Ga0207666_100005814 | 242 |
| 236 | 3300025290 | Ga0207673_1000304 | Ga0207673_10003044 | 242 |
| 237 | 3300025315 | Ga0207697_10002181 | Ga0207697_100021817 | 242 |
| 238 | 3300025885 | Ga0207653_10009697 | Ga0207653_100096973 | 242 |
| 239 | 3300025893 | Ga0207682_10000062 | Ga0207682_1000006243 | 242 |
| 240 | 3300025899 | Ga0207642_10018823 | Ga0207642_100188233 | 242 |
| 241 | 3300025900 | Ga0207710_10014353 | Ga0207710_100143533 | 242 |
| 242 | 3300025900 | Ga0207710_10088695 | Ga0207710_100886952 | 242 |
| 243 | 3300025901 | Ga0207688_10000104 | Ga0207688_100001049 | 242 |
| 244 | 3300025904 | Ga0207647_10023538 | Ga0207647_100235383 | 242 |
| 245 | 3300025906 | Ga0207699_10100105 | Ga0207699_101001052 | 242 |
| 246 | 3300025907 | Ga0207645_10000248 | Ga0207645_1000024842 | 242 |
| 247 | 3300025908 | Ga0207643_10000064 | Ga0207643_1000006423 | 242 |
| 248 | 3300025911 | Ga0207654_10027740 | Ga0207654_100277403 | 242 |
| 249 | 3300025912 | Ga0207707_10017172 | Ga0207707_100171726 | 242 |
| 250 | 3300025912 | Ga0207707_10082488 | Ga0207707_100824882 | 242 |
| 251 | 3300025912 | Ga0207707_10102346 | Ga0207707_101023463 | 242 |
| 252 | 3300025912 | Ga0207707_10337076 | Ga0207707_103370762 | 242 |
| 253 | 3300025915 | Ga0207693_10012179 | Ga0207693_100121796 | 242 |
| 254 | 3300025915 | Ga0207693_10037909 | Ga0207693_100379093 | 242 |
| 255 | 3300025915 | Ga0207693_10260203 | Ga0207693_102602031 | 242 |
| 256 | 3300025916 | Ga0207663_10078745 | Ga0207663_100787452 | 242 |
| 257 | 3300025917 | Ga0207660_10031484 | Ga0207660_100314843 | 242 |
| 258 | 3300025918 | Ga0207662_10000134 | Ga0207662_1000013422 | 242 |
| 259 | 3300025919 | Ga0207657_10001575 | Ga0207657_100015754 | 242 |
| 260 | 3300025919 | Ga0207657_10012774 | Ga0207657_100127745 | 242 |
| 261 | 3300025920 | Ga0207649_10058832 | Ga0207649_100588322 | 242 |
| 262 | 3300025921 | Ga0207652_10018868 | Ga0207652_100188686 | 242 |
| 263 | 3300025921 | Ga0207652_10057841 | Ga0207652_100578413 | 242 |
| 264 | 3300025923 | Ga0207681_10050723 | Ga0207681_100507232 | 242 |
| 265 | 3300025924 | Ga0207694_10060989 | Ga0207694_100609892 | 242 |
| 266 | 3300025925 | Ga0207650_10036151 | Ga0207650_100361512 | 242 |
| 267 | 3300025926 | Ga0207659_10001851 | Ga0207659_100018514 | 242 |
| 268 | 3300025926 | Ga0207659_10051095 | Ga0207659_100510952 | 242 |
| 269 | 3300025927 | Ga0207687_10002717 | Ga0207687_100027174 | 242 |
| 270 | 3300025927 | Ga0207687_10064367 | Ga0207687_100643673 | 242 |
| 271 | 3300025928 | Ga0207700_10081002 | Ga0207700_100810023 | 242 |
| 272 | 3300025929 | Ga0207664_10332895 | Ga0207664_103328952 | 242 |
| 273 | 3300025931 | Ga0207644_10004656 | Ga0207644_100046565 | 242 |
| 274 | 3300025932 | Ga0207690_10038716 | Ga0207690_100387163 | 242 |
| 275 | 3300025933 | Ga0207706_10007687 | Ga0207706_100076873 | 242 |
| 276 | 3300025933 | Ga0207706_10040480 | Ga0207706_100404802 | 242 |
| 277 | 3300025934 | Ga0207686_10030432 | Ga0207686_100304323 | 242 |
| 278 | 3300025935 | Ga0207709_10031872 | Ga0207709_100318722 | 242 |
| 279 | 3300025935 | Ga0207709_10031873 | Ga0207709_100318732 | 242 |
| 280 | 3300025936 | Ga0207670_10077466 | Ga0207670_100774663 | 242 |
| 281 | 3300025937 | Ga0207669_10010545 | Ga0207669_100105453 | 242 |
| 282 | 3300025938 | Ga0207704_10022978 | Ga0207704_100229783 | 242 |
| 283 | 3300025939 | Ga0207665_10079262 | Ga0207665_100792622 | 242 |
| 284 | 3300025940 | Ga0207691_10004339 | Ga0207691_100043398 | 242 |
| 285 | 3300025941 | Ga0207711_10008358 | Ga0207711_100083584 | 242 |
| 286 | 3300025942 | Ga0207689_10001739 | Ga0207689_1000173912 | 242 |
| 287 | 3300025944 | Ga0207661_10000098 | Ga0207661_1000009849 | 242 |
| 288 | 3300025945 | Ga0207679_10000174 | Ga0207679_1000017450 | 242 |
| 289 | 3300025945 | Ga0207679_10122262 | Ga0207679_101222623 | 242 |
| 290 | 3300025949 | Ga0207667_10062587 | Ga0207667_100625874 | 242 |
| 291 | 3300025960 | Ga0207651_10000786 | Ga0207651_100007865 | 242 |
| 292 | 3300025960 | Ga0207651_10058567 | Ga0207651_100585672 | 242 |
| 293 | 3300025961 | Ga0207712_10021461 | Ga0207712_100214613 | 242 |
| 294 | 3300025972 | Ga0207668_10530956 | Ga0207668_105309562 | 242 |
| 295 | 3300025981 | Ga0207640_10008270 | Ga0207640_100082704 | 242 |
| 296 | 3300025986 | Ga0207658_10060993 | Ga0207658_100609932 | 242 |
| 297 | 3300026023 | Ga0207677_10019916 | Ga0207677_100199164 | 242 |
| 298 | 3300026035 | Ga0207703_10001605 | Ga0207703_100016053 | 242 |
| 299 | 3300026035 | Ga0207703_10058384 | Ga0207703_100583843 | 242 |
| 300 | 3300026041 | Ga0207639_10082617 | Ga0207639_100826172 | 242 |
| 301 | 3300026067 | Ga0207678_10029099 | Ga0207678_100290994 | 242 |
| 302 | 3300026075 | Ga0207708_10022585 | Ga0207708_100225853 | 242 |
| 303 | 3300026078 | Ga0207702_10120281 | Ga0207702_101202813 | 242 |
| 304 | 3300026088 | Ga0207641_10052471 | Ga0207641_100524712 | 242 |
| 305 | 3300026089 | Ga0207648_10004808 | Ga0207648_100048089 | 242 |
| 306 | 3300026089 | Ga0207648_10270515 | Ga0207648_102705151 | 242 |
| 307 | 3300026095 | Ga0207676_10070191 | Ga0207676_100701913 | 242 |
| 308 | 3300026116 | Ga0207674_10011184 | Ga0207674_100111843 | 242 |
| 309 | 3300026118 | Ga0207675_100001176 | Ga0207675_10000117615 | 242 |
| 310 | 3300026121 | Ga0207683_10007909 | Ga0207683_100079097 | 242 |
| 311 | 3300026121 | Ga0207683_10443334 | Ga0207683_104433341 | 242 |
| 312 | 3300026142 | Ga0207698_11023976 | Ga0207698_110239761 | 242 |
| 313 | 3300027617 | Ga0210002_1002216 | Ga0210002_10022163 | 242 |
| 314 | 3300027682 | Ga0209971_1064312 | Ga0209971_10643121 | 242 |
| 315 | 3300027695 | Ga0209966_1002673 | Ga0209966_10026732 | 242 |
| 316 | 3300027717 | Ga0209998_10002759 | Ga0209998_100027594 | 242 |
| 317 | 3300027876 | Ga0209974_10026056 | Ga0209974_100260562 | 242 |
| 318 | 3300027907 | Ga0207428_10000075 | Ga0207428_1000007519 | 242 |
| 319 | 3300027907 | Ga0207428_10000513 | Ga0207428_100005134 | 242 |
| 320 | 3300028379 | Ga0268266_10145078 | Ga0268266_101450782 | 242 |
| 321 | 3300028381 | Ga0268264_10077515 | Ga0268264_100775153 | 242 |
| 322 | 3300028556 | Ga0265337_1001558 | Ga0265337_10015585 | 242 |
| 323 | 3300028800 | Ga0265338_10056280 | Ga0265338_100562803 | 242 |
| 324 | 3300028800 | Ga0265338_10094758 | Ga0265338_100947582 | 242 |
| 325 | 3300031235 | Ga0265330_10131359 | Ga0265330_101313591 | 242 |
| 326 | 3300031241 | Ga0265325_10000398 | Ga0265325_1000039822 | 242 |
| 327 | 3300031241 | Ga0265325_10049082 | Ga0265325_100490822 | 242 |
| 328 | 3300031241 | Ga0265325_10080091 | Ga0265325_100800911 | 242 |
| 329 | 3300031249 | Ga0265339_10002964 | Ga0265339_100029643 | 242 |
| 330 | 3300031249 | Ga0265339_10061509 | Ga0265339_100615092 | 242 |
| 331 | 3300031249 | Ga0265339_10106907 | Ga0265339_101069072 | 242 |
| 332 | 3300031344 | Ga0265316_10153918 | Ga0265316_101539182 | 242 |
| 333 | 3300031344 | Ga0265316_10263032 | Ga0265316_102630322 | 242 |
| 334 | 3300031595 | Ga0265313_10006372 | Ga0265313_1000637210 | 242 |
| 335 | 3300031595 | Ga0265313_10018880 | Ga0265313_100188803 | 242 |
| 336 | 3300031595 | Ga0265313_10104208 | Ga0265313_101042082 | 242 |
| 337 | 3300031595 | Ga0265313_10124610 | Ga0265313_101246101 | 242 |
| 338 | 3300031691 | Ga0316579_10162430 | Ga0316579_101624301 | 242 |
| 339 | 3300031711 | Ga0265314_10053795 | Ga0265314_100537953 | 242 |
| 340 | 3300031712 | Ga0265342_10011396 | Ga0265342_100113965 | 242 |
| 341 | 3300034816 | Ga0373930_0005168 | Ga0373930_0005168_1291_2019 | 242 |
| 342 | 3300034818 | Ga0373950_0018326 | Ga0373950_0018326_429_1157 | 242 |
| 343 | 3300034819 | Ga0373958_0000115 | Ga0373958_0000115_5344_6072 | 242 |
| 344 | 3300034819 | Ga0373958_0006733 | Ga0373958_0006733_594_1322 | 242 |
| 345 | 3300034820 | Ga0373959_0000953 | Ga0373959_0000953_1743_2471 | 242 |
| 346 | 3300034820 | Ga0373959_0015328 | Ga0373959_0015328_14_742 | 242 |
| 347 | 3300034957 | Ga0373938_0000029 | Ga0373938_0000029_1355_2083 | 242 |
| 348 | 3300034957 | Ga0373938_0002765 | Ga0373938_0002765_644_1372 | 242 |
| 349 | 3300035084 | Ga0373928_0000121 | Ga0373928_0000121_10629_11357 | 242 |
| 350 | 3300035084 | Ga0373928_0001807 | Ga0373928_0001807_2172_2900 | 242 |
| 351 | 3300035085 | Ga0373929_0001284 | Ga0373929_0001284_2240_2968 | 242 |
| 352 | 3300035085 | Ga0373929_0053344 | Ga0373929_0053344_64_792 | 242 |
| 353 | 3300035086 | Ga0373934_0072016 | Ga0373934_0072016_35_772 | 242 |
| 354 | 3300035088 | Ga0373940_0000632 | Ga0373940_0000632_1386_2114 | 242 |
| 355 | 3300035088 | Ga0373940_0010069 | Ga0373940_0010069_377_1105 | 242 |
| 356 | 3300035090 | Ga0373949_0002317 | Ga0373949_0002317_2295_3023 | 242 |
| 357 | 3300035090 | Ga0373949_0010686 | Ga0373949_0010686_19_747 | 242 |
| 358 | 3300035091 | Ga0373951_0000245 | Ga0373951_0000245_6008_6736 | 242 |
| 359 | 3300035091 | Ga0373951_0009551 | Ga0373951_0009551_459_1187 | 242 |
| 360 | 3300035091 | Ga0373951_0010395 | Ga0373951_0010395_709_1437 | 242 |
| 361 | 3300035092 | Ga0373952_0000027 | Ga0373952_0000027_7112_7840 | 242 |
| 362 | 3300035092 | Ga0373952_0002479 | Ga0373952_0002479_1400_2128 | 242 |
| 363 | 3300035111 | Ga0373923_0057499 | Ga0373923_0057499_886_1623 | 242 |
| 364 | 3300035112 | Ga0373932_0000184 | Ga0373932_0000184_6698_7426 | 242 |
| 365 | 3300035112 | Ga0373932_0008264 | Ga0373932_0008264_1335_2063 | 242 |
| 366 | 3300035114 | Ga0373939_0002514 | Ga0373939_0002514_2587_3315 | 242 |
| 367 | 3300035114 | Ga0373939_0013344 | Ga0373939_0013344_649_1377 | 242 |
| 368 | 3300035115 | Ga0373941_0001231 | Ga0373941_0001231_638_1366 | 242 |
| 369 | 3300035117 | Ga0373953_0019775 | Ga0373953_0019775_1694_2422 | 242 |
| 370 | 3300035117 | Ga0373953_0093834 | Ga0373953_0093834_27_764 | 242 |
| 371 | 3300035118 | Ga0373954_0011707 | Ga0373954_0011707_1662_2399 | 242 |
| 372 | 3300035118 | Ga0373954_0014085 | Ga0373954_0014085_438_1166 | 242 |
| 373 | 3300035119 | Ga0373956_0017813 | Ga0373956_0017813_1240_1968 | 242 |
| 374 | 3300035119 | Ga0373956_0196156 | Ga0373956_0196156_104_832 | 242 |
| 375 | 3300035120 | Ga0373957_0012150 | Ga0373957_0012150_2116_2844 | 242 |
| 376 | 3300035120 | Ga0373957_0046677 | Ga0373957_0046677_818_1546 | 242 |
| 377 | 3300035120 | Ga0373957_0048552 | Ga0373957_0048552_735_1472 | 242 |
| 378 | 3300035121 | Ga0373960_0000954 | Ga0373960_0000954_3222_3950 | 242 |
| 379 | 3300035121 | Ga0373960_0011280 | Ga0373960_0011280_1107_1835 | 242 |
| 380 | 3300035121 | Ga0373960_0012254 | Ga0373960_0012254_1274_2002 | 242 |
| 381 | 3300035172 | Ga0373955_0009584 | Ga0373955_0009584_2472_3209 | 242 |
| 382 | 3300035207 | Ga0373942_0000413 | Ga0373942_0000413_2425_3153 | 242 |
| 383 | 3300035207 | Ga0373942_0003298 | Ga0373942_0003298_2186_2914 | 242 |
| 384 | 3300035241 | Ga0373961_0006713 | Ga0373961_0006713_162_890 | 242 |
| 385 | 3300035242 | Ga0373962_0019611 | Ga0373962_0019611_311_1039 | 242 |
| 386 | 3300035410 | Ga0373924_0025238 | Ga0373924_0025238_717_1454 | 242 |
| 387 | 3300035691 | Ga0373931_0017929 | Ga0373931_0017929_733_1461 | 242 |
| 388 | 3300035691 | Ga0373931_0019490 | Ga0373931_0019490_1303_2031 | 242 |
| 389 | 3300035692 | Ga0373935_0199320 | Ga0373935_0199320_185_922 | 242 |
| 390 | 3300035695 | Ga0373927_0028383 | Ga0373927_0028383_621_1358 | 242 |
| 391 | 3300035724 | Ga0373933_0001260 | Ga0373933_0001260_7189_7917 | 242 |
| 392 | 3300035724 | Ga0373933_0001594 | Ga0373933_0001594_9624_10361 | 242 |
| 393 | 3300035725 | Ga0373947_0011238 | Ga0373947_0011238_1620_2357 | 242 |
| 394 | 3300036401 | Ga0373937_0002059 | Ga0373937_0002059_4686_5423 | 242 |
| 395 | 3300036401 | Ga0373937_0005468 | Ga0373937_0005468_8560_9288 | 242 |
| 396 | 3300036401 | Ga0373937_0011313 | Ga0373937_0011313_1278_2006 | 242 |
| 397 | 3300036401 | Ga0373937_0025330 | Ga0373937_0025330_3395_4123 | 242 |
| 398 | 3300036401 | Ga0373937_0634331 | Ga0373937_0634331_243_971 | 242 |
| 399 | 3300037068 | Ga0373925_0058527 | Ga0373925_0058527_554_1282 | 242 |
| 400 | 3300037068 | Ga0373925_0153626 | Ga0373925_0153626_514_1251 | 242 |
| 401 | 3300038698 | Ga0242419_000779 | Ga0242419_000779_958_1686 | 242 |
| 402 | 3300038996 | Ga0242420_009034 | Ga0242420_009034_390_1118 | 242 |
| 403 | 3300041443 | Ga0451789_0289166 | Ga0451789_0289166_42_782 | 242 |
| 404 | 3300042439 | Ga0439464_0051376 | Ga0439464_0051376_181_909 | 242 |
| 405 | 3300042461 | Ga0439460_0018060 | Ga0439460_0018060_364_1092 | 242 |
| 406 | 3300042876 | Ga0451577_0099082 | Ga0451577_0099082_1774_2502 | 242 |
| 407 | 3300044684 | Ga0466966_0075655 | Ga0466966_0075655_117_866 | 242 |
| 408 | 3300044693 | Ga0466961_0037785 | Ga0466961_0037785_731_1480 | 242 |
| 409 | 3300044694 | Ga0466963_0139045 | Ga0466963_0139045_897_1634 | 242 |
| 410 | 3300044842 | Ga0466957_0060726 | Ga0466957_0060726_1519_2256 | 242 |
| 411 | 3300045049 | Ga0466959_0144643 | Ga0466959_0144643_131_880 | 242 |
| 412 | 3300045051 | Ga0451576_0013919 | Ga0451576_0013919_2571_3338 | 242 |
| 413 | 3300046454 | Ga0495592_0000977 | Ga0495592_0000977_2858_3586 | 242 |
| 414 | 3300046454 | Ga0495592_0005236 | Ga0495592_0005236_7131_7868 | 242 |
| 415 | 3300046454 | Ga0495592_0064072 | Ga0495592_0064072_296_1033 | 242 |
| 416 | 3300046454 | Ga0495592_0083431 | Ga0495592_0083431_51_779 | 242 |
| 417 | 3300046455 | Ga0495603_0235693 | Ga0495603_0235693_69_806 | 242 |
| 418 | 3300046455 | Ga0495603_0256376 | Ga0495603_0256376_113_850 | 242 |
| 419 | 3300046459 | Ga0495629_0012459 | Ga0495629_0012459_3601_4338 | 242 |
| 420 | 3300046462 | Ga0495651_0001229 | Ga0495651_0001229_8237_8974 | 242 |
| 421 | 3300046462 | Ga0495651_0063577 | Ga0495651_0063577_1837_2565 | 242 |
| 422 | 3300046462 | Ga0495651_0093622 | Ga0495651_0093622_1069_1797 | 242 |
| 423 | 3300046463 | Ga0495653_0008785 | Ga0495653_0008785_4719_5456 | 242 |
| 424 | 3300046463 | Ga0495653_0017398 | Ga0495653_0017398_50_778 | 242 |
| 425 | 3300046463 | Ga0495653_0058844 | Ga0495653_0058844_2170_2898 | 242 |
| 426 | 3300046475 | Ga0495639_0019558 | Ga0495639_0019558_705_1442 | 242 |
| 427 | 3300046476 | Ga0495662_0080669 | Ga0495662_0080669_480_1217 | 242 |
| 428 | 3300046477 | Ga0495664_0092553 | Ga0495664_0092553_655_1383 | 242 |
| 429 | 3300046477 | Ga0495664_0198053 | Ga0495664_0198053_147_884 | 242 |
| 430 | 3300046491 | Ga0495584_0009511 | Ga0495584_0009511_1149_1886 | 242 |
| 431 | 3300046491 | Ga0495584_0114429 | Ga0495584_0114429_494_1222 | 242 |
| 432 | 3300046511 | Ga0495608_0002079 | Ga0495608_0002079_11216_11953 | 242 |
| 433 | 3300046511 | Ga0495608_0010323 | Ga0495608_0010323_2875_3603 | 242 |
| 434 | 3300046514 | Ga0495618_0006214 | Ga0495618_0006214_5177_5914 | 242 |
| 435 | 3300046514 | Ga0495618_0066540 | Ga0495618_0066540_1386_2114 | 242 |
| 436 | 3300046516 | Ga0495628_0002874 | Ga0495628_0002874_10495_11223 | 242 |
| 437 | 3300046516 | Ga0495628_0058341 | Ga0495628_0058341_1738_2475 | 242 |
| 438 | 3300046516 | Ga0495628_0070950 | Ga0495628_0070950_1529_2257 | 242 |
| 439 | 3300046517 | Ga0495630_0162156 | Ga0495630_0162156_30_767 | 242 |
| 440 | 3300046517 | Ga0495630_0251416 | Ga0495630_0251416_261_998 | 242 |
| 441 | 3300046524 | Ga0495648_0025233 | Ga0495648_0025233_1836_2573 | 242 |
| 442 | 3300046529 | Ga0495652_0011201 | Ga0495652_0011201_6962_7699 | 242 |
| 443 | 3300046529 | Ga0495652_0015643 | Ga0495652_0015643_3122_3850 | 242 |
| 444 | 3300046533 | Ga0495640_0012149 | Ga0495640_0012149_3585_4313 | 242 |
| 445 | 3300046533 | Ga0495640_0032609 | Ga0495640_0032609_1149_1886 | 242 |
| 446 | 3300046535 | Ga0495586_0059313 | Ga0495586_0059313_631_1359 | 242 |
| 447 | 3300046536 | Ga0495587_0001517 | Ga0495587_0001517_5494_6222 | 242 |
| 448 | 3300046536 | Ga0495587_0013260 | Ga0495587_0013260_1701_2438 | 242 |
| 449 | 3300046543 | Ga0495645_0001520 | Ga0495645_0001520_916_1644 | 242 |
| 450 | 3300046543 | Ga0495645_0033460 | Ga0495645_0033460_2967_3704 | 242 |
| 451 | 3300046543 | Ga0495645_0052120 | Ga0495645_0052120_970_1698 | 242 |
| 452 | 3300046559 | Ga0495667_0003504 | Ga0495667_0003504_1761_2498 | 242 |
| 453 | 3300046559 | Ga0495667_0006970 | Ga0495667_0006970_3571_4299 | 242 |
| 454 | 3300046559 | Ga0495667_0010321 | Ga0495667_0010321_1318_2046 | 242 |
| 455 | 3300046642 | Ga0495634_0013659 | Ga0495634_0013659_2406_3143 | 242 |
| 456 | 3300046642 | Ga0495634_0056342 | Ga0495634_0056342_872_1600 | 242 |
| 457 | 3300046642 | Ga0495634_0064248 | Ga0495634_0064248_1423_2160 | 242 |
| 458 | 3300046648 | Ga0495611_0131437 | Ga0495611_0131437_126_863 | 242 |
| 459 | 3300046663 | Ga0495635_0009233 | Ga0495635_0009233_4857_5585 | 242 |
| 460 | 3300046663 | Ga0495635_0011873 | Ga0495635_0011873_2245_2982 | 242 |
| 461 | 3300046664 | Ga0495659_0074672 | Ga0495659_0074672_211_939 | 242 |
| 462 | 3300046675 | Ga0495657_0013755 | Ga0495657_0013755_5163_5891 | 242 |
| 463 | 3300046675 | Ga0495657_0022880 | Ga0495657_0022880_1233_1970 | 242 |
| 464 | 3300046678 | Ga0495599_0002791 | Ga0495599_0002791_5436_6164 | 242 |
| 465 | 3300046679 | Ga0495623_0001343 | Ga0495623_0001343_8221_8958 | 242 |
| 466 | 3300046679 | Ga0495623_0015018 | Ga0495623_0015018_780_1508 | 242 |
| 467 | 3300046679 | Ga0495623_0023847 | Ga0495623_0023847_1691_2419 | 242 |
| 468 | 3300046680 | Ga0495646_0006053 | Ga0495646_0006053_3368_4096 | 242 |
| 469 | 3300046680 | Ga0495646_0022295 | Ga0495646_0022295_158_886 | 242 |
| 470 | 3300046680 | Ga0495646_0032748 | Ga0495646_0032748_671_1408 | 242 |
| 471 | 3300046683 | Ga0495658_0118916 | Ga0495658_0118916_741_1478 | 242 |
| 472 | 3300046684 | Ga0495669_0125200 | Ga0495669_0125200_214_942 | 242 |
| 473 | 3300046689 | Ga0495613_0038390 | Ga0495613_0038390_1762_2499 | 242 |
| 474 | 3300046690 | Ga0495624_0077419 | Ga0495624_0077419_450_1187 | 242 |
| 475 | 3300046809 | Ga0495600_0004399 | Ga0495600_0004399_343_1071 | 242 |
| 476 | 3300046809 | Ga0495600_0013400 | Ga0495600_0013400_2875_3612 | 242 |
| 477 | 3300046809 | Ga0495600_0052295 | Ga0495600_0052295_1095_1823 | 242 |
| 478 | 3300047315 | Ga0495581_0068701 | Ga0495581_0068701_921_1658 | 242 |
| 479 | 3300047317 | Ga0495604_0005068 | Ga0495604_0005068_1455_2192 | 242 |
| 480 | 3300047317 | Ga0495604_0032301 | Ga0495604_0032301_2241_2969 | 242 |
| 481 | 3300047317 | Ga0495604_0096216 | Ga0495604_0096216_1214_1942 | 242 |
| 482 | 3300047319 | Ga0495674_0008197 | Ga0495674_0008197_4510_5247 | 242 |
| 483 | 3300047319 | Ga0495674_0086510 | Ga0495674_0086510_1635_2372 | 242 |
| 484 | 3300047319 | Ga0495674_0096932 | Ga0495674_0096932_1519_2247 | 242 |
| 485 | 3300047319 | Ga0495674_0280727 | Ga0495674_0280727_50_778 | 242 |
| 486 | 3300047321 | Ga0495676_0167434 | Ga0495676_0167434_52_789 | 242 |
| 487 | 3300047322 | Ga0495680_0003398 | Ga0495680_0003398_10712_11449 | 242 |
| 488 | 3300047322 | Ga0495680_0003788 | Ga0495680_0003788_11920_12648 | 242 |
| 489 | 3300047322 | Ga0495680_0006593 | Ga0495680_0006593_2924_3652 | 242 |
| 490 | 3300047444 | Ga0495675_0002111 | Ga0495675_0002111_2150_2887 | 242 |
| 491 | 3300047471 | Ga0495684_0036214 | Ga0495684_0036214_2270_3007 | 242 |
| 492 | 3300047673 | Ga0495593_0134252 | Ga0495593_0134252_390_1127 | 242 |
| 493 | 3300047673 | Ga0495593_0259270 | Ga0495593_0259270_121_849 | 242 |
| 494 | 3300048088 | Ga0495602_0008143 | Ga0495602_0008143_1644_2381 | 242 |
| 495 | 3300048088 | Ga0495602_0036984 | Ga0495602_0036984_3699_4427 | 242 |
| 496 | 3300048089 | Ga0495614_0265880 | Ga0495614_0265880_21_758 | 242 |
| 497 | 3300048903 | Ga0496100_0004065 | Ga0496100_0004065_5540_6268 | 242 |
| 498 | 3300048904 | Ga0496101_0017402 | Ga0496101_0017402_1476_2204 | 242 |
| 499 | 3300048904 | Ga0496101_0026633 | Ga0496101_0026633_149_877 | 242 |
| 500 | 3300048905 | Ga0496102_0285516 | Ga0496102_0285516_86_814 | 242 |
| 501 | 3300048906 | Ga0496103_0028447 | Ga0496103_0028447_606_1334 | 242 |
| 502 | 3300048906 | Ga0496103_0029611 | Ga0496103_0029611_2356_3084 | 242 |
| 503 | 3300048906 | Ga0496103_0066812 | Ga0496103_0066812_524_1252 | 242 |
| 504 | 3300048907 | Ga0496104_0000126 | Ga0496104_0000126_61904_62632 | 242 |
| 505 | 3300048907 | Ga0496104_0041050 | Ga0496104_0041050_776_1504 | 242 |
| 506 | 3300048907 | Ga0496104_0045945 | Ga0496104_0045945_2369_3097 | 242 |
| 507 | 3300048907 | Ga0496104_0186823 | Ga0496104_0186823_73_801 | 242 |
| 508 | 3300048908 | Ga0496105_0001562 | Ga0496105_0001562_13379_14107 | 242 |
| 509 | 3300048908 | Ga0496105_0009019 | Ga0496105_0009019_5027_5755 | 242 |
| 510 | 3300048909 | Ga0496106_0018040 | Ga0496106_0018040_4398_5126 | 242 |
| 511 | 3300048909 | Ga0496106_0019136 | Ga0496106_0019136_3400_4128 | 242 |
| 512 | 3300048909 | Ga0496106_0074272 | Ga0496106_0074272_268_996 | 242 |
| 513 | 3300048910 | Ga0496107_0015179 | Ga0496107_0015179_3138_3866 | 242 |
| 514 | 3300048910 | Ga0496107_0051373 | Ga0496107_0051373_1988_2716 | 242 |
| 515 | 3300048910 | Ga0496107_0061807 | Ga0496107_0061807_1371_2099 | 242 |
| 516 | 3300048910 | Ga0496107_0079988 | Ga0496107_0079988_713_1441 | 242 |
| 517 | 3300048910 | Ga0496107_0292030 | Ga0496107_0292030_329_1057 | 242 |
| 518 | 3300048911 | Ga0496108_0004643 | Ga0496108_0004643_6806_7534 | 242 |
| 519 | 3300048911 | Ga0496108_0032262 | Ga0496108_0032262_1282_2010 | 242 |
| 520 | 3300048912 | Ga0496109_0000188 | Ga0496109_0000188_51608_52336 | 242 |
| 521 | 3300048912 | Ga0496109_0000831 | Ga0496109_0000831_7219_7947 | 242 |
| 522 | 3300048912 | Ga0496109_0045459 | Ga0496109_0045459_2626_3354 | 242 |
| 523 | 3300048913 | Ga0496110_0018071 | Ga0496110_0018071_2873_3601 | 242 |
| 524 | 3300048913 | Ga0496110_0107676 | Ga0496110_0107676_1265_1993 | 242 |
| 525 | 3300048913 | Ga0496110_0232069 | Ga0496110_0232069_818_1546 | 242 |
| 526 | 3300048914 | Ga0496111_0005732 | Ga0496111_0005732_1883_2611 | 242 |
| 527 | 3300048914 | Ga0496111_0051979 | Ga0496111_0051979_1794_2522 | 242 |
| 528 | 3300048914 | Ga0496111_0087931 | Ga0496111_0087931_1262_1990 | 242 |
| 529 | 3300048915 | Ga0496112_0053867 | Ga0496112_0053867_1741_2469 | 242 |
| 530 | 3300048916 | Ga0496113_0000478 | Ga0496113_0000478_16587_17315 | 242 |
| 531 | 3300048916 | Ga0496113_0110473 | Ga0496113_0110473_225_953 | 242 |
| 532 | 3300048917 | Ga0496114_0029292 | Ga0496114_0029292_2571_3299 | 242 |
| 533 | 3300048917 | Ga0496114_0058254 | Ga0496114_0058254_1072_1800 | 242 |
| 534 | 3300048917 | Ga0496114_0078927 | Ga0496114_0078927_1838_2566 | 242 |
| 535 | 3300048918 | Ga0496115_0007975 | Ga0496115_0007975_394_1122 | 242 |
| 536 | 3300048918 | Ga0496115_0096288 | Ga0496115_0096288_935_1663 | 242 |
| 537 | 3300048918 | Ga0496115_0117874 | Ga0496115_0117874_1384_2124 | 242 |
| 538 | 3300048918 | Ga0496115_0356921 | Ga0496115_0356921_25_753 | 242 |
| 539 | 3300049568 | Ga0501031_0021508 | Ga0501031_0021508_992_1720 | 242 |
| 540 | 3300049569 | Ga0501032_0065423 | Ga0501032_0065423_774_1502 | 242 |
| 541 | 3300049569 | Ga0501032_0126039 | Ga0501032_0126039_700_1443 | 242 |
| 542 | 3300049570 | Ga0501033_0012528 | Ga0501033_0012528_32_760 | 242 |
| 543 | 3300049571 | Ga0501034_0047775 | Ga0501034_0047775_1224_1952 | 242 |
| 544 | 3300049571 | Ga0501034_0078675 | Ga0501034_0078675_1840_2568 | 242 |
| 545 | 3300049571 | Ga0501034_0158358 | Ga0501034_0158358_1015_1752 | 242 |
| 546 | 3300049571 | Ga0501034_0616440 | Ga0501034_0616440_198_956 | 242 |
| 547 | 3300049572 | Ga0501036_0145056 | Ga0501036_0145056_1063_1791 | 242 |
| 548 | 3300049572 | Ga0501036_0261549 | Ga0501036_0261549_674_1402 | 242 |
| 549 | 3300049573 | Ga0501037_0012452 | Ga0501037_0012452_2423_3151 | 242 |
| 550 | 3300049573 | Ga0501037_0025758 | Ga0501037_0025758_340_1074 | 242 |
| 551 | 3300049573 | Ga0501037_0139396 | Ga0501037_0139396_559_1287 | 242 |
| 552 | 3300049574 | Ga0501038_0006074 | Ga0501038_0006074_72_806 | 242 |
| 553 | 3300049575 | Ga0501039_0025227 | Ga0501039_0025227_801_1529 | 242 |
| 554 | 3300049575 | Ga0501039_0064571 | Ga0501039_0064571_1581_2315 | 242 |
| 555 | 3300049575 | Ga0501039_0382720 | Ga0501039_0382720_302_1036 | 242 |
| 556 | 3300049576 | Ga0501040_0199648 | Ga0501040_0199648_184_912 | 242 |
| 557 | 3300049579 | Ga0501043_0017718 | Ga0501043_0017718_4411_5145 | 242 |
| 558 | 3300049579 | Ga0501043_0295893 | Ga0501043_0295893_79_807 | 242 |
| 559 | 3300049579 | Ga0501043_0297196 | Ga0501043_0297196_32_775 | 242 |
| 560 | 3300049580 | Ga0501046_0054232 | Ga0501046_0054232_871_1605 | 242 |
| 561 | 3300049580 | Ga0501046_0207297 | Ga0501046_0207297_421_1155 | 242 |
| 562 | 3300049581 | Ga0501047_0008130 | Ga0501047_0008130_1815_2549 | 242 |
| 563 | 3300049581 | Ga0501047_0040003 | Ga0501047_0040003_3439_4182 | 242 |
| 564 | 3300049581 | Ga0501047_0040364 | Ga0501047_0040364_2725_3453 | 242 |
| 565 | 3300049581 | Ga0501047_0123765 | Ga0501047_0123765_289_1023 | 242 |
| 566 | 3300049584 | Ga0501068_0238773 | Ga0501068_0238773_366_1100 | 242 |
| 567 | 3300049585 | Ga0501069_0070407 | Ga0501069_0070407_944_1672 | 242 |
| 568 | 3300049586 | Ga0501070_0018855 | Ga0501070_0018855_2423_3151 | 242 |
| 569 | 3300049586 | Ga0501070_0035258 | Ga0501070_0035258_2199_2927 | 242 |
| 570 | 3300049586 | Ga0501070_0283869 | Ga0501070_0283869_134_877 | 242 |
| 571 | 3300049586 | Ga0501070_0290737 | Ga0501070_0290737_151_885 | 242 |
| 572 | 3300049587 | Ga0501071_0104047 | Ga0501071_0104047_1159_1887 | 242 |
| 573 | 3300049589 | Ga0501073_0163021 | Ga0501073_0163021_137_871 | 242 |
| 574 | 3300049589 | Ga0501073_0490506 | Ga0501073_0490506_90_818 | 242 |
| 575 | 3300049590 | Ga0501074_0169367 | Ga0501074_0169367_496_1230 | 242 |
| 576 | 3300049591 | Ga0501075_0216270 | Ga0501075_0216270_615_1343 | 242 |
| 577 | 3300049592 | Ga0501076_0055308 | Ga0501076_0055308_1151_1879 | 242 |
| 578 | 3300049593 | Ga0501077_0036288 | Ga0501077_0036288_1497_2225 | 242 |
| 579 | 3300049742 | Ga0501080_0037678 | Ga0501080_0037678_518_1252 | 242 |
| 580 | 3300049742 | Ga0501080_0068717 | Ga0501080_0068717_2531_3265 | 242 |
| 581 | 3300049744 | Ga0501083_0030430 | Ga0501083_0030430_2542_3276 | 242 |
| 582 | 3300049744 | Ga0501083_0044224 | Ga0501083_0044224_1707_2441 | 242 |
| 583 | 3300049822 | Ga0501035_0009635 | Ga0501035_0009635_5649_6377 | 242 |
| 584 | 3300049822 | Ga0501035_0388756 | Ga0501035_0388756_54_797 | 242 |
| 585 | 3300049822 | Ga0501035_0607976 | Ga0501035_0607976_67_801 | 242 |
| 586 | 3300049823 | Ga0501044_0034371 | Ga0501044_0034371_3736_4464 | 242 |
| 587 | 3300049823 | Ga0501044_0215223 | Ga0501044_0215223_734_1477 | 242 |
| 588 | 3300049823 | Ga0501044_0277177 | Ga0501044_0277177_57_791 | 242 |
| 589 | 3300049823 | Ga0501044_0433333 | Ga0501044_0433333_170_904 | 242 |
| 590 | 3300050489 | nmdc:mga03683_125930_c1 | nmdc:mga03683_125930_c1_245_982 | 242 |
| 591 | 3300050490 | nmdc:mga03n38_50030_c1 | nmdc:mga03n38_50030_c1_373_1110 | 242 |
| 592 | 3300050491 | nmdc:mga00v17_116628_c1 | nmdc:mga00v17_116628_c1_315_1052 | 242 |
| 593 | 3300050491 | nmdc:mga00v17_20175_c1 | nmdc:mga00v17_20175_c1_385_1128 | 242 |
| 594 | 3300050492 | nmdc:mga0yw44_137254_c2 | nmdc:mga0yw44_137254_c2_86_823 | 242 |
| 595 | 3300050494 | nmdc:mga06z11_33142_c1 | nmdc:mga06z11_33142_c1_1362_2099 | 242 |
| 596 | 3300050494 | nmdc:mga06z11_59148_c1 | nmdc:mga06z11_59148_c1_626_1354 | 242 |
| 597 | 3300050495 | nmdc:mga04h51_33140_c1 | nmdc:mga04h51_33140_c1_745_1482 | 242 |
| 598 | 3300050496 | nmdc:mga07m45_12942_c1 | nmdc:mga07m45_12942_c1_2887_3624 | 242 |
| 599 | 3300050496 | nmdc:mga07m45_41994_c2 | nmdc:mga07m45_41994_c2_640_1368 | 242 |
| 600 | 3300050507 | nmdc:mga05p37_32_c1 | nmdc:mga05p37_32_c1_108506_109234 | 242 |
| 601 | 3300050508 | nmdc:mga09592_1665_c1 | nmdc:mga09592_1665_c1_16241_16969 | 242 |
| 602 | 3300050509 | nmdc:mga0qj67_12610_c1 | nmdc:mga0qj67_12610_c1_552_1280 | 242 |
| 603 | 3300050510 | nmdc:mga06r32_16533_c1 | nmdc:mga06r32_16533_c1_3981_4709 | 242 |
| 604 | 3300050511 | nmdc:mga08y16_684_c1 | nmdc:mga08y16_684_c1_19739_20467 | 242 |
| 605 | 3300050511 | nmdc:mga08y16_83672_c1 | nmdc:mga08y16_83672_c1_2341_3069 | 242 |
| 606 | 3300050512 | nmdc:mga0n895_824_c1 | nmdc:mga0n895_824_c1_20076_20804 | 242 |
| 607 | 3300050512 | nmdc:mga0n895_9017_c1 | nmdc:mga0n895_9017_c1_4120_4848 | 242 |
| 608 | 3300050513 | nmdc:mga0rr50_134223_c1 | nmdc:mga0rr50_134223_c1_1102_1830 | 242 |
| 609 | 3300050513 | nmdc:mga0rr50_670517_c1 | nmdc:mga0rr50_670517_c1_108_836 | 242 |
| 610 | 3300050515 | nmdc:mga0a205_2160_c1 | nmdc:mga0a205_2160_c1_2391_3119 | 242 |
| 611 | 3300050515 | nmdc:mga0a205_216234_c1 | nmdc:mga0a205_216234_c1_241_969 | 242 |
| 612 | 3300050515 | nmdc:mga0a205_31621_c1 | nmdc:mga0a205_31621_c1_1564_2292 | 242 |
| 613 | 3300053077 | Ga0495601_0000159 | Ga0495601_0000159_5372_6100 | 242 |
| 614 | 3300053077 | Ga0495601_0004646 | Ga0495601_0004646_2144_2881 | 242 |
| 615 | 3300053077 | Ga0495601_0029443 | Ga0495601_0029443_621_1349 | 242 |
| 616 | 3300053077 | Ga0495601_0040605 | Ga0495601_0040605_1866_2603 | 242 |
| 617 | 3300053078 | Ga0495612_0000689 | Ga0495612_0000689_2281_3018 | 242 |
| 618 | 3300053078 | Ga0495612_0004359 | Ga0495612_0004359_2465_3193 | 242 |
| 619 | 3300053084 | Ga0495595_0000974 | Ga0495595_0000974_9460_10197 | 242 |
| 620 | 3300053084 | Ga0495595_0014772 | Ga0495595_0014772_2476_3204 | 242 |
| 621 | 3300053084 | Ga0495595_0017832 | Ga0495595_0017832_459_1187 | 242 |
| 622 | 3300053085 | Ga0495619_0001290 | Ga0495619_0001290_6189_6926 | 242 |
| 623 | 3300053085 | Ga0495619_0048530 | Ga0495619_0048530_1284_2012 | 242 |
| 624 | 3300053087 | Ga0500643_015552 | Ga0500643_015552_1537_2265 | 242 |
| 625 | 3300053088 | Ga0500644_0000552 | Ga0500644_0000552_10706_11434 | 242 |
| 626 | 3300053093 | Ga0500651_0182986 | Ga0500651_0182986_279_1007 | 242 |
| 627 | 3300053096 | Ga0500641_0060664 | Ga0500641_0060664_753_1481 | 242 |
| 628 | 3300053108 | Ga0500562_057999 | Ga0500562_057999_250_987 | 242 |
| 629 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_198245_198973 | 242 |
| 630 | 3300053119 | Ga0500595_008002 | Ga0500595_008002_2898_3635 | 242 |
| 631 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_629056_629784 | 242 |
| 632 | 3300054114 | Ga0501084_0210818 | Ga0501084_0210818_177_905 | 242 |
| 633 | 3300060353 | Ga0501082_0070745 | Ga0501082_0070745_1780_2514 | 242 |
| 634 | 3300060353 | Ga0501082_0106231 | Ga0501082_0106231_1503_2231 | 242 |
| 635 | 3300060353 | Ga0501082_0169003 | Ga0501082_0169003_170_898 | 242 |
| 636 | 3300061719 | Ga0466962_0071453 | Ga0466962_0071453_314_1042 | 242 |
| 637 | 3300061719 | Ga0466962_0112881 | Ga0466962_0112881_82_819 | 242 |
| 638 | iso_pu_bacteria | 2643221547 | 2643758766 | 242 |
| 639 | 3300049569 | Ga0501032_0007580 | Ga0501032_0007580_5857_6594 | 243 |
| 640 | 3300049573 | Ga0501037_0003014 | Ga0501037_0003014_307_1044 | 243 |
| 641 | 3300049575 | Ga0501039_0318156 | Ga0501039_0318156_365_1102 | 243 |
| 642 | 3300049580 | Ga0501046_0006409 | Ga0501046_0006409_657_1394 | 243 |
| 643 | 3300049583 | Ga0501067_0008646 | Ga0501067_0008646_258_995 | 243 |
| 644 | 3300049584 | Ga0501068_0003025 | Ga0501068_0003025_5576_6313 | 243 |
| 645 | 3300049588 | Ga0501072_0447098 | Ga0501072_0447098_165_902 | 243 |
| 646 | 3300049742 | Ga0501080_0015340 | Ga0501080_0015340_5855_6592 | 243 |
| 647 | 3300060353 | Ga0501082_0060360 | Ga0501082_0060360_341_1078 | 243 |
| 648 | 3300050496 | nmdc:mga07m45_26313_c1 | nmdc:mga07m45_26313_c1_591_1325 | 244 |
| 649 | 3300049823 | Ga0501044_0386085 | Ga0501044_0386085_289_1047 | 245 |
| 650 | 3300005434 | Ga0070709_10508727 | Ga0070709_105087271 | 246 |
| 651 | 3300049588 | Ga0501072_0268873 | Ga0501072_0268873_489_1247 | 249 |
| 652 | 3300049744 | Ga0501083_0176162 | Ga0501083_0176162_486_1244 | 249 |
| 653 | 3300006042 | Ga0075368_10009881 | Ga0075368_100098813 | 256 |
| 654 | 3300006186 | Ga0075369_10114095 | Ga0075369_101140952 | 256 |
| 655 | 3300025915 | Ga0207693_10057260 | Ga0207693_100572603 | 256 |
| 656 | 3300027866 | Ga0209813_10003725 | Ga0209813_100037252 | 256 |
| 657 | 3300009093 | Ga0105240_10530235 | Ga0105240_105302351 | 261 |
| 658 | 3300013104 | Ga0157370_10719423 | Ga0157370_107194231 | 261 |
| 659 | 3300025913 | Ga0207695_10378440 | Ga0207695_103784402 | 261 |
| 660 | 3300006058 | Ga0075432_10046659 | Ga0075432_100466591 | 262 |
| 661 | 3300006852 | Ga0075433_10232499 | Ga0075433_102324992 | 262 |
| 662 | 3300006871 | Ga0075434_100296546 | Ga0075434_1002965462 | 262 |
| 663 | 3300007076 | Ga0075435_100009711 | Ga0075435_1000097115 | 262 |
| 664 | 3300050507 | nmdc:mga05p37_7430_c1 | nmdc:mga05p37_7430_c1_1429_2226 | 262 |
| 665 | 3300050512 | nmdc:mga0n895_46646_c1 | nmdc:mga0n895_46646_c1_1984_2781 | 262 |
| 666 | 3300050513 | nmdc:mga0rr50_19008_c1 | nmdc:mga0rr50_19008_c1_2525_3322 | 262 |
| 667 | 3300050513 | nmdc:mga0rr50_265161_c1 | nmdc:mga0rr50_265161_c1_328_1125 | 262 |
| 668 | 3300050515 | nmdc:mga0a205_109041_c1 | nmdc:mga0a205_109041_c1_300_1097 | 262 |
| 669 | 3300005438 | Ga0070701_10234044 | Ga0070701_102340441 | 271 |
| 670 | 2209111006 | 2214544930 | 2213593606 | 273 |
| 671 | 2209111006 | 2214656054 | 2213681326 | 273 |
| 672 | 3300000045 | ARCol0oldRDRAFT_c00091 | ARCol0oldRDRAFT_000912 | 273 |
| 673 | 3300001990 | JGI24737J22298_10017420 | JGI24737J22298_100174203 | 273 |
| 674 | 3300005289 | Ga0065704_10086870 | Ga0065704_100868703 | 273 |
| 675 | 3300005290 | Ga0065712_10016314 | Ga0065712_100163143 | 273 |
| 676 | 3300005340 | Ga0070689_100086111 | Ga0070689_1000861112 | 273 |
| 677 | 3300005345 | Ga0070692_10022878 | Ga0070692_100228783 | 273 |
| 678 | 3300005353 | Ga0070669_100015571 | Ga0070669_1000155713 | 273 |
| 679 | 3300005354 | Ga0070675_100116117 | Ga0070675_1001161173 | 273 |
| 680 | 3300005365 | Ga0070688_100057107 | Ga0070688_1000571073 | 273 |
| 681 | 3300005366 | Ga0070659_100141682 | Ga0070659_1001416821 | 273 |
| 682 | 3300005367 | Ga0070667_100043434 | Ga0070667_1000434343 | 273 |
| 683 | 3300005440 | Ga0070705_100167308 | Ga0070705_1001673082 | 273 |
| 684 | 3300005441 | Ga0070700_100002037 | Ga0070700_1000020374 | 273 |
| 685 | 3300005444 | Ga0070694_100017473 | Ga0070694_1000174734 | 273 |
| 686 | 3300005455 | Ga0070663_100069885 | Ga0070663_1000698852 | 273 |
| 687 | 3300005457 | Ga0070662_100035728 | Ga0070662_1000357283 | 273 |
| 688 | 3300005458 | Ga0070681_10197475 | Ga0070681_101974752 | 273 |
| 689 | 3300005459 | Ga0068867_100118073 | Ga0068867_1001180733 | 273 |
| 690 | 3300005535 | Ga0070684_100022881 | Ga0070684_1000228814 | 273 |
| 691 | 3300005539 | Ga0068853_100110959 | Ga0068853_1001109592 | 273 |
| 692 | 3300005543 | Ga0070672_100072116 | Ga0070672_1000721162 | 273 |
| 693 | 3300005545 | Ga0070695_100049655 | Ga0070695_1000496553 | 273 |
| 694 | 3300005549 | Ga0070704_100178216 | Ga0070704_1001782163 | 273 |
| 695 | 3300005577 | Ga0068857_100159616 | Ga0068857_1001596161 | 273 |
| 696 | 3300005614 | Ga0068856_100533468 | Ga0068856_1005334682 | 273 |
| 697 | 3300005617 | Ga0068859_100058508 | Ga0068859_1000585084 | 273 |
| 698 | 3300005719 | Ga0068861_100131739 | Ga0068861_1001317391 | 273 |
| 699 | 3300005841 | Ga0068863_100735281 | Ga0068863_1007352811 | 273 |
| 700 | 3300005842 | Ga0068858_100165196 | Ga0068858_1001651962 | 273 |
| 701 | 3300005843 | Ga0068860_100127705 | Ga0068860_1001277053 | 273 |
| 702 | 3300005844 | Ga0068862_100009980 | Ga0068862_1000099804 | 273 |
| 703 | 3300006931 | Ga0097620_100058509 | Ga0097620_1000585092 | 273 |
| 704 | 3300025271 | Ga0207666_1001163 | Ga0207666_10011633 | 273 |
| 705 | 3300025315 | Ga0207697_10037066 | Ga0207697_100370662 | 273 |
| 706 | 3300025904 | Ga0207647_10024001 | Ga0207647_100240013 | 273 |
| 707 | 3300025912 | Ga0207707_10021923 | Ga0207707_100219235 | 273 |
| 708 | 3300025918 | Ga0207662_10013070 | Ga0207662_100130703 | 273 |
| 709 | 3300025923 | Ga0207681_10083028 | Ga0207681_100830283 | 273 |
| 710 | 3300025933 | Ga0207706_10033234 | Ga0207706_100332343 | 273 |
| 711 | 3300025935 | Ga0207709_10051583 | Ga0207709_100515832 | 273 |
| 712 | 3300025936 | Ga0207670_10038449 | Ga0207670_100384493 | 273 |
| 713 | 3300025940 | Ga0207691_10159730 | Ga0207691_101597303 | 273 |
| 714 | 3300025986 | Ga0207658_10221421 | Ga0207658_102214212 | 273 |
| 715 | 3300026035 | Ga0207703_10178928 | Ga0207703_101789282 | 273 |
| 716 | 3300026089 | Ga0207648_10028161 | Ga0207648_100281613 | 273 |
| 717 | 3300026116 | Ga0207674_10099929 | Ga0207674_100999292 | 273 |
| 718 | 3300026118 | Ga0207675_100032335 | Ga0207675_1000323353 | 273 |
| 719 | 3300027682 | Ga0209971_1009754 | Ga0209971_10097542 | 273 |
| 720 | 3300027717 | Ga0209998_10002525 | Ga0209998_100025253 | 273 |
| 721 | 3300027907 | Ga0207428_10001650 | Ga0207428_100016509 | 273 |
| 722 | 3300028380 | Ga0268265_10233338 | Ga0268265_102333382 | 273 |
| 723 | 3300028381 | Ga0268264_10115664 | Ga0268264_101156642 | 273 |
| 724 | 3300035724 | Ga0373933_0055454 | Ga0373933_0055454_1101_1949 | 273 |
| 725 | 3300037068 | Ga0373925_0236795 | Ga0373925_0236795_228_1052 | 273 |
| 726 | 3300046454 | Ga0495592_0175888 | Ga0495592_0175888_99_923 | 273 |
| 727 | 3300046529 | Ga0495652_0064134 | Ga0495652_0064134_447_1271 | 273 |
| 728 | 3300046559 | Ga0495667_0081150 | Ga0495667_0081150_1136_1960 | 273 |
| 729 | 3300046642 | Ga0495634_0175633 | Ga0495634_0175633_116_940 | 273 |
| 730 | 3300046663 | Ga0495635_0033017 | Ga0495635_0033017_1835_2659 | 273 |
| 731 | 3300046683 | Ga0495658_0018993 | Ga0495658_0018993_607_1431 | 273 |
| 732 | 3300046809 | Ga0495600_0193655 | Ga0495600_0193655_261_1085 | 273 |
| 733 | 3300047317 | Ga0495604_0021395 | Ga0495604_0021395_928_1752 | 273 |
| 734 | 3300047319 | Ga0495674_0073545 | Ga0495674_0073545_524_1348 | 273 |
| 735 | 3300047322 | Ga0495680_0094179 | Ga0495680_0094179_35_859 | 273 |
| 736 | 3300053077 | Ga0495601_0004928 | Ga0495601_0004928_2239_3063 | 273 |
| 737 | 3300053078 | Ga0495612_0015211 | Ga0495612_0015211_1363_2187 | 273 |
| 738 | 3300053085 | Ga0495619_0000016 | Ga0495619_0000016_146499_147323 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gq9-assembly1.cif.gz_B | the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase complexed with ctp at 100k | 0.9176 | 34 | 272 |
| 3oam-assembly2.cif.gz_D | crystal structure of cytidylyltransferase from vibrio cholerae | 0.9175 | 34 | 272 |
| 2y6p-assembly2.cif.gz_C-2 | evidence for a two-metal-ion-mechanism in the kdo- cytidylyltransferase kdsb | 0.9169 | 36 | 270 |
| 4xwi-assembly1.cif.gz_A | x-ray crystal structure of cmp-kdo synthase from pseudomonas aeruginosa | 0.9063 | 34 | 273 |
| 3k8e-assembly2.cif.gz_A | crystal structure of e. coli lipopolysaccharide specific cmp-kdo synthetase | 0.9056 | 34 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LT34_51_301_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9207 | 29 | 271 | 3.90.550.10 |
| 1h7eA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9187 | 34 | 272 | 3.90.550.10 |
| 2y6pC00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9169 | 36 | 270 | 3.90.550.10 |
| 2y6pC00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9054 | 36 | 270 | 3.90.550.10 |
| 3k8eD00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8911 | 36 | 270 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527Y7C8-F1-model_v4 | 3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38) | 0.9937 | 34 | 247 |
GO:0005829
GO:0008690 GO:0009103 |
| AF-A0A357CHF1-F1-model_v4 | 3-deoxy-manno-octulosonate cytidylyltransferase | 0.9898 | 35 | 140 |
GO:0005829
GO:0008690 GO:0009103 |
| AF-A0A528WT37-F1-model_v4 | 3-deoxy-manno-octulosonate cytidylyltransferase | 0.9895 | 34 | 193 |
GO:0005829
GO:0008690 GO:0009103 |
| AF-A0A1C2AHU6-F1-model_v4 | 3-deoxy-manno-octulosonate cytidylyltransferase | 0.983 | 36 | 119 |
GO:0005829
GO:0008690 GO:0009103 |
| AF-A0A847ZQZ3-F1-model_v4 | NTP transferase domain-containing protein | 0.9821 | 32 | 147 |
GO:0005829
GO:0008690 GO:0009103 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar