F478384

General Info

Members Datasets Scaffolds Average Seq Length
738 283 738 325

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10071557|Ga0105238_100715573
Length 349
Sequence MQKLLRFADISIADRTGASMITLTSFARASRAFVCALAVAAAATPAVAQDAYPSKPVRIIVPFAAGGPADVYARFLAERLQQSMGQTFIVDDRPGAGSIIGTDAVAKSAPDGYTLLLMSNTHTVNESLIANKPFQLMRDFAPIAPINSSDLVLVARRSLPVSTVHELIAAAKAKPGAMTYASSGPGTPYHMAGELFKALAGVSILHIPYKGSSGARTDVLGGQVDLMFDAVTTMTEHVRQGKVKALGTTGKTRSEVMPDVPTIAEAGVPGYEATIWLGLMAPKNTPAQIVSRLNAEVGKIVGQPEVVKAWRVQGAVPMTMSVAEFTKYLNDDIVKWARIVKVSGAKPEQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 2.98
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10038972 3300005327 Bacteria 3833
2 Ga0070658_10069095 3300005327 Bacteria 2889
3 Ga0070658_10178290 3300005327 Bacteria 1788
4 Ga0070676_10006626 3300005328 Bacteria 6197
5 Ga0070676_10010777 3300005328 Bacteria 4961
6 Ga0070676_10021963 3300005328 Bacteria 3576
7 Ga0070676_10219195 3300005328 Bacteria 1256
8 Ga0070683_100007182 3300005329 Bacteria 9391
9 Ga0070683_100030885 3300005329 Bacteria 4867
10 Ga0070683_100039556 3300005329 Bacteria 4330
11 Ga0070690_100013351 3300005330 Bacteria 4849
12 Ga0070690_100041543 3300005330 Bacteria 2912
13 Ga0070690_100042787 3300005330 Bacteria 2869
14 Ga0070670_100008462 3300005331 Bacteria 8777
15 Ga0070670_100013351 3300005331 Bacteria 7034
16 Ga0070670_100051505 3300005331 Bacteria 3535
17 Ga0070670_100072433 3300005331 Bacteria 2959
18 Ga0070670_100277101 3300005331 Bacteria 1464
19 Ga0070677_10002013 3300005333 Bacteria 6459
20 Ga0070677_10039117 3300005333 Bacteria 1860
21 Ga0068869_100002941 3300005334 Bacteria 10343
22 Ga0068869_100008210 3300005334 Bacteria 6718
23 Ga0068869_100015759 3300005334 Bacteria 5080
24 Ga0070666_10002937 3300005335 Bacteria 10314
25 Ga0070666_10003117 3300005335 Bacteria 10072
26 Ga0070666_10006093 3300005335 Bacteria 7411
27 Ga0070666_10033038 3300005335 Bacteria 3421
28 Ga0070666_10230815 3300005335 Bacteria 1307
29 Ga0070680_100194013 3300005336 Bacteria 1712
30 Ga0070680_100330288 3300005336 Bacteria 1295
31 Ga0070682_100024784 3300005337 Bacteria 3574
32 Ga0068868_100006024 3300005338 Bacteria 8563
33 Ga0068868_100043259 3300005338 Bacteria 3518
34 Ga0068868_100112766 3300005338 Bacteria 2211
35 Ga0068868_100112875 3300005338 Bacteria 2209
36 Ga0068868_100255747 3300005338 Bacteria 1475
37 Ga0070660_100015941 3300005339 Bacteria 5443
38 Ga0070689_100007815 3300005340 Bacteria 7494
39 Ga0070689_100010101 3300005340 Bacteria 6720
40 Ga0070689_100034823 3300005340 Bacteria 3843
41 Ga0070689_100112561 3300005340 Bacteria 2166
42 Ga0070689_100264698 3300005340 Bacteria 1422
43 Ga0070661_100001163 3300005344 Bacteria 18546
44 Ga0070661_100002517 3300005344 Bacteria 12548
45 Ga0070661_100004458 3300005344 Bacteria 9655
46 Ga0070661_100020742 3300005344 Bacteria 4688
47 Ga0070661_100032933 3300005344 Bacteria 3754
48 Ga0070661_100050297 3300005344 Bacteria 3049
49 Ga0070661_100114099 3300005344 Bacteria 2020
50 Ga0070668_100006563 3300005347 Bacteria 8619
51 Ga0070668_100017926 3300005347 Bacteria 5310
52 Ga0070668_100089486 3300005347 Bacteria 2425
53 Ga0070669_100000703 3300005353 Bacteria 24519
54 Ga0070669_100010671 3300005353 Bacteria 6519
55 Ga0070669_100017967 3300005353 Bacteria 5051
56 Ga0070669_100025112 3300005353 Bacteria 4278
57 Ga0070669_100075027 3300005353 Bacteria 2507
58 Ga0070669_100082373 3300005353 Bacteria 2398
59 Ga0070669_100135105 3300005353 Bacteria 1896
60 Ga0070669_100163088 3300005353 Bacteria 1733
61 Ga0070669_100278085 3300005353 Bacteria 1340
62 Ga0070675_100008358 3300005354 Bacteria 8033
63 Ga0070675_100015033 3300005354 Bacteria 6114
64 Ga0070675_100019752 3300005354 Bacteria 5372
65 Ga0070675_100040486 3300005354 Bacteria 3804
66 Ga0070675_100050125 3300005354 Bacteria 3428
67 Ga0070675_100057458 3300005354 Bacteria 3208
68 Ga0070675_100407801 3300005354 Bacteria 1213
69 Ga0070671_100002148 3300005355 Bacteria 15230
70 Ga0070671_100002779 3300005355 Bacteria 13599
71 Ga0070671_100004213 3300005355 Bacteria 11377
72 Ga0070671_100005567 3300005355 Bacteria 10036
73 Ga0070671_100024596 3300005355 Bacteria 4932
74 Ga0070671_100054814 3300005355 Bacteria 3316
75 Ga0070671_100054877 3300005355 Bacteria 3314
76 Ga0070671_100058361 3300005355 Bacteria 3213
77 Ga0070671_100159378 3300005355 Bacteria 1907
78 Ga0070671_100185377 3300005355 Bacteria 1763
79 Ga0070674_100001675 3300005356 Bacteria 11979
80 Ga0070674_100009858 3300005356 Bacteria 5745
81 Ga0070674_100108214 3300005356 Bacteria 2037
82 Ga0070674_100194891 3300005356 Bacteria 1560
83 Ga0070673_100004285 3300005364 Bacteria 9005
84 Ga0070673_100007461 3300005364 Bacteria 7213
85 Ga0070673_100058265 3300005364 Bacteria 3053
86 Ga0070673_100108377 3300005364 Bacteria 2300
87 Ga0070673_100108608 3300005364 Bacteria 2297
88 Ga0070673_100132910 3300005364 Bacteria 2090
89 Ga0070673_100410746 3300005364 Bacteria 1212
90 Ga0070659_100030369 3300005366 Bacteria 4183
91 Ga0070659_100192578 3300005366 Bacteria 1676
92 Ga0070667_100002963 3300005367 Bacteria 14593
93 Ga0070667_100003662 3300005367 Bacteria 13081
94 Ga0070667_100006668 3300005367 Bacteria 9598
95 Ga0070667_100007802 3300005367 Bacteria 8874
96 Ga0070667_100013595 3300005367 Bacteria 6726
97 Ga0070667_100099996 3300005367 Bacteria 2504
98 Ga0070709_10008703 3300005434 Bacteria 5584
99 Ga0070709_10035113 3300005434 Bacteria 3045
100 Ga0070709_10068902 3300005434 Bacteria 2277
101 Ga0070709_10076840 3300005434 Bacteria 2169
102 Ga0070709_10084055 3300005434 Bacteria 2084
103 Ga0070714_100014948 3300005435 Bacteria 6240
104 Ga0070714_100033506 3300005435 Bacteria 4294
105 Ga0070714_100132569 3300005435 Bacteria 2228
106 Ga0070713_100004952 3300005436 Bacteria 9043
107 Ga0070713_100125784 3300005436 Bacteria 2254
108 Ga0070713_100186705 3300005436 Bacteria 1866
109 Ga0070710_10002378 3300005437 Bacteria 8909
110 Ga0070701_10052732 3300005438 Bacteria 2114
111 Ga0070700_100022620 3300005441 Bacteria 3669
112 Ga0070700_100131993 3300005441 Bacteria 1687
113 Ga0070663_100002838 3300005455 Bacteria 9844
114 Ga0070663_100010680 3300005455 Bacteria 5730
115 Ga0070663_100122677 3300005455 Bacteria 1964
116 Ga0070678_100004327 3300005456 Bacteria 8034
117 Ga0070678_100014019 3300005456 Bacteria 5041
118 Ga0070678_100077605 3300005456 Bacteria 2506
119 Ga0070678_100144515 3300005456 Bacteria 1907
120 Ga0070678_100184737 3300005456 Bacteria 1710
121 Ga0070662_100000827 3300005457 Bacteria 19059
122 Ga0070662_100003262 3300005457 Bacteria 10093
123 Ga0070662_100012595 3300005457 Bacteria 5610
124 Ga0070662_100019182 3300005457 Bacteria 4640
125 Ga0070662_100199012 3300005457 Bacteria 1589
126 Ga0070681_10006174 3300005458 Bacteria 11640
127 Ga0070681_10008534 3300005458 Bacteria 10033
128 Ga0070681_10022228 3300005458 Bacteria 6366
129 Ga0068867_100001658 3300005459 Bacteria 15497
130 Ga0068867_100002428 3300005459 Bacteria 13095
131 Ga0068867_100004893 3300005459 Bacteria 9428
132 Ga0068867_100007088 3300005459 Bacteria 7922
133 Ga0068867_100029241 3300005459 Bacteria 3970
134 Ga0068867_100214604 3300005459 Bacteria 1547
135 Ga0068867_100245561 3300005459 Bacteria 1453
136 Ga0070685_10056628 3300005466 Bacteria 2279
137 Ga0070699_100017505 3300005518 Bacteria 6150
138 Ga0070679_100003587 3300005530 Bacteria 14196
139 Ga0070679_100188447 3300005530 Bacteria 2032
140 Ga0070679_100204541 3300005530 Bacteria 1939
141 Ga0070684_100074081 3300005535 Bacteria 3001
142 Ga0070684_100116544 3300005535 Bacteria 2399
143 Ga0068853_100017860 3300005539 Bacteria 5860
144 Ga0068853_100144640 3300005539 Bacteria 2136
145 Ga0068853_100281595 3300005539 Bacteria 1533
146 Ga0070672_100001237 3300005543 Bacteria 15684
147 Ga0070672_100002999 3300005543 Bacteria 10878
148 Ga0070672_100015202 3300005543 Bacteria 5473
149 Ga0070672_100031023 3300005543 Bacteria 4020
150 Ga0070672_100038186 3300005543 Bacteria 3667
151 Ga0070672_100046661 3300005543 Bacteria 3357
152 Ga0070672_100090681 3300005543 Bacteria 2465
153 Ga0070672_100168707 3300005543 Bacteria 1819
154 Ga0070672_100304933 3300005543 Bacteria 1351
155 Ga0070693_100027970 3300005547 Bacteria 3062
156 Ga0070665_100034048 3300005548 Bacteria 5123
157 Ga0070665_100073195 3300005548 Bacteria 3433
158 Ga0070665_100080552 3300005548 Bacteria 3262
159 Ga0070665_100113254 3300005548 Bacteria 2715
160 Ga0070665_100570285 3300005548 Bacteria 1144
161 Ga0068855_100004781 3300005563 Bacteria 16532
162 Ga0068855_100048925 3300005563 Bacteria 4988
163 Ga0068855_100062803 3300005563 Bacteria 4335
164 Ga0068855_100075008 3300005563 Bacteria 3927
165 Ga0068855_100158356 3300005563 Bacteria 2572
166 Ga0070664_100000152 3300005564 Bacteria 47795
167 Ga0070664_100006501 3300005564 Bacteria 9420
168 Ga0070664_100046254 3300005564 Bacteria 3676
169 Ga0070664_100057608 3300005564 Bacteria 3303
170 Ga0070664_100129450 3300005564 Bacteria 2216
171 Ga0068857_100034689 3300005577 Bacteria 4462
172 Ga0068857_100098900 3300005577 Bacteria 2617
173 Ga0068857_100114033 3300005577 Bacteria 2430
174 Ga0068857_100133405 3300005577 Bacteria 2241
175 Ga0068857_100444974 3300005577 Bacteria 1211
176 Ga0068854_100013085 3300005578 Bacteria 5439
177 Ga0068856_100000093 3300005614 Bacteria 84752
178 Ga0068856_100018144 3300005614 Bacteria 6822
179 Ga0068856_100034204 3300005614 Bacteria 4978
180 Ga0068856_100039961 3300005614 Bacteria 4606
181 Ga0068856_100043551 3300005614 Bacteria 4416
182 Ga0068856_100210731 3300005614 Bacteria 1958
183 Ga0070702_100259425 3300005615 Bacteria 1182
184 Ga0068852_100002316 3300005616 Bacteria 13089
185 Ga0068852_100007090 3300005616 Bacteria 8165
186 Ga0068852_100018088 3300005616 Bacteria 5545
187 Ga0068852_100072473 3300005616 Bacteria 3027
188 Ga0068852_100377612 3300005616 Bacteria 1390
189 Ga0068859_100008717 3300005617 Bacteria 10248
190 Ga0068859_100097646 3300005617 Bacteria 2991
191 Ga0068859_100105275 3300005617 Bacteria 2880
192 Ga0068859_100214803 3300005617 Bacteria 2010
193 Ga0068864_100001297 3300005618 Bacteria 20799
194 Ga0068864_100001959 3300005618 Bacteria 16928
195 Ga0068864_100020907 3300005618 Bacteria 5478
196 Ga0068864_100024057 3300005618 Bacteria 5120
197 Ga0068864_100044371 3300005618 Bacteria 3810
198 Ga0068864_100049557 3300005618 Bacteria 3614
199 Ga0068864_100057582 3300005618 Bacteria 3358
200 Ga0068864_100069289 3300005618 Bacteria 3067
201 Ga0068866_10005854 3300005718 Bacteria 5104
202 Ga0068866_10011312 3300005718 Bacteria 3857
203 Ga0068866_10071157 3300005718 Bacteria 1839
204 Ga0068861_100003125 3300005719 Bacteria 10939
205 Ga0068861_100026691 3300005719 Bacteria 4201
206 Ga0068861_100058140 3300005719 Bacteria 2956
207 Ga0068861_100148460 3300005719 Bacteria 1921
208 Ga0068851_10002770 3300005834 Bacteria 7725
209 Ga0068851_10005190 3300005834 Bacteria 5913
210 Ga0068851_10038242 3300005834 Bacteria 2406
211 Ga0068851_10051815 3300005834 Bacteria 2086
212 Ga0068851_10112432 3300005834 Bacteria 1455
213 Ga0068870_10031559 3300005840 Bacteria 2685
214 Ga0068870_10152355 3300005840 Bacteria 1363
215 Ga0068863_100002914 3300005841 Bacteria 16966
216 Ga0068863_100011402 3300005841 Bacteria 8600
217 Ga0068863_100023298 3300005841 Bacteria 5915
218 Ga0068863_100025750 3300005841 Bacteria 5611
219 Ga0068863_100082868 3300005841 Bacteria 3039
220 Ga0068863_100097888 3300005841 Bacteria 2786
221 Ga0068863_100133660 3300005841 Bacteria 2369
222 Ga0068863_100559558 3300005841 Bacteria 1130
223 Ga0068858_100000729 3300005842 Bacteria 34410
224 Ga0068858_100003258 3300005842 Bacteria 16181
225 Ga0068858_100007127 3300005842 Bacteria 10858
226 Ga0068858_100010459 3300005842 Bacteria 8789
227 Ga0068858_100029114 3300005842 Bacteria 5128
228 Ga0068858_100056819 3300005842 Bacteria 3617
229 Ga0068858_100134991 3300005842 Bacteria 2315
230 Ga0068860_100004309 3300005843 Bacteria 14547
231 Ga0068860_100020088 3300005843 Bacteria 6471
232 Ga0068860_100036517 3300005843 Bacteria 4707
233 Ga0068860_100039107 3300005843 Bacteria 4537
234 Ga0068862_100187360 3300005844 Bacteria 1860
235 Ga0068862_100240530 3300005844 Bacteria 1646
236 Ga0081455_10002056 3300005937 Bacteria 24066
237 Ga0081540_1000313 3300005983 Bacteria 50236
238 Ga0070717_10259098 3300006028 Bacteria 1538
239 Ga0075365_10118008 3300006038 Bacteria 1828
240 Ga0070715_10038775 3300006163 Bacteria 1980
241 Ga0075367_10002955 3300006178 Bacteria 7942
242 Ga0075367_10036455 3300006178 Bacteria 2852
243 Ga0075366_10000957 3300006195 Bacteria 14080
244 Ga0097621_100027028 3300006237 Bacteria 4508
245 Ga0097621_100385941 3300006237 Bacteria 1252
246 Ga0068871_100009333 3300006358 Bacteria 7103
247 Ga0068871_100016446 3300006358 Bacteria 5571
248 Ga0068871_100063765 3300006358 Bacteria 3015
249 Ga0068871_100177611 3300006358 Bacteria 1828
250 Ga0075428_100014820 3300006844 Bacteria 8663
251 Ga0075430_100044473 3300006846 Bacteria 3754
252 Ga0075431_100015583 3300006847 Bacteria 7704
253 Ga0075434_100066222 3300006871 Bacteria 3598
254 Ga0075429_100000003 3300006880 Bacteria 130377
255 Ga0068865_100000968 3300006881 Bacteria 16397
256 Ga0068865_100025566 3300006881 Bacteria 3885
257 Ga0097620_100008717 3300006931 Bacteria 10248
258 Ga0097620_100097646 3300006931 Bacteria 2991
259 Ga0097620_100105274 3300006931 Bacteria 2880
260 Ga0097620_100214795 3300006931 Bacteria 2010
261 Ga0105240_10002702 3300009093 Bacteria 28208
262 Ga0105240_10006429 3300009093 Bacteria 17273
263 Ga0111539_10683744 3300009094 Bacteria 1195
264 Ga0111539_10696005 3300009094 Bacteria 1183
265 Ga0105245_10017282 3300009098 Bacteria 6294
266 Ga0105245_10118338 3300009098 Bacteria 2472
267 Ga0105247_10021696 3300009101 Bacteria 3864
268 Ga0114129_10005359 3300009147 Bacteria 18104
269 Ga0114129_10183640 3300009147 Bacteria 2844
270 Ga0105243_10020478 3300009148 Bacteria 5014
271 Ga0105243_10086073 3300009148 Bacteria 2577
272 Ga0105243_10189703 3300009148 Bacteria 1794
273 Ga0105241_10001154 3300009174 Bacteria 20103
274 Ga0105241_10059857 3300009174 Bacteria 2929
275 Ga0105241_10402513 3300009174 Bacteria 1201
276 Ga0105242_10014088 3300009176 Bacteria 6189
277 Ga0105248_10007025 3300009177 Bacteria 12334
278 Ga0105248_10010702 3300009177 Bacteria 10123
279 Ga0105248_10016915 3300009177 Bacteria 8030
280 Ga0105248_10021738 3300009177 Bacteria 7108
281 Ga0105237_10040115 3300009545 Bacteria 4722
282 Ga0105237_10093770 3300009545 Bacteria 2991
283 Ga0105237_10099157 3300009545 Bacteria 2905
284 Ga0105237_10198199 3300009545 Bacteria 2007
285 Ga0105238_10003012 3300009551 Bacteria 16820
286 Ga0105238_10049052 3300009551 Bacteria 4254
287 Ga0105238_10071557 3300009551 Bacteria 3465
288 Ga0105238_10144516 3300009551 Bacteria 2355
289 Ga0105239_10357501 3300010375 Bacteria 1649
290 Ga0105239_10420440 3300010375 Bacteria 1514
291 Ga0105246_10083596 3300011119 Bacteria 2282
292 Ga0157373_10005664 3300013100 Bacteria 9360
293 Ga0157373_10020608 3300013100 Bacteria 4790
294 Ga0157373_10030761 3300013100 Bacteria 3863
295 Ga0157373_10154523 3300013100 Bacteria 1614
296 Ga0157371_10000696 3300013102 Bacteria 39564
297 Ga0157370_10004239 3300013104 Bacteria 16583
298 Ga0157370_10007103 3300013104 Bacteria 12223
299 Ga0157370_10034563 3300013104 Bacteria 4919
300 Ga0157370_10036749 3300013104 Bacteria 4751
301 Ga0157370_10242582 3300013104 Bacteria 1667
302 Ga0157369_10033319 3300013105 Bacteria 5662
303 Ga0157369_10079192 3300013105 Bacteria 3519
304 Ga0157369_10105602 3300013105 Bacteria 2998
305 Ga0157369_10240825 3300013105 Bacteria 1890
306 Ga0157374_10015544 3300013296 Bacteria 6677
307 Ga0157374_10074601 3300013296 Bacteria 3204
308 Ga0157378_10005031 3300013297 Bacteria 11605
309 Ga0157378_10009099 3300013297 Bacteria 8647
310 Ga0157378_10156425 3300013297 Bacteria 2128
311 Ga0157378_10200607 3300013297 Bacteria 1887
312 Ga0163162_10006321 3300013306 Bacteria 11471
313 Ga0163162_10012725 3300013306 Bacteria 8217
314 Ga0163162_10019386 3300013306 Bacteria 6671
315 Ga0163162_10040663 3300013306 Bacteria 4650
316 Ga0163162_10069143 3300013306 Bacteria 3583
317 Ga0163162_10236441 3300013306 Bacteria 1957
318 Ga0163162_10438558 3300013306 Bacteria 1438
319 Ga0157372_10006652 3300013307 Bacteria 12300
320 Ga0157372_10017050 3300013307 Bacteria 7798
321 Ga0157372_10020731 3300013307 Bacteria 7096
322 Ga0157372_10039214 3300013307 Bacteria 5228
323 Ga0157372_10257305 3300013307 Bacteria 2027
324 Ga0157372_10257905 3300013307 Bacteria 2024
325 Ga0157375_10011280 3300013308 Bacteria 7889
326 Ga0157375_10046064 3300013308 Bacteria 4249
327 Ga0157375_10061788 3300013308 Bacteria 3721
328 Ga0157375_10070170 3300013308 Bacteria 3513
329 Ga0157375_10115633 3300013308 Bacteria 2786
330 Ga0157375_10355364 3300013308 Bacteria 1631
331 Ga0163163_10005612 3300014325 Bacteria 10872
332 Ga0157380_10051443 3300014326 Bacteria 3258
333 Ga0157380_10076156 3300014326 Bacteria 2729
334 Ga0157380_10126496 3300014326 Bacteria 2173
335 Ga0157380_10326050 3300014326 Bacteria 1426
336 Ga0157380_10444018 3300014326 Bacteria 1244
337 Ga0157377_10030418 3300014745 Bacteria 2925
338 Ga0157377_10113807 3300014745 Bacteria 1630
339 Ga0157379_10004210 3300014968 Bacteria 12286
340 Ga0157379_10012185 3300014968 Bacteria 7511
341 Ga0157379_10027063 3300014968 Bacteria 5104
342 Ga0157379_10027423 3300014968 Bacteria 5072
343 Ga0157379_10048460 3300014968 Bacteria 3792
344 Ga0157379_10063062 3300014968 Bacteria 3314
345 Ga0157379_10350138 3300014968 Bacteria 1352
346 Ga0157376_10032082 3300014969 Bacteria 4214
347 Ga0157376_10042780 3300014969 Bacteria 3714
348 Ga0163161_10014345 3300017792 Bacteria 5515
349 Ga0163161_10016630 3300017792 Bacteria 5137
350 Ga0163161_10151608 3300017792 Bacteria 1762
351 Ga0163161_10219535 3300017792 Bacteria 1472
352 Ga0213875_10055598 3300021388 Bacteria 1854
353 Ga0207697_10005139 3300025315 Bacteria 6117
354 Ga0207656_10026749 3300025321 Bacteria 2354
355 Ga0207656_10034710 3300025321 Bacteria 2107
356 Ga0207656_10041790 3300025321 Bacteria 1949
357 Ga0207682_10003194 3300025893 Bacteria 7171
358 Ga0207682_10003662 3300025893 Bacteria 6632
359 Ga0207682_10005486 3300025893 Bacteria 5165
360 Ga0207682_10042845 3300025893 Bacteria 1850
361 Ga0207692_10029153 3300025898 Bacteria 2619
362 Ga0207692_10125477 3300025898 Bacteria 1443
363 Ga0207642_10017417 3300025899 Bacteria 2732
364 Ga0207642_10091773 3300025899 Bacteria 1502
365 Ga0207710_10012681 3300025900 Bacteria 3547
366 Ga0207688_10036655 3300025901 Bacteria 2719
367 Ga0207688_10086011 3300025901 Bacteria 1801
368 Ga0207680_10001451 3300025903 Bacteria 11248
369 Ga0207680_10006222 3300025903 Bacteria 5760
370 Ga0207647_10188483 3300025904 Bacteria 1196
371 Ga0207699_10004274 3300025906 Bacteria 6831
372 Ga0207699_10013825 3300025906 Bacteria 4143
373 Ga0207699_10073449 3300025906 Bacteria 2098
374 Ga0207699_10151573 3300025906 Bacteria 1534
375 Ga0207645_10000930 3300025907 Bacteria 24267
376 Ga0207645_10013116 3300025907 Bacteria 5598
377 Ga0207645_10015439 3300025907 Bacteria 5072
378 Ga0207645_10147256 3300025907 Bacteria 1536
379 Ga0207654_10230110 3300025911 Bacteria 1234
380 Ga0207707_10008674 3300025912 Bacteria 8822
381 Ga0207707_10041031 3300025912 Bacteria 4041
382 Ga0207707_10143737 3300025912 Bacteria 2085
383 Ga0207695_10076155 3300025913 Bacteria 3412
384 Ga0207671_10046808 3300025914 Bacteria 3200
385 Ga0207671_10165688 3300025914 Bacteria 1713
386 Ga0207671_10241857 3300025914 Bacteria 1418
387 Ga0207693_10004943 3300025915 Bacteria 11203
388 Ga0207660_10002422 3300025917 Bacteria 12251
389 Ga0207660_10127395 3300025917 Bacteria 1935
390 Ga0207660_10335885 3300025917 Bacteria 1209
391 Ga0207660_10424668 3300025917 Bacteria 1073
392 Ga0207662_10006278 3300025918 Bacteria 6402
393 Ga0207657_10000045 3300025919 Bacteria 114661
394 Ga0207657_10008538 3300025919 Bacteria 10388
395 Ga0207657_10015160 3300025919 Bacteria 7485
396 Ga0207657_10046535 3300025919 Bacteria 3799
397 Ga0207657_10076083 3300025919 Bacteria 2832
398 Ga0207657_10104022 3300025919 Bacteria 2353
399 Ga0207649_10002175 3300025920 Bacteria 11083
400 Ga0207649_10021178 3300025920 Bacteria 3738
401 Ga0207649_10028095 3300025920 Bacteria 3309
402 Ga0207652_10028914 3300025921 Bacteria 4627
403 Ga0207652_10034707 3300025921 Bacteria 4252
404 Ga0207652_10066886 3300025921 Bacteria 3115
405 Ga0207652_10166294 3300025921 Bacteria 1978
406 Ga0207652_10208730 3300025921 Bacteria 1758
407 Ga0207681_10008494 3300025923 Bacteria 6276
408 Ga0207681_10016331 3300025923 Bacteria 4642
409 Ga0207681_10018436 3300025923 Bacteria 4397
410 Ga0207681_10064768 3300025923 Bacteria 2525
411 Ga0207681_10085109 3300025923 Bacteria 2243
412 Ga0207681_10153744 3300025923 Bacteria 1727
413 Ga0207694_10021014 3300025924 Bacteria 4941
414 Ga0207694_10080374 3300025924 Bacteria 2558
415 Ga0207694_10116776 3300025924 Bacteria 2127
416 Ga0207650_10003438 3300025925 Bacteria 10883
417 Ga0207650_10005120 3300025925 Bacteria 8945
418 Ga0207650_10019766 3300025925 Bacteria 4737
419 Ga0207650_10053216 3300025925 Bacteria 3000
420 Ga0207650_10235668 3300025925 Bacteria 1478
421 Ga0207659_10002463 3300025926 Bacteria 11038
422 Ga0207659_10013645 3300025926 Bacteria 5212
423 Ga0207659_10013858 3300025926 Bacteria 5182
424 Ga0207659_10025053 3300025926 Bacteria 4004
425 Ga0207659_10026817 3300025926 Bacteria 3893
426 Ga0207659_10272011 3300025926 Bacteria 1382
427 Ga0207687_10055910 3300025927 Bacteria 2766
428 Ga0207687_10059337 3300025927 Bacteria 2695
429 Ga0207687_10121380 3300025927 Bacteria 1955
430 Ga0207700_10195097 3300025928 Bacteria 1703
431 Ga0207664_10006610 3300025929 Bacteria 7985
432 Ga0207664_10034959 3300025929 Unclassified 3874
433 Ga0207664_10073502 3300025929 Bacteria 2759
434 Ga0207664_10139257 3300025929 Bacteria 2051
435 Ga0207644_10000899 3300025931 Bacteria 18825
436 Ga0207644_10006192 3300025931 Bacteria 7803
437 Ga0207644_10008628 3300025931 Bacteria 6668
438 Ga0207644_10010401 3300025931 Bacteria 6130
439 Ga0207644_10011430 3300025931 Bacteria 5874
440 Ga0207644_10015764 3300025931 Bacteria 5080
441 Ga0207644_10017295 3300025931 Bacteria 4867
442 Ga0207644_10029367 3300025931 Bacteria 3814
443 Ga0207644_10030228 3300025931 Bacteria 3764
444 Ga0207644_10060211 3300025931 Bacteria 2747
445 Ga0207644_10108880 3300025931 Bacteria 2092
446 Ga0207690_10008126 3300025932 Bacteria 6225
447 Ga0207706_10000149 3300025933 Bacteria 76532
448 Ga0207706_10004918 3300025933 Bacteria 12497
449 Ga0207706_10063073 3300025933 Bacteria 3263
450 Ga0207706_10197542 3300025933 Bacteria 1764
451 Ga0207670_10007087 3300025936 Bacteria 6243
452 Ga0207669_10002834 3300025937 Bacteria 7429
453 Ga0207669_10005706 3300025937 Bacteria 5614
454 Ga0207669_10008202 3300025937 Bacteria 4893
455 Ga0207669_10094153 3300025937 Bacteria 1959
456 Ga0207669_10145510 3300025937 Bacteria 1652
457 Ga0207704_10011475 3300025938 Bacteria 4362
458 Ga0207704_10018556 3300025938 Bacteria 3634
459 Ga0207704_10075417 3300025938 Bacteria 2156
460 Ga0207704_10252369 3300025938 Bacteria 1325
461 Ga0207704_10274919 3300025938 Bacteria 1277
462 Ga0207691_10000229 3300025940 Bacteria 54461
463 Ga0207691_10000427 3300025940 Bacteria 41828
464 Ga0207691_10002230 3300025940 Bacteria 18966
465 Ga0207691_10012281 3300025940 Bacteria 8210
466 Ga0207691_10023136 3300025940 Bacteria 5850
467 Ga0207691_10098557 3300025940 Bacteria 2611
468 Ga0207691_10143168 3300025940 Bacteria 2105
469 Ga0207691_10290176 3300025940 Bacteria 1407
470 Ga0207711_10062825 3300025941 Bacteria 3204
471 Ga0207711_10099325 3300025941 Bacteria 2573
472 Ga0207711_10173222 3300025941 Bacteria 1959
473 Ga0207711_10336826 3300025941 Bacteria 1396
474 Ga0207689_10000534 3300025942 Bacteria 36072
475 Ga0207689_10014374 3300025942 Bacteria 6734
476 Ga0207689_10020977 3300025942 Bacteria 5492
477 Ga0207689_10022098 3300025942 Bacteria 5350
478 Ga0207661_10042690 3300025944 Bacteria 3576
479 Ga0207679_10007689 3300025945 Bacteria 6847
480 Ga0207679_10030294 3300025945 Bacteria 3776
481 Ga0207679_10037851 3300025945 Bacteria 3433
482 Ga0207679_10050669 3300025945 Bacteria 3035
483 Ga0207679_10109357 3300025945 Bacteria 2178
484 Ga0207667_10006125 3300025949 Bacteria 14614
485 Ga0207667_10009172 3300025949 Bacteria 11683
486 Ga0207667_10066614 3300025949 Bacteria 3753
487 Ga0207667_10110217 3300025949 Bacteria 2840
488 Ga0207651_10000426 3300025960 Bacteria 17948
489 Ga0207651_10003355 3300025960 Bacteria 7852
490 Ga0207651_10014425 3300025960 Bacteria 4562
491 Ga0207651_10042232 3300025960 Bacteria 3033
492 Ga0207651_10109840 3300025960 Bacteria 2067
493 Ga0207651_10394827 3300025960 Bacteria 1175
494 Ga0207712_10113305 3300025961 Bacteria 2038
495 Ga0207668_10006200 3300025972 Bacteria 7059
496 Ga0207668_10023509 3300025972 Bacteria 3963
497 Ga0207668_10034913 3300025972 Bacteria 3344
498 Ga0207640_10008111 3300025981 Bacteria 5813
499 Ga0207640_10036740 3300025981 Bacteria 3077
500 Ga0207640_10127115 3300025981 Bacteria 1837
501 Ga0207658_10014038 3300025986 Bacteria 5482
502 Ga0207658_10016118 3300025986 Bacteria 5134
503 Ga0207658_10042566 3300025986 Bacteria 3295
504 Ga0207658_10054412 3300025986 Bacteria 2961
505 Ga0207677_10001186 3300026023 Bacteria 14157
506 Ga0207677_10090607 3300026023 Bacteria 2222
507 Ga0207677_10140060 3300026023 Bacteria 1851
508 Ga0207703_10006732 3300026035 Bacteria 9167
509 Ga0207703_10008279 3300026035 Bacteria 8211
510 Ga0207703_10011058 3300026035 Bacteria 7032
511 Ga0207703_10024049 3300026035 Bacteria 4793
512 Ga0207703_10028143 3300026035 Bacteria 4427
513 Ga0207639_10067425 3300026041 Bacteria 2784
514 Ga0207639_10070474 3300026041 Bacteria 2730
515 Ga0207639_10075376 3300026041 Bacteria 2652
516 Ga0207639_10268590 3300026041 Bacteria 1495
517 Ga0207678_10003299 3300026067 Bacteria 14542
518 Ga0207678_10005357 3300026067 Bacteria 11489
519 Ga0207678_10077448 3300026067 Bacteria 2848
520 Ga0207678_10243294 3300026067 Bacteria 1541
521 Ga0207708_10059652 3300026075 Bacteria 2913
522 Ga0207702_10002780 3300026078 Bacteria 16396
523 Ga0207702_10024915 3300026078 Bacteria 4964
524 Ga0207702_10030260 3300026078 Bacteria 4511
525 Ga0207702_10034801 3300026078 Bacteria 4213
526 Ga0207641_10005867 3300026088 Bacteria 10421
527 Ga0207641_10007082 3300026088 Bacteria 9366
528 Ga0207641_10012653 3300026088 Bacteria 6918
529 Ga0207641_10044089 3300026088 Bacteria 3749
530 Ga0207641_10071896 3300026088 Bacteria 2977
531 Ga0207641_10138801 3300026088 Bacteria 2190
532 Ga0207641_10175007 3300026088 Bacteria 1962
533 Ga0207648_10007896 3300026089 Bacteria 10380
534 Ga0207648_10009020 3300026089 Bacteria 9592
535 Ga0207648_10015197 3300026089 Bacteria 7086
536 Ga0207648_10026307 3300026089 Bacteria 5173
537 Ga0207648_10054752 3300026089 Bacteria 3483
538 Ga0207676_10000572 3300026095 Bacteria 30479
539 Ga0207676_10008732 3300026095 Bacteria 7207
540 Ga0207676_10024429 3300026095 Bacteria 4471
541 Ga0207676_10029091 3300026095 Bacteria 4133
542 Ga0207676_10032079 3300026095 Bacteria 3956
543 Ga0207676_10053510 3300026095 Bacteria 3160
544 Ga0207676_10060766 3300026095 Bacteria 2990
545 Ga0207676_10230755 3300026095 Bacteria 1654
546 Ga0207676_10348655 3300026095 Bacteria 1368
547 Ga0207674_10000020 3300026116 Bacteria 162474
548 Ga0207674_10005781 3300026116 Bacteria 14669
549 Ga0207674_10016690 3300026116 Bacteria 8025
550 Ga0207674_10026116 3300026116 Bacteria 6213
551 Ga0207674_10055498 3300026116 Bacteria 4027
552 Ga0207674_10200449 3300026116 Bacteria 1945
553 Ga0207675_100000977 3300026118 Bacteria 28393
554 Ga0207675_100095977 3300026118 Bacteria 2791
555 Ga0207675_100142898 3300026118 Bacteria 2274
556 Ga0207675_100176299 3300026118 Bacteria 2045
557 Ga0207683_10000255 3300026121 Bacteria 47453
558 Ga0207683_10009517 3300026121 Bacteria 8284
559 Ga0207683_10009854 3300026121 Bacteria 8149
560 Ga0207683_10012448 3300026121 Bacteria 7261
561 Ga0207683_10103230 3300026121 Bacteria 2546
562 Ga0207683_10183269 3300026121 Bacteria 1899
563 Ga0207683_10247104 3300026121 Bacteria 1628
564 Ga0207698_10000678 3300026142 Bacteria 19757
565 Ga0207698_10040085 3300026142 Bacteria 3476
566 Ga0207698_10096091 3300026142 Bacteria 2441
567 Ga0207698_10156733 3300026142 Bacteria 1985
568 Ga0207698_10163891 3300026142 Bacteria 1948
569 Ga0209969_1004367 3300027360 Bacteria 1976
570 Ga0209981_1009139 3300027378 Bacteria 1353
571 Ga0210000_1000587 3300027462 Bacteria 4982
572 Ga0209995_1002182 3300027471 Bacteria 3075
573 Ga0209999_1003367 3300027543 Bacteria 2854
574 Ga0209970_1014656 3300027614 Bacteria 1302
575 Ga0209983_1015547 3300027665 Bacteria 1570
576 Ga0209971_1008724 3300027682 Bacteria 2404
577 Ga0209974_10005410 3300027876 Bacteria 4494
578 Ga0268266_10030810 3300028379 Bacteria 4555
579 Ga0268266_10220163 3300028379 Bacteria 1744
580 Ga0268265_10059617 3300028380 Bacteria 2921
581 Ga0268265_10184664 3300028380 Bacteria 1795
582 Ga0268265_10204180 3300028380 Bacteria 1717
583 Ga0268264_10003403 3300028381 Bacteria 13736
584 Ga0268264_10004892 3300028381 Bacteria 11351
585 Ga0268264_10023821 3300028381 Bacteria 4994
586 Ga0268264_10024856 3300028381 Bacteria 4894
587 Ga0268264_10204319 3300028381 Bacteria 1809
588 Ga0265334_10011495 3300028573 Bacteria 3727
589 Ga0307517_10029255 3300028786 Bacteria 6516
590 Ga0307515_10027818 3300028794 Bacteria 9641
591 Ga0307515_10045696 3300028794 Bacteria 6718
592 Ga0265763_1000043 3300030763 Bacteria 4926
593 Ga0265332_10004952 3300031238 Bacteria 6191
594 Ga0265329_10006218 3300031242 Bacteria 4756
595 Ga0265340_10037750 3300031247 Bacteria 2392
596 Ga0265331_10002953 3300031250 Bacteria 11208
597 Ga0265316_10011908 3300031344 Bacteria 7820
598 Ga0307513_10002039 3300031456 Bacteria 28431
599 Ga0307513_10091844 3300031456 Bacteria 3092
600 Ga0307509_10003320 3300031507 Bacteria 24618
601 Ga0307509_10015069 3300031507 Bacteria 9054
602 Ga0307509_10049191 3300031507 Bacteria 4522
603 Ga0307509_10323607 3300031507 Bacteria 1277
604 Ga0307508_10013319 3300031616 Bacteria 7520
605 Ga0307508_10035587 3300031616 Bacteria 4487
606 Ga0307508_10088128 3300031616 Bacteria 2687
607 Ga0265314_10000675 3300031711 Bacteria 41616
608 Ga0307405_10078564 3300031731 Bacteria 2148
609 Ga0307412_10009961 3300031911 Bacteria 5467
610 Ga0307409_100019238 3300031995 Bacteria 4617
611 Ga0307409_100175482 3300031995 Bacteria 1891
612 Ga0307416_100003082 3300032002 Bacteria 9747
613 Ga0307416_100021079 3300032002 Bacteria 4669
614 Ga0307414_10105381 3300032004 Bacteria 2132
615 Ga0307414_10223272 3300032004 Bacteria 1548
616 Ga0307415_100006914 3300032126 Bacteria 6160
617 Ga0307507_10038308 3300033179 Bacteria 4864
618 Ga0307510_10004077 3300033180 Bacteria 17138
619 Ga0373932_0008285 3300035112 Bacteria 2483
620 Ga0373954_0031280 3300035118 Bacteria 2457
621 Ga0373955_0161011 3300035172 Bacteria 1325
622 Ga0373931_0011481 3300035691 Bacteria 4281
623 Ga0373931_0116909 3300035691 Bacteria 1520
624 Ga0373931_0215223 3300035691 Bacteria 1154
625 Ga0373935_0309779 3300035692 Bacteria 1118
626 Ga0373927_0006163 3300035695 Bacteria 8196
627 Ga0373937_0063736 3300036401 Bacteria 3390
628 Ga0373937_0272260 3300036401 Bacteria 1598
629 Ga0373925_0055592 3300037068 Bacteria 2964
630 Ga0373925_0288195 3300037068 Bacteria 1324
631 Ga0395899_0035008 3300037312 Bacteria 3771
632 Ga0395900_0042602 3300037418 Bacteria 4678
633 Ga0395900_0178929 3300037418 Bacteria 2156
634 Ga0395898_0350567 3300037466 Bacteria 1408
635 Ga0395905_0119984 3300037471 Bacteria 2471
636 Ga0395901_0047820 3300038443 Bacteria 4442
637 Ga0395901_0309598 3300038443 Bacteria 1636
638 Ga0436363_0039369 3300039450 Bacteria 2254
639 Ga0436363_1432274 3300039450 Bacteria 3391
640 Ga0439460_0014745 3300042461 Bacteria 2057
641 Ga0451577_0087317 3300042876 Bacteria 2783
642 Ga0453683_0002604 3300044673 Bacteria 13836
643 Ga0466957_0015486 3300044842 Bacteria 4454
644 Ga0451576_0000958 3300045051 Bacteria 54063
645 Ga0451576_0021618 3300045051 Bacteria 6990
646 Ga0451576_0261011 3300045051 Bacteria 1811
647 Ga0466958_0054661 3300045836 Unclassified 2421
648 Ga0466967_0060948 3300045976 Bacteria 3346
649 Ga0466967_0345095 3300045976 Bacteria 1440
650 Ga0495592_0000091 3300046454 Bacteria 79692
651 Ga0495629_0000119 3300046459 Bacteria 69922
652 Ga0495629_0325573 3300046459 Bacteria 1050
653 Ga0495638_0002000 3300046460 Bacteria 17405
654 Ga0495641_0036929 3300046461 Bacteria 2293
655 Ga0495641_0159846 3300046461 Bacteria 1008
656 Ga0495653_0000105 3300046463 Bacteria 69642
657 Ga0495650_0008654 3300046471 Bacteria 5898
658 Ga0495580_0037962 3300046472 Bacteria 3453
659 Ga0495580_0284869 3300046472 Bacteria 1127
660 Ga0495582_0006122 3300046473 Bacteria 6697
661 Ga0495582_0194811 3300046473 Bacteria 1157
662 Ga0495605_0004840 3300046474 Bacteria 7875
663 Ga0495639_0039657 3300046475 Bacteria 2118
664 Ga0495596_0013806 3300046500 Bacteria 3416
665 Ga0495583_0014674 3300046506 Bacteria 4307
666 Ga0495618_0138351 3300046514 Bacteria 1557
667 Ga0495620_0025057 3300046515 Bacteria 2828
668 Ga0495628_0065838 3300046516 Bacteria 2833
669 Ga0495630_0006184 3300046517 Bacteria 8493
670 Ga0495632_0027203 3300046519 Bacteria 2998
671 Ga0495648_0062567 3300046524 Bacteria 2203
672 Ga0495648_0070644 3300046524 Bacteria 2027
673 Ga0495642_0029869 3300046528 Bacteria 2179
674 Ga0495642_0059778 3300046528 Bacteria 1580
675 Ga0495598_0003719 3300046537 Bacteria 3258
676 Ga0495621_0150695 3300046539 Bacteria 915
677 Ga0495597_0049496 3300046542 Bacteria 1857
678 Ga0495645_0084567 3300046543 Bacteria 2272
679 Ga0495656_0012291 3300046615 Bacteria 3156
680 Ga0495668_0025062 3300046616 Bacteria 3391
681 Ga0495611_0006324 3300046648 Bacteria 5046
682 Ga0495658_0020138 3300046683 Bacteria 3496
683 Ga0495613_0088270 3300046689 Bacteria 2247
684 Ga0495613_0110946 3300046689 Bacteria 1976
685 Ga0495624_0008327 3300046690 Bacteria 7247
686 Ga0495636_0081213 3300047318 Bacteria 1396
687 Ga0495674_0140882 3300047319 Bacteria 2027
688 Ga0495676_0022853 3300047321 Bacteria 5434
689 Ga0495687_041223 3300047443 Bacteria 2027
690 Ga0495675_0192687 3300047444 Bacteria 1244
691 Ga0495677_0030820 3300047445 Bacteria 1952
692 Ga0495679_000036 3300047446 Bacteria 161473
693 Ga0495673_0053985 3300047469 Bacteria 1749
694 Ga0495673_0068673 3300047469 Bacteria 1497
695 Ga0495686_0209793 3300047472 Bacteria 1113
696 Ga0495593_0006473 3300047673 Bacteria 6862
697 Ga0495593_0042344 3300047673 Bacteria 2444
698 Ga0495602_0067890 3300048088 Bacteria 3065
699 Ga0495615_0005970 3300048090 Bacteria 2226
700 Ga0496100_0193290 3300048903 Bacteria 1479
701 Ga0496100_0340207 3300048903 Bacteria 1131
702 Ga0496101_0109186 3300048904 Bacteria 2081
703 Ga0496102_0018172 3300048905 Bacteria 6171
704 Ga0496102_0026199 3300048905 Bacteria 5198
705 Ga0496102_0189230 3300048905 Bacteria 1939
706 Ga0496102_0568276 3300048905 Bacteria 1057
707 Ga0496104_0010876 3300048907 Bacteria 8139
708 Ga0496104_0047214 3300048907 Bacteria 4058
709 Ga0496104_0275556 3300048907 Bacteria 1595
710 Ga0496105_0005406 3300048908 Bacteria 9693
711 Ga0496106_0005880 3300048909 Bacteria 9071
712 Ga0496106_0093215 3300048909 Bacteria 2327
713 Ga0496107_0146360 3300048910 Bacteria 1747
714 Ga0496108_0055598 3300048911 Bacteria 3324
715 Ga0496108_0122521 3300048911 Bacteria 2231
716 Ga0496108_0143712 3300048911 Bacteria 2056
717 Ga0496109_0097929 3300048912 Bacteria 2719
718 Ga0496110_0429548 3300048913 Bacteria 1204
719 Ga0496112_0142010 3300048915 Bacteria 2370
720 Ga0496113_0052135 3300048916 Bacteria 3054
721 Ga0496114_0090010 3300048917 Bacteria 2605
722 Ga0496121_0016679 3300048924 Bacteria 7560
723 Ga0496126_0016483 3300048929 Bacteria 7385
724 Ga0496126_0172501 3300048929 Bacteria 1842
725 nmdc:mga0yw44_131089_c1 3300050492 Bacteria 1623
726 nmdc:mga0k408_185355_c1 3300050493 Bacteria 1241
727 nmdc:mga0k408_2166_c1 3300050493 Bacteria 10537
728 nmdc:mga06z11_7758_c1 3300050494 Bacteria 4435
729 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
730 nmdc:mga09592_140_c1 3300050508 Bacteria 48059
731 nmdc:mga0qj67_1823_c1 3300050509 Bacteria 15086
732 nmdc:mga06r32_288860_c1 3300050510 Bacteria 1627
733 nmdc:mga06r32_4881_c1 3300050510 Bacteria 12079
734 nmdc:mga0n895_344162_c1 3300050512 Bacteria 1510
735 Ga0495601_0060369 3300053077 Bacteria 2406
736 Ga0495612_0075047 3300053078 Bacteria 1415
737 Ga0495619_0164616 3300053085 Bacteria 1532
738 Ga0500641_0002176 3300053096 Bacteria 6942

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0429548 Ga0496110_0429548_128_1108 286
2 3300005434 Ga0070709_10008703 Ga0070709_100087033 289
3 3300005436 Ga0070713_100004952 Ga0070713_1000049525 289
4 3300006163 Ga0070715_10038775 Ga0070715_100387751 289
5 3300009094 Ga0111539_10683744 Ga0111539_106837441 289
6 3300025898 Ga0207692_10125477 Ga0207692_101254772 289
7 3300025906 Ga0207699_10004274 Ga0207699_100042744 289
8 3300025915 Ga0207693_10004943 Ga0207693_100049437 289
9 3300025929 Ga0207664_10034959 Ga0207664_100349592 289
10 3300031247 Ga0265340_10037750 Ga0265340_100377503 289
11 3300046461 Ga0495641_0159846 Ga0495641_0159846_15_884 289
12 3300046459 Ga0495629_0325573 Ga0495629_0325573_13_894 293
13 3300046539 Ga0495621_0150695 Ga0495621_0150695_24_905 293
14 3300006178 Ga0075367_10002955 Ga0075367_100029556 297
15 3300050494 nmdc:mga06z11_7758_c1 nmdc:mga06z11_7758_c1_2633_3613 297
16 3300044842 Ga0466957_0015486 Ga0466957_0015486_3295_4260 300
17 3300045836 Ga0466958_0054661 Ga0466958_0054661_233_1198 300
18 3300048904 Ga0496101_0109186 Ga0496101_0109186_101_1090 300
19 3300048905 Ga0496102_0189230 Ga0496102_0189230_113_1102 300
20 3300048907 Ga0496104_0010876 Ga0496104_0010876_1669_2658 300
21 3300048908 Ga0496105_0005406 Ga0496105_0005406_2493_3482 300
22 3300048911 Ga0496108_0143712 Ga0496108_0143712_674_1651 300
23 3300048917 Ga0496114_0090010 Ga0496114_0090010_1448_2437 300
24 3300025938 Ga0207704_10252369 Ga0207704_102523692 307
25 3300048929 Ga0496126_0172501 Ga0496126_0172501_875_1804 307
26 3300005618 Ga0068864_100049557 Ga0068864_1000495573 308
27 3300037418 Ga0395900_0042602 Ga0395900_0042602_2608_3564 309
28 3300038443 Ga0395901_0047820 Ga0395901_0047820_655_1611 309
29 3300005354 Ga0070675_100050125 Ga0070675_1000501252 310
30 3300035692 Ga0373935_0309779 Ga0373935_0309779_166_1107 310
31 3300005331 Ga0070670_100008462 Ga0070670_10000846210 311
32 3300005436 Ga0070713_100125784 Ga0070713_1001257843 311
33 3300005330 Ga0070690_100042787 Ga0070690_1000427872 312
34 3300005333 Ga0070677_10002013 Ga0070677_100020132 312
35 3300005335 Ga0070666_10033038 Ga0070666_100330383 312
36 3300005338 Ga0068868_100112875 Ga0068868_1001128752 312
37 3300005340 Ga0070689_100010101 Ga0070689_1000101017 312
38 3300005353 Ga0070669_100075027 Ga0070669_1000750271 312
39 3300005353 Ga0070669_100135105 Ga0070669_1001351053 312
40 3300005354 Ga0070675_100407801 Ga0070675_1004078012 312
41 3300005355 Ga0070671_100005567 Ga0070671_1000055672 312
42 3300005355 Ga0070671_100159378 Ga0070671_1001593782 312
43 3300005356 Ga0070674_100194891 Ga0070674_1001948912 312
44 3300005364 Ga0070673_100058265 Ga0070673_1000582653 312
45 3300005364 Ga0070673_100132910 Ga0070673_1001329102 312
46 3300005367 Ga0070667_100013595 Ga0070667_1000135952 312
47 3300005434 Ga0070709_10084055 Ga0070709_100840553 312
48 3300005438 Ga0070701_10052732 Ga0070701_100527322 312
49 3300005441 Ga0070700_100022620 Ga0070700_1000226203 312
50 3300005457 Ga0070662_100003262 Ga0070662_10000326211 312
51 3300005459 Ga0068867_100004893 Ga0068867_1000048937 312
52 3300005466 Ga0070685_10056628 Ga0070685_100566283 312
53 3300005543 Ga0070672_100168707 Ga0070672_1001687072 312
54 3300005548 Ga0070665_100570285 Ga0070665_1005702852 312
55 3300005577 Ga0068857_100133405 Ga0068857_1001334053 312
56 3300005615 Ga0070702_100259425 Ga0070702_1002594252 312
57 3300005617 Ga0068859_100214803 Ga0068859_1002148033 312
58 3300005618 Ga0068864_100001959 Ga0068864_1000019592 312
59 3300005618 Ga0068864_100044371 Ga0068864_1000443713 312
60 3300005618 Ga0068864_100069289 Ga0068864_1000692893 312
61 3300005718 Ga0068866_10005854 Ga0068866_100058542 312
62 3300005840 Ga0068870_10031559 Ga0068870_100315593 312
63 3300005841 Ga0068863_100082868 Ga0068863_1000828684 312
64 3300005841 Ga0068863_100133660 Ga0068863_1001336602 312
65 3300005842 Ga0068858_100029114 Ga0068858_1000291145 312
66 3300005843 Ga0068860_100039107 Ga0068860_1000391076 312
67 3300006028 Ga0070717_10259098 Ga0070717_102590983 312
68 3300006358 Ga0068871_100009333 Ga0068871_1000093335 312
69 3300006881 Ga0068865_100025566 Ga0068865_1000255663 312
70 3300006931 Ga0097620_100214795 Ga0097620_1002147951 312
71 3300009176 Ga0105242_10014088 Ga0105242_100140887 312
72 3300009177 Ga0105248_10010702 Ga0105248_100107025 312
73 3300013297 Ga0157378_10009099 Ga0157378_100090994 312
74 3300013308 Ga0157375_10115633 Ga0157375_101156332 312
75 3300014326 Ga0157380_10126496 Ga0157380_101264962 312
76 3300014745 Ga0157377_10030418 Ga0157377_100304183 312
77 3300014968 Ga0157379_10048460 Ga0157379_100484602 312
78 3300014969 Ga0157376_10032082 Ga0157376_100320825 312
79 3300025893 Ga0207682_10003662 Ga0207682_100036624 312
80 3300025899 Ga0207642_10017417 Ga0207642_100174172 312
81 3300025901 Ga0207688_10036655 Ga0207688_100366553 312
82 3300025901 Ga0207688_10086011 Ga0207688_100860112 312
83 3300025907 Ga0207645_10013116 Ga0207645_100131163 312
84 3300025918 Ga0207662_10006278 Ga0207662_100062784 312
85 3300025925 Ga0207650_10053216 Ga0207650_100532164 312
86 3300025926 Ga0207659_10026817 Ga0207659_100268173 312
87 3300025931 Ga0207644_10030228 Ga0207644_100302283 312
88 3300025931 Ga0207644_10060211 Ga0207644_100602112 312
89 3300025933 Ga0207706_10004918 Ga0207706_100049184 312
90 3300025937 Ga0207669_10005706 Ga0207669_100057062 312
91 3300025938 Ga0207704_10075417 Ga0207704_100754173 312
92 3300025940 Ga0207691_10290176 Ga0207691_102901761 312
93 3300025960 Ga0207651_10042232 Ga0207651_100422323 312
94 3300026023 Ga0207677_10140060 Ga0207677_101400602 312
95 3300026035 Ga0207703_10011058 Ga0207703_100110586 312
96 3300026088 Ga0207641_10071896 Ga0207641_100718962 312
97 3300026088 Ga0207641_10138801 Ga0207641_101388012 312
98 3300026089 Ga0207648_10054752 Ga0207648_100547523 312
99 3300026095 Ga0207676_10024429 Ga0207676_100244293 312
100 3300026121 Ga0207683_10009517 Ga0207683_100095177 312
101 3300027378 Ga0209981_1009139 Ga0209981_10091392 312
102 3300028380 Ga0268265_10059617 Ga0268265_100596173 312
103 3300028381 Ga0268264_10024856 Ga0268264_100248564 312
104 3300028381 Ga0268264_10204319 Ga0268264_102043192 312
105 3300031238 Ga0265332_10004952 Ga0265332_100049527 312
106 3300031242 Ga0265329_10006218 Ga0265329_100062185 312
107 3300031250 Ga0265331_10002953 Ga0265331_100029533 312
108 3300031344 Ga0265316_10011908 Ga0265316_100119082 312
109 3300031711 Ga0265314_10000675 Ga0265314_1000067531 312
110 3300045051 Ga0451576_0261011 Ga0451576_0261011_225_1199 312
111 3300045976 Ga0466967_0060948 Ga0466967_0060948_311_1276 312
112 3300046528 Ga0495642_0029869 Ga0495642_0029869_880_1854 312
113 3300046528 Ga0495642_0059778 Ga0495642_0059778_216_1163 312
114 3300046537 Ga0495598_0003719 Ga0495598_0003719_1195_2169 312
115 3300046615 Ga0495656_0012291 Ga0495656_0012291_423_1391 312
116 3300047443 Ga0495687_041223 Ga0495687_041223_63_1010 312
117 3300048090 Ga0495615_0005970 Ga0495615_0005970_1162_2130 312
118 3300005328 Ga0070676_10006626 Ga0070676_100066263 313
119 3300005336 Ga0070680_100330288 Ga0070680_1003302882 313
120 3300005338 Ga0068868_100043259 Ga0068868_1000432592 313
121 3300005344 Ga0070661_100032933 Ga0070661_1000329333 313
122 3300005355 Ga0070671_100058361 Ga0070671_1000583612 313
123 3300005458 Ga0070681_10022228 Ga0070681_100222286 313
124 3300005459 Ga0068867_100007088 Ga0068867_1000070882 313
125 3300005543 Ga0070672_100038186 Ga0070672_1000381864 313
126 3300005577 Ga0068857_100098900 Ga0068857_1000989002 313
127 3300005834 Ga0068851_10051815 Ga0068851_100518152 313
128 3300009177 Ga0105248_10021738 Ga0105248_100217388 313
129 3300013100 Ga0157373_10154523 Ga0157373_101545232 313
130 3300025912 Ga0207707_10041031 Ga0207707_100410312 313
131 3300025917 Ga0207660_10127395 Ga0207660_101273952 313
132 3300025931 Ga0207644_10008628 Ga0207644_100086288 313
133 3300025931 Ga0207644_10015764 Ga0207644_100157646 313
134 3300025941 Ga0207711_10173222 Ga0207711_101732221 313
135 3300025981 Ga0207640_10036740 Ga0207640_100367402 313
136 3300026089 Ga0207648_10007896 Ga0207648_100078962 313
137 3300026116 Ga0207674_10026116 Ga0207674_100261165 313
138 3300037068 Ga0373925_0288195 Ga0373925_0288195_57_1043 313
139 3300045051 Ga0451576_0000958 Ga0451576_0000958_43810_44778 313
140 3300046459 Ga0495629_0000119 Ga0495629_0000119_50381_51343 313
141 3300046460 Ga0495638_0002000 Ga0495638_0002000_4221_5183 313
142 3300046461 Ga0495641_0036929 Ga0495641_0036929_1180_2142 313
143 3300046463 Ga0495653_0000105 Ga0495653_0000105_50114_51076 313
144 3300046471 Ga0495650_0008654 Ga0495650_0008654_505_1467 313
145 3300046473 Ga0495582_0006122 Ga0495582_0006122_4955_5917 313
146 3300046474 Ga0495605_0004840 Ga0495605_0004840_22_984 313
147 3300046500 Ga0495596_0013806 Ga0495596_0013806_134_1096 313
148 3300046506 Ga0495583_0014674 Ga0495583_0014674_763_1725 313
149 3300046514 Ga0495618_0138351 Ga0495618_0138351_76_1038 313
150 3300046515 Ga0495620_0025057 Ga0495620_0025057_1233_2195 313
151 3300046516 Ga0495628_0065838 Ga0495628_0065838_616_1578 313
152 3300046517 Ga0495630_0006184 Ga0495630_0006184_3376_4338 313
153 3300046524 Ga0495648_0070644 Ga0495648_0070644_743_1705 313
154 3300046542 Ga0495597_0049496 Ga0495597_0049496_444_1406 313
155 3300046648 Ga0495611_0006324 Ga0495611_0006324_279_1241 313
156 3300046689 Ga0495613_0088270 Ga0495613_0088270_927_1889 313
157 3300046690 Ga0495624_0008327 Ga0495624_0008327_4307_5269 313
158 3300047321 Ga0495676_0022853 Ga0495676_0022853_3564_4526 313
159 3300047446 Ga0495679_000036 Ga0495679_000036_35628_36590 313
160 3300047469 Ga0495673_0053985 Ga0495673_0053985_78_1040 313
161 3300047472 Ga0495686_0209793 Ga0495686_0209793_38_1000 313
162 3300047673 Ga0495593_0006473 Ga0495593_0006473_1507_2469 313
163 3300048088 Ga0495602_0067890 Ga0495602_0067890_1354_2316 313
164 3300048924 Ga0496121_0016679 Ga0496121_0016679_3332_4294 313
165 3300005331 Ga0070670_100277101 Ga0070670_1002771012 314
166 3300005455 Ga0070663_100122677 Ga0070663_1001226772 314
167 3300005459 Ga0068867_100245561 Ga0068867_1002455612 314
168 3300005983 Ga0081540_1000313 Ga0081540_100031315 314
169 3300014745 Ga0157377_10113807 Ga0157377_101138071 314
170 3300025893 Ga0207682_10005486 Ga0207682_100054862 314
171 3300025942 Ga0207689_10000534 Ga0207689_1000053410 314
172 3300028794 Ga0307515_10045696 Ga0307515_100456966 314
173 3300031456 Ga0307513_10002039 Ga0307513_1000203911 314
174 3300039450 Ga0436363_0039369 Ga0436363_0039369_1064_2035 314
175 3300048907 Ga0496104_0047214 Ga0496104_0047214_2079_3050 314
176 3300005330 Ga0070690_100041543 Ga0070690_1000415432 315
177 3300005353 Ga0070669_100163088 Ga0070669_1001630881 315
178 3300005353 Ga0070669_100278085 Ga0070669_1002780852 315
179 3300005456 Ga0070678_100077605 Ga0070678_1000776053 315
180 3300005539 Ga0068853_100144640 Ga0068853_1001446402 315
181 3300005564 Ga0070664_100046254 Ga0070664_1000462542 315
182 3300005616 Ga0068852_100007090 Ga0068852_1000070906 315
183 3300005618 Ga0068864_100024057 Ga0068864_1000240574 315
184 3300005841 Ga0068863_100559558 Ga0068863_1005595581 315
185 3300005844 Ga0068862_100240530 Ga0068862_1002405302 315
186 3300006237 Ga0097621_100385941 Ga0097621_1003859411 315
187 3300009101 Ga0105247_10021696 Ga0105247_100216963 315
188 3300009551 Ga0105238_10144516 Ga0105238_101445162 315
189 3300013308 Ga0157375_10355364 Ga0157375_103553641 315
190 3300014968 Ga0157379_10350138 Ga0157379_103501382 315
191 3300017792 Ga0163161_10151608 Ga0163161_101516082 315
192 3300021388 Ga0213875_10055598 Ga0213875_100555981 315
193 3300025900 Ga0207710_10012681 Ga0207710_100126813 315
194 3300025904 Ga0207647_10188483 Ga0207647_101884831 315
195 3300025924 Ga0207694_10116776 Ga0207694_101167762 315
196 3300025927 Ga0207687_10055910 Ga0207687_100559102 315
197 3300026075 Ga0207708_10059652 Ga0207708_100596522 315
198 3300026088 Ga0207641_10175007 Ga0207641_101750072 315
199 3300026095 Ga0207676_10008732 Ga0207676_100087324 315
200 3300026116 Ga0207674_10016690 Ga0207674_100166903 315
201 3300026121 Ga0207683_10103230 Ga0207683_101032303 315
202 3300026142 Ga0207698_10163891 Ga0207698_101638913 315
203 3300028380 Ga0268265_10204180 Ga0268265_102041802 315
204 3300037068 Ga0373925_0055592 Ga0373925_0055592_1862_2827 315
205 3300048905 Ga0496102_0568276 Ga0496102_0568276_25_999 315
206 3300053078 Ga0495612_0075047 Ga0495612_0075047_144_1112 315
207 3300053096 Ga0500641_0002176 Ga0500641_0002176_3147_4133 315
208 3300005335 Ga0070666_10230815 Ga0070666_102308152 316
209 3300005435 Ga0070714_100132569 Ga0070714_1001325692 316
210 3300005436 Ga0070713_100186705 Ga0070713_1001867052 316
211 3300005437 Ga0070710_10002378 Ga0070710_100023786 316
212 3300005548 Ga0070665_100113254 Ga0070665_1001132543 316
213 3300005614 Ga0068856_100210731 Ga0068856_1002107312 316
214 3300005937 Ga0081455_10002056 Ga0081455_1000205615 316
215 3300006038 Ga0075365_10118008 Ga0075365_101180082 316
216 3300006178 Ga0075367_10036455 Ga0075367_100364552 316
217 3300006844 Ga0075428_100014820 Ga0075428_1000148209 316
218 3300006880 Ga0075429_100000003 Ga0075429_10000000359 316
219 3300009098 Ga0105245_10118338 Ga0105245_101183382 316
220 3300009147 Ga0114129_10005359 Ga0114129_100053592 316
221 3300009147 Ga0114129_10183640 Ga0114129_101836403 316
222 3300009148 Ga0105243_10086073 Ga0105243_100860733 316
223 3300009148 Ga0105243_10189703 Ga0105243_101897032 316
224 3300011119 Ga0105246_10083596 Ga0105246_100835962 316
225 3300014326 Ga0157380_10326050 Ga0157380_103260501 316
226 3300025928 Ga0207700_10195097 Ga0207700_101950972 316
227 3300025941 Ga0207711_10099325 Ga0207711_100993253 316
228 3300028573 Ga0265334_10011495 Ga0265334_100114953 316
229 3300030763 Ga0265763_1000043 Ga0265763_10000433 316
230 3300035695 Ga0373927_0006163 Ga0373927_0006163_154_1131 316
231 3300037466 Ga0395898_0350567 Ga0395898_0350567_324_1292 316
232 3300046472 Ga0495580_0284869 Ga0495580_0284869_12_989 316
233 3300046475 Ga0495639_0039657 Ga0495639_0039657_680_1657 316
234 3300048907 Ga0496104_0275556 Ga0496104_0275556_196_1173 316
235 3300048929 Ga0496126_0016483 Ga0496126_0016483_6029_7006 316
236 3300050492 nmdc:mga0yw44_131089_c1 nmdc:mga0yw44_131089_c1_219_1187 316
237 3300050507 nmdc:mga05p37_77_c1 nmdc:mga05p37_77_c1_51451_52428 316
238 3300050508 nmdc:mga09592_140_c1 nmdc:mga09592_140_c1_20083_21060 316
239 3300050510 nmdc:mga06r32_288860_c1 nmdc:mga06r32_288860_c1_563_1540 316
240 3300005328 Ga0070676_10010777 Ga0070676_100107775 317
241 3300005330 Ga0070690_100013351 Ga0070690_1000133512 317
242 3300005331 Ga0070670_100072433 Ga0070670_1000724333 317
243 3300005334 Ga0068869_100008210 Ga0068869_1000082102 317
244 3300005334 Ga0068869_100015759 Ga0068869_1000157595 317
245 3300005335 Ga0070666_10003117 Ga0070666_100031174 317
246 3300005335 Ga0070666_10006093 Ga0070666_100060932 317
247 3300005338 Ga0068868_100006024 Ga0068868_1000060243 317
248 3300005338 Ga0068868_100112766 Ga0068868_1001127662 317
249 3300005340 Ga0070689_100007815 Ga0070689_1000078152 317
250 3300005340 Ga0070689_100112561 Ga0070689_1001125612 317
251 3300005353 Ga0070669_100017967 Ga0070669_1000179672 317
252 3300005353 Ga0070669_100025112 Ga0070669_1000251122 317
253 3300005354 Ga0070675_100015033 Ga0070675_1000150335 317
254 3300005354 Ga0070675_100040486 Ga0070675_1000404862 317
255 3300005355 Ga0070671_100054877 Ga0070671_1000548774 317
256 3300005356 Ga0070674_100108214 Ga0070674_1001082142 317
257 3300005364 Ga0070673_100004285 Ga0070673_1000042854 317
258 3300005364 Ga0070673_100108608 Ga0070673_1001086081 317
259 3300005367 Ga0070667_100006668 Ga0070667_1000066684 317
260 3300005367 Ga0070667_100099996 Ga0070667_1000999963 317
261 3300005456 Ga0070678_100004327 Ga0070678_1000043274 317
262 3300005459 Ga0068867_100029241 Ga0068867_1000292413 317
263 3300005539 Ga0068853_100017860 Ga0068853_1000178602 317
264 3300005543 Ga0070672_100031023 Ga0070672_1000310232 317
265 3300005543 Ga0070672_100304933 Ga0070672_1003049331 317
266 3300005548 Ga0070665_100034048 Ga0070665_1000340483 317
267 3300005617 Ga0068859_100008717 Ga0068859_10000871711 317
268 3300005618 Ga0068864_100001297 Ga0068864_10000129720 317
269 3300005718 Ga0068866_10071157 Ga0068866_100711572 317
270 3300005719 Ga0068861_100058140 Ga0068861_1000581403 317
271 3300005834 Ga0068851_10112432 Ga0068851_101124322 317
272 3300005840 Ga0068870_10152355 Ga0068870_101523552 317
273 3300005841 Ga0068863_100025750 Ga0068863_1000257502 317
274 3300005841 Ga0068863_100097888 Ga0068863_1000978882 317
275 3300005842 Ga0068858_100000729 Ga0068858_1000007295 317
276 3300005842 Ga0068858_100010459 Ga0068858_1000104598 317
277 3300005843 Ga0068860_100036517 Ga0068860_1000365175 317
278 3300005844 Ga0068862_100187360 Ga0068862_1001873602 317
279 3300006358 Ga0068871_100063765 Ga0068871_1000637652 317
280 3300006881 Ga0068865_100000968 Ga0068865_10000096815 317
281 3300006931 Ga0097620_100008717 Ga0097620_10000871711 317
282 3300009177 Ga0105248_10016915 Ga0105248_100169153 317
283 3300013297 Ga0157378_10200607 Ga0157378_102006072 317
284 3300013306 Ga0163162_10006321 Ga0163162_100063214 317
285 3300013306 Ga0163162_10069143 Ga0163162_100691432 317
286 3300013307 Ga0157372_10257905 Ga0157372_102579052 317
287 3300013308 Ga0157375_10061788 Ga0157375_100617883 317
288 3300014325 Ga0163163_10005612 Ga0163163_1000561212 317
289 3300014326 Ga0157380_10051443 Ga0157380_100514433 317
290 3300014326 Ga0157380_10076156 Ga0157380_100761562 317
291 3300014968 Ga0157379_10027423 Ga0157379_100274233 317
292 3300017792 Ga0163161_10014345 Ga0163161_100143453 317
293 3300017792 Ga0163161_10016630 Ga0163161_100166305 317
294 3300025315 Ga0207697_10005139 Ga0207697_100051396 317
295 3300025903 Ga0207680_10001451 Ga0207680_100014517 317
296 3300025903 Ga0207680_10006222 Ga0207680_100062226 317
297 3300025907 Ga0207645_10000930 Ga0207645_100009302 317
298 3300025921 Ga0207652_10028914 Ga0207652_100289143 317
299 3300025923 Ga0207681_10018436 Ga0207681_100184365 317
300 3300025923 Ga0207681_10085109 Ga0207681_100851092 317
301 3300025925 Ga0207650_10019766 Ga0207650_100197665 317
302 3300025926 Ga0207659_10002463 Ga0207659_100024635 317
303 3300025926 Ga0207659_10025053 Ga0207659_100250535 317
304 3300025931 Ga0207644_10000899 Ga0207644_1000089916 317
305 3300025931 Ga0207644_10029367 Ga0207644_100293671 317
306 3300025933 Ga0207706_10197542 Ga0207706_101975421 317
307 3300025936 Ga0207670_10007087 Ga0207670_100070876 317
308 3300025937 Ga0207669_10094153 Ga0207669_100941532 317
309 3300025937 Ga0207669_10145510 Ga0207669_101455102 317
310 3300025938 Ga0207704_10011475 Ga0207704_100114753 317
311 3300025938 Ga0207704_10274919 Ga0207704_102749192 317
312 3300025940 Ga0207691_10000427 Ga0207691_1000042719 317
313 3300025940 Ga0207691_10012281 Ga0207691_100122818 317
314 3300025941 Ga0207711_10062825 Ga0207711_100628252 317
315 3300025941 Ga0207711_10336826 Ga0207711_103368262 317
316 3300025942 Ga0207689_10014374 Ga0207689_100143746 317
317 3300025942 Ga0207689_10022098 Ga0207689_100220985 317
318 3300025960 Ga0207651_10000426 Ga0207651_100004265 317
319 3300025961 Ga0207712_10113305 Ga0207712_101133052 317
320 3300025972 Ga0207668_10023509 Ga0207668_100235092 317
321 3300025986 Ga0207658_10014038 Ga0207658_100140384 317
322 3300025986 Ga0207658_10016118 Ga0207658_100161184 317
323 3300026023 Ga0207677_10001186 Ga0207677_100011866 317
324 3300026023 Ga0207677_10090607 Ga0207677_100906072 317
325 3300026035 Ga0207703_10006732 Ga0207703_100067325 317
326 3300026035 Ga0207703_10028143 Ga0207703_100281432 317
327 3300026088 Ga0207641_10005867 Ga0207641_100058679 317
328 3300026088 Ga0207641_10044089 Ga0207641_100440893 317
329 3300026089 Ga0207648_10015197 Ga0207648_100151974 317
330 3300026095 Ga0207676_10000572 Ga0207676_100005729 317
331 3300026095 Ga0207676_10029091 Ga0207676_100290915 317
332 3300026118 Ga0207675_100095977 Ga0207675_1000959771 317
333 3300026118 Ga0207675_100142898 Ga0207675_1001428982 317
334 3300026121 Ga0207683_10000255 Ga0207683_1000025528 317
335 3300026121 Ga0207683_10009854 Ga0207683_100098546 317
336 3300026142 Ga0207698_10040085 Ga0207698_100400852 317
337 3300027360 Ga0209969_1004367 Ga0209969_10043672 317
338 3300027462 Ga0210000_1000587 Ga0210000_10005873 317
339 3300027471 Ga0209995_1002182 Ga0209995_10021822 317
340 3300027543 Ga0209999_1003367 Ga0209999_10033673 317
341 3300027614 Ga0209970_1014656 Ga0209970_10146562 317
342 3300027665 Ga0209983_1015547 Ga0209983_10155471 317
343 3300027682 Ga0209971_1008724 Ga0209971_10087242 317
344 3300027876 Ga0209974_10005410 Ga0209974_100054104 317
345 3300028379 Ga0268266_10030810 Ga0268266_100308103 317
346 3300028380 Ga0268265_10184664 Ga0268265_101846642 317
347 3300028381 Ga0268264_10004892 Ga0268264_1000489210 317
348 3300037471 Ga0395905_0119984 Ga0395905_0119984_1218_2195 317
349 3300042461 Ga0439460_0014745 Ga0439460_0014745_578_1558 317
350 3300046454 Ga0495592_0000091 Ga0495592_0000091_16197_17189 317
351 3300046472 Ga0495580_0037962 Ga0495580_0037962_216_1193 317
352 3300047318 Ga0495636_0081213 Ga0495636_0081213_218_1189 317
353 3300047445 Ga0495677_0030820 Ga0495677_0030820_230_1201 317
354 3300048903 Ga0496100_0340207 Ga0496100_0340207_104_1072 317
355 3300048909 Ga0496106_0093215 Ga0496106_0093215_1185_2153 317
356 3300048911 Ga0496108_0122521 Ga0496108_0122521_201_1175 317
357 3300048915 Ga0496112_0142010 Ga0496112_0142010_687_1661 317
358 3300048916 Ga0496113_0052135 Ga0496113_0052135_2026_3000 317
359 3300005327 Ga0070658_10069095 Ga0070658_100690952 318
360 3300005328 Ga0070676_10219195 Ga0070676_102191952 318
361 3300005333 Ga0070677_10039117 Ga0070677_100391172 318
362 3300005340 Ga0070689_100034823 Ga0070689_1000348234 318
363 3300005344 Ga0070661_100114099 Ga0070661_1001140992 318
364 3300005347 Ga0070668_100089486 Ga0070668_1000894863 318
365 3300005355 Ga0070671_100185377 Ga0070671_1001853772 318
366 3300005364 Ga0070673_100108377 Ga0070673_1001083772 318
367 3300005456 Ga0070678_100144515 Ga0070678_1001445152 318
368 3300005456 Ga0070678_100184737 Ga0070678_1001847372 318
369 3300005457 Ga0070662_100199012 Ga0070662_1001990122 318
370 3300006195 Ga0075366_10000957 Ga0075366_100009575 318
371 3300006846 Ga0075430_100044473 Ga0075430_1000444733 318
372 3300006871 Ga0075434_100066222 Ga0075434_1000662222 318
373 3300025893 Ga0207682_10042845 Ga0207682_100428452 318
374 3300025907 Ga0207645_10147256 Ga0207645_101472562 318
375 3300025931 Ga0207644_10006192 Ga0207644_100061922 318
376 3300026121 Ga0207683_10183269 Ga0207683_101832692 318
377 3300044673 Ga0453683_0002604 Ga0453683_0002604_2130_3110 318
378 3300045051 Ga0451576_0021618 Ga0451576_0021618_1084_2064 318
379 3300050493 nmdc:mga0k408_185355_c1 nmdc:mga0k408_185355_c1_151_1128 318
380 3300050493 nmdc:mga0k408_2166_c1 nmdc:mga0k408_2166_c1_8301_9302 318
381 3300005327 Ga0070658_10178290 Ga0070658_101782902 319
382 3300005347 Ga0070668_100017926 Ga0070668_1000179263 319
383 3300005353 Ga0070669_100082373 Ga0070669_1000823732 319
384 3300005354 Ga0070675_100008358 Ga0070675_1000083582 319
385 3300005355 Ga0070671_100024596 Ga0070671_1000245963 319
386 3300005367 Ga0070667_100002963 Ga0070667_1000029637 319
387 3300005543 Ga0070672_100002999 Ga0070672_10000299911 319
388 3300005548 Ga0070665_100080552 Ga0070665_1000805525 319
389 3300006237 Ga0097621_100027028 Ga0097621_1000270285 319
390 3300006358 Ga0068871_100016446 Ga0068871_1000164467 319
391 3300009094 Ga0111539_10696005 Ga0111539_106960051 319
392 3300009177 Ga0105248_10007025 Ga0105248_1000702514 319
393 3300009545 Ga0105237_10093770 Ga0105237_100937703 319
394 3300013296 Ga0157374_10074601 Ga0157374_100746013 319
395 3300013297 Ga0157378_10005031 Ga0157378_100050315 319
396 3300013297 Ga0157378_10156425 Ga0157378_101564252 319
397 3300013306 Ga0163162_10019386 Ga0163162_100193866 319
398 3300013308 Ga0157375_10046064 Ga0157375_100460644 319
399 3300014968 Ga0157379_10027063 Ga0157379_100270632 319
400 3300014969 Ga0157376_10042780 Ga0157376_100427803 319
401 3300025321 Ga0207656_10041790 Ga0207656_100417901 319
402 3300025923 Ga0207681_10064768 Ga0207681_100647682 319
403 3300025925 Ga0207650_10003438 Ga0207650_100034387 319
404 3300025926 Ga0207659_10013645 Ga0207659_100136456 319
405 3300025931 Ga0207644_10108880 Ga0207644_101088801 319
406 3300025940 Ga0207691_10002230 Ga0207691_100022303 319
407 3300025940 Ga0207691_10098557 Ga0207691_100985572 319
408 3300025972 Ga0207668_10034913 Ga0207668_100349131 319
409 3300025986 Ga0207658_10042566 Ga0207658_100425662 319
410 3300026095 Ga0207676_10348655 Ga0207676_103486552 319
411 3300026142 Ga0207698_10096091 Ga0207698_100960912 319
412 3300026142 Ga0207698_10156733 Ga0207698_101567332 319
413 3300028786 Ga0307517_10029255 Ga0307517_100292558 319
414 3300031456 Ga0307513_10091844 Ga0307513_100918441 319
415 3300031507 Ga0307509_10003320 Ga0307509_100033203 319
416 3300031507 Ga0307509_10015069 Ga0307509_100150692 319
417 3300031507 Ga0307509_10049191 Ga0307509_100491912 319
418 3300031616 Ga0307508_10013319 Ga0307508_100133198 319
419 3300031616 Ga0307508_10035587 Ga0307508_100355875 319
420 3300031616 Ga0307508_10088128 Ga0307508_100881282 319
421 3300033179 Ga0307507_10038308 Ga0307507_100383083 319
422 3300033180 Ga0307510_10004077 Ga0307510_1000407712 319
423 3300035691 Ga0373931_0116909 Ga0373931_0116909_255_1226 319
424 3300036401 Ga0373937_0272260 Ga0373937_0272260_327_1310 319
425 3300046519 Ga0495632_0027203 Ga0495632_0027203_55_1053 319
426 3300046524 Ga0495648_0062567 Ga0495648_0062567_1114_2091 319
427 3300046543 Ga0495645_0084567 Ga0495645_0084567_421_1404 319
428 3300046683 Ga0495658_0020138 Ga0495658_0020138_1072_2055 319
429 3300046689 Ga0495613_0110946 Ga0495613_0110946_246_1229 319
430 3300047319 Ga0495674_0140882 Ga0495674_0140882_233_1216 319
431 3300047469 Ga0495673_0068673 Ga0495673_0068673_58_1056 319
432 3300048903 Ga0496100_0193290 Ga0496100_0193290_432_1424 319
433 3300048911 Ga0496108_0055598 Ga0496108_0055598_1141_2124 319
434 3300048912 Ga0496109_0097929 Ga0496109_0097929_784_1776 319
435 3300053077 Ga0495601_0060369 Ga0495601_0060369_1161_2144 319
436 3300053085 Ga0495619_0164616 Ga0495619_0164616_321_1304 319
437 3300005329 Ga0070683_100039556 Ga0070683_1000395564 320
438 3300005331 Ga0070670_100051505 Ga0070670_1000515054 320
439 3300005334 Ga0068869_100002941 Ga0068869_10000294111 320
440 3300005335 Ga0070666_10002937 Ga0070666_100029377 320
441 3300005338 Ga0068868_100255747 Ga0068868_1002557472 320
442 3300005344 Ga0070661_100004458 Ga0070661_1000044587 320
443 3300005347 Ga0070668_100006563 Ga0070668_1000065638 320
444 3300005353 Ga0070669_100000703 Ga0070669_1000007036 320
445 3300005355 Ga0070671_100002779 Ga0070671_10000277916 320
446 3300005356 Ga0070674_100001675 Ga0070674_1000016756 320
447 3300005366 Ga0070659_100192578 Ga0070659_1001925782 320
448 3300005367 Ga0070667_100003662 Ga0070667_1000036628 320
449 3300005367 Ga0070667_100007802 Ga0070667_1000078029 320
450 3300005441 Ga0070700_100131993 Ga0070700_1001319932 320
451 3300005457 Ga0070662_100019182 Ga0070662_1000191825 320
452 3300005459 Ga0068867_100002428 Ga0068867_10000242810 320
453 3300005543 Ga0070672_100015202 Ga0070672_1000152026 320
454 3300005543 Ga0070672_100046661 Ga0070672_1000466613 320
455 3300005543 Ga0070672_100090681 Ga0070672_1000906812 320
456 3300005547 Ga0070693_100027970 Ga0070693_1000279703 320
457 3300005548 Ga0070665_100073195 Ga0070665_1000731953 320
458 3300005614 Ga0068856_100034204 Ga0068856_1000342044 320
459 3300005616 Ga0068852_100072473 Ga0068852_1000724732 320
460 3300005617 Ga0068859_100097646 Ga0068859_1000976464 320
461 3300005617 Ga0068859_100105275 Ga0068859_1001052753 320
462 3300005618 Ga0068864_100057582 Ga0068864_1000575823 320
463 3300005718 Ga0068866_10011312 Ga0068866_100113122 320
464 3300005719 Ga0068861_100003125 Ga0068861_1000031252 320
465 3300005719 Ga0068861_100026691 Ga0068861_1000266912 320
466 3300005834 Ga0068851_10005190 Ga0068851_100051907 320
467 3300005834 Ga0068851_10038242 Ga0068851_100382422 320
468 3300005841 Ga0068863_100002914 Ga0068863_10000291417 320
469 3300005841 Ga0068863_100011402 Ga0068863_1000114024 320
470 3300005841 Ga0068863_100023298 Ga0068863_1000232984 320
471 3300005842 Ga0068858_100003258 Ga0068858_1000032587 320
472 3300005842 Ga0068858_100007127 Ga0068858_1000071276 320
473 3300005842 Ga0068858_100134991 Ga0068858_1001349912 320
474 3300005843 Ga0068860_100004309 Ga0068860_10000430912 320
475 3300005843 Ga0068860_100020088 Ga0068860_1000200882 320
476 3300006358 Ga0068871_100177611 Ga0068871_1001776112 320
477 3300006847 Ga0075431_100015583 Ga0075431_1000155832 320
478 3300006931 Ga0097620_100097646 Ga0097620_1000976464 320
479 3300006931 Ga0097620_100105274 Ga0097620_1001052742 320
480 3300009098 Ga0105245_10017282 Ga0105245_100172827 320
481 3300009148 Ga0105243_10020478 Ga0105243_100204786 320
482 3300009545 Ga0105237_10040115 Ga0105237_100401154 320
483 3300009551 Ga0105238_10071557 Ga0105238_100715573 320
484 3300010375 Ga0105239_10420440 Ga0105239_104204402 320
485 3300013296 Ga0157374_10015544 Ga0157374_100155448 320
486 3300013306 Ga0163162_10012725 Ga0163162_100127257 320
487 3300013306 Ga0163162_10040663 Ga0163162_100406632 320
488 3300013306 Ga0163162_10438558 Ga0163162_104385582 320
489 3300013307 Ga0157372_10257305 Ga0157372_102573052 320
490 3300013308 Ga0157375_10011280 Ga0157375_100112805 320
491 3300013308 Ga0157375_10070170 Ga0157375_100701703 320
492 3300014968 Ga0157379_10004210 Ga0157379_100042102 320
493 3300014968 Ga0157379_10012185 Ga0157379_100121858 320
494 3300014968 Ga0157379_10063062 Ga0157379_100630622 320
495 3300025321 Ga0207656_10026749 Ga0207656_100267492 320
496 3300025907 Ga0207645_10015439 Ga0207645_100154393 320
497 3300025914 Ga0207671_10241857 Ga0207671_102418572 320
498 3300025919 Ga0207657_10076083 Ga0207657_100760832 320
499 3300025921 Ga0207652_10208730 Ga0207652_102087302 320
500 3300025923 Ga0207681_10016331 Ga0207681_100163314 320
501 3300025925 Ga0207650_10235668 Ga0207650_102356681 320
502 3300025927 Ga0207687_10059337 Ga0207687_100593373 320
503 3300025927 Ga0207687_10121380 Ga0207687_101213802 320
504 3300025937 Ga0207669_10002834 Ga0207669_100028342 320
505 3300025938 Ga0207704_10018556 Ga0207704_100185564 320
506 3300025940 Ga0207691_10023136 Ga0207691_100231363 320
507 3300025940 Ga0207691_10143168 Ga0207691_101431682 320
508 3300025942 Ga0207689_10020977 Ga0207689_100209773 320
509 3300025944 Ga0207661_10042690 Ga0207661_100426904 320
510 3300025960 Ga0207651_10109840 Ga0207651_101098402 320
511 3300025972 Ga0207668_10006200 Ga0207668_100062002 320
512 3300025981 Ga0207640_10127115 Ga0207640_101271152 320
513 3300025986 Ga0207658_10054412 Ga0207658_100544122 320
514 3300026035 Ga0207703_10008279 Ga0207703_100082796 320
515 3300026035 Ga0207703_10024049 Ga0207703_100240495 320
516 3300026041 Ga0207639_10070474 Ga0207639_100704744 320
517 3300026041 Ga0207639_10075376 Ga0207639_100753763 320
518 3300026067 Ga0207678_10077448 Ga0207678_100774484 320
519 3300026078 Ga0207702_10024915 Ga0207702_100249155 320
520 3300026088 Ga0207641_10007082 Ga0207641_100070824 320
521 3300026088 Ga0207641_10012653 Ga0207641_100126535 320
522 3300026095 Ga0207676_10053510 Ga0207676_100535102 320
523 3300026095 Ga0207676_10060766 Ga0207676_100607661 320
524 3300026095 Ga0207676_10230755 Ga0207676_102307552 320
525 3300026116 Ga0207674_10055498 Ga0207674_100554981 320
526 3300026118 Ga0207675_100000977 Ga0207675_10000097714 320
527 3300026121 Ga0207683_10247104 Ga0207683_102471041 320
528 3300028379 Ga0268266_10220163 Ga0268266_102201632 320
529 3300028381 Ga0268264_10003403 Ga0268264_1000340313 320
530 3300028381 Ga0268264_10023821 Ga0268264_100238213 320
531 3300028794 Ga0307515_10027818 Ga0307515_100278183 320
532 3300031507 Ga0307509_10323607 Ga0307509_103236072 320
533 3300032002 Ga0307416_100003082 Ga0307416_1000030826 320
534 3300032004 Ga0307414_10105381 Ga0307414_101053812 320
535 3300032126 Ga0307415_100006914 Ga0307415_1000069143 320
536 3300035112 Ga0373932_0008285 Ga0373932_0008285_707_1708 320
537 3300035691 Ga0373931_0011481 Ga0373931_0011481_1297_2298 320
538 3300039450 Ga0436363_1432274 Ga0436363_1432274_392_1381 320
539 3300046473 Ga0495582_0194811 Ga0495582_0194811_35_1048 320
540 3300046616 Ga0495668_0025062 Ga0495668_0025062_160_1176 320
541 3300047444 Ga0495675_0192687 Ga0495675_0192687_92_1105 320
542 3300047673 Ga0495593_0042344 Ga0495593_0042344_231_1232 320
543 3300050509 nmdc:mga0qj67_1823_c1 nmdc:mga0qj67_1823_c1_2901_3917 320
544 3300050510 nmdc:mga06r32_4881_c1 nmdc:mga06r32_4881_c1_9386_10402 320
545 3300050512 nmdc:mga0n895_344162_c1 nmdc:mga0n895_344162_c1_236_1228 320
546 3300005327 Ga0070658_10038972 Ga0070658_100389723 321
547 3300005328 Ga0070676_10021963 Ga0070676_100219633 321
548 3300005329 Ga0070683_100007182 Ga0070683_10000718210 321
549 3300005329 Ga0070683_100030885 Ga0070683_1000308853 321
550 3300005331 Ga0070670_100013351 Ga0070670_1000133515 321
551 3300005336 Ga0070680_100194013 Ga0070680_1001940132 321
552 3300005337 Ga0070682_100024784 Ga0070682_1000247842 321
553 3300005339 Ga0070660_100015941 Ga0070660_1000159414 321
554 3300005340 Ga0070689_100264698 Ga0070689_1002646981 321
555 3300005344 Ga0070661_100001163 Ga0070661_1000011636 321
556 3300005344 Ga0070661_100002517 Ga0070661_1000025178 321
557 3300005344 Ga0070661_100020742 Ga0070661_1000207422 321
558 3300005344 Ga0070661_100050297 Ga0070661_1000502972 321
559 3300005353 Ga0070669_100010671 Ga0070669_1000106716 321
560 3300005354 Ga0070675_100019752 Ga0070675_1000197522 321
561 3300005354 Ga0070675_100057458 Ga0070675_1000574583 321
562 3300005355 Ga0070671_100002148 Ga0070671_1000021488 321
563 3300005355 Ga0070671_100004213 Ga0070671_1000042136 321
564 3300005355 Ga0070671_100054814 Ga0070671_1000548143 321
565 3300005356 Ga0070674_100009858 Ga0070674_1000098583 321
566 3300005364 Ga0070673_100007461 Ga0070673_1000074619 321
567 3300005364 Ga0070673_100410746 Ga0070673_1004107462 321
568 3300005366 Ga0070659_100030369 Ga0070659_1000303692 321
569 3300005434 Ga0070709_10035113 Ga0070709_100351133 321
570 3300005434 Ga0070709_10068902 Ga0070709_100689022 321
571 3300005434 Ga0070709_10076840 Ga0070709_100768402 321
572 3300005435 Ga0070714_100014948 Ga0070714_1000149486 321
573 3300005435 Ga0070714_100033506 Ga0070714_1000335063 321
574 3300005455 Ga0070663_100002838 Ga0070663_1000028384 321
575 3300005455 Ga0070663_100010680 Ga0070663_1000106803 321
576 3300005456 Ga0070678_100014019 Ga0070678_1000140194 321
577 3300005457 Ga0070662_100000827 Ga0070662_10000082716 321
578 3300005457 Ga0070662_100012595 Ga0070662_1000125955 321
579 3300005458 Ga0070681_10006174 Ga0070681_100061748 321
580 3300005458 Ga0070681_10008534 Ga0070681_100085343 321
581 3300005459 Ga0068867_100001658 Ga0068867_10000165813 321
582 3300005459 Ga0068867_100214604 Ga0068867_1002146042 321
583 3300005518 Ga0070699_100017505 Ga0070699_1000175052 321
584 3300005530 Ga0070679_100003587 Ga0070679_1000035873 321
585 3300005530 Ga0070679_100188447 Ga0070679_1001884473 321
586 3300005530 Ga0070679_100204541 Ga0070679_1002045412 321
587 3300005535 Ga0070684_100074081 Ga0070684_1000740812 321
588 3300005535 Ga0070684_100116544 Ga0070684_1001165443 321
589 3300005539 Ga0068853_100281595 Ga0068853_1002815952 321
590 3300005543 Ga0070672_100001237 Ga0070672_10000123711 321
591 3300005563 Ga0068855_100004781 Ga0068855_10000478114 321
592 3300005563 Ga0068855_100048925 Ga0068855_1000489254 321
593 3300005563 Ga0068855_100062803 Ga0068855_1000628033 321
594 3300005563 Ga0068855_100075008 Ga0068855_1000750083 321
595 3300005563 Ga0068855_100158356 Ga0068855_1001583562 321
596 3300005564 Ga0070664_100000152 Ga0070664_1000001523 321
597 3300005564 Ga0070664_100006501 Ga0070664_1000065014 321
598 3300005564 Ga0070664_100057608 Ga0070664_1000576084 321
599 3300005564 Ga0070664_100129450 Ga0070664_1001294502 321
600 3300005577 Ga0068857_100034689 Ga0068857_1000346894 321
601 3300005577 Ga0068857_100114033 Ga0068857_1001140332 321
602 3300005577 Ga0068857_100444974 Ga0068857_1004449742 321
603 3300005578 Ga0068854_100013085 Ga0068854_1000130853 321
604 3300005614 Ga0068856_100000093 Ga0068856_10000009376 321
605 3300005614 Ga0068856_100018144 Ga0068856_1000181442 321
606 3300005614 Ga0068856_100039961 Ga0068856_1000399615 321
607 3300005614 Ga0068856_100043551 Ga0068856_1000435513 321
608 3300005616 Ga0068852_100002316 Ga0068852_1000023164 321
609 3300005616 Ga0068852_100018088 Ga0068852_1000180884 321
610 3300005616 Ga0068852_100377612 Ga0068852_1003776122 321
611 3300005618 Ga0068864_100020907 Ga0068864_1000209073 321
612 3300005719 Ga0068861_100148460 Ga0068861_1001484602 321
613 3300005834 Ga0068851_10002770 Ga0068851_100027705 321
614 3300005842 Ga0068858_100056819 Ga0068858_1000568193 321
615 3300009093 Ga0105240_10002702 Ga0105240_1000270211 321
616 3300009093 Ga0105240_10006429 Ga0105240_1000642915 321
617 3300009174 Ga0105241_10001154 Ga0105241_1000115415 321
618 3300009174 Ga0105241_10059857 Ga0105241_100598572 321
619 3300009174 Ga0105241_10402513 Ga0105241_104025131 321
620 3300009545 Ga0105237_10099157 Ga0105237_100991573 321
621 3300009545 Ga0105237_10198199 Ga0105237_101981992 321
622 3300009551 Ga0105238_10003012 Ga0105238_1000301215 321
623 3300009551 Ga0105238_10049052 Ga0105238_100490522 321
624 3300010375 Ga0105239_10357501 Ga0105239_103575012 321
625 3300013100 Ga0157373_10005664 Ga0157373_100056647 321
626 3300013100 Ga0157373_10020608 Ga0157373_100206083 321
627 3300013100 Ga0157373_10030761 Ga0157373_100307613 321
628 3300013102 Ga0157371_10000696 Ga0157371_1000069635 321
629 3300013104 Ga0157370_10004239 Ga0157370_1000423915 321
630 3300013104 Ga0157370_10007103 Ga0157370_100071033 321
631 3300013104 Ga0157370_10034563 Ga0157370_100345635 321
632 3300013104 Ga0157370_10036749 Ga0157370_100367494 321
633 3300013104 Ga0157370_10242582 Ga0157370_102425822 321
634 3300013105 Ga0157369_10033319 Ga0157369_100333194 321
635 3300013105 Ga0157369_10079192 Ga0157369_100791924 321
636 3300013105 Ga0157369_10105602 Ga0157369_101056023 321
637 3300013105 Ga0157369_10240825 Ga0157369_102408251 321
638 3300013306 Ga0163162_10236441 Ga0163162_102364412 321
639 3300013307 Ga0157372_10006652 Ga0157372_100066529 321
640 3300013307 Ga0157372_10017050 Ga0157372_100170506 321
641 3300013307 Ga0157372_10020731 Ga0157372_100207315 321
642 3300013307 Ga0157372_10039214 Ga0157372_100392145 321
643 3300014326 Ga0157380_10444018 Ga0157380_104440182 321
644 3300017792 Ga0163161_10219535 Ga0163161_102195352 321
645 3300025321 Ga0207656_10034710 Ga0207656_100347103 321
646 3300025893 Ga0207682_10003194 Ga0207682_100031942 321
647 3300025898 Ga0207692_10029153 Ga0207692_100291531 321
648 3300025899 Ga0207642_10091773 Ga0207642_100917731 321
649 3300025906 Ga0207699_10013825 Ga0207699_100138252 321
650 3300025906 Ga0207699_10073449 Ga0207699_100734492 321
651 3300025906 Ga0207699_10151573 Ga0207699_101515732 321
652 3300025911 Ga0207654_10230110 Ga0207654_102301102 321
653 3300025912 Ga0207707_10008674 Ga0207707_100086744 321
654 3300025912 Ga0207707_10143737 Ga0207707_101437372 321
655 3300025913 Ga0207695_10076155 Ga0207695_100761552 321
656 3300025914 Ga0207671_10046808 Ga0207671_100468083 321
657 3300025914 Ga0207671_10165688 Ga0207671_101656882 321
658 3300025917 Ga0207660_10002422 Ga0207660_100024227 321
659 3300025917 Ga0207660_10335885 Ga0207660_103358852 321
660 3300025917 Ga0207660_10424668 Ga0207660_104246681 321
661 3300025919 Ga0207657_10000045 Ga0207657_10000045100 321
662 3300025919 Ga0207657_10008538 Ga0207657_100085385 321
663 3300025919 Ga0207657_10015160 Ga0207657_100151604 321
664 3300025919 Ga0207657_10046535 Ga0207657_100465354 321
665 3300025919 Ga0207657_10104022 Ga0207657_101040222 321
666 3300025920 Ga0207649_10002175 Ga0207649_1000217511 321
667 3300025920 Ga0207649_10021178 Ga0207649_100211783 321
668 3300025920 Ga0207649_10028095 Ga0207649_100280952 321
669 3300025921 Ga0207652_10034707 Ga0207652_100347073 321
670 3300025921 Ga0207652_10066886 Ga0207652_100668862 321
671 3300025921 Ga0207652_10166294 Ga0207652_101662942 321
672 3300025923 Ga0207681_10008494 Ga0207681_100084948 321
673 3300025923 Ga0207681_10153744 Ga0207681_101537442 321
674 3300025924 Ga0207694_10021014 Ga0207694_100210142 321
675 3300025924 Ga0207694_10080374 Ga0207694_100803743 321
676 3300025925 Ga0207650_10005120 Ga0207650_100051204 321
677 3300025926 Ga0207659_10013858 Ga0207659_100138586 321
678 3300025926 Ga0207659_10272011 Ga0207659_102720112 321
679 3300025929 Ga0207664_10006610 Ga0207664_100066105 321
680 3300025929 Ga0207664_10073502 Ga0207664_100735022 321
681 3300025929 Ga0207664_10139257 Ga0207664_101392572 321
682 3300025931 Ga0207644_10010401 Ga0207644_100104016 321
683 3300025931 Ga0207644_10011430 Ga0207644_100114302 321
684 3300025931 Ga0207644_10017295 Ga0207644_100172953 321
685 3300025932 Ga0207690_10008126 Ga0207690_100081263 321
686 3300025933 Ga0207706_10000149 Ga0207706_100001494 321
687 3300025933 Ga0207706_10063073 Ga0207706_100630734 321
688 3300025937 Ga0207669_10008202 Ga0207669_100082023 321
689 3300025940 Ga0207691_10000229 Ga0207691_1000022918 321
690 3300025945 Ga0207679_10007689 Ga0207679_100076894 321
691 3300025945 Ga0207679_10030294 Ga0207679_100302943 321
692 3300025945 Ga0207679_10037851 Ga0207679_100378512 321
693 3300025945 Ga0207679_10050669 Ga0207679_100506693 321
694 3300025945 Ga0207679_10109357 Ga0207679_101093572 321
695 3300025949 Ga0207667_10006125 Ga0207667_100061256 321
696 3300025949 Ga0207667_10009172 Ga0207667_1000917210 321
697 3300025949 Ga0207667_10066614 Ga0207667_100666143 321
698 3300025949 Ga0207667_10110217 Ga0207667_101102173 321
699 3300025960 Ga0207651_10003355 Ga0207651_100033558 321
700 3300025960 Ga0207651_10014425 Ga0207651_100144254 321
701 3300025960 Ga0207651_10394827 Ga0207651_103948271 321
702 3300025981 Ga0207640_10008111 Ga0207640_100081116 321
703 3300026041 Ga0207639_10067425 Ga0207639_100674253 321
704 3300026041 Ga0207639_10268590 Ga0207639_102685902 321
705 3300026067 Ga0207678_10003299 Ga0207678_1000329915 321
706 3300026067 Ga0207678_10005357 Ga0207678_100053578 321
707 3300026067 Ga0207678_10243294 Ga0207678_102432941 321
708 3300026078 Ga0207702_10002780 Ga0207702_100027808 321
709 3300026078 Ga0207702_10030260 Ga0207702_100302604 321
710 3300026078 Ga0207702_10034801 Ga0207702_100348013 321
711 3300026089 Ga0207648_10009020 Ga0207648_100090203 321
712 3300026089 Ga0207648_10026307 Ga0207648_100263074 321
713 3300026095 Ga0207676_10032079 Ga0207676_100320793 321
714 3300026116 Ga0207674_10000020 Ga0207674_100000204 321
715 3300026116 Ga0207674_10005781 Ga0207674_100057816 321
716 3300026116 Ga0207674_10200449 Ga0207674_102004492 321
717 3300026118 Ga0207675_100176299 Ga0207675_1001762992 321
718 3300026121 Ga0207683_10012448 Ga0207683_100124482 321
719 3300026142 Ga0207698_10000678 Ga0207698_1000067811 321
720 3300031731 Ga0307405_10078564 Ga0307405_100785641 321
721 3300031911 Ga0307412_10009961 Ga0307412_100099616 321
722 3300031995 Ga0307409_100019238 Ga0307409_1000192382 321
723 3300031995 Ga0307409_100175482 Ga0307409_1001754823 321
724 3300032002 Ga0307416_100021079 Ga0307416_1000210791 321
725 3300032004 Ga0307414_10223272 Ga0307414_102232722 321
726 3300035118 Ga0373954_0031280 Ga0373954_0031280_1401_2366 321
727 3300035172 Ga0373955_0161011 Ga0373955_0161011_117_1082 321
728 3300035691 Ga0373931_0215223 Ga0373931_0215223_34_999 321
729 3300036401 Ga0373937_0063736 Ga0373937_0063736_177_1142 321
730 3300037312 Ga0395899_0035008 Ga0395899_0035008_739_1704 321
731 3300037418 Ga0395900_0178929 Ga0395900_0178929_1140_2105 321
732 3300038443 Ga0395901_0309598 Ga0395901_0309598_592_1557 321
733 3300042876 Ga0451577_0087317 Ga0451577_0087317_144_1109 321
734 3300045976 Ga0466967_0345095 Ga0466967_0345095_64_1029 321
735 3300048905 Ga0496102_0018172 Ga0496102_0018172_4496_5461 321
736 3300048905 Ga0496102_0026199 Ga0496102_0026199_2755_3720 321
737 3300048909 Ga0496106_0005880 Ga0496106_0005880_4840_5805 321
738 3300048910 Ga0496107_0146360 Ga0496107_0146360_168_1133 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

72

345

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9636 28 320
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9625 23 318
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.95 23 318
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9497 24 312
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9469 24 320
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9455 123 244 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.945 123 240 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9356 123 241 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.934 123 244 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9282 24 320 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9984 61 314
AF-A0A536YZ85-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.998 24 320
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9817 49 316
AF-A0A1B2R9E2-F1-model_v4 LacI family transcriptional regulator 0.9791 22 318
AF-A0A096FIP4-F1-model_v4 MFS transporter 0.9786 22 320

Feature Viewer

pLDDT pTM Quality
93.72 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map