F478384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 283 | 738 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10071557|Ga0105238_100715573 |
| Length | 349 |
| Sequence | MQKLLRFADISIADRTGASMITLTSFARASRAFVCALAVAAAATPAVAQDAYPSKPVRIIVPFAAGGPADVYARFLAERLQQSMGQTFIVDDRPGAGSIIGTDAVAKSAPDGYTLLLMSNTHTVNESLIANKPFQLMRDFAPIAPINSSDLVLVARRSLPVSTVHELIAAAKAKPGAMTYASSGPGTPYHMAGELFKALAGVSILHIPYKGSSGARTDVLGGQVDLMFDAVTTMTEHVRQGKVKALGTTGKTRSEVMPDVPTIAEAGVPGYEATIWLGLMAPKNTPAQIVSRLNAEVGKIVGQPEVVKAWRVQGAVPMTMSVAEFTKYLNDDIVKWARIVKVSGAKPEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 194 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 195 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.22 |
| Nodule | 0 |
| Rhizoplane | 2.98 |
| Rhizosphere | 93.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10038972 | 3300005327 | Bacteria | 3833 |
| 2 | Ga0070658_10069095 | 3300005327 | Bacteria | 2889 |
| 3 | Ga0070658_10178290 | 3300005327 | Bacteria | 1788 |
| 4 | Ga0070676_10006626 | 3300005328 | Bacteria | 6197 |
| 5 | Ga0070676_10010777 | 3300005328 | Bacteria | 4961 |
| 6 | Ga0070676_10021963 | 3300005328 | Bacteria | 3576 |
| 7 | Ga0070676_10219195 | 3300005328 | Bacteria | 1256 |
| 8 | Ga0070683_100007182 | 3300005329 | Bacteria | 9391 |
| 9 | Ga0070683_100030885 | 3300005329 | Bacteria | 4867 |
| 10 | Ga0070683_100039556 | 3300005329 | Bacteria | 4330 |
| 11 | Ga0070690_100013351 | 3300005330 | Bacteria | 4849 |
| 12 | Ga0070690_100041543 | 3300005330 | Bacteria | 2912 |
| 13 | Ga0070690_100042787 | 3300005330 | Bacteria | 2869 |
| 14 | Ga0070670_100008462 | 3300005331 | Bacteria | 8777 |
| 15 | Ga0070670_100013351 | 3300005331 | Bacteria | 7034 |
| 16 | Ga0070670_100051505 | 3300005331 | Bacteria | 3535 |
| 17 | Ga0070670_100072433 | 3300005331 | Bacteria | 2959 |
| 18 | Ga0070670_100277101 | 3300005331 | Bacteria | 1464 |
| 19 | Ga0070677_10002013 | 3300005333 | Bacteria | 6459 |
| 20 | Ga0070677_10039117 | 3300005333 | Bacteria | 1860 |
| 21 | Ga0068869_100002941 | 3300005334 | Bacteria | 10343 |
| 22 | Ga0068869_100008210 | 3300005334 | Bacteria | 6718 |
| 23 | Ga0068869_100015759 | 3300005334 | Bacteria | 5080 |
| 24 | Ga0070666_10002937 | 3300005335 | Bacteria | 10314 |
| 25 | Ga0070666_10003117 | 3300005335 | Bacteria | 10072 |
| 26 | Ga0070666_10006093 | 3300005335 | Bacteria | 7411 |
| 27 | Ga0070666_10033038 | 3300005335 | Bacteria | 3421 |
| 28 | Ga0070666_10230815 | 3300005335 | Bacteria | 1307 |
| 29 | Ga0070680_100194013 | 3300005336 | Bacteria | 1712 |
| 30 | Ga0070680_100330288 | 3300005336 | Bacteria | 1295 |
| 31 | Ga0070682_100024784 | 3300005337 | Bacteria | 3574 |
| 32 | Ga0068868_100006024 | 3300005338 | Bacteria | 8563 |
| 33 | Ga0068868_100043259 | 3300005338 | Bacteria | 3518 |
| 34 | Ga0068868_100112766 | 3300005338 | Bacteria | 2211 |
| 35 | Ga0068868_100112875 | 3300005338 | Bacteria | 2209 |
| 36 | Ga0068868_100255747 | 3300005338 | Bacteria | 1475 |
| 37 | Ga0070660_100015941 | 3300005339 | Bacteria | 5443 |
| 38 | Ga0070689_100007815 | 3300005340 | Bacteria | 7494 |
| 39 | Ga0070689_100010101 | 3300005340 | Bacteria | 6720 |
| 40 | Ga0070689_100034823 | 3300005340 | Bacteria | 3843 |
| 41 | Ga0070689_100112561 | 3300005340 | Bacteria | 2166 |
| 42 | Ga0070689_100264698 | 3300005340 | Bacteria | 1422 |
| 43 | Ga0070661_100001163 | 3300005344 | Bacteria | 18546 |
| 44 | Ga0070661_100002517 | 3300005344 | Bacteria | 12548 |
| 45 | Ga0070661_100004458 | 3300005344 | Bacteria | 9655 |
| 46 | Ga0070661_100020742 | 3300005344 | Bacteria | 4688 |
| 47 | Ga0070661_100032933 | 3300005344 | Bacteria | 3754 |
| 48 | Ga0070661_100050297 | 3300005344 | Bacteria | 3049 |
| 49 | Ga0070661_100114099 | 3300005344 | Bacteria | 2020 |
| 50 | Ga0070668_100006563 | 3300005347 | Bacteria | 8619 |
| 51 | Ga0070668_100017926 | 3300005347 | Bacteria | 5310 |
| 52 | Ga0070668_100089486 | 3300005347 | Bacteria | 2425 |
| 53 | Ga0070669_100000703 | 3300005353 | Bacteria | 24519 |
| 54 | Ga0070669_100010671 | 3300005353 | Bacteria | 6519 |
| 55 | Ga0070669_100017967 | 3300005353 | Bacteria | 5051 |
| 56 | Ga0070669_100025112 | 3300005353 | Bacteria | 4278 |
| 57 | Ga0070669_100075027 | 3300005353 | Bacteria | 2507 |
| 58 | Ga0070669_100082373 | 3300005353 | Bacteria | 2398 |
| 59 | Ga0070669_100135105 | 3300005353 | Bacteria | 1896 |
| 60 | Ga0070669_100163088 | 3300005353 | Bacteria | 1733 |
| 61 | Ga0070669_100278085 | 3300005353 | Bacteria | 1340 |
| 62 | Ga0070675_100008358 | 3300005354 | Bacteria | 8033 |
| 63 | Ga0070675_100015033 | 3300005354 | Bacteria | 6114 |
| 64 | Ga0070675_100019752 | 3300005354 | Bacteria | 5372 |
| 65 | Ga0070675_100040486 | 3300005354 | Bacteria | 3804 |
| 66 | Ga0070675_100050125 | 3300005354 | Bacteria | 3428 |
| 67 | Ga0070675_100057458 | 3300005354 | Bacteria | 3208 |
| 68 | Ga0070675_100407801 | 3300005354 | Bacteria | 1213 |
| 69 | Ga0070671_100002148 | 3300005355 | Bacteria | 15230 |
| 70 | Ga0070671_100002779 | 3300005355 | Bacteria | 13599 |
| 71 | Ga0070671_100004213 | 3300005355 | Bacteria | 11377 |
| 72 | Ga0070671_100005567 | 3300005355 | Bacteria | 10036 |
| 73 | Ga0070671_100024596 | 3300005355 | Bacteria | 4932 |
| 74 | Ga0070671_100054814 | 3300005355 | Bacteria | 3316 |
| 75 | Ga0070671_100054877 | 3300005355 | Bacteria | 3314 |
| 76 | Ga0070671_100058361 | 3300005355 | Bacteria | 3213 |
| 77 | Ga0070671_100159378 | 3300005355 | Bacteria | 1907 |
| 78 | Ga0070671_100185377 | 3300005355 | Bacteria | 1763 |
| 79 | Ga0070674_100001675 | 3300005356 | Bacteria | 11979 |
| 80 | Ga0070674_100009858 | 3300005356 | Bacteria | 5745 |
| 81 | Ga0070674_100108214 | 3300005356 | Bacteria | 2037 |
| 82 | Ga0070674_100194891 | 3300005356 | Bacteria | 1560 |
| 83 | Ga0070673_100004285 | 3300005364 | Bacteria | 9005 |
| 84 | Ga0070673_100007461 | 3300005364 | Bacteria | 7213 |
| 85 | Ga0070673_100058265 | 3300005364 | Bacteria | 3053 |
| 86 | Ga0070673_100108377 | 3300005364 | Bacteria | 2300 |
| 87 | Ga0070673_100108608 | 3300005364 | Bacteria | 2297 |
| 88 | Ga0070673_100132910 | 3300005364 | Bacteria | 2090 |
| 89 | Ga0070673_100410746 | 3300005364 | Bacteria | 1212 |
| 90 | Ga0070659_100030369 | 3300005366 | Bacteria | 4183 |
| 91 | Ga0070659_100192578 | 3300005366 | Bacteria | 1676 |
| 92 | Ga0070667_100002963 | 3300005367 | Bacteria | 14593 |
| 93 | Ga0070667_100003662 | 3300005367 | Bacteria | 13081 |
| 94 | Ga0070667_100006668 | 3300005367 | Bacteria | 9598 |
| 95 | Ga0070667_100007802 | 3300005367 | Bacteria | 8874 |
| 96 | Ga0070667_100013595 | 3300005367 | Bacteria | 6726 |
| 97 | Ga0070667_100099996 | 3300005367 | Bacteria | 2504 |
| 98 | Ga0070709_10008703 | 3300005434 | Bacteria | 5584 |
| 99 | Ga0070709_10035113 | 3300005434 | Bacteria | 3045 |
| 100 | Ga0070709_10068902 | 3300005434 | Bacteria | 2277 |
| 101 | Ga0070709_10076840 | 3300005434 | Bacteria | 2169 |
| 102 | Ga0070709_10084055 | 3300005434 | Bacteria | 2084 |
| 103 | Ga0070714_100014948 | 3300005435 | Bacteria | 6240 |
| 104 | Ga0070714_100033506 | 3300005435 | Bacteria | 4294 |
| 105 | Ga0070714_100132569 | 3300005435 | Bacteria | 2228 |
| 106 | Ga0070713_100004952 | 3300005436 | Bacteria | 9043 |
| 107 | Ga0070713_100125784 | 3300005436 | Bacteria | 2254 |
| 108 | Ga0070713_100186705 | 3300005436 | Bacteria | 1866 |
| 109 | Ga0070710_10002378 | 3300005437 | Bacteria | 8909 |
| 110 | Ga0070701_10052732 | 3300005438 | Bacteria | 2114 |
| 111 | Ga0070700_100022620 | 3300005441 | Bacteria | 3669 |
| 112 | Ga0070700_100131993 | 3300005441 | Bacteria | 1687 |
| 113 | Ga0070663_100002838 | 3300005455 | Bacteria | 9844 |
| 114 | Ga0070663_100010680 | 3300005455 | Bacteria | 5730 |
| 115 | Ga0070663_100122677 | 3300005455 | Bacteria | 1964 |
| 116 | Ga0070678_100004327 | 3300005456 | Bacteria | 8034 |
| 117 | Ga0070678_100014019 | 3300005456 | Bacteria | 5041 |
| 118 | Ga0070678_100077605 | 3300005456 | Bacteria | 2506 |
| 119 | Ga0070678_100144515 | 3300005456 | Bacteria | 1907 |
| 120 | Ga0070678_100184737 | 3300005456 | Bacteria | 1710 |
| 121 | Ga0070662_100000827 | 3300005457 | Bacteria | 19059 |
| 122 | Ga0070662_100003262 | 3300005457 | Bacteria | 10093 |
| 123 | Ga0070662_100012595 | 3300005457 | Bacteria | 5610 |
| 124 | Ga0070662_100019182 | 3300005457 | Bacteria | 4640 |
| 125 | Ga0070662_100199012 | 3300005457 | Bacteria | 1589 |
| 126 | Ga0070681_10006174 | 3300005458 | Bacteria | 11640 |
| 127 | Ga0070681_10008534 | 3300005458 | Bacteria | 10033 |
| 128 | Ga0070681_10022228 | 3300005458 | Bacteria | 6366 |
| 129 | Ga0068867_100001658 | 3300005459 | Bacteria | 15497 |
| 130 | Ga0068867_100002428 | 3300005459 | Bacteria | 13095 |
| 131 | Ga0068867_100004893 | 3300005459 | Bacteria | 9428 |
| 132 | Ga0068867_100007088 | 3300005459 | Bacteria | 7922 |
| 133 | Ga0068867_100029241 | 3300005459 | Bacteria | 3970 |
| 134 | Ga0068867_100214604 | 3300005459 | Bacteria | 1547 |
| 135 | Ga0068867_100245561 | 3300005459 | Bacteria | 1453 |
| 136 | Ga0070685_10056628 | 3300005466 | Bacteria | 2279 |
| 137 | Ga0070699_100017505 | 3300005518 | Bacteria | 6150 |
| 138 | Ga0070679_100003587 | 3300005530 | Bacteria | 14196 |
| 139 | Ga0070679_100188447 | 3300005530 | Bacteria | 2032 |
| 140 | Ga0070679_100204541 | 3300005530 | Bacteria | 1939 |
| 141 | Ga0070684_100074081 | 3300005535 | Bacteria | 3001 |
| 142 | Ga0070684_100116544 | 3300005535 | Bacteria | 2399 |
| 143 | Ga0068853_100017860 | 3300005539 | Bacteria | 5860 |
| 144 | Ga0068853_100144640 | 3300005539 | Bacteria | 2136 |
| 145 | Ga0068853_100281595 | 3300005539 | Bacteria | 1533 |
| 146 | Ga0070672_100001237 | 3300005543 | Bacteria | 15684 |
| 147 | Ga0070672_100002999 | 3300005543 | Bacteria | 10878 |
| 148 | Ga0070672_100015202 | 3300005543 | Bacteria | 5473 |
| 149 | Ga0070672_100031023 | 3300005543 | Bacteria | 4020 |
| 150 | Ga0070672_100038186 | 3300005543 | Bacteria | 3667 |
| 151 | Ga0070672_100046661 | 3300005543 | Bacteria | 3357 |
| 152 | Ga0070672_100090681 | 3300005543 | Bacteria | 2465 |
| 153 | Ga0070672_100168707 | 3300005543 | Bacteria | 1819 |
| 154 | Ga0070672_100304933 | 3300005543 | Bacteria | 1351 |
| 155 | Ga0070693_100027970 | 3300005547 | Bacteria | 3062 |
| 156 | Ga0070665_100034048 | 3300005548 | Bacteria | 5123 |
| 157 | Ga0070665_100073195 | 3300005548 | Bacteria | 3433 |
| 158 | Ga0070665_100080552 | 3300005548 | Bacteria | 3262 |
| 159 | Ga0070665_100113254 | 3300005548 | Bacteria | 2715 |
| 160 | Ga0070665_100570285 | 3300005548 | Bacteria | 1144 |
| 161 | Ga0068855_100004781 | 3300005563 | Bacteria | 16532 |
| 162 | Ga0068855_100048925 | 3300005563 | Bacteria | 4988 |
| 163 | Ga0068855_100062803 | 3300005563 | Bacteria | 4335 |
| 164 | Ga0068855_100075008 | 3300005563 | Bacteria | 3927 |
| 165 | Ga0068855_100158356 | 3300005563 | Bacteria | 2572 |
| 166 | Ga0070664_100000152 | 3300005564 | Bacteria | 47795 |
| 167 | Ga0070664_100006501 | 3300005564 | Bacteria | 9420 |
| 168 | Ga0070664_100046254 | 3300005564 | Bacteria | 3676 |
| 169 | Ga0070664_100057608 | 3300005564 | Bacteria | 3303 |
| 170 | Ga0070664_100129450 | 3300005564 | Bacteria | 2216 |
| 171 | Ga0068857_100034689 | 3300005577 | Bacteria | 4462 |
| 172 | Ga0068857_100098900 | 3300005577 | Bacteria | 2617 |
| 173 | Ga0068857_100114033 | 3300005577 | Bacteria | 2430 |
| 174 | Ga0068857_100133405 | 3300005577 | Bacteria | 2241 |
| 175 | Ga0068857_100444974 | 3300005577 | Bacteria | 1211 |
| 176 | Ga0068854_100013085 | 3300005578 | Bacteria | 5439 |
| 177 | Ga0068856_100000093 | 3300005614 | Bacteria | 84752 |
| 178 | Ga0068856_100018144 | 3300005614 | Bacteria | 6822 |
| 179 | Ga0068856_100034204 | 3300005614 | Bacteria | 4978 |
| 180 | Ga0068856_100039961 | 3300005614 | Bacteria | 4606 |
| 181 | Ga0068856_100043551 | 3300005614 | Bacteria | 4416 |
| 182 | Ga0068856_100210731 | 3300005614 | Bacteria | 1958 |
| 183 | Ga0070702_100259425 | 3300005615 | Bacteria | 1182 |
| 184 | Ga0068852_100002316 | 3300005616 | Bacteria | 13089 |
| 185 | Ga0068852_100007090 | 3300005616 | Bacteria | 8165 |
| 186 | Ga0068852_100018088 | 3300005616 | Bacteria | 5545 |
| 187 | Ga0068852_100072473 | 3300005616 | Bacteria | 3027 |
| 188 | Ga0068852_100377612 | 3300005616 | Bacteria | 1390 |
| 189 | Ga0068859_100008717 | 3300005617 | Bacteria | 10248 |
| 190 | Ga0068859_100097646 | 3300005617 | Bacteria | 2991 |
| 191 | Ga0068859_100105275 | 3300005617 | Bacteria | 2880 |
| 192 | Ga0068859_100214803 | 3300005617 | Bacteria | 2010 |
| 193 | Ga0068864_100001297 | 3300005618 | Bacteria | 20799 |
| 194 | Ga0068864_100001959 | 3300005618 | Bacteria | 16928 |
| 195 | Ga0068864_100020907 | 3300005618 | Bacteria | 5478 |
| 196 | Ga0068864_100024057 | 3300005618 | Bacteria | 5120 |
| 197 | Ga0068864_100044371 | 3300005618 | Bacteria | 3810 |
| 198 | Ga0068864_100049557 | 3300005618 | Bacteria | 3614 |
| 199 | Ga0068864_100057582 | 3300005618 | Bacteria | 3358 |
| 200 | Ga0068864_100069289 | 3300005618 | Bacteria | 3067 |
| 201 | Ga0068866_10005854 | 3300005718 | Bacteria | 5104 |
| 202 | Ga0068866_10011312 | 3300005718 | Bacteria | 3857 |
| 203 | Ga0068866_10071157 | 3300005718 | Bacteria | 1839 |
| 204 | Ga0068861_100003125 | 3300005719 | Bacteria | 10939 |
| 205 | Ga0068861_100026691 | 3300005719 | Bacteria | 4201 |
| 206 | Ga0068861_100058140 | 3300005719 | Bacteria | 2956 |
| 207 | Ga0068861_100148460 | 3300005719 | Bacteria | 1921 |
| 208 | Ga0068851_10002770 | 3300005834 | Bacteria | 7725 |
| 209 | Ga0068851_10005190 | 3300005834 | Bacteria | 5913 |
| 210 | Ga0068851_10038242 | 3300005834 | Bacteria | 2406 |
| 211 | Ga0068851_10051815 | 3300005834 | Bacteria | 2086 |
| 212 | Ga0068851_10112432 | 3300005834 | Bacteria | 1455 |
| 213 | Ga0068870_10031559 | 3300005840 | Bacteria | 2685 |
| 214 | Ga0068870_10152355 | 3300005840 | Bacteria | 1363 |
| 215 | Ga0068863_100002914 | 3300005841 | Bacteria | 16966 |
| 216 | Ga0068863_100011402 | 3300005841 | Bacteria | 8600 |
| 217 | Ga0068863_100023298 | 3300005841 | Bacteria | 5915 |
| 218 | Ga0068863_100025750 | 3300005841 | Bacteria | 5611 |
| 219 | Ga0068863_100082868 | 3300005841 | Bacteria | 3039 |
| 220 | Ga0068863_100097888 | 3300005841 | Bacteria | 2786 |
| 221 | Ga0068863_100133660 | 3300005841 | Bacteria | 2369 |
| 222 | Ga0068863_100559558 | 3300005841 | Bacteria | 1130 |
| 223 | Ga0068858_100000729 | 3300005842 | Bacteria | 34410 |
| 224 | Ga0068858_100003258 | 3300005842 | Bacteria | 16181 |
| 225 | Ga0068858_100007127 | 3300005842 | Bacteria | 10858 |
| 226 | Ga0068858_100010459 | 3300005842 | Bacteria | 8789 |
| 227 | Ga0068858_100029114 | 3300005842 | Bacteria | 5128 |
| 228 | Ga0068858_100056819 | 3300005842 | Bacteria | 3617 |
| 229 | Ga0068858_100134991 | 3300005842 | Bacteria | 2315 |
| 230 | Ga0068860_100004309 | 3300005843 | Bacteria | 14547 |
| 231 | Ga0068860_100020088 | 3300005843 | Bacteria | 6471 |
| 232 | Ga0068860_100036517 | 3300005843 | Bacteria | 4707 |
| 233 | Ga0068860_100039107 | 3300005843 | Bacteria | 4537 |
| 234 | Ga0068862_100187360 | 3300005844 | Bacteria | 1860 |
| 235 | Ga0068862_100240530 | 3300005844 | Bacteria | 1646 |
| 236 | Ga0081455_10002056 | 3300005937 | Bacteria | 24066 |
| 237 | Ga0081540_1000313 | 3300005983 | Bacteria | 50236 |
| 238 | Ga0070717_10259098 | 3300006028 | Bacteria | 1538 |
| 239 | Ga0075365_10118008 | 3300006038 | Bacteria | 1828 |
| 240 | Ga0070715_10038775 | 3300006163 | Bacteria | 1980 |
| 241 | Ga0075367_10002955 | 3300006178 | Bacteria | 7942 |
| 242 | Ga0075367_10036455 | 3300006178 | Bacteria | 2852 |
| 243 | Ga0075366_10000957 | 3300006195 | Bacteria | 14080 |
| 244 | Ga0097621_100027028 | 3300006237 | Bacteria | 4508 |
| 245 | Ga0097621_100385941 | 3300006237 | Bacteria | 1252 |
| 246 | Ga0068871_100009333 | 3300006358 | Bacteria | 7103 |
| 247 | Ga0068871_100016446 | 3300006358 | Bacteria | 5571 |
| 248 | Ga0068871_100063765 | 3300006358 | Bacteria | 3015 |
| 249 | Ga0068871_100177611 | 3300006358 | Bacteria | 1828 |
| 250 | Ga0075428_100014820 | 3300006844 | Bacteria | 8663 |
| 251 | Ga0075430_100044473 | 3300006846 | Bacteria | 3754 |
| 252 | Ga0075431_100015583 | 3300006847 | Bacteria | 7704 |
| 253 | Ga0075434_100066222 | 3300006871 | Bacteria | 3598 |
| 254 | Ga0075429_100000003 | 3300006880 | Bacteria | 130377 |
| 255 | Ga0068865_100000968 | 3300006881 | Bacteria | 16397 |
| 256 | Ga0068865_100025566 | 3300006881 | Bacteria | 3885 |
| 257 | Ga0097620_100008717 | 3300006931 | Bacteria | 10248 |
| 258 | Ga0097620_100097646 | 3300006931 | Bacteria | 2991 |
| 259 | Ga0097620_100105274 | 3300006931 | Bacteria | 2880 |
| 260 | Ga0097620_100214795 | 3300006931 | Bacteria | 2010 |
| 261 | Ga0105240_10002702 | 3300009093 | Bacteria | 28208 |
| 262 | Ga0105240_10006429 | 3300009093 | Bacteria | 17273 |
| 263 | Ga0111539_10683744 | 3300009094 | Bacteria | 1195 |
| 264 | Ga0111539_10696005 | 3300009094 | Bacteria | 1183 |
| 265 | Ga0105245_10017282 | 3300009098 | Bacteria | 6294 |
| 266 | Ga0105245_10118338 | 3300009098 | Bacteria | 2472 |
| 267 | Ga0105247_10021696 | 3300009101 | Bacteria | 3864 |
| 268 | Ga0114129_10005359 | 3300009147 | Bacteria | 18104 |
| 269 | Ga0114129_10183640 | 3300009147 | Bacteria | 2844 |
| 270 | Ga0105243_10020478 | 3300009148 | Bacteria | 5014 |
| 271 | Ga0105243_10086073 | 3300009148 | Bacteria | 2577 |
| 272 | Ga0105243_10189703 | 3300009148 | Bacteria | 1794 |
| 273 | Ga0105241_10001154 | 3300009174 | Bacteria | 20103 |
| 274 | Ga0105241_10059857 | 3300009174 | Bacteria | 2929 |
| 275 | Ga0105241_10402513 | 3300009174 | Bacteria | 1201 |
| 276 | Ga0105242_10014088 | 3300009176 | Bacteria | 6189 |
| 277 | Ga0105248_10007025 | 3300009177 | Bacteria | 12334 |
| 278 | Ga0105248_10010702 | 3300009177 | Bacteria | 10123 |
| 279 | Ga0105248_10016915 | 3300009177 | Bacteria | 8030 |
| 280 | Ga0105248_10021738 | 3300009177 | Bacteria | 7108 |
| 281 | Ga0105237_10040115 | 3300009545 | Bacteria | 4722 |
| 282 | Ga0105237_10093770 | 3300009545 | Bacteria | 2991 |
| 283 | Ga0105237_10099157 | 3300009545 | Bacteria | 2905 |
| 284 | Ga0105237_10198199 | 3300009545 | Bacteria | 2007 |
| 285 | Ga0105238_10003012 | 3300009551 | Bacteria | 16820 |
| 286 | Ga0105238_10049052 | 3300009551 | Bacteria | 4254 |
| 287 | Ga0105238_10071557 | 3300009551 | Bacteria | 3465 |
| 288 | Ga0105238_10144516 | 3300009551 | Bacteria | 2355 |
| 289 | Ga0105239_10357501 | 3300010375 | Bacteria | 1649 |
| 290 | Ga0105239_10420440 | 3300010375 | Bacteria | 1514 |
| 291 | Ga0105246_10083596 | 3300011119 | Bacteria | 2282 |
| 292 | Ga0157373_10005664 | 3300013100 | Bacteria | 9360 |
| 293 | Ga0157373_10020608 | 3300013100 | Bacteria | 4790 |
| 294 | Ga0157373_10030761 | 3300013100 | Bacteria | 3863 |
| 295 | Ga0157373_10154523 | 3300013100 | Bacteria | 1614 |
| 296 | Ga0157371_10000696 | 3300013102 | Bacteria | 39564 |
| 297 | Ga0157370_10004239 | 3300013104 | Bacteria | 16583 |
| 298 | Ga0157370_10007103 | 3300013104 | Bacteria | 12223 |
| 299 | Ga0157370_10034563 | 3300013104 | Bacteria | 4919 |
| 300 | Ga0157370_10036749 | 3300013104 | Bacteria | 4751 |
| 301 | Ga0157370_10242582 | 3300013104 | Bacteria | 1667 |
| 302 | Ga0157369_10033319 | 3300013105 | Bacteria | 5662 |
| 303 | Ga0157369_10079192 | 3300013105 | Bacteria | 3519 |
| 304 | Ga0157369_10105602 | 3300013105 | Bacteria | 2998 |
| 305 | Ga0157369_10240825 | 3300013105 | Bacteria | 1890 |
| 306 | Ga0157374_10015544 | 3300013296 | Bacteria | 6677 |
| 307 | Ga0157374_10074601 | 3300013296 | Bacteria | 3204 |
| 308 | Ga0157378_10005031 | 3300013297 | Bacteria | 11605 |
| 309 | Ga0157378_10009099 | 3300013297 | Bacteria | 8647 |
| 310 | Ga0157378_10156425 | 3300013297 | Bacteria | 2128 |
| 311 | Ga0157378_10200607 | 3300013297 | Bacteria | 1887 |
| 312 | Ga0163162_10006321 | 3300013306 | Bacteria | 11471 |
| 313 | Ga0163162_10012725 | 3300013306 | Bacteria | 8217 |
| 314 | Ga0163162_10019386 | 3300013306 | Bacteria | 6671 |
| 315 | Ga0163162_10040663 | 3300013306 | Bacteria | 4650 |
| 316 | Ga0163162_10069143 | 3300013306 | Bacteria | 3583 |
| 317 | Ga0163162_10236441 | 3300013306 | Bacteria | 1957 |
| 318 | Ga0163162_10438558 | 3300013306 | Bacteria | 1438 |
| 319 | Ga0157372_10006652 | 3300013307 | Bacteria | 12300 |
| 320 | Ga0157372_10017050 | 3300013307 | Bacteria | 7798 |
| 321 | Ga0157372_10020731 | 3300013307 | Bacteria | 7096 |
| 322 | Ga0157372_10039214 | 3300013307 | Bacteria | 5228 |
| 323 | Ga0157372_10257305 | 3300013307 | Bacteria | 2027 |
| 324 | Ga0157372_10257905 | 3300013307 | Bacteria | 2024 |
| 325 | Ga0157375_10011280 | 3300013308 | Bacteria | 7889 |
| 326 | Ga0157375_10046064 | 3300013308 | Bacteria | 4249 |
| 327 | Ga0157375_10061788 | 3300013308 | Bacteria | 3721 |
| 328 | Ga0157375_10070170 | 3300013308 | Bacteria | 3513 |
| 329 | Ga0157375_10115633 | 3300013308 | Bacteria | 2786 |
| 330 | Ga0157375_10355364 | 3300013308 | Bacteria | 1631 |
| 331 | Ga0163163_10005612 | 3300014325 | Bacteria | 10872 |
| 332 | Ga0157380_10051443 | 3300014326 | Bacteria | 3258 |
| 333 | Ga0157380_10076156 | 3300014326 | Bacteria | 2729 |
| 334 | Ga0157380_10126496 | 3300014326 | Bacteria | 2173 |
| 335 | Ga0157380_10326050 | 3300014326 | Bacteria | 1426 |
| 336 | Ga0157380_10444018 | 3300014326 | Bacteria | 1244 |
| 337 | Ga0157377_10030418 | 3300014745 | Bacteria | 2925 |
| 338 | Ga0157377_10113807 | 3300014745 | Bacteria | 1630 |
| 339 | Ga0157379_10004210 | 3300014968 | Bacteria | 12286 |
| 340 | Ga0157379_10012185 | 3300014968 | Bacteria | 7511 |
| 341 | Ga0157379_10027063 | 3300014968 | Bacteria | 5104 |
| 342 | Ga0157379_10027423 | 3300014968 | Bacteria | 5072 |
| 343 | Ga0157379_10048460 | 3300014968 | Bacteria | 3792 |
| 344 | Ga0157379_10063062 | 3300014968 | Bacteria | 3314 |
| 345 | Ga0157379_10350138 | 3300014968 | Bacteria | 1352 |
| 346 | Ga0157376_10032082 | 3300014969 | Bacteria | 4214 |
| 347 | Ga0157376_10042780 | 3300014969 | Bacteria | 3714 |
| 348 | Ga0163161_10014345 | 3300017792 | Bacteria | 5515 |
| 349 | Ga0163161_10016630 | 3300017792 | Bacteria | 5137 |
| 350 | Ga0163161_10151608 | 3300017792 | Bacteria | 1762 |
| 351 | Ga0163161_10219535 | 3300017792 | Bacteria | 1472 |
| 352 | Ga0213875_10055598 | 3300021388 | Bacteria | 1854 |
| 353 | Ga0207697_10005139 | 3300025315 | Bacteria | 6117 |
| 354 | Ga0207656_10026749 | 3300025321 | Bacteria | 2354 |
| 355 | Ga0207656_10034710 | 3300025321 | Bacteria | 2107 |
| 356 | Ga0207656_10041790 | 3300025321 | Bacteria | 1949 |
| 357 | Ga0207682_10003194 | 3300025893 | Bacteria | 7171 |
| 358 | Ga0207682_10003662 | 3300025893 | Bacteria | 6632 |
| 359 | Ga0207682_10005486 | 3300025893 | Bacteria | 5165 |
| 360 | Ga0207682_10042845 | 3300025893 | Bacteria | 1850 |
| 361 | Ga0207692_10029153 | 3300025898 | Bacteria | 2619 |
| 362 | Ga0207692_10125477 | 3300025898 | Bacteria | 1443 |
| 363 | Ga0207642_10017417 | 3300025899 | Bacteria | 2732 |
| 364 | Ga0207642_10091773 | 3300025899 | Bacteria | 1502 |
| 365 | Ga0207710_10012681 | 3300025900 | Bacteria | 3547 |
| 366 | Ga0207688_10036655 | 3300025901 | Bacteria | 2719 |
| 367 | Ga0207688_10086011 | 3300025901 | Bacteria | 1801 |
| 368 | Ga0207680_10001451 | 3300025903 | Bacteria | 11248 |
| 369 | Ga0207680_10006222 | 3300025903 | Bacteria | 5760 |
| 370 | Ga0207647_10188483 | 3300025904 | Bacteria | 1196 |
| 371 | Ga0207699_10004274 | 3300025906 | Bacteria | 6831 |
| 372 | Ga0207699_10013825 | 3300025906 | Bacteria | 4143 |
| 373 | Ga0207699_10073449 | 3300025906 | Bacteria | 2098 |
| 374 | Ga0207699_10151573 | 3300025906 | Bacteria | 1534 |
| 375 | Ga0207645_10000930 | 3300025907 | Bacteria | 24267 |
| 376 | Ga0207645_10013116 | 3300025907 | Bacteria | 5598 |
| 377 | Ga0207645_10015439 | 3300025907 | Bacteria | 5072 |
| 378 | Ga0207645_10147256 | 3300025907 | Bacteria | 1536 |
| 379 | Ga0207654_10230110 | 3300025911 | Bacteria | 1234 |
| 380 | Ga0207707_10008674 | 3300025912 | Bacteria | 8822 |
| 381 | Ga0207707_10041031 | 3300025912 | Bacteria | 4041 |
| 382 | Ga0207707_10143737 | 3300025912 | Bacteria | 2085 |
| 383 | Ga0207695_10076155 | 3300025913 | Bacteria | 3412 |
| 384 | Ga0207671_10046808 | 3300025914 | Bacteria | 3200 |
| 385 | Ga0207671_10165688 | 3300025914 | Bacteria | 1713 |
| 386 | Ga0207671_10241857 | 3300025914 | Bacteria | 1418 |
| 387 | Ga0207693_10004943 | 3300025915 | Bacteria | 11203 |
| 388 | Ga0207660_10002422 | 3300025917 | Bacteria | 12251 |
| 389 | Ga0207660_10127395 | 3300025917 | Bacteria | 1935 |
| 390 | Ga0207660_10335885 | 3300025917 | Bacteria | 1209 |
| 391 | Ga0207660_10424668 | 3300025917 | Bacteria | 1073 |
| 392 | Ga0207662_10006278 | 3300025918 | Bacteria | 6402 |
| 393 | Ga0207657_10000045 | 3300025919 | Bacteria | 114661 |
| 394 | Ga0207657_10008538 | 3300025919 | Bacteria | 10388 |
| 395 | Ga0207657_10015160 | 3300025919 | Bacteria | 7485 |
| 396 | Ga0207657_10046535 | 3300025919 | Bacteria | 3799 |
| 397 | Ga0207657_10076083 | 3300025919 | Bacteria | 2832 |
| 398 | Ga0207657_10104022 | 3300025919 | Bacteria | 2353 |
| 399 | Ga0207649_10002175 | 3300025920 | Bacteria | 11083 |
| 400 | Ga0207649_10021178 | 3300025920 | Bacteria | 3738 |
| 401 | Ga0207649_10028095 | 3300025920 | Bacteria | 3309 |
| 402 | Ga0207652_10028914 | 3300025921 | Bacteria | 4627 |
| 403 | Ga0207652_10034707 | 3300025921 | Bacteria | 4252 |
| 404 | Ga0207652_10066886 | 3300025921 | Bacteria | 3115 |
| 405 | Ga0207652_10166294 | 3300025921 | Bacteria | 1978 |
| 406 | Ga0207652_10208730 | 3300025921 | Bacteria | 1758 |
| 407 | Ga0207681_10008494 | 3300025923 | Bacteria | 6276 |
| 408 | Ga0207681_10016331 | 3300025923 | Bacteria | 4642 |
| 409 | Ga0207681_10018436 | 3300025923 | Bacteria | 4397 |
| 410 | Ga0207681_10064768 | 3300025923 | Bacteria | 2525 |
| 411 | Ga0207681_10085109 | 3300025923 | Bacteria | 2243 |
| 412 | Ga0207681_10153744 | 3300025923 | Bacteria | 1727 |
| 413 | Ga0207694_10021014 | 3300025924 | Bacteria | 4941 |
| 414 | Ga0207694_10080374 | 3300025924 | Bacteria | 2558 |
| 415 | Ga0207694_10116776 | 3300025924 | Bacteria | 2127 |
| 416 | Ga0207650_10003438 | 3300025925 | Bacteria | 10883 |
| 417 | Ga0207650_10005120 | 3300025925 | Bacteria | 8945 |
| 418 | Ga0207650_10019766 | 3300025925 | Bacteria | 4737 |
| 419 | Ga0207650_10053216 | 3300025925 | Bacteria | 3000 |
| 420 | Ga0207650_10235668 | 3300025925 | Bacteria | 1478 |
| 421 | Ga0207659_10002463 | 3300025926 | Bacteria | 11038 |
| 422 | Ga0207659_10013645 | 3300025926 | Bacteria | 5212 |
| 423 | Ga0207659_10013858 | 3300025926 | Bacteria | 5182 |
| 424 | Ga0207659_10025053 | 3300025926 | Bacteria | 4004 |
| 425 | Ga0207659_10026817 | 3300025926 | Bacteria | 3893 |
| 426 | Ga0207659_10272011 | 3300025926 | Bacteria | 1382 |
| 427 | Ga0207687_10055910 | 3300025927 | Bacteria | 2766 |
| 428 | Ga0207687_10059337 | 3300025927 | Bacteria | 2695 |
| 429 | Ga0207687_10121380 | 3300025927 | Bacteria | 1955 |
| 430 | Ga0207700_10195097 | 3300025928 | Bacteria | 1703 |
| 431 | Ga0207664_10006610 | 3300025929 | Bacteria | 7985 |
| 432 | Ga0207664_10034959 | 3300025929 | Unclassified | 3874 |
| 433 | Ga0207664_10073502 | 3300025929 | Bacteria | 2759 |
| 434 | Ga0207664_10139257 | 3300025929 | Bacteria | 2051 |
| 435 | Ga0207644_10000899 | 3300025931 | Bacteria | 18825 |
| 436 | Ga0207644_10006192 | 3300025931 | Bacteria | 7803 |
| 437 | Ga0207644_10008628 | 3300025931 | Bacteria | 6668 |
| 438 | Ga0207644_10010401 | 3300025931 | Bacteria | 6130 |
| 439 | Ga0207644_10011430 | 3300025931 | Bacteria | 5874 |
| 440 | Ga0207644_10015764 | 3300025931 | Bacteria | 5080 |
| 441 | Ga0207644_10017295 | 3300025931 | Bacteria | 4867 |
| 442 | Ga0207644_10029367 | 3300025931 | Bacteria | 3814 |
| 443 | Ga0207644_10030228 | 3300025931 | Bacteria | 3764 |
| 444 | Ga0207644_10060211 | 3300025931 | Bacteria | 2747 |
| 445 | Ga0207644_10108880 | 3300025931 | Bacteria | 2092 |
| 446 | Ga0207690_10008126 | 3300025932 | Bacteria | 6225 |
| 447 | Ga0207706_10000149 | 3300025933 | Bacteria | 76532 |
| 448 | Ga0207706_10004918 | 3300025933 | Bacteria | 12497 |
| 449 | Ga0207706_10063073 | 3300025933 | Bacteria | 3263 |
| 450 | Ga0207706_10197542 | 3300025933 | Bacteria | 1764 |
| 451 | Ga0207670_10007087 | 3300025936 | Bacteria | 6243 |
| 452 | Ga0207669_10002834 | 3300025937 | Bacteria | 7429 |
| 453 | Ga0207669_10005706 | 3300025937 | Bacteria | 5614 |
| 454 | Ga0207669_10008202 | 3300025937 | Bacteria | 4893 |
| 455 | Ga0207669_10094153 | 3300025937 | Bacteria | 1959 |
| 456 | Ga0207669_10145510 | 3300025937 | Bacteria | 1652 |
| 457 | Ga0207704_10011475 | 3300025938 | Bacteria | 4362 |
| 458 | Ga0207704_10018556 | 3300025938 | Bacteria | 3634 |
| 459 | Ga0207704_10075417 | 3300025938 | Bacteria | 2156 |
| 460 | Ga0207704_10252369 | 3300025938 | Bacteria | 1325 |
| 461 | Ga0207704_10274919 | 3300025938 | Bacteria | 1277 |
| 462 | Ga0207691_10000229 | 3300025940 | Bacteria | 54461 |
| 463 | Ga0207691_10000427 | 3300025940 | Bacteria | 41828 |
| 464 | Ga0207691_10002230 | 3300025940 | Bacteria | 18966 |
| 465 | Ga0207691_10012281 | 3300025940 | Bacteria | 8210 |
| 466 | Ga0207691_10023136 | 3300025940 | Bacteria | 5850 |
| 467 | Ga0207691_10098557 | 3300025940 | Bacteria | 2611 |
| 468 | Ga0207691_10143168 | 3300025940 | Bacteria | 2105 |
| 469 | Ga0207691_10290176 | 3300025940 | Bacteria | 1407 |
| 470 | Ga0207711_10062825 | 3300025941 | Bacteria | 3204 |
| 471 | Ga0207711_10099325 | 3300025941 | Bacteria | 2573 |
| 472 | Ga0207711_10173222 | 3300025941 | Bacteria | 1959 |
| 473 | Ga0207711_10336826 | 3300025941 | Bacteria | 1396 |
| 474 | Ga0207689_10000534 | 3300025942 | Bacteria | 36072 |
| 475 | Ga0207689_10014374 | 3300025942 | Bacteria | 6734 |
| 476 | Ga0207689_10020977 | 3300025942 | Bacteria | 5492 |
| 477 | Ga0207689_10022098 | 3300025942 | Bacteria | 5350 |
| 478 | Ga0207661_10042690 | 3300025944 | Bacteria | 3576 |
| 479 | Ga0207679_10007689 | 3300025945 | Bacteria | 6847 |
| 480 | Ga0207679_10030294 | 3300025945 | Bacteria | 3776 |
| 481 | Ga0207679_10037851 | 3300025945 | Bacteria | 3433 |
| 482 | Ga0207679_10050669 | 3300025945 | Bacteria | 3035 |
| 483 | Ga0207679_10109357 | 3300025945 | Bacteria | 2178 |
| 484 | Ga0207667_10006125 | 3300025949 | Bacteria | 14614 |
| 485 | Ga0207667_10009172 | 3300025949 | Bacteria | 11683 |
| 486 | Ga0207667_10066614 | 3300025949 | Bacteria | 3753 |
| 487 | Ga0207667_10110217 | 3300025949 | Bacteria | 2840 |
| 488 | Ga0207651_10000426 | 3300025960 | Bacteria | 17948 |
| 489 | Ga0207651_10003355 | 3300025960 | Bacteria | 7852 |
| 490 | Ga0207651_10014425 | 3300025960 | Bacteria | 4562 |
| 491 | Ga0207651_10042232 | 3300025960 | Bacteria | 3033 |
| 492 | Ga0207651_10109840 | 3300025960 | Bacteria | 2067 |
| 493 | Ga0207651_10394827 | 3300025960 | Bacteria | 1175 |
| 494 | Ga0207712_10113305 | 3300025961 | Bacteria | 2038 |
| 495 | Ga0207668_10006200 | 3300025972 | Bacteria | 7059 |
| 496 | Ga0207668_10023509 | 3300025972 | Bacteria | 3963 |
| 497 | Ga0207668_10034913 | 3300025972 | Bacteria | 3344 |
| 498 | Ga0207640_10008111 | 3300025981 | Bacteria | 5813 |
| 499 | Ga0207640_10036740 | 3300025981 | Bacteria | 3077 |
| 500 | Ga0207640_10127115 | 3300025981 | Bacteria | 1837 |
| 501 | Ga0207658_10014038 | 3300025986 | Bacteria | 5482 |
| 502 | Ga0207658_10016118 | 3300025986 | Bacteria | 5134 |
| 503 | Ga0207658_10042566 | 3300025986 | Bacteria | 3295 |
| 504 | Ga0207658_10054412 | 3300025986 | Bacteria | 2961 |
| 505 | Ga0207677_10001186 | 3300026023 | Bacteria | 14157 |
| 506 | Ga0207677_10090607 | 3300026023 | Bacteria | 2222 |
| 507 | Ga0207677_10140060 | 3300026023 | Bacteria | 1851 |
| 508 | Ga0207703_10006732 | 3300026035 | Bacteria | 9167 |
| 509 | Ga0207703_10008279 | 3300026035 | Bacteria | 8211 |
| 510 | Ga0207703_10011058 | 3300026035 | Bacteria | 7032 |
| 511 | Ga0207703_10024049 | 3300026035 | Bacteria | 4793 |
| 512 | Ga0207703_10028143 | 3300026035 | Bacteria | 4427 |
| 513 | Ga0207639_10067425 | 3300026041 | Bacteria | 2784 |
| 514 | Ga0207639_10070474 | 3300026041 | Bacteria | 2730 |
| 515 | Ga0207639_10075376 | 3300026041 | Bacteria | 2652 |
| 516 | Ga0207639_10268590 | 3300026041 | Bacteria | 1495 |
| 517 | Ga0207678_10003299 | 3300026067 | Bacteria | 14542 |
| 518 | Ga0207678_10005357 | 3300026067 | Bacteria | 11489 |
| 519 | Ga0207678_10077448 | 3300026067 | Bacteria | 2848 |
| 520 | Ga0207678_10243294 | 3300026067 | Bacteria | 1541 |
| 521 | Ga0207708_10059652 | 3300026075 | Bacteria | 2913 |
| 522 | Ga0207702_10002780 | 3300026078 | Bacteria | 16396 |
| 523 | Ga0207702_10024915 | 3300026078 | Bacteria | 4964 |
| 524 | Ga0207702_10030260 | 3300026078 | Bacteria | 4511 |
| 525 | Ga0207702_10034801 | 3300026078 | Bacteria | 4213 |
| 526 | Ga0207641_10005867 | 3300026088 | Bacteria | 10421 |
| 527 | Ga0207641_10007082 | 3300026088 | Bacteria | 9366 |
| 528 | Ga0207641_10012653 | 3300026088 | Bacteria | 6918 |
| 529 | Ga0207641_10044089 | 3300026088 | Bacteria | 3749 |
| 530 | Ga0207641_10071896 | 3300026088 | Bacteria | 2977 |
| 531 | Ga0207641_10138801 | 3300026088 | Bacteria | 2190 |
| 532 | Ga0207641_10175007 | 3300026088 | Bacteria | 1962 |
| 533 | Ga0207648_10007896 | 3300026089 | Bacteria | 10380 |
| 534 | Ga0207648_10009020 | 3300026089 | Bacteria | 9592 |
| 535 | Ga0207648_10015197 | 3300026089 | Bacteria | 7086 |
| 536 | Ga0207648_10026307 | 3300026089 | Bacteria | 5173 |
| 537 | Ga0207648_10054752 | 3300026089 | Bacteria | 3483 |
| 538 | Ga0207676_10000572 | 3300026095 | Bacteria | 30479 |
| 539 | Ga0207676_10008732 | 3300026095 | Bacteria | 7207 |
| 540 | Ga0207676_10024429 | 3300026095 | Bacteria | 4471 |
| 541 | Ga0207676_10029091 | 3300026095 | Bacteria | 4133 |
| 542 | Ga0207676_10032079 | 3300026095 | Bacteria | 3956 |
| 543 | Ga0207676_10053510 | 3300026095 | Bacteria | 3160 |
| 544 | Ga0207676_10060766 | 3300026095 | Bacteria | 2990 |
| 545 | Ga0207676_10230755 | 3300026095 | Bacteria | 1654 |
| 546 | Ga0207676_10348655 | 3300026095 | Bacteria | 1368 |
| 547 | Ga0207674_10000020 | 3300026116 | Bacteria | 162474 |
| 548 | Ga0207674_10005781 | 3300026116 | Bacteria | 14669 |
| 549 | Ga0207674_10016690 | 3300026116 | Bacteria | 8025 |
| 550 | Ga0207674_10026116 | 3300026116 | Bacteria | 6213 |
| 551 | Ga0207674_10055498 | 3300026116 | Bacteria | 4027 |
| 552 | Ga0207674_10200449 | 3300026116 | Bacteria | 1945 |
| 553 | Ga0207675_100000977 | 3300026118 | Bacteria | 28393 |
| 554 | Ga0207675_100095977 | 3300026118 | Bacteria | 2791 |
| 555 | Ga0207675_100142898 | 3300026118 | Bacteria | 2274 |
| 556 | Ga0207675_100176299 | 3300026118 | Bacteria | 2045 |
| 557 | Ga0207683_10000255 | 3300026121 | Bacteria | 47453 |
| 558 | Ga0207683_10009517 | 3300026121 | Bacteria | 8284 |
| 559 | Ga0207683_10009854 | 3300026121 | Bacteria | 8149 |
| 560 | Ga0207683_10012448 | 3300026121 | Bacteria | 7261 |
| 561 | Ga0207683_10103230 | 3300026121 | Bacteria | 2546 |
| 562 | Ga0207683_10183269 | 3300026121 | Bacteria | 1899 |
| 563 | Ga0207683_10247104 | 3300026121 | Bacteria | 1628 |
| 564 | Ga0207698_10000678 | 3300026142 | Bacteria | 19757 |
| 565 | Ga0207698_10040085 | 3300026142 | Bacteria | 3476 |
| 566 | Ga0207698_10096091 | 3300026142 | Bacteria | 2441 |
| 567 | Ga0207698_10156733 | 3300026142 | Bacteria | 1985 |
| 568 | Ga0207698_10163891 | 3300026142 | Bacteria | 1948 |
| 569 | Ga0209969_1004367 | 3300027360 | Bacteria | 1976 |
| 570 | Ga0209981_1009139 | 3300027378 | Bacteria | 1353 |
| 571 | Ga0210000_1000587 | 3300027462 | Bacteria | 4982 |
| 572 | Ga0209995_1002182 | 3300027471 | Bacteria | 3075 |
| 573 | Ga0209999_1003367 | 3300027543 | Bacteria | 2854 |
| 574 | Ga0209970_1014656 | 3300027614 | Bacteria | 1302 |
| 575 | Ga0209983_1015547 | 3300027665 | Bacteria | 1570 |
| 576 | Ga0209971_1008724 | 3300027682 | Bacteria | 2404 |
| 577 | Ga0209974_10005410 | 3300027876 | Bacteria | 4494 |
| 578 | Ga0268266_10030810 | 3300028379 | Bacteria | 4555 |
| 579 | Ga0268266_10220163 | 3300028379 | Bacteria | 1744 |
| 580 | Ga0268265_10059617 | 3300028380 | Bacteria | 2921 |
| 581 | Ga0268265_10184664 | 3300028380 | Bacteria | 1795 |
| 582 | Ga0268265_10204180 | 3300028380 | Bacteria | 1717 |
| 583 | Ga0268264_10003403 | 3300028381 | Bacteria | 13736 |
| 584 | Ga0268264_10004892 | 3300028381 | Bacteria | 11351 |
| 585 | Ga0268264_10023821 | 3300028381 | Bacteria | 4994 |
| 586 | Ga0268264_10024856 | 3300028381 | Bacteria | 4894 |
| 587 | Ga0268264_10204319 | 3300028381 | Bacteria | 1809 |
| 588 | Ga0265334_10011495 | 3300028573 | Bacteria | 3727 |
| 589 | Ga0307517_10029255 | 3300028786 | Bacteria | 6516 |
| 590 | Ga0307515_10027818 | 3300028794 | Bacteria | 9641 |
| 591 | Ga0307515_10045696 | 3300028794 | Bacteria | 6718 |
| 592 | Ga0265763_1000043 | 3300030763 | Bacteria | 4926 |
| 593 | Ga0265332_10004952 | 3300031238 | Bacteria | 6191 |
| 594 | Ga0265329_10006218 | 3300031242 | Bacteria | 4756 |
| 595 | Ga0265340_10037750 | 3300031247 | Bacteria | 2392 |
| 596 | Ga0265331_10002953 | 3300031250 | Bacteria | 11208 |
| 597 | Ga0265316_10011908 | 3300031344 | Bacteria | 7820 |
| 598 | Ga0307513_10002039 | 3300031456 | Bacteria | 28431 |
| 599 | Ga0307513_10091844 | 3300031456 | Bacteria | 3092 |
| 600 | Ga0307509_10003320 | 3300031507 | Bacteria | 24618 |
| 601 | Ga0307509_10015069 | 3300031507 | Bacteria | 9054 |
| 602 | Ga0307509_10049191 | 3300031507 | Bacteria | 4522 |
| 603 | Ga0307509_10323607 | 3300031507 | Bacteria | 1277 |
| 604 | Ga0307508_10013319 | 3300031616 | Bacteria | 7520 |
| 605 | Ga0307508_10035587 | 3300031616 | Bacteria | 4487 |
| 606 | Ga0307508_10088128 | 3300031616 | Bacteria | 2687 |
| 607 | Ga0265314_10000675 | 3300031711 | Bacteria | 41616 |
| 608 | Ga0307405_10078564 | 3300031731 | Bacteria | 2148 |
| 609 | Ga0307412_10009961 | 3300031911 | Bacteria | 5467 |
| 610 | Ga0307409_100019238 | 3300031995 | Bacteria | 4617 |
| 611 | Ga0307409_100175482 | 3300031995 | Bacteria | 1891 |
| 612 | Ga0307416_100003082 | 3300032002 | Bacteria | 9747 |
| 613 | Ga0307416_100021079 | 3300032002 | Bacteria | 4669 |
| 614 | Ga0307414_10105381 | 3300032004 | Bacteria | 2132 |
| 615 | Ga0307414_10223272 | 3300032004 | Bacteria | 1548 |
| 616 | Ga0307415_100006914 | 3300032126 | Bacteria | 6160 |
| 617 | Ga0307507_10038308 | 3300033179 | Bacteria | 4864 |
| 618 | Ga0307510_10004077 | 3300033180 | Bacteria | 17138 |
| 619 | Ga0373932_0008285 | 3300035112 | Bacteria | 2483 |
| 620 | Ga0373954_0031280 | 3300035118 | Bacteria | 2457 |
| 621 | Ga0373955_0161011 | 3300035172 | Bacteria | 1325 |
| 622 | Ga0373931_0011481 | 3300035691 | Bacteria | 4281 |
| 623 | Ga0373931_0116909 | 3300035691 | Bacteria | 1520 |
| 624 | Ga0373931_0215223 | 3300035691 | Bacteria | 1154 |
| 625 | Ga0373935_0309779 | 3300035692 | Bacteria | 1118 |
| 626 | Ga0373927_0006163 | 3300035695 | Bacteria | 8196 |
| 627 | Ga0373937_0063736 | 3300036401 | Bacteria | 3390 |
| 628 | Ga0373937_0272260 | 3300036401 | Bacteria | 1598 |
| 629 | Ga0373925_0055592 | 3300037068 | Bacteria | 2964 |
| 630 | Ga0373925_0288195 | 3300037068 | Bacteria | 1324 |
| 631 | Ga0395899_0035008 | 3300037312 | Bacteria | 3771 |
| 632 | Ga0395900_0042602 | 3300037418 | Bacteria | 4678 |
| 633 | Ga0395900_0178929 | 3300037418 | Bacteria | 2156 |
| 634 | Ga0395898_0350567 | 3300037466 | Bacteria | 1408 |
| 635 | Ga0395905_0119984 | 3300037471 | Bacteria | 2471 |
| 636 | Ga0395901_0047820 | 3300038443 | Bacteria | 4442 |
| 637 | Ga0395901_0309598 | 3300038443 | Bacteria | 1636 |
| 638 | Ga0436363_0039369 | 3300039450 | Bacteria | 2254 |
| 639 | Ga0436363_1432274 | 3300039450 | Bacteria | 3391 |
| 640 | Ga0439460_0014745 | 3300042461 | Bacteria | 2057 |
| 641 | Ga0451577_0087317 | 3300042876 | Bacteria | 2783 |
| 642 | Ga0453683_0002604 | 3300044673 | Bacteria | 13836 |
| 643 | Ga0466957_0015486 | 3300044842 | Bacteria | 4454 |
| 644 | Ga0451576_0000958 | 3300045051 | Bacteria | 54063 |
| 645 | Ga0451576_0021618 | 3300045051 | Bacteria | 6990 |
| 646 | Ga0451576_0261011 | 3300045051 | Bacteria | 1811 |
| 647 | Ga0466958_0054661 | 3300045836 | Unclassified | 2421 |
| 648 | Ga0466967_0060948 | 3300045976 | Bacteria | 3346 |
| 649 | Ga0466967_0345095 | 3300045976 | Bacteria | 1440 |
| 650 | Ga0495592_0000091 | 3300046454 | Bacteria | 79692 |
| 651 | Ga0495629_0000119 | 3300046459 | Bacteria | 69922 |
| 652 | Ga0495629_0325573 | 3300046459 | Bacteria | 1050 |
| 653 | Ga0495638_0002000 | 3300046460 | Bacteria | 17405 |
| 654 | Ga0495641_0036929 | 3300046461 | Bacteria | 2293 |
| 655 | Ga0495641_0159846 | 3300046461 | Bacteria | 1008 |
| 656 | Ga0495653_0000105 | 3300046463 | Bacteria | 69642 |
| 657 | Ga0495650_0008654 | 3300046471 | Bacteria | 5898 |
| 658 | Ga0495580_0037962 | 3300046472 | Bacteria | 3453 |
| 659 | Ga0495580_0284869 | 3300046472 | Bacteria | 1127 |
| 660 | Ga0495582_0006122 | 3300046473 | Bacteria | 6697 |
| 661 | Ga0495582_0194811 | 3300046473 | Bacteria | 1157 |
| 662 | Ga0495605_0004840 | 3300046474 | Bacteria | 7875 |
| 663 | Ga0495639_0039657 | 3300046475 | Bacteria | 2118 |
| 664 | Ga0495596_0013806 | 3300046500 | Bacteria | 3416 |
| 665 | Ga0495583_0014674 | 3300046506 | Bacteria | 4307 |
| 666 | Ga0495618_0138351 | 3300046514 | Bacteria | 1557 |
| 667 | Ga0495620_0025057 | 3300046515 | Bacteria | 2828 |
| 668 | Ga0495628_0065838 | 3300046516 | Bacteria | 2833 |
| 669 | Ga0495630_0006184 | 3300046517 | Bacteria | 8493 |
| 670 | Ga0495632_0027203 | 3300046519 | Bacteria | 2998 |
| 671 | Ga0495648_0062567 | 3300046524 | Bacteria | 2203 |
| 672 | Ga0495648_0070644 | 3300046524 | Bacteria | 2027 |
| 673 | Ga0495642_0029869 | 3300046528 | Bacteria | 2179 |
| 674 | Ga0495642_0059778 | 3300046528 | Bacteria | 1580 |
| 675 | Ga0495598_0003719 | 3300046537 | Bacteria | 3258 |
| 676 | Ga0495621_0150695 | 3300046539 | Bacteria | 915 |
| 677 | Ga0495597_0049496 | 3300046542 | Bacteria | 1857 |
| 678 | Ga0495645_0084567 | 3300046543 | Bacteria | 2272 |
| 679 | Ga0495656_0012291 | 3300046615 | Bacteria | 3156 |
| 680 | Ga0495668_0025062 | 3300046616 | Bacteria | 3391 |
| 681 | Ga0495611_0006324 | 3300046648 | Bacteria | 5046 |
| 682 | Ga0495658_0020138 | 3300046683 | Bacteria | 3496 |
| 683 | Ga0495613_0088270 | 3300046689 | Bacteria | 2247 |
| 684 | Ga0495613_0110946 | 3300046689 | Bacteria | 1976 |
| 685 | Ga0495624_0008327 | 3300046690 | Bacteria | 7247 |
| 686 | Ga0495636_0081213 | 3300047318 | Bacteria | 1396 |
| 687 | Ga0495674_0140882 | 3300047319 | Bacteria | 2027 |
| 688 | Ga0495676_0022853 | 3300047321 | Bacteria | 5434 |
| 689 | Ga0495687_041223 | 3300047443 | Bacteria | 2027 |
| 690 | Ga0495675_0192687 | 3300047444 | Bacteria | 1244 |
| 691 | Ga0495677_0030820 | 3300047445 | Bacteria | 1952 |
| 692 | Ga0495679_000036 | 3300047446 | Bacteria | 161473 |
| 693 | Ga0495673_0053985 | 3300047469 | Bacteria | 1749 |
| 694 | Ga0495673_0068673 | 3300047469 | Bacteria | 1497 |
| 695 | Ga0495686_0209793 | 3300047472 | Bacteria | 1113 |
| 696 | Ga0495593_0006473 | 3300047673 | Bacteria | 6862 |
| 697 | Ga0495593_0042344 | 3300047673 | Bacteria | 2444 |
| 698 | Ga0495602_0067890 | 3300048088 | Bacteria | 3065 |
| 699 | Ga0495615_0005970 | 3300048090 | Bacteria | 2226 |
| 700 | Ga0496100_0193290 | 3300048903 | Bacteria | 1479 |
| 701 | Ga0496100_0340207 | 3300048903 | Bacteria | 1131 |
| 702 | Ga0496101_0109186 | 3300048904 | Bacteria | 2081 |
| 703 | Ga0496102_0018172 | 3300048905 | Bacteria | 6171 |
| 704 | Ga0496102_0026199 | 3300048905 | Bacteria | 5198 |
| 705 | Ga0496102_0189230 | 3300048905 | Bacteria | 1939 |
| 706 | Ga0496102_0568276 | 3300048905 | Bacteria | 1057 |
| 707 | Ga0496104_0010876 | 3300048907 | Bacteria | 8139 |
| 708 | Ga0496104_0047214 | 3300048907 | Bacteria | 4058 |
| 709 | Ga0496104_0275556 | 3300048907 | Bacteria | 1595 |
| 710 | Ga0496105_0005406 | 3300048908 | Bacteria | 9693 |
| 711 | Ga0496106_0005880 | 3300048909 | Bacteria | 9071 |
| 712 | Ga0496106_0093215 | 3300048909 | Bacteria | 2327 |
| 713 | Ga0496107_0146360 | 3300048910 | Bacteria | 1747 |
| 714 | Ga0496108_0055598 | 3300048911 | Bacteria | 3324 |
| 715 | Ga0496108_0122521 | 3300048911 | Bacteria | 2231 |
| 716 | Ga0496108_0143712 | 3300048911 | Bacteria | 2056 |
| 717 | Ga0496109_0097929 | 3300048912 | Bacteria | 2719 |
| 718 | Ga0496110_0429548 | 3300048913 | Bacteria | 1204 |
| 719 | Ga0496112_0142010 | 3300048915 | Bacteria | 2370 |
| 720 | Ga0496113_0052135 | 3300048916 | Bacteria | 3054 |
| 721 | Ga0496114_0090010 | 3300048917 | Bacteria | 2605 |
| 722 | Ga0496121_0016679 | 3300048924 | Bacteria | 7560 |
| 723 | Ga0496126_0016483 | 3300048929 | Bacteria | 7385 |
| 724 | Ga0496126_0172501 | 3300048929 | Bacteria | 1842 |
| 725 | nmdc:mga0yw44_131089_c1 | 3300050492 | Bacteria | 1623 |
| 726 | nmdc:mga0k408_185355_c1 | 3300050493 | Bacteria | 1241 |
| 727 | nmdc:mga0k408_2166_c1 | 3300050493 | Bacteria | 10537 |
| 728 | nmdc:mga06z11_7758_c1 | 3300050494 | Bacteria | 4435 |
| 729 | nmdc:mga05p37_77_c1 | 3300050507 | Bacteria | 86224 |
| 730 | nmdc:mga09592_140_c1 | 3300050508 | Bacteria | 48059 |
| 731 | nmdc:mga0qj67_1823_c1 | 3300050509 | Bacteria | 15086 |
| 732 | nmdc:mga06r32_288860_c1 | 3300050510 | Bacteria | 1627 |
| 733 | nmdc:mga06r32_4881_c1 | 3300050510 | Bacteria | 12079 |
| 734 | nmdc:mga0n895_344162_c1 | 3300050512 | Bacteria | 1510 |
| 735 | Ga0495601_0060369 | 3300053077 | Bacteria | 2406 |
| 736 | Ga0495612_0075047 | 3300053078 | Bacteria | 1415 |
| 737 | Ga0495619_0164616 | 3300053085 | Bacteria | 1532 |
| 738 | Ga0500641_0002176 | 3300053096 | Bacteria | 6942 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0429548 | Ga0496110_0429548_128_1108 | 286 |
| 2 | 3300005434 | Ga0070709_10008703 | Ga0070709_100087033 | 289 |
| 3 | 3300005436 | Ga0070713_100004952 | Ga0070713_1000049525 | 289 |
| 4 | 3300006163 | Ga0070715_10038775 | Ga0070715_100387751 | 289 |
| 5 | 3300009094 | Ga0111539_10683744 | Ga0111539_106837441 | 289 |
| 6 | 3300025898 | Ga0207692_10125477 | Ga0207692_101254772 | 289 |
| 7 | 3300025906 | Ga0207699_10004274 | Ga0207699_100042744 | 289 |
| 8 | 3300025915 | Ga0207693_10004943 | Ga0207693_100049437 | 289 |
| 9 | 3300025929 | Ga0207664_10034959 | Ga0207664_100349592 | 289 |
| 10 | 3300031247 | Ga0265340_10037750 | Ga0265340_100377503 | 289 |
| 11 | 3300046461 | Ga0495641_0159846 | Ga0495641_0159846_15_884 | 289 |
| 12 | 3300046459 | Ga0495629_0325573 | Ga0495629_0325573_13_894 | 293 |
| 13 | 3300046539 | Ga0495621_0150695 | Ga0495621_0150695_24_905 | 293 |
| 14 | 3300006178 | Ga0075367_10002955 | Ga0075367_100029556 | 297 |
| 15 | 3300050494 | nmdc:mga06z11_7758_c1 | nmdc:mga06z11_7758_c1_2633_3613 | 297 |
| 16 | 3300044842 | Ga0466957_0015486 | Ga0466957_0015486_3295_4260 | 300 |
| 17 | 3300045836 | Ga0466958_0054661 | Ga0466958_0054661_233_1198 | 300 |
| 18 | 3300048904 | Ga0496101_0109186 | Ga0496101_0109186_101_1090 | 300 |
| 19 | 3300048905 | Ga0496102_0189230 | Ga0496102_0189230_113_1102 | 300 |
| 20 | 3300048907 | Ga0496104_0010876 | Ga0496104_0010876_1669_2658 | 300 |
| 21 | 3300048908 | Ga0496105_0005406 | Ga0496105_0005406_2493_3482 | 300 |
| 22 | 3300048911 | Ga0496108_0143712 | Ga0496108_0143712_674_1651 | 300 |
| 23 | 3300048917 | Ga0496114_0090010 | Ga0496114_0090010_1448_2437 | 300 |
| 24 | 3300025938 | Ga0207704_10252369 | Ga0207704_102523692 | 307 |
| 25 | 3300048929 | Ga0496126_0172501 | Ga0496126_0172501_875_1804 | 307 |
| 26 | 3300005618 | Ga0068864_100049557 | Ga0068864_1000495573 | 308 |
| 27 | 3300037418 | Ga0395900_0042602 | Ga0395900_0042602_2608_3564 | 309 |
| 28 | 3300038443 | Ga0395901_0047820 | Ga0395901_0047820_655_1611 | 309 |
| 29 | 3300005354 | Ga0070675_100050125 | Ga0070675_1000501252 | 310 |
| 30 | 3300035692 | Ga0373935_0309779 | Ga0373935_0309779_166_1107 | 310 |
| 31 | 3300005331 | Ga0070670_100008462 | Ga0070670_10000846210 | 311 |
| 32 | 3300005436 | Ga0070713_100125784 | Ga0070713_1001257843 | 311 |
| 33 | 3300005330 | Ga0070690_100042787 | Ga0070690_1000427872 | 312 |
| 34 | 3300005333 | Ga0070677_10002013 | Ga0070677_100020132 | 312 |
| 35 | 3300005335 | Ga0070666_10033038 | Ga0070666_100330383 | 312 |
| 36 | 3300005338 | Ga0068868_100112875 | Ga0068868_1001128752 | 312 |
| 37 | 3300005340 | Ga0070689_100010101 | Ga0070689_1000101017 | 312 |
| 38 | 3300005353 | Ga0070669_100075027 | Ga0070669_1000750271 | 312 |
| 39 | 3300005353 | Ga0070669_100135105 | Ga0070669_1001351053 | 312 |
| 40 | 3300005354 | Ga0070675_100407801 | Ga0070675_1004078012 | 312 |
| 41 | 3300005355 | Ga0070671_100005567 | Ga0070671_1000055672 | 312 |
| 42 | 3300005355 | Ga0070671_100159378 | Ga0070671_1001593782 | 312 |
| 43 | 3300005356 | Ga0070674_100194891 | Ga0070674_1001948912 | 312 |
| 44 | 3300005364 | Ga0070673_100058265 | Ga0070673_1000582653 | 312 |
| 45 | 3300005364 | Ga0070673_100132910 | Ga0070673_1001329102 | 312 |
| 46 | 3300005367 | Ga0070667_100013595 | Ga0070667_1000135952 | 312 |
| 47 | 3300005434 | Ga0070709_10084055 | Ga0070709_100840553 | 312 |
| 48 | 3300005438 | Ga0070701_10052732 | Ga0070701_100527322 | 312 |
| 49 | 3300005441 | Ga0070700_100022620 | Ga0070700_1000226203 | 312 |
| 50 | 3300005457 | Ga0070662_100003262 | Ga0070662_10000326211 | 312 |
| 51 | 3300005459 | Ga0068867_100004893 | Ga0068867_1000048937 | 312 |
| 52 | 3300005466 | Ga0070685_10056628 | Ga0070685_100566283 | 312 |
| 53 | 3300005543 | Ga0070672_100168707 | Ga0070672_1001687072 | 312 |
| 54 | 3300005548 | Ga0070665_100570285 | Ga0070665_1005702852 | 312 |
| 55 | 3300005577 | Ga0068857_100133405 | Ga0068857_1001334053 | 312 |
| 56 | 3300005615 | Ga0070702_100259425 | Ga0070702_1002594252 | 312 |
| 57 | 3300005617 | Ga0068859_100214803 | Ga0068859_1002148033 | 312 |
| 58 | 3300005618 | Ga0068864_100001959 | Ga0068864_1000019592 | 312 |
| 59 | 3300005618 | Ga0068864_100044371 | Ga0068864_1000443713 | 312 |
| 60 | 3300005618 | Ga0068864_100069289 | Ga0068864_1000692893 | 312 |
| 61 | 3300005718 | Ga0068866_10005854 | Ga0068866_100058542 | 312 |
| 62 | 3300005840 | Ga0068870_10031559 | Ga0068870_100315593 | 312 |
| 63 | 3300005841 | Ga0068863_100082868 | Ga0068863_1000828684 | 312 |
| 64 | 3300005841 | Ga0068863_100133660 | Ga0068863_1001336602 | 312 |
| 65 | 3300005842 | Ga0068858_100029114 | Ga0068858_1000291145 | 312 |
| 66 | 3300005843 | Ga0068860_100039107 | Ga0068860_1000391076 | 312 |
| 67 | 3300006028 | Ga0070717_10259098 | Ga0070717_102590983 | 312 |
| 68 | 3300006358 | Ga0068871_100009333 | Ga0068871_1000093335 | 312 |
| 69 | 3300006881 | Ga0068865_100025566 | Ga0068865_1000255663 | 312 |
| 70 | 3300006931 | Ga0097620_100214795 | Ga0097620_1002147951 | 312 |
| 71 | 3300009176 | Ga0105242_10014088 | Ga0105242_100140887 | 312 |
| 72 | 3300009177 | Ga0105248_10010702 | Ga0105248_100107025 | 312 |
| 73 | 3300013297 | Ga0157378_10009099 | Ga0157378_100090994 | 312 |
| 74 | 3300013308 | Ga0157375_10115633 | Ga0157375_101156332 | 312 |
| 75 | 3300014326 | Ga0157380_10126496 | Ga0157380_101264962 | 312 |
| 76 | 3300014745 | Ga0157377_10030418 | Ga0157377_100304183 | 312 |
| 77 | 3300014968 | Ga0157379_10048460 | Ga0157379_100484602 | 312 |
| 78 | 3300014969 | Ga0157376_10032082 | Ga0157376_100320825 | 312 |
| 79 | 3300025893 | Ga0207682_10003662 | Ga0207682_100036624 | 312 |
| 80 | 3300025899 | Ga0207642_10017417 | Ga0207642_100174172 | 312 |
| 81 | 3300025901 | Ga0207688_10036655 | Ga0207688_100366553 | 312 |
| 82 | 3300025901 | Ga0207688_10086011 | Ga0207688_100860112 | 312 |
| 83 | 3300025907 | Ga0207645_10013116 | Ga0207645_100131163 | 312 |
| 84 | 3300025918 | Ga0207662_10006278 | Ga0207662_100062784 | 312 |
| 85 | 3300025925 | Ga0207650_10053216 | Ga0207650_100532164 | 312 |
| 86 | 3300025926 | Ga0207659_10026817 | Ga0207659_100268173 | 312 |
| 87 | 3300025931 | Ga0207644_10030228 | Ga0207644_100302283 | 312 |
| 88 | 3300025931 | Ga0207644_10060211 | Ga0207644_100602112 | 312 |
| 89 | 3300025933 | Ga0207706_10004918 | Ga0207706_100049184 | 312 |
| 90 | 3300025937 | Ga0207669_10005706 | Ga0207669_100057062 | 312 |
| 91 | 3300025938 | Ga0207704_10075417 | Ga0207704_100754173 | 312 |
| 92 | 3300025940 | Ga0207691_10290176 | Ga0207691_102901761 | 312 |
| 93 | 3300025960 | Ga0207651_10042232 | Ga0207651_100422323 | 312 |
| 94 | 3300026023 | Ga0207677_10140060 | Ga0207677_101400602 | 312 |
| 95 | 3300026035 | Ga0207703_10011058 | Ga0207703_100110586 | 312 |
| 96 | 3300026088 | Ga0207641_10071896 | Ga0207641_100718962 | 312 |
| 97 | 3300026088 | Ga0207641_10138801 | Ga0207641_101388012 | 312 |
| 98 | 3300026089 | Ga0207648_10054752 | Ga0207648_100547523 | 312 |
| 99 | 3300026095 | Ga0207676_10024429 | Ga0207676_100244293 | 312 |
| 100 | 3300026121 | Ga0207683_10009517 | Ga0207683_100095177 | 312 |
| 101 | 3300027378 | Ga0209981_1009139 | Ga0209981_10091392 | 312 |
| 102 | 3300028380 | Ga0268265_10059617 | Ga0268265_100596173 | 312 |
| 103 | 3300028381 | Ga0268264_10024856 | Ga0268264_100248564 | 312 |
| 104 | 3300028381 | Ga0268264_10204319 | Ga0268264_102043192 | 312 |
| 105 | 3300031238 | Ga0265332_10004952 | Ga0265332_100049527 | 312 |
| 106 | 3300031242 | Ga0265329_10006218 | Ga0265329_100062185 | 312 |
| 107 | 3300031250 | Ga0265331_10002953 | Ga0265331_100029533 | 312 |
| 108 | 3300031344 | Ga0265316_10011908 | Ga0265316_100119082 | 312 |
| 109 | 3300031711 | Ga0265314_10000675 | Ga0265314_1000067531 | 312 |
| 110 | 3300045051 | Ga0451576_0261011 | Ga0451576_0261011_225_1199 | 312 |
| 111 | 3300045976 | Ga0466967_0060948 | Ga0466967_0060948_311_1276 | 312 |
| 112 | 3300046528 | Ga0495642_0029869 | Ga0495642_0029869_880_1854 | 312 |
| 113 | 3300046528 | Ga0495642_0059778 | Ga0495642_0059778_216_1163 | 312 |
| 114 | 3300046537 | Ga0495598_0003719 | Ga0495598_0003719_1195_2169 | 312 |
| 115 | 3300046615 | Ga0495656_0012291 | Ga0495656_0012291_423_1391 | 312 |
| 116 | 3300047443 | Ga0495687_041223 | Ga0495687_041223_63_1010 | 312 |
| 117 | 3300048090 | Ga0495615_0005970 | Ga0495615_0005970_1162_2130 | 312 |
| 118 | 3300005328 | Ga0070676_10006626 | Ga0070676_100066263 | 313 |
| 119 | 3300005336 | Ga0070680_100330288 | Ga0070680_1003302882 | 313 |
| 120 | 3300005338 | Ga0068868_100043259 | Ga0068868_1000432592 | 313 |
| 121 | 3300005344 | Ga0070661_100032933 | Ga0070661_1000329333 | 313 |
| 122 | 3300005355 | Ga0070671_100058361 | Ga0070671_1000583612 | 313 |
| 123 | 3300005458 | Ga0070681_10022228 | Ga0070681_100222286 | 313 |
| 124 | 3300005459 | Ga0068867_100007088 | Ga0068867_1000070882 | 313 |
| 125 | 3300005543 | Ga0070672_100038186 | Ga0070672_1000381864 | 313 |
| 126 | 3300005577 | Ga0068857_100098900 | Ga0068857_1000989002 | 313 |
| 127 | 3300005834 | Ga0068851_10051815 | Ga0068851_100518152 | 313 |
| 128 | 3300009177 | Ga0105248_10021738 | Ga0105248_100217388 | 313 |
| 129 | 3300013100 | Ga0157373_10154523 | Ga0157373_101545232 | 313 |
| 130 | 3300025912 | Ga0207707_10041031 | Ga0207707_100410312 | 313 |
| 131 | 3300025917 | Ga0207660_10127395 | Ga0207660_101273952 | 313 |
| 132 | 3300025931 | Ga0207644_10008628 | Ga0207644_100086288 | 313 |
| 133 | 3300025931 | Ga0207644_10015764 | Ga0207644_100157646 | 313 |
| 134 | 3300025941 | Ga0207711_10173222 | Ga0207711_101732221 | 313 |
| 135 | 3300025981 | Ga0207640_10036740 | Ga0207640_100367402 | 313 |
| 136 | 3300026089 | Ga0207648_10007896 | Ga0207648_100078962 | 313 |
| 137 | 3300026116 | Ga0207674_10026116 | Ga0207674_100261165 | 313 |
| 138 | 3300037068 | Ga0373925_0288195 | Ga0373925_0288195_57_1043 | 313 |
| 139 | 3300045051 | Ga0451576_0000958 | Ga0451576_0000958_43810_44778 | 313 |
| 140 | 3300046459 | Ga0495629_0000119 | Ga0495629_0000119_50381_51343 | 313 |
| 141 | 3300046460 | Ga0495638_0002000 | Ga0495638_0002000_4221_5183 | 313 |
| 142 | 3300046461 | Ga0495641_0036929 | Ga0495641_0036929_1180_2142 | 313 |
| 143 | 3300046463 | Ga0495653_0000105 | Ga0495653_0000105_50114_51076 | 313 |
| 144 | 3300046471 | Ga0495650_0008654 | Ga0495650_0008654_505_1467 | 313 |
| 145 | 3300046473 | Ga0495582_0006122 | Ga0495582_0006122_4955_5917 | 313 |
| 146 | 3300046474 | Ga0495605_0004840 | Ga0495605_0004840_22_984 | 313 |
| 147 | 3300046500 | Ga0495596_0013806 | Ga0495596_0013806_134_1096 | 313 |
| 148 | 3300046506 | Ga0495583_0014674 | Ga0495583_0014674_763_1725 | 313 |
| 149 | 3300046514 | Ga0495618_0138351 | Ga0495618_0138351_76_1038 | 313 |
| 150 | 3300046515 | Ga0495620_0025057 | Ga0495620_0025057_1233_2195 | 313 |
| 151 | 3300046516 | Ga0495628_0065838 | Ga0495628_0065838_616_1578 | 313 |
| 152 | 3300046517 | Ga0495630_0006184 | Ga0495630_0006184_3376_4338 | 313 |
| 153 | 3300046524 | Ga0495648_0070644 | Ga0495648_0070644_743_1705 | 313 |
| 154 | 3300046542 | Ga0495597_0049496 | Ga0495597_0049496_444_1406 | 313 |
| 155 | 3300046648 | Ga0495611_0006324 | Ga0495611_0006324_279_1241 | 313 |
| 156 | 3300046689 | Ga0495613_0088270 | Ga0495613_0088270_927_1889 | 313 |
| 157 | 3300046690 | Ga0495624_0008327 | Ga0495624_0008327_4307_5269 | 313 |
| 158 | 3300047321 | Ga0495676_0022853 | Ga0495676_0022853_3564_4526 | 313 |
| 159 | 3300047446 | Ga0495679_000036 | Ga0495679_000036_35628_36590 | 313 |
| 160 | 3300047469 | Ga0495673_0053985 | Ga0495673_0053985_78_1040 | 313 |
| 161 | 3300047472 | Ga0495686_0209793 | Ga0495686_0209793_38_1000 | 313 |
| 162 | 3300047673 | Ga0495593_0006473 | Ga0495593_0006473_1507_2469 | 313 |
| 163 | 3300048088 | Ga0495602_0067890 | Ga0495602_0067890_1354_2316 | 313 |
| 164 | 3300048924 | Ga0496121_0016679 | Ga0496121_0016679_3332_4294 | 313 |
| 165 | 3300005331 | Ga0070670_100277101 | Ga0070670_1002771012 | 314 |
| 166 | 3300005455 | Ga0070663_100122677 | Ga0070663_1001226772 | 314 |
| 167 | 3300005459 | Ga0068867_100245561 | Ga0068867_1002455612 | 314 |
| 168 | 3300005983 | Ga0081540_1000313 | Ga0081540_100031315 | 314 |
| 169 | 3300014745 | Ga0157377_10113807 | Ga0157377_101138071 | 314 |
| 170 | 3300025893 | Ga0207682_10005486 | Ga0207682_100054862 | 314 |
| 171 | 3300025942 | Ga0207689_10000534 | Ga0207689_1000053410 | 314 |
| 172 | 3300028794 | Ga0307515_10045696 | Ga0307515_100456966 | 314 |
| 173 | 3300031456 | Ga0307513_10002039 | Ga0307513_1000203911 | 314 |
| 174 | 3300039450 | Ga0436363_0039369 | Ga0436363_0039369_1064_2035 | 314 |
| 175 | 3300048907 | Ga0496104_0047214 | Ga0496104_0047214_2079_3050 | 314 |
| 176 | 3300005330 | Ga0070690_100041543 | Ga0070690_1000415432 | 315 |
| 177 | 3300005353 | Ga0070669_100163088 | Ga0070669_1001630881 | 315 |
| 178 | 3300005353 | Ga0070669_100278085 | Ga0070669_1002780852 | 315 |
| 179 | 3300005456 | Ga0070678_100077605 | Ga0070678_1000776053 | 315 |
| 180 | 3300005539 | Ga0068853_100144640 | Ga0068853_1001446402 | 315 |
| 181 | 3300005564 | Ga0070664_100046254 | Ga0070664_1000462542 | 315 |
| 182 | 3300005616 | Ga0068852_100007090 | Ga0068852_1000070906 | 315 |
| 183 | 3300005618 | Ga0068864_100024057 | Ga0068864_1000240574 | 315 |
| 184 | 3300005841 | Ga0068863_100559558 | Ga0068863_1005595581 | 315 |
| 185 | 3300005844 | Ga0068862_100240530 | Ga0068862_1002405302 | 315 |
| 186 | 3300006237 | Ga0097621_100385941 | Ga0097621_1003859411 | 315 |
| 187 | 3300009101 | Ga0105247_10021696 | Ga0105247_100216963 | 315 |
| 188 | 3300009551 | Ga0105238_10144516 | Ga0105238_101445162 | 315 |
| 189 | 3300013308 | Ga0157375_10355364 | Ga0157375_103553641 | 315 |
| 190 | 3300014968 | Ga0157379_10350138 | Ga0157379_103501382 | 315 |
| 191 | 3300017792 | Ga0163161_10151608 | Ga0163161_101516082 | 315 |
| 192 | 3300021388 | Ga0213875_10055598 | Ga0213875_100555981 | 315 |
| 193 | 3300025900 | Ga0207710_10012681 | Ga0207710_100126813 | 315 |
| 194 | 3300025904 | Ga0207647_10188483 | Ga0207647_101884831 | 315 |
| 195 | 3300025924 | Ga0207694_10116776 | Ga0207694_101167762 | 315 |
| 196 | 3300025927 | Ga0207687_10055910 | Ga0207687_100559102 | 315 |
| 197 | 3300026075 | Ga0207708_10059652 | Ga0207708_100596522 | 315 |
| 198 | 3300026088 | Ga0207641_10175007 | Ga0207641_101750072 | 315 |
| 199 | 3300026095 | Ga0207676_10008732 | Ga0207676_100087324 | 315 |
| 200 | 3300026116 | Ga0207674_10016690 | Ga0207674_100166903 | 315 |
| 201 | 3300026121 | Ga0207683_10103230 | Ga0207683_101032303 | 315 |
| 202 | 3300026142 | Ga0207698_10163891 | Ga0207698_101638913 | 315 |
| 203 | 3300028380 | Ga0268265_10204180 | Ga0268265_102041802 | 315 |
| 204 | 3300037068 | Ga0373925_0055592 | Ga0373925_0055592_1862_2827 | 315 |
| 205 | 3300048905 | Ga0496102_0568276 | Ga0496102_0568276_25_999 | 315 |
| 206 | 3300053078 | Ga0495612_0075047 | Ga0495612_0075047_144_1112 | 315 |
| 207 | 3300053096 | Ga0500641_0002176 | Ga0500641_0002176_3147_4133 | 315 |
| 208 | 3300005335 | Ga0070666_10230815 | Ga0070666_102308152 | 316 |
| 209 | 3300005435 | Ga0070714_100132569 | Ga0070714_1001325692 | 316 |
| 210 | 3300005436 | Ga0070713_100186705 | Ga0070713_1001867052 | 316 |
| 211 | 3300005437 | Ga0070710_10002378 | Ga0070710_100023786 | 316 |
| 212 | 3300005548 | Ga0070665_100113254 | Ga0070665_1001132543 | 316 |
| 213 | 3300005614 | Ga0068856_100210731 | Ga0068856_1002107312 | 316 |
| 214 | 3300005937 | Ga0081455_10002056 | Ga0081455_1000205615 | 316 |
| 215 | 3300006038 | Ga0075365_10118008 | Ga0075365_101180082 | 316 |
| 216 | 3300006178 | Ga0075367_10036455 | Ga0075367_100364552 | 316 |
| 217 | 3300006844 | Ga0075428_100014820 | Ga0075428_1000148209 | 316 |
| 218 | 3300006880 | Ga0075429_100000003 | Ga0075429_10000000359 | 316 |
| 219 | 3300009098 | Ga0105245_10118338 | Ga0105245_101183382 | 316 |
| 220 | 3300009147 | Ga0114129_10005359 | Ga0114129_100053592 | 316 |
| 221 | 3300009147 | Ga0114129_10183640 | Ga0114129_101836403 | 316 |
| 222 | 3300009148 | Ga0105243_10086073 | Ga0105243_100860733 | 316 |
| 223 | 3300009148 | Ga0105243_10189703 | Ga0105243_101897032 | 316 |
| 224 | 3300011119 | Ga0105246_10083596 | Ga0105246_100835962 | 316 |
| 225 | 3300014326 | Ga0157380_10326050 | Ga0157380_103260501 | 316 |
| 226 | 3300025928 | Ga0207700_10195097 | Ga0207700_101950972 | 316 |
| 227 | 3300025941 | Ga0207711_10099325 | Ga0207711_100993253 | 316 |
| 228 | 3300028573 | Ga0265334_10011495 | Ga0265334_100114953 | 316 |
| 229 | 3300030763 | Ga0265763_1000043 | Ga0265763_10000433 | 316 |
| 230 | 3300035695 | Ga0373927_0006163 | Ga0373927_0006163_154_1131 | 316 |
| 231 | 3300037466 | Ga0395898_0350567 | Ga0395898_0350567_324_1292 | 316 |
| 232 | 3300046472 | Ga0495580_0284869 | Ga0495580_0284869_12_989 | 316 |
| 233 | 3300046475 | Ga0495639_0039657 | Ga0495639_0039657_680_1657 | 316 |
| 234 | 3300048907 | Ga0496104_0275556 | Ga0496104_0275556_196_1173 | 316 |
| 235 | 3300048929 | Ga0496126_0016483 | Ga0496126_0016483_6029_7006 | 316 |
| 236 | 3300050492 | nmdc:mga0yw44_131089_c1 | nmdc:mga0yw44_131089_c1_219_1187 | 316 |
| 237 | 3300050507 | nmdc:mga05p37_77_c1 | nmdc:mga05p37_77_c1_51451_52428 | 316 |
| 238 | 3300050508 | nmdc:mga09592_140_c1 | nmdc:mga09592_140_c1_20083_21060 | 316 |
| 239 | 3300050510 | nmdc:mga06r32_288860_c1 | nmdc:mga06r32_288860_c1_563_1540 | 316 |
| 240 | 3300005328 | Ga0070676_10010777 | Ga0070676_100107775 | 317 |
| 241 | 3300005330 | Ga0070690_100013351 | Ga0070690_1000133512 | 317 |
| 242 | 3300005331 | Ga0070670_100072433 | Ga0070670_1000724333 | 317 |
| 243 | 3300005334 | Ga0068869_100008210 | Ga0068869_1000082102 | 317 |
| 244 | 3300005334 | Ga0068869_100015759 | Ga0068869_1000157595 | 317 |
| 245 | 3300005335 | Ga0070666_10003117 | Ga0070666_100031174 | 317 |
| 246 | 3300005335 | Ga0070666_10006093 | Ga0070666_100060932 | 317 |
| 247 | 3300005338 | Ga0068868_100006024 | Ga0068868_1000060243 | 317 |
| 248 | 3300005338 | Ga0068868_100112766 | Ga0068868_1001127662 | 317 |
| 249 | 3300005340 | Ga0070689_100007815 | Ga0070689_1000078152 | 317 |
| 250 | 3300005340 | Ga0070689_100112561 | Ga0070689_1001125612 | 317 |
| 251 | 3300005353 | Ga0070669_100017967 | Ga0070669_1000179672 | 317 |
| 252 | 3300005353 | Ga0070669_100025112 | Ga0070669_1000251122 | 317 |
| 253 | 3300005354 | Ga0070675_100015033 | Ga0070675_1000150335 | 317 |
| 254 | 3300005354 | Ga0070675_100040486 | Ga0070675_1000404862 | 317 |
| 255 | 3300005355 | Ga0070671_100054877 | Ga0070671_1000548774 | 317 |
| 256 | 3300005356 | Ga0070674_100108214 | Ga0070674_1001082142 | 317 |
| 257 | 3300005364 | Ga0070673_100004285 | Ga0070673_1000042854 | 317 |
| 258 | 3300005364 | Ga0070673_100108608 | Ga0070673_1001086081 | 317 |
| 259 | 3300005367 | Ga0070667_100006668 | Ga0070667_1000066684 | 317 |
| 260 | 3300005367 | Ga0070667_100099996 | Ga0070667_1000999963 | 317 |
| 261 | 3300005456 | Ga0070678_100004327 | Ga0070678_1000043274 | 317 |
| 262 | 3300005459 | Ga0068867_100029241 | Ga0068867_1000292413 | 317 |
| 263 | 3300005539 | Ga0068853_100017860 | Ga0068853_1000178602 | 317 |
| 264 | 3300005543 | Ga0070672_100031023 | Ga0070672_1000310232 | 317 |
| 265 | 3300005543 | Ga0070672_100304933 | Ga0070672_1003049331 | 317 |
| 266 | 3300005548 | Ga0070665_100034048 | Ga0070665_1000340483 | 317 |
| 267 | 3300005617 | Ga0068859_100008717 | Ga0068859_10000871711 | 317 |
| 268 | 3300005618 | Ga0068864_100001297 | Ga0068864_10000129720 | 317 |
| 269 | 3300005718 | Ga0068866_10071157 | Ga0068866_100711572 | 317 |
| 270 | 3300005719 | Ga0068861_100058140 | Ga0068861_1000581403 | 317 |
| 271 | 3300005834 | Ga0068851_10112432 | Ga0068851_101124322 | 317 |
| 272 | 3300005840 | Ga0068870_10152355 | Ga0068870_101523552 | 317 |
| 273 | 3300005841 | Ga0068863_100025750 | Ga0068863_1000257502 | 317 |
| 274 | 3300005841 | Ga0068863_100097888 | Ga0068863_1000978882 | 317 |
| 275 | 3300005842 | Ga0068858_100000729 | Ga0068858_1000007295 | 317 |
| 276 | 3300005842 | Ga0068858_100010459 | Ga0068858_1000104598 | 317 |
| 277 | 3300005843 | Ga0068860_100036517 | Ga0068860_1000365175 | 317 |
| 278 | 3300005844 | Ga0068862_100187360 | Ga0068862_1001873602 | 317 |
| 279 | 3300006358 | Ga0068871_100063765 | Ga0068871_1000637652 | 317 |
| 280 | 3300006881 | Ga0068865_100000968 | Ga0068865_10000096815 | 317 |
| 281 | 3300006931 | Ga0097620_100008717 | Ga0097620_10000871711 | 317 |
| 282 | 3300009177 | Ga0105248_10016915 | Ga0105248_100169153 | 317 |
| 283 | 3300013297 | Ga0157378_10200607 | Ga0157378_102006072 | 317 |
| 284 | 3300013306 | Ga0163162_10006321 | Ga0163162_100063214 | 317 |
| 285 | 3300013306 | Ga0163162_10069143 | Ga0163162_100691432 | 317 |
| 286 | 3300013307 | Ga0157372_10257905 | Ga0157372_102579052 | 317 |
| 287 | 3300013308 | Ga0157375_10061788 | Ga0157375_100617883 | 317 |
| 288 | 3300014325 | Ga0163163_10005612 | Ga0163163_1000561212 | 317 |
| 289 | 3300014326 | Ga0157380_10051443 | Ga0157380_100514433 | 317 |
| 290 | 3300014326 | Ga0157380_10076156 | Ga0157380_100761562 | 317 |
| 291 | 3300014968 | Ga0157379_10027423 | Ga0157379_100274233 | 317 |
| 292 | 3300017792 | Ga0163161_10014345 | Ga0163161_100143453 | 317 |
| 293 | 3300017792 | Ga0163161_10016630 | Ga0163161_100166305 | 317 |
| 294 | 3300025315 | Ga0207697_10005139 | Ga0207697_100051396 | 317 |
| 295 | 3300025903 | Ga0207680_10001451 | Ga0207680_100014517 | 317 |
| 296 | 3300025903 | Ga0207680_10006222 | Ga0207680_100062226 | 317 |
| 297 | 3300025907 | Ga0207645_10000930 | Ga0207645_100009302 | 317 |
| 298 | 3300025921 | Ga0207652_10028914 | Ga0207652_100289143 | 317 |
| 299 | 3300025923 | Ga0207681_10018436 | Ga0207681_100184365 | 317 |
| 300 | 3300025923 | Ga0207681_10085109 | Ga0207681_100851092 | 317 |
| 301 | 3300025925 | Ga0207650_10019766 | Ga0207650_100197665 | 317 |
| 302 | 3300025926 | Ga0207659_10002463 | Ga0207659_100024635 | 317 |
| 303 | 3300025926 | Ga0207659_10025053 | Ga0207659_100250535 | 317 |
| 304 | 3300025931 | Ga0207644_10000899 | Ga0207644_1000089916 | 317 |
| 305 | 3300025931 | Ga0207644_10029367 | Ga0207644_100293671 | 317 |
| 306 | 3300025933 | Ga0207706_10197542 | Ga0207706_101975421 | 317 |
| 307 | 3300025936 | Ga0207670_10007087 | Ga0207670_100070876 | 317 |
| 308 | 3300025937 | Ga0207669_10094153 | Ga0207669_100941532 | 317 |
| 309 | 3300025937 | Ga0207669_10145510 | Ga0207669_101455102 | 317 |
| 310 | 3300025938 | Ga0207704_10011475 | Ga0207704_100114753 | 317 |
| 311 | 3300025938 | Ga0207704_10274919 | Ga0207704_102749192 | 317 |
| 312 | 3300025940 | Ga0207691_10000427 | Ga0207691_1000042719 | 317 |
| 313 | 3300025940 | Ga0207691_10012281 | Ga0207691_100122818 | 317 |
| 314 | 3300025941 | Ga0207711_10062825 | Ga0207711_100628252 | 317 |
| 315 | 3300025941 | Ga0207711_10336826 | Ga0207711_103368262 | 317 |
| 316 | 3300025942 | Ga0207689_10014374 | Ga0207689_100143746 | 317 |
| 317 | 3300025942 | Ga0207689_10022098 | Ga0207689_100220985 | 317 |
| 318 | 3300025960 | Ga0207651_10000426 | Ga0207651_100004265 | 317 |
| 319 | 3300025961 | Ga0207712_10113305 | Ga0207712_101133052 | 317 |
| 320 | 3300025972 | Ga0207668_10023509 | Ga0207668_100235092 | 317 |
| 321 | 3300025986 | Ga0207658_10014038 | Ga0207658_100140384 | 317 |
| 322 | 3300025986 | Ga0207658_10016118 | Ga0207658_100161184 | 317 |
| 323 | 3300026023 | Ga0207677_10001186 | Ga0207677_100011866 | 317 |
| 324 | 3300026023 | Ga0207677_10090607 | Ga0207677_100906072 | 317 |
| 325 | 3300026035 | Ga0207703_10006732 | Ga0207703_100067325 | 317 |
| 326 | 3300026035 | Ga0207703_10028143 | Ga0207703_100281432 | 317 |
| 327 | 3300026088 | Ga0207641_10005867 | Ga0207641_100058679 | 317 |
| 328 | 3300026088 | Ga0207641_10044089 | Ga0207641_100440893 | 317 |
| 329 | 3300026089 | Ga0207648_10015197 | Ga0207648_100151974 | 317 |
| 330 | 3300026095 | Ga0207676_10000572 | Ga0207676_100005729 | 317 |
| 331 | 3300026095 | Ga0207676_10029091 | Ga0207676_100290915 | 317 |
| 332 | 3300026118 | Ga0207675_100095977 | Ga0207675_1000959771 | 317 |
| 333 | 3300026118 | Ga0207675_100142898 | Ga0207675_1001428982 | 317 |
| 334 | 3300026121 | Ga0207683_10000255 | Ga0207683_1000025528 | 317 |
| 335 | 3300026121 | Ga0207683_10009854 | Ga0207683_100098546 | 317 |
| 336 | 3300026142 | Ga0207698_10040085 | Ga0207698_100400852 | 317 |
| 337 | 3300027360 | Ga0209969_1004367 | Ga0209969_10043672 | 317 |
| 338 | 3300027462 | Ga0210000_1000587 | Ga0210000_10005873 | 317 |
| 339 | 3300027471 | Ga0209995_1002182 | Ga0209995_10021822 | 317 |
| 340 | 3300027543 | Ga0209999_1003367 | Ga0209999_10033673 | 317 |
| 341 | 3300027614 | Ga0209970_1014656 | Ga0209970_10146562 | 317 |
| 342 | 3300027665 | Ga0209983_1015547 | Ga0209983_10155471 | 317 |
| 343 | 3300027682 | Ga0209971_1008724 | Ga0209971_10087242 | 317 |
| 344 | 3300027876 | Ga0209974_10005410 | Ga0209974_100054104 | 317 |
| 345 | 3300028379 | Ga0268266_10030810 | Ga0268266_100308103 | 317 |
| 346 | 3300028380 | Ga0268265_10184664 | Ga0268265_101846642 | 317 |
| 347 | 3300028381 | Ga0268264_10004892 | Ga0268264_1000489210 | 317 |
| 348 | 3300037471 | Ga0395905_0119984 | Ga0395905_0119984_1218_2195 | 317 |
| 349 | 3300042461 | Ga0439460_0014745 | Ga0439460_0014745_578_1558 | 317 |
| 350 | 3300046454 | Ga0495592_0000091 | Ga0495592_0000091_16197_17189 | 317 |
| 351 | 3300046472 | Ga0495580_0037962 | Ga0495580_0037962_216_1193 | 317 |
| 352 | 3300047318 | Ga0495636_0081213 | Ga0495636_0081213_218_1189 | 317 |
| 353 | 3300047445 | Ga0495677_0030820 | Ga0495677_0030820_230_1201 | 317 |
| 354 | 3300048903 | Ga0496100_0340207 | Ga0496100_0340207_104_1072 | 317 |
| 355 | 3300048909 | Ga0496106_0093215 | Ga0496106_0093215_1185_2153 | 317 |
| 356 | 3300048911 | Ga0496108_0122521 | Ga0496108_0122521_201_1175 | 317 |
| 357 | 3300048915 | Ga0496112_0142010 | Ga0496112_0142010_687_1661 | 317 |
| 358 | 3300048916 | Ga0496113_0052135 | Ga0496113_0052135_2026_3000 | 317 |
| 359 | 3300005327 | Ga0070658_10069095 | Ga0070658_100690952 | 318 |
| 360 | 3300005328 | Ga0070676_10219195 | Ga0070676_102191952 | 318 |
| 361 | 3300005333 | Ga0070677_10039117 | Ga0070677_100391172 | 318 |
| 362 | 3300005340 | Ga0070689_100034823 | Ga0070689_1000348234 | 318 |
| 363 | 3300005344 | Ga0070661_100114099 | Ga0070661_1001140992 | 318 |
| 364 | 3300005347 | Ga0070668_100089486 | Ga0070668_1000894863 | 318 |
| 365 | 3300005355 | Ga0070671_100185377 | Ga0070671_1001853772 | 318 |
| 366 | 3300005364 | Ga0070673_100108377 | Ga0070673_1001083772 | 318 |
| 367 | 3300005456 | Ga0070678_100144515 | Ga0070678_1001445152 | 318 |
| 368 | 3300005456 | Ga0070678_100184737 | Ga0070678_1001847372 | 318 |
| 369 | 3300005457 | Ga0070662_100199012 | Ga0070662_1001990122 | 318 |
| 370 | 3300006195 | Ga0075366_10000957 | Ga0075366_100009575 | 318 |
| 371 | 3300006846 | Ga0075430_100044473 | Ga0075430_1000444733 | 318 |
| 372 | 3300006871 | Ga0075434_100066222 | Ga0075434_1000662222 | 318 |
| 373 | 3300025893 | Ga0207682_10042845 | Ga0207682_100428452 | 318 |
| 374 | 3300025907 | Ga0207645_10147256 | Ga0207645_101472562 | 318 |
| 375 | 3300025931 | Ga0207644_10006192 | Ga0207644_100061922 | 318 |
| 376 | 3300026121 | Ga0207683_10183269 | Ga0207683_101832692 | 318 |
| 377 | 3300044673 | Ga0453683_0002604 | Ga0453683_0002604_2130_3110 | 318 |
| 378 | 3300045051 | Ga0451576_0021618 | Ga0451576_0021618_1084_2064 | 318 |
| 379 | 3300050493 | nmdc:mga0k408_185355_c1 | nmdc:mga0k408_185355_c1_151_1128 | 318 |
| 380 | 3300050493 | nmdc:mga0k408_2166_c1 | nmdc:mga0k408_2166_c1_8301_9302 | 318 |
| 381 | 3300005327 | Ga0070658_10178290 | Ga0070658_101782902 | 319 |
| 382 | 3300005347 | Ga0070668_100017926 | Ga0070668_1000179263 | 319 |
| 383 | 3300005353 | Ga0070669_100082373 | Ga0070669_1000823732 | 319 |
| 384 | 3300005354 | Ga0070675_100008358 | Ga0070675_1000083582 | 319 |
| 385 | 3300005355 | Ga0070671_100024596 | Ga0070671_1000245963 | 319 |
| 386 | 3300005367 | Ga0070667_100002963 | Ga0070667_1000029637 | 319 |
| 387 | 3300005543 | Ga0070672_100002999 | Ga0070672_10000299911 | 319 |
| 388 | 3300005548 | Ga0070665_100080552 | Ga0070665_1000805525 | 319 |
| 389 | 3300006237 | Ga0097621_100027028 | Ga0097621_1000270285 | 319 |
| 390 | 3300006358 | Ga0068871_100016446 | Ga0068871_1000164467 | 319 |
| 391 | 3300009094 | Ga0111539_10696005 | Ga0111539_106960051 | 319 |
| 392 | 3300009177 | Ga0105248_10007025 | Ga0105248_1000702514 | 319 |
| 393 | 3300009545 | Ga0105237_10093770 | Ga0105237_100937703 | 319 |
| 394 | 3300013296 | Ga0157374_10074601 | Ga0157374_100746013 | 319 |
| 395 | 3300013297 | Ga0157378_10005031 | Ga0157378_100050315 | 319 |
| 396 | 3300013297 | Ga0157378_10156425 | Ga0157378_101564252 | 319 |
| 397 | 3300013306 | Ga0163162_10019386 | Ga0163162_100193866 | 319 |
| 398 | 3300013308 | Ga0157375_10046064 | Ga0157375_100460644 | 319 |
| 399 | 3300014968 | Ga0157379_10027063 | Ga0157379_100270632 | 319 |
| 400 | 3300014969 | Ga0157376_10042780 | Ga0157376_100427803 | 319 |
| 401 | 3300025321 | Ga0207656_10041790 | Ga0207656_100417901 | 319 |
| 402 | 3300025923 | Ga0207681_10064768 | Ga0207681_100647682 | 319 |
| 403 | 3300025925 | Ga0207650_10003438 | Ga0207650_100034387 | 319 |
| 404 | 3300025926 | Ga0207659_10013645 | Ga0207659_100136456 | 319 |
| 405 | 3300025931 | Ga0207644_10108880 | Ga0207644_101088801 | 319 |
| 406 | 3300025940 | Ga0207691_10002230 | Ga0207691_100022303 | 319 |
| 407 | 3300025940 | Ga0207691_10098557 | Ga0207691_100985572 | 319 |
| 408 | 3300025972 | Ga0207668_10034913 | Ga0207668_100349131 | 319 |
| 409 | 3300025986 | Ga0207658_10042566 | Ga0207658_100425662 | 319 |
| 410 | 3300026095 | Ga0207676_10348655 | Ga0207676_103486552 | 319 |
| 411 | 3300026142 | Ga0207698_10096091 | Ga0207698_100960912 | 319 |
| 412 | 3300026142 | Ga0207698_10156733 | Ga0207698_101567332 | 319 |
| 413 | 3300028786 | Ga0307517_10029255 | Ga0307517_100292558 | 319 |
| 414 | 3300031456 | Ga0307513_10091844 | Ga0307513_100918441 | 319 |
| 415 | 3300031507 | Ga0307509_10003320 | Ga0307509_100033203 | 319 |
| 416 | 3300031507 | Ga0307509_10015069 | Ga0307509_100150692 | 319 |
| 417 | 3300031507 | Ga0307509_10049191 | Ga0307509_100491912 | 319 |
| 418 | 3300031616 | Ga0307508_10013319 | Ga0307508_100133198 | 319 |
| 419 | 3300031616 | Ga0307508_10035587 | Ga0307508_100355875 | 319 |
| 420 | 3300031616 | Ga0307508_10088128 | Ga0307508_100881282 | 319 |
| 421 | 3300033179 | Ga0307507_10038308 | Ga0307507_100383083 | 319 |
| 422 | 3300033180 | Ga0307510_10004077 | Ga0307510_1000407712 | 319 |
| 423 | 3300035691 | Ga0373931_0116909 | Ga0373931_0116909_255_1226 | 319 |
| 424 | 3300036401 | Ga0373937_0272260 | Ga0373937_0272260_327_1310 | 319 |
| 425 | 3300046519 | Ga0495632_0027203 | Ga0495632_0027203_55_1053 | 319 |
| 426 | 3300046524 | Ga0495648_0062567 | Ga0495648_0062567_1114_2091 | 319 |
| 427 | 3300046543 | Ga0495645_0084567 | Ga0495645_0084567_421_1404 | 319 |
| 428 | 3300046683 | Ga0495658_0020138 | Ga0495658_0020138_1072_2055 | 319 |
| 429 | 3300046689 | Ga0495613_0110946 | Ga0495613_0110946_246_1229 | 319 |
| 430 | 3300047319 | Ga0495674_0140882 | Ga0495674_0140882_233_1216 | 319 |
| 431 | 3300047469 | Ga0495673_0068673 | Ga0495673_0068673_58_1056 | 319 |
| 432 | 3300048903 | Ga0496100_0193290 | Ga0496100_0193290_432_1424 | 319 |
| 433 | 3300048911 | Ga0496108_0055598 | Ga0496108_0055598_1141_2124 | 319 |
| 434 | 3300048912 | Ga0496109_0097929 | Ga0496109_0097929_784_1776 | 319 |
| 435 | 3300053077 | Ga0495601_0060369 | Ga0495601_0060369_1161_2144 | 319 |
| 436 | 3300053085 | Ga0495619_0164616 | Ga0495619_0164616_321_1304 | 319 |
| 437 | 3300005329 | Ga0070683_100039556 | Ga0070683_1000395564 | 320 |
| 438 | 3300005331 | Ga0070670_100051505 | Ga0070670_1000515054 | 320 |
| 439 | 3300005334 | Ga0068869_100002941 | Ga0068869_10000294111 | 320 |
| 440 | 3300005335 | Ga0070666_10002937 | Ga0070666_100029377 | 320 |
| 441 | 3300005338 | Ga0068868_100255747 | Ga0068868_1002557472 | 320 |
| 442 | 3300005344 | Ga0070661_100004458 | Ga0070661_1000044587 | 320 |
| 443 | 3300005347 | Ga0070668_100006563 | Ga0070668_1000065638 | 320 |
| 444 | 3300005353 | Ga0070669_100000703 | Ga0070669_1000007036 | 320 |
| 445 | 3300005355 | Ga0070671_100002779 | Ga0070671_10000277916 | 320 |
| 446 | 3300005356 | Ga0070674_100001675 | Ga0070674_1000016756 | 320 |
| 447 | 3300005366 | Ga0070659_100192578 | Ga0070659_1001925782 | 320 |
| 448 | 3300005367 | Ga0070667_100003662 | Ga0070667_1000036628 | 320 |
| 449 | 3300005367 | Ga0070667_100007802 | Ga0070667_1000078029 | 320 |
| 450 | 3300005441 | Ga0070700_100131993 | Ga0070700_1001319932 | 320 |
| 451 | 3300005457 | Ga0070662_100019182 | Ga0070662_1000191825 | 320 |
| 452 | 3300005459 | Ga0068867_100002428 | Ga0068867_10000242810 | 320 |
| 453 | 3300005543 | Ga0070672_100015202 | Ga0070672_1000152026 | 320 |
| 454 | 3300005543 | Ga0070672_100046661 | Ga0070672_1000466613 | 320 |
| 455 | 3300005543 | Ga0070672_100090681 | Ga0070672_1000906812 | 320 |
| 456 | 3300005547 | Ga0070693_100027970 | Ga0070693_1000279703 | 320 |
| 457 | 3300005548 | Ga0070665_100073195 | Ga0070665_1000731953 | 320 |
| 458 | 3300005614 | Ga0068856_100034204 | Ga0068856_1000342044 | 320 |
| 459 | 3300005616 | Ga0068852_100072473 | Ga0068852_1000724732 | 320 |
| 460 | 3300005617 | Ga0068859_100097646 | Ga0068859_1000976464 | 320 |
| 461 | 3300005617 | Ga0068859_100105275 | Ga0068859_1001052753 | 320 |
| 462 | 3300005618 | Ga0068864_100057582 | Ga0068864_1000575823 | 320 |
| 463 | 3300005718 | Ga0068866_10011312 | Ga0068866_100113122 | 320 |
| 464 | 3300005719 | Ga0068861_100003125 | Ga0068861_1000031252 | 320 |
| 465 | 3300005719 | Ga0068861_100026691 | Ga0068861_1000266912 | 320 |
| 466 | 3300005834 | Ga0068851_10005190 | Ga0068851_100051907 | 320 |
| 467 | 3300005834 | Ga0068851_10038242 | Ga0068851_100382422 | 320 |
| 468 | 3300005841 | Ga0068863_100002914 | Ga0068863_10000291417 | 320 |
| 469 | 3300005841 | Ga0068863_100011402 | Ga0068863_1000114024 | 320 |
| 470 | 3300005841 | Ga0068863_100023298 | Ga0068863_1000232984 | 320 |
| 471 | 3300005842 | Ga0068858_100003258 | Ga0068858_1000032587 | 320 |
| 472 | 3300005842 | Ga0068858_100007127 | Ga0068858_1000071276 | 320 |
| 473 | 3300005842 | Ga0068858_100134991 | Ga0068858_1001349912 | 320 |
| 474 | 3300005843 | Ga0068860_100004309 | Ga0068860_10000430912 | 320 |
| 475 | 3300005843 | Ga0068860_100020088 | Ga0068860_1000200882 | 320 |
| 476 | 3300006358 | Ga0068871_100177611 | Ga0068871_1001776112 | 320 |
| 477 | 3300006847 | Ga0075431_100015583 | Ga0075431_1000155832 | 320 |
| 478 | 3300006931 | Ga0097620_100097646 | Ga0097620_1000976464 | 320 |
| 479 | 3300006931 | Ga0097620_100105274 | Ga0097620_1001052742 | 320 |
| 480 | 3300009098 | Ga0105245_10017282 | Ga0105245_100172827 | 320 |
| 481 | 3300009148 | Ga0105243_10020478 | Ga0105243_100204786 | 320 |
| 482 | 3300009545 | Ga0105237_10040115 | Ga0105237_100401154 | 320 |
| 483 | 3300009551 | Ga0105238_10071557 | Ga0105238_100715573 | 320 |
| 484 | 3300010375 | Ga0105239_10420440 | Ga0105239_104204402 | 320 |
| 485 | 3300013296 | Ga0157374_10015544 | Ga0157374_100155448 | 320 |
| 486 | 3300013306 | Ga0163162_10012725 | Ga0163162_100127257 | 320 |
| 487 | 3300013306 | Ga0163162_10040663 | Ga0163162_100406632 | 320 |
| 488 | 3300013306 | Ga0163162_10438558 | Ga0163162_104385582 | 320 |
| 489 | 3300013307 | Ga0157372_10257305 | Ga0157372_102573052 | 320 |
| 490 | 3300013308 | Ga0157375_10011280 | Ga0157375_100112805 | 320 |
| 491 | 3300013308 | Ga0157375_10070170 | Ga0157375_100701703 | 320 |
| 492 | 3300014968 | Ga0157379_10004210 | Ga0157379_100042102 | 320 |
| 493 | 3300014968 | Ga0157379_10012185 | Ga0157379_100121858 | 320 |
| 494 | 3300014968 | Ga0157379_10063062 | Ga0157379_100630622 | 320 |
| 495 | 3300025321 | Ga0207656_10026749 | Ga0207656_100267492 | 320 |
| 496 | 3300025907 | Ga0207645_10015439 | Ga0207645_100154393 | 320 |
| 497 | 3300025914 | Ga0207671_10241857 | Ga0207671_102418572 | 320 |
| 498 | 3300025919 | Ga0207657_10076083 | Ga0207657_100760832 | 320 |
| 499 | 3300025921 | Ga0207652_10208730 | Ga0207652_102087302 | 320 |
| 500 | 3300025923 | Ga0207681_10016331 | Ga0207681_100163314 | 320 |
| 501 | 3300025925 | Ga0207650_10235668 | Ga0207650_102356681 | 320 |
| 502 | 3300025927 | Ga0207687_10059337 | Ga0207687_100593373 | 320 |
| 503 | 3300025927 | Ga0207687_10121380 | Ga0207687_101213802 | 320 |
| 504 | 3300025937 | Ga0207669_10002834 | Ga0207669_100028342 | 320 |
| 505 | 3300025938 | Ga0207704_10018556 | Ga0207704_100185564 | 320 |
| 506 | 3300025940 | Ga0207691_10023136 | Ga0207691_100231363 | 320 |
| 507 | 3300025940 | Ga0207691_10143168 | Ga0207691_101431682 | 320 |
| 508 | 3300025942 | Ga0207689_10020977 | Ga0207689_100209773 | 320 |
| 509 | 3300025944 | Ga0207661_10042690 | Ga0207661_100426904 | 320 |
| 510 | 3300025960 | Ga0207651_10109840 | Ga0207651_101098402 | 320 |
| 511 | 3300025972 | Ga0207668_10006200 | Ga0207668_100062002 | 320 |
| 512 | 3300025981 | Ga0207640_10127115 | Ga0207640_101271152 | 320 |
| 513 | 3300025986 | Ga0207658_10054412 | Ga0207658_100544122 | 320 |
| 514 | 3300026035 | Ga0207703_10008279 | Ga0207703_100082796 | 320 |
| 515 | 3300026035 | Ga0207703_10024049 | Ga0207703_100240495 | 320 |
| 516 | 3300026041 | Ga0207639_10070474 | Ga0207639_100704744 | 320 |
| 517 | 3300026041 | Ga0207639_10075376 | Ga0207639_100753763 | 320 |
| 518 | 3300026067 | Ga0207678_10077448 | Ga0207678_100774484 | 320 |
| 519 | 3300026078 | Ga0207702_10024915 | Ga0207702_100249155 | 320 |
| 520 | 3300026088 | Ga0207641_10007082 | Ga0207641_100070824 | 320 |
| 521 | 3300026088 | Ga0207641_10012653 | Ga0207641_100126535 | 320 |
| 522 | 3300026095 | Ga0207676_10053510 | Ga0207676_100535102 | 320 |
| 523 | 3300026095 | Ga0207676_10060766 | Ga0207676_100607661 | 320 |
| 524 | 3300026095 | Ga0207676_10230755 | Ga0207676_102307552 | 320 |
| 525 | 3300026116 | Ga0207674_10055498 | Ga0207674_100554981 | 320 |
| 526 | 3300026118 | Ga0207675_100000977 | Ga0207675_10000097714 | 320 |
| 527 | 3300026121 | Ga0207683_10247104 | Ga0207683_102471041 | 320 |
| 528 | 3300028379 | Ga0268266_10220163 | Ga0268266_102201632 | 320 |
| 529 | 3300028381 | Ga0268264_10003403 | Ga0268264_1000340313 | 320 |
| 530 | 3300028381 | Ga0268264_10023821 | Ga0268264_100238213 | 320 |
| 531 | 3300028794 | Ga0307515_10027818 | Ga0307515_100278183 | 320 |
| 532 | 3300031507 | Ga0307509_10323607 | Ga0307509_103236072 | 320 |
| 533 | 3300032002 | Ga0307416_100003082 | Ga0307416_1000030826 | 320 |
| 534 | 3300032004 | Ga0307414_10105381 | Ga0307414_101053812 | 320 |
| 535 | 3300032126 | Ga0307415_100006914 | Ga0307415_1000069143 | 320 |
| 536 | 3300035112 | Ga0373932_0008285 | Ga0373932_0008285_707_1708 | 320 |
| 537 | 3300035691 | Ga0373931_0011481 | Ga0373931_0011481_1297_2298 | 320 |
| 538 | 3300039450 | Ga0436363_1432274 | Ga0436363_1432274_392_1381 | 320 |
| 539 | 3300046473 | Ga0495582_0194811 | Ga0495582_0194811_35_1048 | 320 |
| 540 | 3300046616 | Ga0495668_0025062 | Ga0495668_0025062_160_1176 | 320 |
| 541 | 3300047444 | Ga0495675_0192687 | Ga0495675_0192687_92_1105 | 320 |
| 542 | 3300047673 | Ga0495593_0042344 | Ga0495593_0042344_231_1232 | 320 |
| 543 | 3300050509 | nmdc:mga0qj67_1823_c1 | nmdc:mga0qj67_1823_c1_2901_3917 | 320 |
| 544 | 3300050510 | nmdc:mga06r32_4881_c1 | nmdc:mga06r32_4881_c1_9386_10402 | 320 |
| 545 | 3300050512 | nmdc:mga0n895_344162_c1 | nmdc:mga0n895_344162_c1_236_1228 | 320 |
| 546 | 3300005327 | Ga0070658_10038972 | Ga0070658_100389723 | 321 |
| 547 | 3300005328 | Ga0070676_10021963 | Ga0070676_100219633 | 321 |
| 548 | 3300005329 | Ga0070683_100007182 | Ga0070683_10000718210 | 321 |
| 549 | 3300005329 | Ga0070683_100030885 | Ga0070683_1000308853 | 321 |
| 550 | 3300005331 | Ga0070670_100013351 | Ga0070670_1000133515 | 321 |
| 551 | 3300005336 | Ga0070680_100194013 | Ga0070680_1001940132 | 321 |
| 552 | 3300005337 | Ga0070682_100024784 | Ga0070682_1000247842 | 321 |
| 553 | 3300005339 | Ga0070660_100015941 | Ga0070660_1000159414 | 321 |
| 554 | 3300005340 | Ga0070689_100264698 | Ga0070689_1002646981 | 321 |
| 555 | 3300005344 | Ga0070661_100001163 | Ga0070661_1000011636 | 321 |
| 556 | 3300005344 | Ga0070661_100002517 | Ga0070661_1000025178 | 321 |
| 557 | 3300005344 | Ga0070661_100020742 | Ga0070661_1000207422 | 321 |
| 558 | 3300005344 | Ga0070661_100050297 | Ga0070661_1000502972 | 321 |
| 559 | 3300005353 | Ga0070669_100010671 | Ga0070669_1000106716 | 321 |
| 560 | 3300005354 | Ga0070675_100019752 | Ga0070675_1000197522 | 321 |
| 561 | 3300005354 | Ga0070675_100057458 | Ga0070675_1000574583 | 321 |
| 562 | 3300005355 | Ga0070671_100002148 | Ga0070671_1000021488 | 321 |
| 563 | 3300005355 | Ga0070671_100004213 | Ga0070671_1000042136 | 321 |
| 564 | 3300005355 | Ga0070671_100054814 | Ga0070671_1000548143 | 321 |
| 565 | 3300005356 | Ga0070674_100009858 | Ga0070674_1000098583 | 321 |
| 566 | 3300005364 | Ga0070673_100007461 | Ga0070673_1000074619 | 321 |
| 567 | 3300005364 | Ga0070673_100410746 | Ga0070673_1004107462 | 321 |
| 568 | 3300005366 | Ga0070659_100030369 | Ga0070659_1000303692 | 321 |
| 569 | 3300005434 | Ga0070709_10035113 | Ga0070709_100351133 | 321 |
| 570 | 3300005434 | Ga0070709_10068902 | Ga0070709_100689022 | 321 |
| 571 | 3300005434 | Ga0070709_10076840 | Ga0070709_100768402 | 321 |
| 572 | 3300005435 | Ga0070714_100014948 | Ga0070714_1000149486 | 321 |
| 573 | 3300005435 | Ga0070714_100033506 | Ga0070714_1000335063 | 321 |
| 574 | 3300005455 | Ga0070663_100002838 | Ga0070663_1000028384 | 321 |
| 575 | 3300005455 | Ga0070663_100010680 | Ga0070663_1000106803 | 321 |
| 576 | 3300005456 | Ga0070678_100014019 | Ga0070678_1000140194 | 321 |
| 577 | 3300005457 | Ga0070662_100000827 | Ga0070662_10000082716 | 321 |
| 578 | 3300005457 | Ga0070662_100012595 | Ga0070662_1000125955 | 321 |
| 579 | 3300005458 | Ga0070681_10006174 | Ga0070681_100061748 | 321 |
| 580 | 3300005458 | Ga0070681_10008534 | Ga0070681_100085343 | 321 |
| 581 | 3300005459 | Ga0068867_100001658 | Ga0068867_10000165813 | 321 |
| 582 | 3300005459 | Ga0068867_100214604 | Ga0068867_1002146042 | 321 |
| 583 | 3300005518 | Ga0070699_100017505 | Ga0070699_1000175052 | 321 |
| 584 | 3300005530 | Ga0070679_100003587 | Ga0070679_1000035873 | 321 |
| 585 | 3300005530 | Ga0070679_100188447 | Ga0070679_1001884473 | 321 |
| 586 | 3300005530 | Ga0070679_100204541 | Ga0070679_1002045412 | 321 |
| 587 | 3300005535 | Ga0070684_100074081 | Ga0070684_1000740812 | 321 |
| 588 | 3300005535 | Ga0070684_100116544 | Ga0070684_1001165443 | 321 |
| 589 | 3300005539 | Ga0068853_100281595 | Ga0068853_1002815952 | 321 |
| 590 | 3300005543 | Ga0070672_100001237 | Ga0070672_10000123711 | 321 |
| 591 | 3300005563 | Ga0068855_100004781 | Ga0068855_10000478114 | 321 |
| 592 | 3300005563 | Ga0068855_100048925 | Ga0068855_1000489254 | 321 |
| 593 | 3300005563 | Ga0068855_100062803 | Ga0068855_1000628033 | 321 |
| 594 | 3300005563 | Ga0068855_100075008 | Ga0068855_1000750083 | 321 |
| 595 | 3300005563 | Ga0068855_100158356 | Ga0068855_1001583562 | 321 |
| 596 | 3300005564 | Ga0070664_100000152 | Ga0070664_1000001523 | 321 |
| 597 | 3300005564 | Ga0070664_100006501 | Ga0070664_1000065014 | 321 |
| 598 | 3300005564 | Ga0070664_100057608 | Ga0070664_1000576084 | 321 |
| 599 | 3300005564 | Ga0070664_100129450 | Ga0070664_1001294502 | 321 |
| 600 | 3300005577 | Ga0068857_100034689 | Ga0068857_1000346894 | 321 |
| 601 | 3300005577 | Ga0068857_100114033 | Ga0068857_1001140332 | 321 |
| 602 | 3300005577 | Ga0068857_100444974 | Ga0068857_1004449742 | 321 |
| 603 | 3300005578 | Ga0068854_100013085 | Ga0068854_1000130853 | 321 |
| 604 | 3300005614 | Ga0068856_100000093 | Ga0068856_10000009376 | 321 |
| 605 | 3300005614 | Ga0068856_100018144 | Ga0068856_1000181442 | 321 |
| 606 | 3300005614 | Ga0068856_100039961 | Ga0068856_1000399615 | 321 |
| 607 | 3300005614 | Ga0068856_100043551 | Ga0068856_1000435513 | 321 |
| 608 | 3300005616 | Ga0068852_100002316 | Ga0068852_1000023164 | 321 |
| 609 | 3300005616 | Ga0068852_100018088 | Ga0068852_1000180884 | 321 |
| 610 | 3300005616 | Ga0068852_100377612 | Ga0068852_1003776122 | 321 |
| 611 | 3300005618 | Ga0068864_100020907 | Ga0068864_1000209073 | 321 |
| 612 | 3300005719 | Ga0068861_100148460 | Ga0068861_1001484602 | 321 |
| 613 | 3300005834 | Ga0068851_10002770 | Ga0068851_100027705 | 321 |
| 614 | 3300005842 | Ga0068858_100056819 | Ga0068858_1000568193 | 321 |
| 615 | 3300009093 | Ga0105240_10002702 | Ga0105240_1000270211 | 321 |
| 616 | 3300009093 | Ga0105240_10006429 | Ga0105240_1000642915 | 321 |
| 617 | 3300009174 | Ga0105241_10001154 | Ga0105241_1000115415 | 321 |
| 618 | 3300009174 | Ga0105241_10059857 | Ga0105241_100598572 | 321 |
| 619 | 3300009174 | Ga0105241_10402513 | Ga0105241_104025131 | 321 |
| 620 | 3300009545 | Ga0105237_10099157 | Ga0105237_100991573 | 321 |
| 621 | 3300009545 | Ga0105237_10198199 | Ga0105237_101981992 | 321 |
| 622 | 3300009551 | Ga0105238_10003012 | Ga0105238_1000301215 | 321 |
| 623 | 3300009551 | Ga0105238_10049052 | Ga0105238_100490522 | 321 |
| 624 | 3300010375 | Ga0105239_10357501 | Ga0105239_103575012 | 321 |
| 625 | 3300013100 | Ga0157373_10005664 | Ga0157373_100056647 | 321 |
| 626 | 3300013100 | Ga0157373_10020608 | Ga0157373_100206083 | 321 |
| 627 | 3300013100 | Ga0157373_10030761 | Ga0157373_100307613 | 321 |
| 628 | 3300013102 | Ga0157371_10000696 | Ga0157371_1000069635 | 321 |
| 629 | 3300013104 | Ga0157370_10004239 | Ga0157370_1000423915 | 321 |
| 630 | 3300013104 | Ga0157370_10007103 | Ga0157370_100071033 | 321 |
| 631 | 3300013104 | Ga0157370_10034563 | Ga0157370_100345635 | 321 |
| 632 | 3300013104 | Ga0157370_10036749 | Ga0157370_100367494 | 321 |
| 633 | 3300013104 | Ga0157370_10242582 | Ga0157370_102425822 | 321 |
| 634 | 3300013105 | Ga0157369_10033319 | Ga0157369_100333194 | 321 |
| 635 | 3300013105 | Ga0157369_10079192 | Ga0157369_100791924 | 321 |
| 636 | 3300013105 | Ga0157369_10105602 | Ga0157369_101056023 | 321 |
| 637 | 3300013105 | Ga0157369_10240825 | Ga0157369_102408251 | 321 |
| 638 | 3300013306 | Ga0163162_10236441 | Ga0163162_102364412 | 321 |
| 639 | 3300013307 | Ga0157372_10006652 | Ga0157372_100066529 | 321 |
| 640 | 3300013307 | Ga0157372_10017050 | Ga0157372_100170506 | 321 |
| 641 | 3300013307 | Ga0157372_10020731 | Ga0157372_100207315 | 321 |
| 642 | 3300013307 | Ga0157372_10039214 | Ga0157372_100392145 | 321 |
| 643 | 3300014326 | Ga0157380_10444018 | Ga0157380_104440182 | 321 |
| 644 | 3300017792 | Ga0163161_10219535 | Ga0163161_102195352 | 321 |
| 645 | 3300025321 | Ga0207656_10034710 | Ga0207656_100347103 | 321 |
| 646 | 3300025893 | Ga0207682_10003194 | Ga0207682_100031942 | 321 |
| 647 | 3300025898 | Ga0207692_10029153 | Ga0207692_100291531 | 321 |
| 648 | 3300025899 | Ga0207642_10091773 | Ga0207642_100917731 | 321 |
| 649 | 3300025906 | Ga0207699_10013825 | Ga0207699_100138252 | 321 |
| 650 | 3300025906 | Ga0207699_10073449 | Ga0207699_100734492 | 321 |
| 651 | 3300025906 | Ga0207699_10151573 | Ga0207699_101515732 | 321 |
| 652 | 3300025911 | Ga0207654_10230110 | Ga0207654_102301102 | 321 |
| 653 | 3300025912 | Ga0207707_10008674 | Ga0207707_100086744 | 321 |
| 654 | 3300025912 | Ga0207707_10143737 | Ga0207707_101437372 | 321 |
| 655 | 3300025913 | Ga0207695_10076155 | Ga0207695_100761552 | 321 |
| 656 | 3300025914 | Ga0207671_10046808 | Ga0207671_100468083 | 321 |
| 657 | 3300025914 | Ga0207671_10165688 | Ga0207671_101656882 | 321 |
| 658 | 3300025917 | Ga0207660_10002422 | Ga0207660_100024227 | 321 |
| 659 | 3300025917 | Ga0207660_10335885 | Ga0207660_103358852 | 321 |
| 660 | 3300025917 | Ga0207660_10424668 | Ga0207660_104246681 | 321 |
| 661 | 3300025919 | Ga0207657_10000045 | Ga0207657_10000045100 | 321 |
| 662 | 3300025919 | Ga0207657_10008538 | Ga0207657_100085385 | 321 |
| 663 | 3300025919 | Ga0207657_10015160 | Ga0207657_100151604 | 321 |
| 664 | 3300025919 | Ga0207657_10046535 | Ga0207657_100465354 | 321 |
| 665 | 3300025919 | Ga0207657_10104022 | Ga0207657_101040222 | 321 |
| 666 | 3300025920 | Ga0207649_10002175 | Ga0207649_1000217511 | 321 |
| 667 | 3300025920 | Ga0207649_10021178 | Ga0207649_100211783 | 321 |
| 668 | 3300025920 | Ga0207649_10028095 | Ga0207649_100280952 | 321 |
| 669 | 3300025921 | Ga0207652_10034707 | Ga0207652_100347073 | 321 |
| 670 | 3300025921 | Ga0207652_10066886 | Ga0207652_100668862 | 321 |
| 671 | 3300025921 | Ga0207652_10166294 | Ga0207652_101662942 | 321 |
| 672 | 3300025923 | Ga0207681_10008494 | Ga0207681_100084948 | 321 |
| 673 | 3300025923 | Ga0207681_10153744 | Ga0207681_101537442 | 321 |
| 674 | 3300025924 | Ga0207694_10021014 | Ga0207694_100210142 | 321 |
| 675 | 3300025924 | Ga0207694_10080374 | Ga0207694_100803743 | 321 |
| 676 | 3300025925 | Ga0207650_10005120 | Ga0207650_100051204 | 321 |
| 677 | 3300025926 | Ga0207659_10013858 | Ga0207659_100138586 | 321 |
| 678 | 3300025926 | Ga0207659_10272011 | Ga0207659_102720112 | 321 |
| 679 | 3300025929 | Ga0207664_10006610 | Ga0207664_100066105 | 321 |
| 680 | 3300025929 | Ga0207664_10073502 | Ga0207664_100735022 | 321 |
| 681 | 3300025929 | Ga0207664_10139257 | Ga0207664_101392572 | 321 |
| 682 | 3300025931 | Ga0207644_10010401 | Ga0207644_100104016 | 321 |
| 683 | 3300025931 | Ga0207644_10011430 | Ga0207644_100114302 | 321 |
| 684 | 3300025931 | Ga0207644_10017295 | Ga0207644_100172953 | 321 |
| 685 | 3300025932 | Ga0207690_10008126 | Ga0207690_100081263 | 321 |
| 686 | 3300025933 | Ga0207706_10000149 | Ga0207706_100001494 | 321 |
| 687 | 3300025933 | Ga0207706_10063073 | Ga0207706_100630734 | 321 |
| 688 | 3300025937 | Ga0207669_10008202 | Ga0207669_100082023 | 321 |
| 689 | 3300025940 | Ga0207691_10000229 | Ga0207691_1000022918 | 321 |
| 690 | 3300025945 | Ga0207679_10007689 | Ga0207679_100076894 | 321 |
| 691 | 3300025945 | Ga0207679_10030294 | Ga0207679_100302943 | 321 |
| 692 | 3300025945 | Ga0207679_10037851 | Ga0207679_100378512 | 321 |
| 693 | 3300025945 | Ga0207679_10050669 | Ga0207679_100506693 | 321 |
| 694 | 3300025945 | Ga0207679_10109357 | Ga0207679_101093572 | 321 |
| 695 | 3300025949 | Ga0207667_10006125 | Ga0207667_100061256 | 321 |
| 696 | 3300025949 | Ga0207667_10009172 | Ga0207667_1000917210 | 321 |
| 697 | 3300025949 | Ga0207667_10066614 | Ga0207667_100666143 | 321 |
| 698 | 3300025949 | Ga0207667_10110217 | Ga0207667_101102173 | 321 |
| 699 | 3300025960 | Ga0207651_10003355 | Ga0207651_100033558 | 321 |
| 700 | 3300025960 | Ga0207651_10014425 | Ga0207651_100144254 | 321 |
| 701 | 3300025960 | Ga0207651_10394827 | Ga0207651_103948271 | 321 |
| 702 | 3300025981 | Ga0207640_10008111 | Ga0207640_100081116 | 321 |
| 703 | 3300026041 | Ga0207639_10067425 | Ga0207639_100674253 | 321 |
| 704 | 3300026041 | Ga0207639_10268590 | Ga0207639_102685902 | 321 |
| 705 | 3300026067 | Ga0207678_10003299 | Ga0207678_1000329915 | 321 |
| 706 | 3300026067 | Ga0207678_10005357 | Ga0207678_100053578 | 321 |
| 707 | 3300026067 | Ga0207678_10243294 | Ga0207678_102432941 | 321 |
| 708 | 3300026078 | Ga0207702_10002780 | Ga0207702_100027808 | 321 |
| 709 | 3300026078 | Ga0207702_10030260 | Ga0207702_100302604 | 321 |
| 710 | 3300026078 | Ga0207702_10034801 | Ga0207702_100348013 | 321 |
| 711 | 3300026089 | Ga0207648_10009020 | Ga0207648_100090203 | 321 |
| 712 | 3300026089 | Ga0207648_10026307 | Ga0207648_100263074 | 321 |
| 713 | 3300026095 | Ga0207676_10032079 | Ga0207676_100320793 | 321 |
| 714 | 3300026116 | Ga0207674_10000020 | Ga0207674_100000204 | 321 |
| 715 | 3300026116 | Ga0207674_10005781 | Ga0207674_100057816 | 321 |
| 716 | 3300026116 | Ga0207674_10200449 | Ga0207674_102004492 | 321 |
| 717 | 3300026118 | Ga0207675_100176299 | Ga0207675_1001762992 | 321 |
| 718 | 3300026121 | Ga0207683_10012448 | Ga0207683_100124482 | 321 |
| 719 | 3300026142 | Ga0207698_10000678 | Ga0207698_1000067811 | 321 |
| 720 | 3300031731 | Ga0307405_10078564 | Ga0307405_100785641 | 321 |
| 721 | 3300031911 | Ga0307412_10009961 | Ga0307412_100099616 | 321 |
| 722 | 3300031995 | Ga0307409_100019238 | Ga0307409_1000192382 | 321 |
| 723 | 3300031995 | Ga0307409_100175482 | Ga0307409_1001754823 | 321 |
| 724 | 3300032002 | Ga0307416_100021079 | Ga0307416_1000210791 | 321 |
| 725 | 3300032004 | Ga0307414_10223272 | Ga0307414_102232722 | 321 |
| 726 | 3300035118 | Ga0373954_0031280 | Ga0373954_0031280_1401_2366 | 321 |
| 727 | 3300035172 | Ga0373955_0161011 | Ga0373955_0161011_117_1082 | 321 |
| 728 | 3300035691 | Ga0373931_0215223 | Ga0373931_0215223_34_999 | 321 |
| 729 | 3300036401 | Ga0373937_0063736 | Ga0373937_0063736_177_1142 | 321 |
| 730 | 3300037312 | Ga0395899_0035008 | Ga0395899_0035008_739_1704 | 321 |
| 731 | 3300037418 | Ga0395900_0178929 | Ga0395900_0178929_1140_2105 | 321 |
| 732 | 3300038443 | Ga0395901_0309598 | Ga0395901_0309598_592_1557 | 321 |
| 733 | 3300042876 | Ga0451577_0087317 | Ga0451577_0087317_144_1109 | 321 |
| 734 | 3300045976 | Ga0466967_0345095 | Ga0466967_0345095_64_1029 | 321 |
| 735 | 3300048905 | Ga0496102_0018172 | Ga0496102_0018172_4496_5461 | 321 |
| 736 | 3300048905 | Ga0496102_0026199 | Ga0496102_0026199_2755_3720 | 321 |
| 737 | 3300048909 | Ga0496106_0005880 | Ga0496106_0005880_4840_5805 | 321 |
| 738 | 3300048910 | Ga0496107_0146360 | Ga0496107_0146360_168_1133 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9636 | 28 | 320 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9625 | 23 | 318 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.95 | 23 | 318 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9497 | 24 | 312 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9469 | 24 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9455 | 123 | 244 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.945 | 123 | 240 | 3.40.190.10 |
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9356 | 123 | 241 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.934 | 123 | 244 | 3.40.190.10 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9282 | 24 | 320 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5PQ67-F1-model_v4 | Tripartite tricarboxylate transporter family receptor | 0.9984 | 61 | 314 |
|
| AF-A0A536YZ85-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.998 | 24 | 320 |
|
| AF-A0A1F4AHA8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9817 | 49 | 316 |
|
| AF-A0A1B2R9E2-F1-model_v4 | LacI family transcriptional regulator | 0.9791 | 22 | 318 |
|
| AF-A0A096FIP4-F1-model_v4 | MFS transporter | 0.9786 | 22 | 320 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar