F478386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 288 | 738 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_12246288|Ga0157374_122462881 |
| Length | 129 |
| Sequence | MSGQPGGHATAEIEEETVMPEDLASQTCAPCRGGTPPLKGAELRSIQQKVPQWKVVNEHHITRAFAFPDFKQALDFVNRVGEVAEQQGHHPDILLTWGKAEITMWTHKIDGLTQSDFIMAAKIDKLLPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 134 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.24 |
| Metatranscriptomes | 1.76 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.18 |
| Rhizosphere | 92.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_9582295 | 2162886012 | Bacteria | 1444 |
| 2 | JGI24752J21851_1000331 | 3300001976 | Bacteria | 6590 |
| 3 | JGI24747J21853_1049202 | 3300001978 | Unclassified | 511 |
| 4 | JGI24737J22298_10028557 | 3300001990 | Bacteria | 1753 |
| 5 | JGI24743J22301_10000093 | 3300001991 | Bacteria | 8658 |
| 6 | JGI24745J21846_1013893 | 3300002073 | Bacteria | 930 |
| 7 | JGI24748J21848_1009443 | 3300002074 | Bacteria | 1149 |
| 8 | JGI24738J21930_10157838 | 3300002075 | Unclassified | 507 |
| 9 | JGI24033J26618_1004020 | 3300002155 | Bacteria | 1573 |
| 10 | JGI24034J26672_10000810 | 3300002239 | Unclassified | 4051 |
| 11 | JGI24751J29686_10000635 | 3300002459 | Bacteria | 9014 |
| 12 | Ga0058863_11769502 | 3300004799 | Unclassified | 1080 |
| 13 | Ga0058862_10008808 | 3300004803 | Unclassified | 625 |
| 14 | Ga0065712_10169285 | 3300005290 | Bacteria | 1253 |
| 15 | Ga0065715_10002672 | 3300005293 | Unclassified | 4564 |
| 16 | Ga0065715_10408013 | 3300005293 | Bacteria | 837 |
| 17 | Ga0070658_10091494 | 3300005327 | Unclassified | 2507 |
| 18 | Ga0070658_10370542 | 3300005327 | Bacteria | 1228 |
| 19 | Ga0070658_10405901 | 3300005327 | Bacteria | 1171 |
| 20 | Ga0070658_10415299 | 3300005327 | Bacteria | 1157 |
| 21 | Ga0070676_10005283 | 3300005328 | Bacteria | 6866 |
| 22 | Ga0070676_10160666 | 3300005328 | Bacteria | 1446 |
| 23 | Ga0070683_100001910 | 3300005329 | Bacteria | 16302 |
| 24 | Ga0070683_100021957 | 3300005329 | Bacteria | 5698 |
| 25 | Ga0070683_100031689 | 3300005329 | Bacteria | 4811 |
| 26 | Ga0070683_100082482 | 3300005329 | Bacteria | 3011 |
| 27 | Ga0070690_100003363 | 3300005330 | Bacteria | 8732 |
| 28 | Ga0070690_100145461 | 3300005330 | Bacteria | 1612 |
| 29 | Ga0070690_100147599 | 3300005330 | Bacteria | 1602 |
| 30 | Ga0070690_100888145 | 3300005330 | Unclassified | 696 |
| 31 | Ga0070670_100001939 | 3300005331 | Bacteria | 16933 |
| 32 | Ga0070670_100126500 | 3300005331 | Unclassified | 2206 |
| 33 | Ga0070670_101075184 | 3300005331 | Unclassified | 733 |
| 34 | Ga0070677_10003715 | 3300005333 | Unclassified | 4938 |
| 35 | Ga0068869_100052848 | 3300005334 | Unclassified | 2951 |
| 36 | Ga0068869_100490673 | 3300005334 | Unclassified | 1024 |
| 37 | Ga0070666_10008180 | 3300005335 | Bacteria | 6481 |
| 38 | Ga0070666_10011983 | 3300005335 | Bacteria | 5456 |
| 39 | Ga0070680_100089047 | 3300005336 | Unclassified | 2554 |
| 40 | Ga0070682_100003286 | 3300005337 | Bacteria | 8968 |
| 41 | Ga0070682_100071298 | 3300005337 | Bacteria | 2223 |
| 42 | Ga0070682_100209862 | 3300005337 | Unclassified | 1379 |
| 43 | Ga0068868_100008382 | 3300005338 | Bacteria | 7398 |
| 44 | Ga0068868_100010214 | 3300005338 | Bacteria | 6786 |
| 45 | Ga0068868_100037793 | 3300005338 | Unclassified | 3744 |
| 46 | Ga0068868_100106830 | 3300005338 | Unclassified | 2271 |
| 47 | Ga0068868_100345696 | 3300005338 | Bacteria | 1273 |
| 48 | Ga0068868_101727857 | 3300005338 | Unclassified | 590 |
| 49 | Ga0070660_100044330 | 3300005339 | Bacteria | 3401 |
| 50 | Ga0070660_100057478 | 3300005339 | Bacteria | 3013 |
| 51 | Ga0070660_100061610 | 3300005339 | Unclassified | 2913 |
| 52 | Ga0070689_100001082 | 3300005340 | Bacteria | 17081 |
| 53 | Ga0070689_100277665 | 3300005340 | Bacteria | 1389 |
| 54 | Ga0070687_100886103 | 3300005343 | Bacteria | 639 |
| 55 | Ga0070661_100009221 | 3300005344 | Bacteria | 6822 |
| 56 | Ga0070661_100033165 | 3300005344 | Bacteria | 3740 |
| 57 | Ga0070661_100107608 | 3300005344 | Bacteria | 2079 |
| 58 | Ga0070661_100162808 | 3300005344 | Bacteria | 1690 |
| 59 | Ga0070668_100055194 | 3300005347 | Bacteria | 3066 |
| 60 | Ga0070668_100635676 | 3300005347 | Bacteria | 937 |
| 61 | Ga0070669_100001365 | 3300005353 | Bacteria | 17595 |
| 62 | Ga0070675_100219209 | 3300005354 | Bacteria | 1656 |
| 63 | Ga0070671_100106068 | 3300005355 | Unclassified | 2358 |
| 64 | Ga0070674_100158283 | 3300005356 | Bacteria | 1716 |
| 65 | Ga0070673_100009008 | 3300005364 | Bacteria | 6679 |
| 66 | Ga0070673_100153144 | 3300005364 | Bacteria | 1954 |
| 67 | Ga0070688_100000289 | 3300005365 | Bacteria | 25802 |
| 68 | Ga0070659_100002441 | 3300005366 | Bacteria | 13204 |
| 69 | Ga0070659_100014097 | 3300005366 | Bacteria | 5966 |
| 70 | Ga0070667_100144235 | 3300005367 | Unclassified | 2087 |
| 71 | Ga0070667_100278847 | 3300005367 | Bacteria | 1500 |
| 72 | Ga0070709_10052109 | 3300005434 | Bacteria | 2570 |
| 73 | Ga0070709_10064095 | 3300005434 | Bacteria | 2349 |
| 74 | Ga0070709_10181912 | 3300005434 | Unclassified | 1477 |
| 75 | Ga0070709_10205448 | 3300005434 | Bacteria | 1397 |
| 76 | Ga0070709_10395508 | 3300005434 | Unclassified | 1031 |
| 77 | Ga0070714_100025598 | 3300005435 | Bacteria | 4870 |
| 78 | Ga0070714_100658023 | 3300005435 | Bacteria | 1009 |
| 79 | Ga0070714_100945325 | 3300005435 | Unclassified | 838 |
| 80 | Ga0070714_102337374 | 3300005435 | Unclassified | 520 |
| 81 | Ga0070713_100005444 | 3300005436 | Bacteria | 8699 |
| 82 | Ga0070713_100019826 | 3300005436 | Bacteria | 5146 |
| 83 | Ga0070713_100054319 | 3300005436 | Bacteria | 3323 |
| 84 | Ga0070713_100086907 | 3300005436 | Archaea | 2682 |
| 85 | Ga0070713_100121506 | 3300005436 | Unclassified | 2291 |
| 86 | Ga0070713_100384492 | 3300005436 | Unclassified | 1308 |
| 87 | Ga0070713_100923606 | 3300005436 | Bacteria | 840 |
| 88 | Ga0070710_10008104 | 3300005437 | Bacteria | 5108 |
| 89 | Ga0070710_10273287 | 3300005437 | Bacteria | 1094 |
| 90 | Ga0070710_10312298 | 3300005437 | Bacteria | 1029 |
| 91 | Ga0070701_10884135 | 3300005438 | Bacteria | 616 |
| 92 | Ga0070711_100002248 | 3300005439 | Bacteria | 10959 |
| 93 | Ga0070711_100129574 | 3300005439 | Bacteria | 1877 |
| 94 | Ga0070711_100307198 | 3300005439 | Bacteria | 1263 |
| 95 | Ga0070711_100351526 | 3300005439 | Bacteria | 1185 |
| 96 | Ga0070711_101634368 | 3300005439 | Bacteria | 564 |
| 97 | Ga0070700_100196077 | 3300005441 | Bacteria | 1415 |
| 98 | Ga0070694_100083271 | 3300005444 | Bacteria | 2229 |
| 99 | Ga0070694_100354565 | 3300005444 | Bacteria | 1137 |
| 100 | Ga0070708_100059755 | 3300005445 | Bacteria | 3399 |
| 101 | Ga0070663_100010379 | 3300005455 | Bacteria | 5805 |
| 102 | Ga0070663_100063087 | 3300005455 | Bacteria | 2674 |
| 103 | Ga0070663_100926013 | 3300005455 | Bacteria | 754 |
| 104 | Ga0070678_100002783 | 3300005456 | Bacteria | 9666 |
| 105 | Ga0070662_100002426 | 3300005457 | Bacteria | 11463 |
| 106 | Ga0070662_100004251 | 3300005457 | Bacteria | 9028 |
| 107 | Ga0070662_100352213 | 3300005457 | Bacteria | 1206 |
| 108 | Ga0070681_10000316 | 3300005458 | Bacteria | 39260 |
| 109 | Ga0070681_10021618 | 3300005458 | Bacteria | 6450 |
| 110 | Ga0070681_10293479 | 3300005458 | Bacteria | 1536 |
| 111 | Ga0070681_10293697 | 3300005458 | Bacteria | 1535 |
| 112 | Ga0068867_100000749 | 3300005459 | Bacteria | 21787 |
| 113 | Ga0068867_100073669 | 3300005459 | Bacteria | 2557 |
| 114 | Ga0068867_100110748 | 3300005459 | Bacteria | 2109 |
| 115 | Ga0068867_100462299 | 3300005459 | Bacteria | 1084 |
| 116 | Ga0070685_10001601 | 3300005466 | Bacteria | 11932 |
| 117 | Ga0070706_100002695 | 3300005467 | Bacteria | 17776 |
| 118 | Ga0070707_100291810 | 3300005468 | Bacteria | 1585 |
| 119 | Ga0070707_101935803 | 3300005468 | Unclassified | 557 |
| 120 | Ga0070699_100001799 | 3300005518 | Bacteria | 19484 |
| 121 | Ga0070699_100004056 | 3300005518 | Bacteria | 12944 |
| 122 | Ga0070679_100069763 | 3300005530 | Unclassified | 3506 |
| 123 | Ga0070679_100095462 | 3300005530 | Bacteria | 2961 |
| 124 | Ga0070679_101621425 | 3300005530 | Bacteria | 595 |
| 125 | Ga0070684_100001382 | 3300005535 | Bacteria | 17441 |
| 126 | Ga0070684_100007536 | 3300005535 | Bacteria | 8472 |
| 127 | Ga0070684_100035675 | 3300005535 | Bacteria | 4258 |
| 128 | Ga0070684_100162037 | 3300005535 | Bacteria | 2029 |
| 129 | Ga0070697_100006755 | 3300005536 | Bacteria | 8898 |
| 130 | Ga0070697_100011980 | 3300005536 | Bacteria | 6787 |
| 131 | Ga0070697_100044001 | 3300005536 | Bacteria | 3616 |
| 132 | Ga0070697_101039472 | 3300005536 | Unclassified | 728 |
| 133 | Ga0068853_100004139 | 3300005539 | Bacteria | 11180 |
| 134 | Ga0068853_100028987 | 3300005539 | Unclassified | 4661 |
| 135 | Ga0068853_100038223 | 3300005539 | Bacteria | 4087 |
| 136 | Ga0068853_100067230 | 3300005539 | Bacteria | 3113 |
| 137 | Ga0068853_100104817 | 3300005539 | Bacteria | 2504 |
| 138 | Ga0070672_100002640 | 3300005543 | Bacteria | 11462 |
| 139 | Ga0070686_100009767 | 3300005544 | Bacteria | 5392 |
| 140 | Ga0070686_100040874 | 3300005544 | Bacteria | 2895 |
| 141 | Ga0070695_100240649 | 3300005545 | Bacteria | 1313 |
| 142 | Ga0070695_100547240 | 3300005545 | Bacteria | 902 |
| 143 | Ga0070695_100664145 | 3300005545 | Bacteria | 824 |
| 144 | Ga0070696_100208070 | 3300005546 | Bacteria | 1463 |
| 145 | Ga0070696_100343277 | 3300005546 | Bacteria | 1154 |
| 146 | Ga0070693_100007116 | 3300005547 | Bacteria | 5455 |
| 147 | Ga0070693_100038385 | 3300005547 | Bacteria | 2676 |
| 148 | Ga0070665_100029285 | 3300005548 | Bacteria | 5542 |
| 149 | Ga0070665_100069445 | 3300005548 | Unclassified | 3531 |
| 150 | Ga0070665_100610923 | 3300005548 | Bacteria | 1103 |
| 151 | Ga0070665_100698832 | 3300005548 | Bacteria | 1027 |
| 152 | Ga0070704_100175269 | 3300005549 | Bacteria | 1710 |
| 153 | Ga0070704_101460233 | 3300005549 | Unclassified | 628 |
| 154 | Ga0068855_100000903 | 3300005563 | Bacteria | 36808 |
| 155 | Ga0068855_100008318 | 3300005563 | Bacteria | 12540 |
| 156 | Ga0068855_100018323 | 3300005563 | Bacteria | 8410 |
| 157 | Ga0068855_100070191 | 3300005563 | Bacteria | 4076 |
| 158 | Ga0068855_100426688 | 3300005563 | Bacteria | 1449 |
| 159 | Ga0068855_101989677 | 3300005563 | Unclassified | 587 |
| 160 | Ga0070664_100006830 | 3300005564 | Bacteria | 9204 |
| 161 | Ga0070664_100020221 | 3300005564 | Bacteria | 5481 |
| 162 | Ga0070664_100103439 | 3300005564 | Bacteria | 2479 |
| 163 | Ga0068857_100002750 | 3300005577 | Bacteria | 14452 |
| 164 | Ga0068857_100006800 | 3300005577 | Bacteria | 9846 |
| 165 | Ga0068857_100015007 | 3300005577 | Bacteria | 6759 |
| 166 | Ga0068857_100183885 | 3300005577 | Bacteria | 1902 |
| 167 | Ga0068857_101723093 | 3300005577 | Unclassified | 613 |
| 168 | Ga0068854_100022350 | 3300005578 | Bacteria | 4307 |
| 169 | Ga0068854_100103379 | 3300005578 | Bacteria | 2138 |
| 170 | Ga0068854_100296632 | 3300005578 | Unclassified | 1306 |
| 171 | Ga0068854_100345535 | 3300005578 | Bacteria | 1216 |
| 172 | Ga0068856_100001036 | 3300005614 | Bacteria | 29524 |
| 173 | Ga0068856_100001068 | 3300005614 | Bacteria | 29002 |
| 174 | Ga0068856_100018327 | 3300005614 | Bacteria | 6786 |
| 175 | Ga0068856_100216334 | 3300005614 | Bacteria | 1931 |
| 176 | Ga0068856_100547126 | 3300005614 | Bacteria | 1179 |
| 177 | Ga0068856_100667995 | 3300005614 | Bacteria | 1060 |
| 178 | Ga0068856_102231514 | 3300005614 | Bacteria | 556 |
| 179 | Ga0070702_100006493 | 3300005615 | Bacteria | 5541 |
| 180 | Ga0070702_100237110 | 3300005615 | Unclassified | 1229 |
| 181 | Ga0068852_100005202 | 3300005616 | Bacteria | 9279 |
| 182 | Ga0068852_100025776 | 3300005616 | Bacteria | 4769 |
| 183 | Ga0068852_100403406 | 3300005616 | Unclassified | 1345 |
| 184 | Ga0068859_100029738 | 3300005617 | Bacteria | 5481 |
| 185 | Ga0068859_100032315 | 3300005617 | Bacteria | 5257 |
| 186 | Ga0068864_100003567 | 3300005618 | Bacteria | 12861 |
| 187 | Ga0068864_100031399 | 3300005618 | Bacteria | 4507 |
| 188 | Ga0068866_10001464 | 3300005718 | Bacteria | 10084 |
| 189 | Ga0068866_10214536 | 3300005718 | Bacteria | 1157 |
| 190 | Ga0068866_10298376 | 3300005718 | Unclassified | 1005 |
| 191 | Ga0068861_100002752 | 3300005719 | Bacteria | 11529 |
| 192 | Ga0068851_10002205 | 3300005834 | Bacteria | 8567 |
| 193 | Ga0068851_10029254 | 3300005834 | Bacteria | 2727 |
| 194 | Ga0068870_10000606 | 3300005840 | Bacteria | 13652 |
| 195 | Ga0068863_100010061 | 3300005841 | Bacteria | 9204 |
| 196 | Ga0068863_100053854 | 3300005841 | Bacteria | 3814 |
| 197 | Ga0068863_100301698 | 3300005841 | Unclassified | 1554 |
| 198 | Ga0068863_100312589 | 3300005841 | Bacteria | 1525 |
| 199 | Ga0068863_102101971 | 3300005841 | Unclassified | 575 |
| 200 | Ga0068858_100005248 | 3300005842 | Bacteria | 12695 |
| 201 | Ga0068858_100021345 | 3300005842 | Bacteria | 6049 |
| 202 | Ga0068858_100062982 | 3300005842 | Unclassified | 3430 |
| 203 | Ga0068858_100070266 | 3300005842 | Bacteria | 3245 |
| 204 | Ga0068858_100964442 | 3300005842 | Bacteria | 835 |
| 205 | Ga0068860_100039000 | 3300005843 | Bacteria | 4544 |
| 206 | Ga0068860_100047365 | 3300005843 | Unclassified | 4098 |
| 207 | Ga0068860_100497156 | 3300005843 | Unclassified | 1217 |
| 208 | Ga0068860_101065769 | 3300005843 | Bacteria | 827 |
| 209 | Ga0068862_100056995 | 3300005844 | Unclassified | 3349 |
| 210 | Ga0068862_100482592 | 3300005844 | Unclassified | 1173 |
| 211 | Ga0070717_10001077 | 3300006028 | Bacteria | 18344 |
| 212 | Ga0070717_10020671 | 3300006028 | Bacteria | 5181 |
| 213 | Ga0070717_10134364 | 3300006028 | Bacteria | 2129 |
| 214 | Ga0070717_11143972 | 3300006028 | Unclassified | 709 |
| 215 | Ga0070715_10010457 | 3300006163 | Unclassified | 3308 |
| 216 | Ga0070715_10016825 | 3300006163 | Bacteria | 2756 |
| 217 | Ga0070715_10102355 | 3300006163 | Bacteria | 1338 |
| 218 | Ga0070716_100026082 | 3300006173 | Unclassified | 3126 |
| 219 | Ga0070716_100058390 | 3300006173 | Bacteria | 2220 |
| 220 | Ga0070716_100060568 | 3300006173 | Bacteria | 2187 |
| 221 | Ga0070716_100074962 | 3300006173 | Bacteria | 2001 |
| 222 | Ga0070716_100109284 | 3300006173 | Bacteria | 1710 |
| 223 | Ga0070716_100147367 | 3300006173 | Bacteria | 1509 |
| 224 | Ga0070716_100290664 | 3300006173 | Bacteria | 1132 |
| 225 | Ga0070716_100451604 | 3300006173 | Unclassified | 937 |
| 226 | Ga0070712_100000566 | 3300006175 | Bacteria | 21524 |
| 227 | Ga0070712_100004100 | 3300006175 | Bacteria | 8952 |
| 228 | Ga0070712_100005444 | 3300006175 | Bacteria | 7883 |
| 229 | Ga0070712_100039310 | 3300006175 | Bacteria | 3237 |
| 230 | Ga0097621_100000216 | 3300006237 | Bacteria | 38151 |
| 231 | Ga0097621_100005019 | 3300006237 | Bacteria | 9288 |
| 232 | Ga0097621_100065896 | 3300006237 | Bacteria | 2982 |
| 233 | Ga0097621_100083411 | 3300006237 | Unclassified | 2663 |
| 234 | Ga0097621_100162180 | 3300006237 | Bacteria | 1922 |
| 235 | Ga0097621_100292566 | 3300006237 | Bacteria | 1436 |
| 236 | Ga0068871_100000182 | 3300006358 | Bacteria | 42634 |
| 237 | Ga0068871_100007539 | 3300006358 | Bacteria | 7783 |
| 238 | Ga0068871_100052698 | 3300006358 | Bacteria | 3296 |
| 239 | Ga0068871_100252176 | 3300006358 | Unclassified | 1537 |
| 240 | Ga0068871_100332071 | 3300006358 | Bacteria | 1341 |
| 241 | Ga0068871_100523629 | 3300006358 | Unclassified | 1071 |
| 242 | Ga0068871_100568285 | 3300006358 | Bacteria | 1028 |
| 243 | Ga0068871_100837450 | 3300006358 | Unclassified | 850 |
| 244 | Ga0075428_101157756 | 3300006844 | Unclassified | 816 |
| 245 | Ga0075433_10117605 | 3300006852 | Unclassified | 2359 |
| 246 | Ga0075433_10530540 | 3300006852 | Unclassified | 1035 |
| 247 | Ga0075433_10997861 | 3300006852 | Unclassified | 729 |
| 248 | Ga0075434_100005505 | 3300006871 | Bacteria | 11532 |
| 249 | Ga0075434_100247864 | 3300006871 | Bacteria | 1800 |
| 250 | Ga0075434_100541282 | 3300006871 | Bacteria | 1184 |
| 251 | Ga0075434_100837917 | 3300006871 | Unclassified | 935 |
| 252 | Ga0068865_100011689 | 3300006881 | Bacteria | 5500 |
| 253 | Ga0068865_100093370 | 3300006881 | Bacteria | 2188 |
| 254 | Ga0068865_100307328 | 3300006881 | Unclassified | 1271 |
| 255 | Ga0075436_100045890 | 3300006914 | Unclassified | 3014 |
| 256 | Ga0075436_100149157 | 3300006914 | Bacteria | 1645 |
| 257 | Ga0075436_101383047 | 3300006914 | Unclassified | 533 |
| 258 | Ga0097620_100029739 | 3300006931 | Bacteria | 5481 |
| 259 | Ga0097620_100032313 | 3300006931 | Bacteria | 5257 |
| 260 | Ga0075435_100092565 | 3300007076 | Bacteria | 2497 |
| 261 | Ga0105250_10611913 | 3300009092 | Unclassified | 506 |
| 262 | Ga0105240_10053308 | 3300009093 | Bacteria | 5077 |
| 263 | Ga0105240_10075293 | 3300009093 | Bacteria | 4164 |
| 264 | Ga0105240_10164065 | 3300009093 | Bacteria | 2636 |
| 265 | Ga0105240_10473020 | 3300009093 | Unclassified | 1398 |
| 266 | Ga0105240_10540673 | 3300009093 | Unclassified | 1290 |
| 267 | Ga0105240_10731093 | 3300009093 | Bacteria | 1078 |
| 268 | Ga0105240_10797934 | 3300009093 | Bacteria | 1023 |
| 269 | Ga0105245_10002797 | 3300009098 | Bacteria | 15694 |
| 270 | Ga0105245_10088679 | 3300009098 | Unclassified | 2842 |
| 271 | Ga0105245_10745329 | 3300009098 | Bacteria | 1015 |
| 272 | Ga0105247_10001769 | 3300009101 | Bacteria | 15200 |
| 273 | Ga0105243_10246974 | 3300009148 | Unclassified | 1591 |
| 274 | Ga0105243_10321931 | 3300009148 | Unclassified | 1409 |
| 275 | Ga0105243_11466350 | 3300009148 | Unclassified | 705 |
| 276 | Ga0105241_10008758 | 3300009174 | Bacteria | 7436 |
| 277 | Ga0105241_10013885 | 3300009174 | Bacteria | 5901 |
| 278 | Ga0105241_10022680 | 3300009174 | Bacteria | 4651 |
| 279 | Ga0105241_10150024 | 3300009174 | Bacteria | 1906 |
| 280 | Ga0105241_10209176 | 3300009174 | Unclassified | 1634 |
| 281 | Ga0105242_10005432 | 3300009176 | Bacteria | 9856 |
| 282 | Ga0105242_10014052 | 3300009176 | Bacteria | 6194 |
| 283 | Ga0105242_10017241 | 3300009176 | Bacteria | 5623 |
| 284 | Ga0105248_10015267 | 3300009177 | Bacteria | 8467 |
| 285 | Ga0105248_10029186 | 3300009177 | Bacteria | 6151 |
| 286 | Ga0105248_10039571 | 3300009177 | Bacteria | 5282 |
| 287 | Ga0105248_10056843 | 3300009177 | Unclassified | 4390 |
| 288 | Ga0105248_10310935 | 3300009177 | Bacteria | 1774 |
| 289 | Ga0105248_11201884 | 3300009177 | Bacteria | 857 |
| 290 | Ga0105237_10022385 | 3300009545 | Bacteria | 6485 |
| 291 | Ga0105237_10030939 | 3300009545 | Bacteria | 5430 |
| 292 | Ga0105237_10061368 | 3300009545 | Unclassified | 3759 |
| 293 | Ga0105237_10278684 | 3300009545 | Unclassified | 1675 |
| 294 | Ga0105237_11135032 | 3300009545 | Unclassified | 788 |
| 295 | Ga0105238_10005296 | 3300009551 | Bacteria | 12753 |
| 296 | Ga0105238_10022710 | 3300009551 | Bacteria | 6394 |
| 297 | Ga0105238_10066624 | 3300009551 | Bacteria | 3602 |
| 298 | Ga0105238_10174097 | 3300009551 | Unclassified | 2128 |
| 299 | Ga0105238_10449343 | 3300009551 | Bacteria | 1286 |
| 300 | Ga0105238_10648251 | 3300009551 | Bacteria | 1066 |
| 301 | Ga0105249_10015359 | 3300009553 | Bacteria | 6776 |
| 302 | Ga0105249_10232384 | 3300009553 | Bacteria | 1819 |
| 303 | Ga0105249_10776029 | 3300009553 | Bacteria | 1021 |
| 304 | Ga0099796_10247869 | 3300010159 | Unclassified | 739 |
| 305 | Ga0105239_10004431 | 3300010375 | Bacteria | 16792 |
| 306 | Ga0105239_10042312 | 3300010375 | Bacteria | 4993 |
| 307 | Ga0105239_10088162 | 3300010375 | Bacteria | 3421 |
| 308 | Ga0105239_10221123 | 3300010375 | Bacteria | 2124 |
| 309 | Ga0105239_10783412 | 3300010375 | Unclassified | 1092 |
| 310 | Ga0105239_10943677 | 3300010375 | Unclassified | 991 |
| 311 | Ga0105246_10002416 | 3300011119 | Bacteria | 11268 |
| 312 | Ga0105246_11074476 | 3300011119 | Unclassified | 733 |
| 313 | Ga0157373_10006047 | 3300013100 | Bacteria | 9050 |
| 314 | Ga0157373_10006948 | 3300013100 | Bacteria | 8426 |
| 315 | Ga0157373_10036993 | 3300013100 | Unclassified | 3502 |
| 316 | Ga0157371_10006502 | 3300013102 | Bacteria | 9624 |
| 317 | Ga0157371_10020814 | 3300013102 | Bacteria | 4825 |
| 318 | Ga0157371_10042811 | 3300013102 | Archaea | 3227 |
| 319 | Ga0157370_10009209 | 3300013104 | Bacteria | 10585 |
| 320 | Ga0157370_10655340 | 3300013104 | Bacteria | 959 |
| 321 | Ga0157370_11643626 | 3300013104 | Unclassified | 577 |
| 322 | Ga0157370_11695722 | 3300013104 | Bacteria | 567 |
| 323 | Ga0157369_10001537 | 3300013105 | Bacteria | 28258 |
| 324 | Ga0157369_10031401 | 3300013105 | Bacteria | 5849 |
| 325 | Ga0157369_10036757 | 3300013105 | Bacteria | 5364 |
| 326 | Ga0157369_11311365 | 3300013105 | Unclassified | 738 |
| 327 | Ga0157369_12651676 | 3300013105 | Unclassified | 506 |
| 328 | Ga0157374_10000090 | 3300013296 | Bacteria | 88789 |
| 329 | Ga0157374_10000483 | 3300013296 | Bacteria | 36023 |
| 330 | Ga0157374_10002984 | 3300013296 | Bacteria | 14164 |
| 331 | Ga0157374_10019060 | 3300013296 | Bacteria | 6070 |
| 332 | Ga0157374_10030042 | 3300013296 | Bacteria | 4931 |
| 333 | Ga0157374_10397741 | 3300013296 | Unclassified | 1374 |
| 334 | Ga0157374_10415739 | 3300013296 | Bacteria | 1343 |
| 335 | Ga0157374_12246288 | 3300013296 | Unclassified | 573 |
| 336 | Ga0157378_10000331 | 3300013297 | Bacteria | 46651 |
| 337 | Ga0157378_10005420 | 3300013297 | Bacteria | 11188 |
| 338 | Ga0157378_10039250 | 3300013297 | Bacteria | 4199 |
| 339 | Ga0157378_10044277 | 3300013297 | Bacteria | 3952 |
| 340 | Ga0157378_10413535 | 3300013297 | Unclassified | 1332 |
| 341 | Ga0157378_12415544 | 3300013297 | Unclassified | 577 |
| 342 | Ga0163162_10013974 | 3300013306 | Bacteria | 7846 |
| 343 | Ga0163162_10024935 | 3300013306 | Bacteria | 5908 |
| 344 | Ga0163162_10088799 | 3300013306 | Unclassified | 3170 |
| 345 | Ga0163162_10205651 | 3300013306 | Bacteria | 2098 |
| 346 | Ga0163162_10716344 | 3300013306 | Unclassified | 1121 |
| 347 | Ga0163162_10761444 | 3300013306 | Bacteria | 1087 |
| 348 | Ga0157372_10000100 | 3300013307 | Bacteria | 89828 |
| 349 | Ga0157372_10009031 | 3300013307 | Bacteria | 10594 |
| 350 | Ga0157372_10021173 | 3300013307 | Bacteria | 7024 |
| 351 | Ga0157372_10424099 | 3300013307 | Unclassified | 1550 |
| 352 | Ga0157372_11411127 | 3300013307 | Unclassified | 803 |
| 353 | Ga0157372_11528981 | 3300013307 | Unclassified | 769 |
| 354 | Ga0157375_10003505 | 3300013308 | Bacteria | 13607 |
| 355 | Ga0157375_10127795 | 3300013308 | Bacteria | 2659 |
| 356 | Ga0163163_10000958 | 3300014325 | Bacteria | 24503 |
| 357 | Ga0163163_10048270 | 3300014325 | Bacteria | 4186 |
| 358 | Ga0163163_10314893 | 3300014325 | Unclassified | 1618 |
| 359 | Ga0163163_11227269 | 3300014325 | Bacteria | 812 |
| 360 | Ga0157380_10025039 | 3300014326 | Unclassified | 4522 |
| 361 | Ga0182008_10002356 | 3300014497 | Bacteria | 11893 |
| 362 | Ga0157377_10000467 | 3300014745 | Bacteria | 17434 |
| 363 | Ga0157379_10006291 | 3300014968 | Bacteria | 10224 |
| 364 | Ga0157379_10030890 | 3300014968 | Unclassified | 4771 |
| 365 | Ga0157379_10665666 | 3300014968 | Bacteria | 975 |
| 366 | Ga0157376_10006340 | 3300014969 | Bacteria | 8355 |
| 367 | Ga0157376_10135808 | 3300014969 | Unclassified | 2201 |
| 368 | Ga0157376_10178373 | 3300014969 | Bacteria | 1940 |
| 369 | Ga0157376_10346075 | 3300014969 | Unclassified | 1421 |
| 370 | Ga0182006_1023091 | 3300015261 | Unclassified | 2577 |
| 371 | Ga0182007_10004823 | 3300015262 | Bacteria | 6040 |
| 372 | Ga0163161_10038216 | 3300017792 | Unclassified | 3443 |
| 373 | Ga0206350_10233586 | 3300020080 | Bacteria | 1443 |
| 374 | Ga0224712_10295021 | 3300022467 | Unclassified | 757 |
| 375 | Ga0224572_1044419 | 3300024225 | Bacteria | 833 |
| 376 | Ga0228598_1001121 | 3300024227 | Bacteria | 5910 |
| 377 | Ga0207697_10002916 | 3300025315 | Bacteria | 8654 |
| 378 | Ga0207697_10161545 | 3300025315 | Unclassified | 977 |
| 379 | Ga0207656_10051754 | 3300025321 | Bacteria | 1776 |
| 380 | Ga0207696_1086358 | 3300025711 | Bacteria | 863 |
| 381 | Ga0207682_10003786 | 3300025893 | Bacteria | 6496 |
| 382 | Ga0207692_10036336 | 3300025898 | Unclassified | 2401 |
| 383 | Ga0207692_10254732 | 3300025898 | Unclassified | 1053 |
| 384 | Ga0207692_10286658 | 3300025898 | Bacteria | 998 |
| 385 | Ga0207642_10008335 | 3300025899 | Bacteria | 3549 |
| 386 | Ga0207642_10092397 | 3300025899 | Bacteria | 1498 |
| 387 | Ga0207642_11153481 | 3300025899 | Unclassified | 502 |
| 388 | Ga0207710_10003898 | 3300025900 | Bacteria | 6589 |
| 389 | Ga0207688_10000372 | 3300025901 | Bacteria | 20907 |
| 390 | Ga0207680_10010107 | 3300025903 | Unclassified | 4709 |
| 391 | Ga0207680_10082240 | 3300025903 | Bacteria | 2026 |
| 392 | Ga0207647_10008793 | 3300025904 | Bacteria | 7209 |
| 393 | Ga0207647_10460846 | 3300025904 | Archaea | 712 |
| 394 | Ga0207685_10403643 | 3300025905 | Unclassified | 701 |
| 395 | Ga0207699_10002843 | 3300025906 | Bacteria | 8200 |
| 396 | Ga0207699_10052304 | 3300025906 | Bacteria | 2417 |
| 397 | Ga0207699_10139708 | 3300025906 | Bacteria | 1591 |
| 398 | Ga0207699_10144125 | 3300025906 | Bacteria | 1568 |
| 399 | Ga0207699_10201970 | 3300025906 | Unclassified | 1347 |
| 400 | Ga0207699_10321803 | 3300025906 | Unclassified | 1085 |
| 401 | Ga0207645_10000051 | 3300025907 | Bacteria | 84255 |
| 402 | Ga0207645_10018414 | 3300025907 | Bacteria | 4594 |
| 403 | Ga0207643_10000079 | 3300025908 | Bacteria | 63366 |
| 404 | Ga0207705_10030843 | 3300025909 | Unclassified | 3826 |
| 405 | Ga0207705_10473411 | 3300025909 | Bacteria | 972 |
| 406 | Ga0207705_10545501 | 3300025909 | Bacteria | 901 |
| 407 | Ga0207684_10003578 | 3300025910 | Bacteria | 15124 |
| 408 | Ga0207654_10004318 | 3300025911 | Bacteria | 7166 |
| 409 | Ga0207654_10062709 | 3300025911 | Unclassified | 2179 |
| 410 | Ga0207654_10073471 | 3300025911 | Bacteria | 2038 |
| 411 | Ga0207654_10172651 | 3300025911 | Bacteria | 1405 |
| 412 | Ga0207654_10179057 | 3300025911 | Bacteria | 1382 |
| 413 | Ga0207707_10006534 | 3300025912 | Bacteria | 10174 |
| 414 | Ga0207707_10038395 | 3300025912 | Bacteria | 4184 |
| 415 | Ga0207707_10083377 | 3300025912 | Bacteria | 2791 |
| 416 | Ga0207707_10113218 | 3300025912 | Bacteria | 2371 |
| 417 | Ga0207707_10127015 | 3300025912 | Bacteria | 2230 |
| 418 | Ga0207695_10053615 | 3300025913 | Bacteria | 4217 |
| 419 | Ga0207695_10329497 | 3300025913 | Unclassified | 1415 |
| 420 | Ga0207695_10372364 | 3300025913 | Unclassified | 1314 |
| 421 | Ga0207695_10537123 | 3300025913 | Bacteria | 1051 |
| 422 | Ga0207671_10009137 | 3300025914 | Bacteria | 8320 |
| 423 | Ga0207671_10052117 | 3300025914 | Bacteria | 3032 |
| 424 | Ga0207671_10104037 | 3300025914 | Bacteria | 2153 |
| 425 | Ga0207671_10267374 | 3300025914 | Bacteria | 1347 |
| 426 | Ga0207671_10561174 | 3300025914 | Unclassified | 910 |
| 427 | Ga0207693_10003938 | 3300025915 | Bacteria | 12624 |
| 428 | Ga0207693_10004992 | 3300025915 | Bacteria | 11129 |
| 429 | Ga0207693_10005699 | 3300025915 | Bacteria | 10352 |
| 430 | Ga0207693_10044528 | 3300025915 | Unclassified | 3488 |
| 431 | Ga0207663_10022475 | 3300025916 | Bacteria | 3605 |
| 432 | Ga0207663_10074322 | 3300025916 | Bacteria | 2202 |
| 433 | Ga0207663_10406697 | 3300025916 | Bacteria | 1042 |
| 434 | Ga0207663_10461684 | 3300025916 | Bacteria | 981 |
| 435 | Ga0207663_10988548 | 3300025916 | Bacteria | 675 |
| 436 | Ga0207660_10055524 | 3300025917 | Bacteria | 2831 |
| 437 | Ga0207660_10068043 | 3300025917 | Archaea | 2582 |
| 438 | Ga0207662_10355510 | 3300025918 | Bacteria | 985 |
| 439 | Ga0207657_10000246 | 3300025919 | Bacteria | 57698 |
| 440 | Ga0207657_10000292 | 3300025919 | Bacteria | 53366 |
| 441 | Ga0207657_10001266 | 3300025919 | Bacteria | 26953 |
| 442 | Ga0207649_10000242 | 3300025920 | Bacteria | 44166 |
| 443 | Ga0207649_10035420 | 3300025920 | Bacteria | 2999 |
| 444 | Ga0207652_10137235 | 3300025921 | Bacteria | 2185 |
| 445 | Ga0207652_10265697 | 3300025921 | Bacteria | 1548 |
| 446 | Ga0207646_10125198 | 3300025922 | Bacteria | 2310 |
| 447 | Ga0207681_10075318 | 3300025923 | Unclassified | 2366 |
| 448 | Ga0207694_10002864 | 3300025924 | Bacteria | 13898 |
| 449 | Ga0207694_10005754 | 3300025924 | Bacteria | 9500 |
| 450 | Ga0207694_10014163 | 3300025924 | Bacteria | 6012 |
| 451 | Ga0207694_10045721 | 3300025924 | Bacteria | 3382 |
| 452 | Ga0207694_10355243 | 3300025924 | Bacteria | 1213 |
| 453 | Ga0207694_10555289 | 3300025924 | Unclassified | 964 |
| 454 | Ga0207650_10000090 | 3300025925 | Bacteria | 118973 |
| 455 | Ga0207650_11082910 | 3300025925 | Unclassified | 682 |
| 456 | Ga0207659_10002035 | 3300025926 | Bacteria | 11997 |
| 457 | Ga0207687_10002307 | 3300025927 | Bacteria | 12991 |
| 458 | Ga0207687_10013901 | 3300025927 | Bacteria | 5260 |
| 459 | Ga0207687_10329020 | 3300025927 | Unclassified | 1239 |
| 460 | Ga0207700_10000685 | 3300025928 | Bacteria | 19728 |
| 461 | Ga0207700_10004609 | 3300025928 | Bacteria | 8159 |
| 462 | Ga0207700_10090161 | 3300025928 | Unclassified | 2419 |
| 463 | Ga0207700_10118884 | 3300025928 | Unclassified | 2139 |
| 464 | Ga0207700_10330357 | 3300025928 | Bacteria | 1323 |
| 465 | Ga0207700_11250885 | 3300025928 | Unclassified | 662 |
| 466 | Ga0207700_11349304 | 3300025928 | Unclassified | 635 |
| 467 | Ga0207664_10148252 | 3300025929 | Bacteria | 1991 |
| 468 | Ga0207664_10172385 | 3300025929 | Bacteria | 1852 |
| 469 | Ga0207664_10347576 | 3300025929 | Unclassified | 1312 |
| 470 | Ga0207664_10409035 | 3300025929 | Bacteria | 1207 |
| 471 | Ga0207664_10748508 | 3300025929 | Unclassified | 879 |
| 472 | Ga0207644_10002582 | 3300025931 | Bacteria | 11652 |
| 473 | Ga0207690_10003087 | 3300025932 | Bacteria | 10034 |
| 474 | Ga0207690_10022450 | 3300025932 | Unclassified | 3927 |
| 475 | Ga0207690_10169754 | 3300025932 | Bacteria | 1633 |
| 476 | Ga0207690_11575827 | 3300025932 | Unclassified | 549 |
| 477 | Ga0207706_10000139 | 3300025933 | Bacteria | 79096 |
| 478 | Ga0207706_10001055 | 3300025933 | Bacteria | 28007 |
| 479 | Ga0207706_10084476 | 3300025933 | Bacteria | 2791 |
| 480 | Ga0207686_10055788 | 3300025934 | Bacteria | 2480 |
| 481 | Ga0207709_10371488 | 3300025935 | Bacteria | 1085 |
| 482 | Ga0207670_10001693 | 3300025936 | Bacteria | 11493 |
| 483 | Ga0207670_10593248 | 3300025936 | Bacteria | 909 |
| 484 | Ga0207669_11121922 | 3300025937 | Unclassified | 664 |
| 485 | Ga0207704_10020900 | 3300025938 | Unclassified | 3474 |
| 486 | Ga0207704_10027609 | 3300025938 | Bacteria | 3136 |
| 487 | Ga0207704_10291971 | 3300025938 | Unclassified | 1245 |
| 488 | Ga0207665_10015670 | 3300025939 | Unclassified | 4975 |
| 489 | Ga0207665_10074253 | 3300025939 | Unclassified | 2327 |
| 490 | Ga0207665_10082116 | 3300025939 | Bacteria | 2220 |
| 491 | Ga0207665_10091681 | 3300025939 | Bacteria | 2107 |
| 492 | Ga0207665_10098521 | 3300025939 | Bacteria | 2037 |
| 493 | Ga0207665_10099049 | 3300025939 | Bacteria | 2032 |
| 494 | Ga0207665_10112571 | 3300025939 | Bacteria | 1914 |
| 495 | Ga0207665_10498451 | 3300025939 | Unclassified | 940 |
| 496 | Ga0207665_10901943 | 3300025939 | Unclassified | 701 |
| 497 | Ga0207691_10001343 | 3300025940 | Bacteria | 24540 |
| 498 | Ga0207711_10002838 | 3300025941 | Bacteria | 15224 |
| 499 | Ga0207711_10018665 | 3300025941 | Bacteria | 5767 |
| 500 | Ga0207711_10108962 | 3300025941 | Bacteria | 2461 |
| 501 | Ga0207711_11879466 | 3300025941 | Bacteria | 542 |
| 502 | Ga0207689_10000304 | 3300025942 | Bacteria | 45071 |
| 503 | Ga0207689_10773812 | 3300025942 | Unclassified | 810 |
| 504 | Ga0207661_10000583 | 3300025944 | Bacteria | 23334 |
| 505 | Ga0207661_10019113 | 3300025944 | Bacteria | 5101 |
| 506 | Ga0207661_10070730 | 3300025944 | Bacteria | 2849 |
| 507 | Ga0207679_10000184 | 3300025945 | Bacteria | 51157 |
| 508 | Ga0207679_10091753 | 3300025945 | Bacteria | 2351 |
| 509 | Ga0207679_10202751 | 3300025945 | Bacteria | 1658 |
| 510 | Ga0207667_10000170 | 3300025949 | Bacteria | 95740 |
| 511 | Ga0207667_10004029 | 3300025949 | Bacteria | 18047 |
| 512 | Ga0207667_10007225 | 3300025949 | Bacteria | 13401 |
| 513 | Ga0207667_10128304 | 3300025949 | Bacteria | 2612 |
| 514 | Ga0207667_10170718 | 3300025949 | Bacteria | 2235 |
| 515 | Ga0207667_10909583 | 3300025949 | Unclassified | 871 |
| 516 | Ga0207651_10002456 | 3300025960 | Bacteria | 8859 |
| 517 | Ga0207651_10223679 | 3300025960 | Unclassified | 1523 |
| 518 | Ga0207712_10013954 | 3300025961 | Bacteria | 5155 |
| 519 | Ga0207712_10079479 | 3300025961 | Bacteria | 2383 |
| 520 | Ga0207668_10052744 | 3300025972 | Bacteria | 2815 |
| 521 | Ga0207668_10074687 | 3300025972 | Unclassified | 2434 |
| 522 | Ga0207668_10818059 | 3300025972 | Unclassified | 825 |
| 523 | Ga0207640_10022601 | 3300025981 | Bacteria | 3767 |
| 524 | Ga0207640_10049454 | 3300025981 | Bacteria | 2722 |
| 525 | Ga0207640_10067491 | 3300025981 | Bacteria | 2394 |
| 526 | Ga0207640_10115583 | 3300025981 | Bacteria | 1911 |
| 527 | Ga0207658_10001983 | 3300025986 | Bacteria | 15269 |
| 528 | Ga0207658_11442689 | 3300025986 | Bacteria | 629 |
| 529 | Ga0207677_10007606 | 3300026023 | Bacteria | 6009 |
| 530 | Ga0207677_10011702 | 3300026023 | Bacteria | 5011 |
| 531 | Ga0207677_10076939 | 3300026023 | Unclassified | 2377 |
| 532 | Ga0207677_10081360 | 3300026023 | Unclassified | 2324 |
| 533 | Ga0207677_10328926 | 3300026023 | Bacteria | 1273 |
| 534 | Ga0207703_10005260 | 3300026035 | Bacteria | 10438 |
| 535 | Ga0207703_10087059 | 3300026035 | Bacteria | 2618 |
| 536 | Ga0207703_10095986 | 3300026035 | Archaea | 2502 |
| 537 | Ga0207703_10115619 | 3300026035 | Bacteria | 2296 |
| 538 | Ga0207639_10002287 | 3300026041 | Bacteria | 12868 |
| 539 | Ga0207639_10016884 | 3300026041 | Bacteria | 5172 |
| 540 | Ga0207639_10056072 | 3300026041 | Bacteria | 3019 |
| 541 | Ga0207639_10421191 | 3300026041 | Bacteria | 1207 |
| 542 | Ga0207678_10000204 | 3300026067 | Bacteria | 52306 |
| 543 | Ga0207678_10001833 | 3300026067 | Bacteria | 19495 |
| 544 | Ga0207702_10001597 | 3300026078 | Bacteria | 22421 |
| 545 | Ga0207702_10005883 | 3300026078 | Bacteria | 10665 |
| 546 | Ga0207702_10048664 | 3300026078 | Unclassified | 3576 |
| 547 | Ga0207702_10202697 | 3300026078 | Bacteria | 1840 |
| 548 | Ga0207702_10464806 | 3300026078 | Bacteria | 1229 |
| 549 | Ga0207702_10578668 | 3300026078 | Bacteria | 1100 |
| 550 | Ga0207702_11808931 | 3300026078 | Bacteria | 603 |
| 551 | Ga0207702_11990640 | 3300026078 | Unclassified | 571 |
| 552 | Ga0207641_10000894 | 3300026088 | Bacteria | 31042 |
| 553 | Ga0207641_10009428 | 3300026088 | Bacteria | 8043 |
| 554 | Ga0207641_10314118 | 3300026088 | Bacteria | 1484 |
| 555 | Ga0207641_10382005 | 3300026088 | Bacteria | 1349 |
| 556 | Ga0207648_10000757 | 3300026089 | Bacteria | 36296 |
| 557 | Ga0207648_10003612 | 3300026089 | Bacteria | 16172 |
| 558 | Ga0207648_10181375 | 3300026089 | Bacteria | 1864 |
| 559 | Ga0207676_10000113 | 3300026095 | Bacteria | 73022 |
| 560 | Ga0207676_10021492 | 3300026095 | Bacteria | 4734 |
| 561 | Ga0207674_10000076 | 3300026116 | Bacteria | 104404 |
| 562 | Ga0207674_10009505 | 3300026116 | Bacteria | 11102 |
| 563 | Ga0207674_10012344 | 3300026116 | Bacteria | 9550 |
| 564 | Ga0207674_10510987 | 3300026116 | Bacteria | 1161 |
| 565 | Ga0207675_100008819 | 3300026118 | Bacteria | 9464 |
| 566 | Ga0207675_100209346 | 3300026118 | Bacteria | 1875 |
| 567 | Ga0207683_10001129 | 3300026121 | Bacteria | 24286 |
| 568 | Ga0207683_10139318 | 3300026121 | Bacteria | 2185 |
| 569 | Ga0207698_10034814 | 3300026142 | Bacteria | 3676 |
| 570 | Ga0207698_10073362 | 3300026142 | Archaea | 2725 |
| 571 | Ga0207698_10080537 | 3300026142 | Unclassified | 2624 |
| 572 | Ga0207698_10366752 | 3300026142 | Unclassified | 1366 |
| 573 | Ga0207698_10376022 | 3300026142 | Bacteria | 1350 |
| 574 | Ga0265354_1003475 | 3300028016 | Bacteria | 1759 |
| 575 | Ga0268266_10005373 | 3300028379 | Bacteria | 11969 |
| 576 | Ga0268266_10061763 | 3300028379 | Unclassified | 3232 |
| 577 | Ga0268266_10278856 | 3300028379 | Bacteria | 1553 |
| 578 | Ga0268265_10002144 | 3300028380 | Bacteria | 15280 |
| 579 | Ga0268264_10017158 | 3300028381 | Bacteria | 5929 |
| 580 | Ga0268264_10103205 | 3300028381 | Bacteria | 2482 |
| 581 | Ga0268264_10507744 | 3300028381 | Unclassified | 1177 |
| 582 | Ga0265762_1000676 | 3300030760 | Bacteria | 6002 |
| 583 | Ga0265762_1062789 | 3300030760 | Bacteria | 766 |
| 584 | Ga0265770_1008320 | 3300030878 | Bacteria | 1477 |
| 585 | Ga0265770_1117410 | 3300030878 | Bacteria | 557 |
| 586 | Ga0265760_10000206 | 3300031090 | Bacteria | 15774 |
| 587 | Ga0265760_10003560 | 3300031090 | Bacteria | 4520 |
| 588 | Ga0265760_10033288 | 3300031090 | Bacteria | 1523 |
| 589 | Ga0265760_10058278 | 3300031090 | Bacteria | 1170 |
| 590 | Ga0265313_10038348 | 3300031595 | Unclassified | 2387 |
| 591 | Ga0265342_10524984 | 3300031712 | Bacteria | 602 |
| 592 | Ga0373940_0186662 | 3300035088 | Unclassified | 676 |
| 593 | Ga0373940_0323771 | 3300035088 | Unclassified | 536 |
| 594 | Ga0373952_0068054 | 3300035092 | Unclassified | 885 |
| 595 | Ga0373923_0348710 | 3300035111 | Bacteria | 707 |
| 596 | Ga0373923_0612287 | 3300035111 | Unclassified | 537 |
| 597 | Ga0373932_0187903 | 3300035112 | Unclassified | 728 |
| 598 | Ga0373936_0031150 | 3300035113 | Bacteria | 2106 |
| 599 | Ga0373945_0015579 | 3300035116 | Bacteria | 2559 |
| 600 | Ga0373956_0068571 | 3300035119 | Bacteria | 1616 |
| 601 | Ga0373956_0629148 | 3300035119 | Unclassified | 512 |
| 602 | Ga0373946_0461935 | 3300035171 | Bacteria | 647 |
| 603 | Ga0373946_0704577 | 3300035171 | Unclassified | 528 |
| 604 | Ga0373955_0551014 | 3300035172 | Unclassified | 705 |
| 605 | Ga0373961_0273698 | 3300035241 | Unclassified | 617 |
| 606 | Ga0373931_0068842 | 3300035691 | Bacteria | 1927 |
| 607 | Ga0373931_0164848 | 3300035691 | Bacteria | 1301 |
| 608 | Ga0373931_0179118 | 3300035691 | Bacteria | 1254 |
| 609 | Ga0373935_0342165 | 3300035692 | Bacteria | 1065 |
| 610 | Ga0373927_0443442 | 3300035695 | Bacteria | 857 |
| 611 | Ga0373933_0111032 | 3300035724 | Bacteria | 1710 |
| 612 | Ga0373933_0692894 | 3300035724 | Bacteria | 670 |
| 613 | Ga0373947_0064565 | 3300035725 | Bacteria | 2232 |
| 614 | Ga0373947_0383275 | 3300035725 | Bacteria | 947 |
| 615 | Ga0373937_0006928 | 3300036401 | Bacteria | 9786 |
| 616 | Ga0373937_0785266 | 3300036401 | Bacteria | 900 |
| 617 | Ga0373937_1618714 | 3300036401 | Unclassified | 595 |
| 618 | Ga0373925_0087337 | 3300037068 | Bacteria | 2380 |
| 619 | Ga0373925_0493020 | 3300037068 | Unclassified | 1005 |
| 620 | Ga0436363_0942494 | 3300039450 | Bacteria | 566 |
| 621 | Ga0451839_0698791 | 3300041496 | Unclassified | 581 |
| 622 | Ga0451576_1282436 | 3300045051 | Unclassified | 764 |
| 623 | Ga0495592_0146182 | 3300046454 | Bacteria | 1639 |
| 624 | Ga0495651_0448419 | 3300046462 | Bacteria | 834 |
| 625 | Ga0495653_0178202 | 3300046463 | Bacteria | 1461 |
| 626 | Ga0495580_0702637 | 3300046472 | Unclassified | 662 |
| 627 | Ga0495662_0340690 | 3300046476 | Unclassified | 737 |
| 628 | Ga0495662_0674788 | 3300046476 | Unclassified | 504 |
| 629 | Ga0495664_0017250 | 3300046477 | Bacteria | 4126 |
| 630 | Ga0495664_0131284 | 3300046477 | Bacteria | 1517 |
| 631 | Ga0495608_0037373 | 3300046511 | Bacteria | 3265 |
| 632 | Ga0495618_0203085 | 3300046514 | Bacteria | 1254 |
| 633 | Ga0495628_0757193 | 3300046516 | Unclassified | 682 |
| 634 | Ga0495630_0084986 | 3300046517 | Bacteria | 2389 |
| 635 | Ga0495630_0121352 | 3300046517 | Bacteria | 1983 |
| 636 | Ga0495642_0275056 | 3300046528 | Unclassified | 737 |
| 637 | Ga0495652_0517785 | 3300046529 | Bacteria | 825 |
| 638 | Ga0495640_0361501 | 3300046533 | Bacteria | 895 |
| 639 | Ga0495640_0411852 | 3300046533 | Unclassified | 829 |
| 640 | Ga0495587_0067745 | 3300046536 | Bacteria | 2080 |
| 641 | Ga0495645_0005114 | 3300046543 | Bacteria | 8987 |
| 642 | Ga0495645_0296977 | 3300046543 | Bacteria | 1057 |
| 643 | Ga0495667_0016821 | 3300046559 | Bacteria | 4938 |
| 644 | Ga0495667_0330784 | 3300046559 | Unclassified | 964 |
| 645 | Ga0495635_0139099 | 3300046663 | Bacteria | 1654 |
| 646 | Ga0495635_0512669 | 3300046663 | Bacteria | 789 |
| 647 | Ga0495657_0057793 | 3300046675 | Bacteria | 2578 |
| 648 | Ga0495599_0023481 | 3300046678 | Bacteria | 3856 |
| 649 | Ga0495623_0121806 | 3300046679 | Bacteria | 1569 |
| 650 | Ga0495623_0535569 | 3300046679 | Bacteria | 615 |
| 651 | Ga0495646_0029962 | 3300046680 | Bacteria | 3399 |
| 652 | Ga0495669_0270201 | 3300046684 | Unclassified | 817 |
| 653 | Ga0495669_0463321 | 3300046684 | Unclassified | 616 |
| 654 | Ga0495589_0496529 | 3300046794 | Unclassified | 557 |
| 655 | Ga0495600_0224293 | 3300046809 | Unclassified | 1202 |
| 656 | Ga0495604_0047356 | 3300047317 | Bacteria | 3348 |
| 657 | Ga0495604_0797291 | 3300047317 | Unclassified | 595 |
| 658 | Ga0495674_0009662 | 3300047319 | Bacteria | 9159 |
| 659 | Ga0495674_0628774 | 3300047319 | Unclassified | 848 |
| 660 | Ga0495680_0349915 | 3300047322 | Bacteria | 1029 |
| 661 | Ga0495684_0051903 | 3300047471 | Bacteria | 3129 |
| 662 | Ga0495684_0320770 | 3300047471 | Bacteria | 1108 |
| 663 | Ga0495602_0000360 | 3300048088 | Bacteria | 42505 |
| 664 | Ga0495602_0188241 | 3300048088 | Bacteria | 1585 |
| 665 | Ga0495602_0427794 | 3300048088 | Bacteria | 939 |
| 666 | Ga0496100_0031661 | 3300048903 | Bacteria | 3290 |
| 667 | Ga0496100_0744742 | 3300048903 | Unclassified | 766 |
| 668 | Ga0496101_0003461 | 3300048904 | Bacteria | 9848 |
| 669 | Ga0496101_0069100 | 3300048904 | Bacteria | 2584 |
| 670 | Ga0496101_0131212 | 3300048904 | Bacteria | 1903 |
| 671 | Ga0496101_0403020 | 3300048904 | Unclassified | 1077 |
| 672 | Ga0496101_0766498 | 3300048904 | Unclassified | 761 |
| 673 | Ga0496102_0000537 | 3300048905 | Bacteria | 40994 |
| 674 | Ga0496102_0034176 | 3300048905 | Unclassified | 4573 |
| 675 | Ga0496102_0042175 | 3300048905 | Unclassified | 4135 |
| 676 | Ga0496102_0084755 | 3300048905 | Unclassified | 2925 |
| 677 | Ga0496103_0029061 | 3300048906 | Bacteria | 3358 |
| 678 | Ga0496103_0087374 | 3300048906 | Bacteria | 1965 |
| 679 | Ga0496103_0908958 | 3300048906 | Unclassified | 551 |
| 680 | Ga0496104_0043291 | 3300048907 | Bacteria | 4229 |
| 681 | Ga0496104_0043663 | 3300048907 | Bacteria | 4210 |
| 682 | Ga0496104_0097111 | 3300048907 | Unclassified | 2819 |
| 683 | Ga0496104_0193678 | 3300048907 | Bacteria | 1945 |
| 684 | Ga0496104_0622441 | 3300048907 | Unclassified | 989 |
| 685 | Ga0496104_0870699 | 3300048907 | Unclassified | 806 |
| 686 | Ga0496105_0223019 | 3300048908 | Unclassified | 1534 |
| 687 | Ga0496105_0396745 | 3300048908 | Bacteria | 1096 |
| 688 | Ga0496105_0855422 | 3300048908 | Unclassified | 688 |
| 689 | Ga0496106_0060516 | 3300048909 | Bacteria | 2871 |
| 690 | Ga0496106_0137926 | 3300048909 | Bacteria | 1917 |
| 691 | Ga0496106_0167565 | 3300048909 | Bacteria | 1740 |
| 692 | Ga0496106_0844584 | 3300048909 | Unclassified | 725 |
| 693 | Ga0496107_0047707 | 3300048910 | Bacteria | 3084 |
| 694 | Ga0496107_0156443 | 3300048910 | Bacteria | 1688 |
| 695 | Ga0496107_0581475 | 3300048910 | Unclassified | 828 |
| 696 | Ga0496107_0790807 | 3300048910 | Unclassified | 695 |
| 697 | Ga0496108_0002118 | 3300048911 | Bacteria | 15901 |
| 698 | Ga0496109_0000008 | 3300048912 | Bacteria | 245809 |
| 699 | Ga0496109_1163704 | 3300048912 | Bacteria | 708 |
| 700 | Ga0496109_1361679 | 3300048912 | Bacteria | 645 |
| 701 | Ga0496110_0008075 | 3300048913 | Bacteria | 8450 |
| 702 | Ga0496110_0110860 | 3300048913 | Bacteria | 2466 |
| 703 | Ga0496111_0005563 | 3300048914 | Bacteria | 8097 |
| 704 | Ga0496112_0000334 | 3300048915 | Bacteria | 30562 |
| 705 | Ga0496112_0001276 | 3300048915 | Bacteria | 19093 |
| 706 | Ga0496112_0044733 | 3300048915 | Bacteria | 4339 |
| 707 | Ga0496112_0072790 | 3300048915 | Unclassified | 3397 |
| 708 | Ga0496112_0207500 | 3300048915 | Unclassified | 1917 |
| 709 | Ga0496112_0277531 | 3300048915 | Bacteria | 1624 |
| 710 | Ga0496112_0409378 | 3300048915 | Unclassified | 1295 |
| 711 | Ga0496113_0006066 | 3300048916 | Bacteria | 7617 |
| 712 | Ga0496113_0111874 | 3300048916 | Unclassified | 2126 |
| 713 | Ga0496113_0151138 | 3300048916 | Bacteria | 1832 |
| 714 | Ga0496113_0267616 | 3300048916 | Archaea | 1366 |
| 715 | Ga0496114_0041204 | 3300048917 | Bacteria | 3826 |
| 716 | Ga0496115_0016349 | 3300048918 | Bacteria | 5648 |
| 717 | Ga0496115_0446328 | 3300048918 | Unclassified | 1045 |
| 718 | Ga0496115_0629328 | 3300048918 | Unclassified | 850 |
| 719 | Ga0501047_0894319 | 3300049581 | Unclassified | 701 |
| 720 | Ga0501073_0258869 | 3300049589 | Bacteria | 1201 |
| 721 | Ga0501044_0158399 | 3300049823 | Bacteria | 2242 |
| 722 | nmdc:mga08y16_1200968_c1 | 3300050511 | Unclassified | 729 |
| 723 | nmdc:mga0n895_34675_c1 | 3300050512 | Bacteria | 4860 |
| 724 | nmdc:mga0n895_634_c1 | 3300050512 | Bacteria | 24414 |
| 725 | nmdc:mga0rr50_711970_c1 | 3300050513 | Unclassified | 857 |
| 726 | nmdc:mga08x19_1121820_c1 | 3300050514 | Unclassified | 558 |
| 727 | nmdc:mga08x19_12628_c1 | 3300050514 | Bacteria | 5093 |
| 728 | nmdc:mga08x19_168254_c1 | 3300050514 | Bacteria | 1491 |
| 729 | nmdc:mga0a205_117991_c1 | 3300050515 | Bacteria | 2552 |
| 730 | nmdc:mga0a205_493545_c1 | 3300050515 | Unclassified | 1082 |
| 731 | nmdc:mga0a205_905760_c1 | 3300050515 | Unclassified | 729 |
| 732 | Ga0495601_0060993 | 3300053077 | Bacteria | 2394 |
| 733 | Ga0495601_0161914 | 3300053077 | Bacteria | 1462 |
| 734 | Ga0495612_0005112 | 3300053078 | Bacteria | 5424 |
| 735 | Ga0495612_0521841 | 3300053078 | Unclassified | 546 |
| 736 | Ga0495595_0072005 | 3300053084 | Unclassified | 1635 |
| 737 | Ga0495619_0358892 | 3300053085 | Unclassified | 1008 |
| 738 | Ga0587077_191670 | 3300059493 | Bacteria | 560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_11074476 | Ga0105246_110744761 | 96 |
| 2 | 3300046559 | Ga0495667_0016821 | Ga0495667_0016821_724_1038 | 102 |
| 3 | 3300005327 | Ga0070658_10405901 | Ga0070658_104059012 | 107 |
| 4 | 3300005338 | Ga0068868_100345696 | Ga0068868_1003456962 | 107 |
| 5 | 3300005435 | Ga0070714_100945325 | Ga0070714_1009453252 | 107 |
| 6 | 3300005436 | Ga0070713_100121506 | Ga0070713_1001215062 | 107 |
| 7 | 3300005439 | Ga0070711_100002248 | Ga0070711_10000224811 | 107 |
| 8 | 3300005439 | Ga0070711_100129574 | Ga0070711_1001295744 | 107 |
| 9 | 3300006028 | Ga0070717_11143972 | Ga0070717_111439721 | 107 |
| 10 | 3300006175 | Ga0070712_100004100 | Ga0070712_10000410010 | 107 |
| 11 | 3300006358 | Ga0068871_100837450 | Ga0068871_1008374502 | 107 |
| 12 | 3300009553 | Ga0105249_10776029 | Ga0105249_107760292 | 107 |
| 13 | 3300010159 | Ga0099796_10247869 | Ga0099796_102478691 | 107 |
| 14 | 3300013306 | Ga0163162_10205651 | Ga0163162_102056514 | 107 |
| 15 | 3300025909 | Ga0207705_10473411 | Ga0207705_104734112 | 107 |
| 16 | 3300025915 | Ga0207693_10003938 | Ga0207693_100039384 | 107 |
| 17 | 3300025916 | Ga0207663_10074322 | Ga0207663_100743222 | 107 |
| 18 | 3300025928 | Ga0207700_10090161 | Ga0207700_100901612 | 107 |
| 19 | 3300025929 | Ga0207664_10347576 | Ga0207664_103475762 | 107 |
| 20 | 3300025939 | Ga0207665_10901943 | Ga0207665_109019432 | 107 |
| 21 | 3300026023 | Ga0207677_10328926 | Ga0207677_103289263 | 107 |
| 22 | 3300026088 | Ga0207641_10382005 | Ga0207641_103820051 | 107 |
| 23 | 3300031090 | Ga0265760_10003560 | Ga0265760_100035606 | 107 |
| 24 | 3300031595 | Ga0265313_10038348 | Ga0265313_100383482 | 107 |
| 25 | 3300031712 | Ga0265342_10524984 | Ga0265342_105249841 | 107 |
| 26 | 3300035092 | Ga0373952_0068054 | Ga0373952_0068054_523_849 | 107 |
| 27 | 3300041496 | Ga0451839_0698791 | Ga0451839_0698791_185_508 | 107 |
| 28 | 3300048088 | Ga0495602_0427794 | Ga0495602_0427794_591_914 | 107 |
| 29 | 3300049581 | Ga0501047_0894319 | Ga0501047_0894319_95_448 | 107 |
| 30 | 3300049823 | Ga0501044_0158399 | Ga0501044_0158399_1873_2226 | 107 |
| 31 | 3300005338 | Ga0068868_101727857 | Ga0068868_1017278571 | 108 |
| 32 | 3300005563 | Ga0068855_101989677 | Ga0068855_1019896771 | 108 |
| 33 | 3300036401 | Ga0373937_0785266 | Ga0373937_0785266_544_882 | 108 |
| 34 | 3300004799 | Ga0058863_11769502 | Ga0058863_117695021 | 109 |
| 35 | 3300004803 | Ga0058862_10008808 | Ga0058862_100088081 | 109 |
| 36 | 3300005327 | Ga0070658_10370542 | Ga0070658_103705422 | 109 |
| 37 | 3300005327 | Ga0070658_10415299 | Ga0070658_104152992 | 109 |
| 38 | 3300005328 | Ga0070676_10160666 | Ga0070676_101606662 | 109 |
| 39 | 3300005329 | Ga0070683_100021957 | Ga0070683_1000219572 | 109 |
| 40 | 3300005329 | Ga0070683_100031689 | Ga0070683_1000316895 | 109 |
| 41 | 3300005329 | Ga0070683_100082482 | Ga0070683_1000824824 | 109 |
| 42 | 3300005330 | Ga0070690_100145461 | Ga0070690_1001454613 | 109 |
| 43 | 3300005330 | Ga0070690_100147599 | Ga0070690_1001475991 | 109 |
| 44 | 3300005330 | Ga0070690_100888145 | Ga0070690_1008881451 | 109 |
| 45 | 3300005331 | Ga0070670_100126500 | Ga0070670_1001265002 | 109 |
| 46 | 3300005331 | Ga0070670_101075184 | Ga0070670_1010751842 | 109 |
| 47 | 3300005334 | Ga0068869_100490673 | Ga0068869_1004906732 | 109 |
| 48 | 3300005335 | Ga0070666_10011983 | Ga0070666_100119836 | 109 |
| 49 | 3300005336 | Ga0070680_100089047 | Ga0070680_1000890473 | 109 |
| 50 | 3300005337 | Ga0070682_100071298 | Ga0070682_1000712981 | 109 |
| 51 | 3300005337 | Ga0070682_100209862 | Ga0070682_1002098621 | 109 |
| 52 | 3300005338 | Ga0068868_100008382 | Ga0068868_1000083826 | 109 |
| 53 | 3300005338 | Ga0068868_100010214 | Ga0068868_1000102143 | 109 |
| 54 | 3300005338 | Ga0068868_100106830 | Ga0068868_1001068302 | 109 |
| 55 | 3300005339 | Ga0070660_100044330 | Ga0070660_1000443305 | 109 |
| 56 | 3300005339 | Ga0070660_100057478 | Ga0070660_1000574784 | 109 |
| 57 | 3300005340 | Ga0070689_100277665 | Ga0070689_1002776652 | 109 |
| 58 | 3300005343 | Ga0070687_100886103 | Ga0070687_1008861031 | 109 |
| 59 | 3300005344 | Ga0070661_100033165 | Ga0070661_1000331651 | 109 |
| 60 | 3300005344 | Ga0070661_100107608 | Ga0070661_1001076081 | 109 |
| 61 | 3300005344 | Ga0070661_100162808 | Ga0070661_1001628082 | 109 |
| 62 | 3300005347 | Ga0070668_100055194 | Ga0070668_1000551942 | 109 |
| 63 | 3300005364 | Ga0070673_100153144 | Ga0070673_1001531442 | 109 |
| 64 | 3300005366 | Ga0070659_100014097 | Ga0070659_1000140976 | 109 |
| 65 | 3300005367 | Ga0070667_100278847 | Ga0070667_1002788471 | 109 |
| 66 | 3300005435 | Ga0070714_100658023 | Ga0070714_1006580232 | 109 |
| 67 | 3300005435 | Ga0070714_102337374 | Ga0070714_1023373741 | 109 |
| 68 | 3300005436 | Ga0070713_100005444 | Ga0070713_1000054442 | 109 |
| 69 | 3300005436 | Ga0070713_100086907 | Ga0070713_1000869073 | 109 |
| 70 | 3300005436 | Ga0070713_100384492 | Ga0070713_1003844922 | 109 |
| 71 | 3300005436 | Ga0070713_100923606 | Ga0070713_1009236061 | 109 |
| 72 | 3300005437 | Ga0070710_10312298 | Ga0070710_103122982 | 109 |
| 73 | 3300005438 | Ga0070701_10884135 | Ga0070701_108841352 | 109 |
| 74 | 3300005444 | Ga0070694_100083271 | Ga0070694_1000832712 | 109 |
| 75 | 3300005445 | Ga0070708_100059755 | Ga0070708_1000597553 | 109 |
| 76 | 3300005455 | Ga0070663_100063087 | Ga0070663_1000630873 | 109 |
| 77 | 3300005457 | Ga0070662_100002426 | Ga0070662_10000242610 | 109 |
| 78 | 3300005457 | Ga0070662_100352213 | Ga0070662_1003522132 | 109 |
| 79 | 3300005458 | Ga0070681_10000316 | Ga0070681_1000031629 | 109 |
| 80 | 3300005458 | Ga0070681_10021618 | Ga0070681_100216183 | 109 |
| 81 | 3300005458 | Ga0070681_10293479 | Ga0070681_102934791 | 109 |
| 82 | 3300005458 | Ga0070681_10293697 | Ga0070681_102936971 | 109 |
| 83 | 3300005459 | Ga0068867_100073669 | Ga0068867_1000736692 | 109 |
| 84 | 3300005459 | Ga0068867_100110748 | Ga0068867_1001107483 | 109 |
| 85 | 3300005459 | Ga0068867_100462299 | Ga0068867_1004622991 | 109 |
| 86 | 3300005467 | Ga0070706_100002695 | Ga0070706_1000026953 | 109 |
| 87 | 3300005468 | Ga0070707_100291810 | Ga0070707_1002918102 | 109 |
| 88 | 3300005518 | Ga0070699_100001799 | Ga0070699_10000179915 | 109 |
| 89 | 3300005518 | Ga0070699_100004056 | Ga0070699_1000040563 | 109 |
| 90 | 3300005530 | Ga0070679_100069763 | Ga0070679_1000697633 | 109 |
| 91 | 3300005530 | Ga0070679_100095462 | Ga0070679_1000954623 | 109 |
| 92 | 3300005530 | Ga0070679_101621425 | Ga0070679_1016214251 | 109 |
| 93 | 3300005535 | Ga0070684_100007536 | Ga0070684_10000753610 | 109 |
| 94 | 3300005535 | Ga0070684_100035675 | Ga0070684_1000356753 | 109 |
| 95 | 3300005535 | Ga0070684_100162037 | Ga0070684_1001620372 | 109 |
| 96 | 3300005536 | Ga0070697_100006755 | Ga0070697_10000675511 | 109 |
| 97 | 3300005536 | Ga0070697_100011980 | Ga0070697_1000119806 | 109 |
| 98 | 3300005536 | Ga0070697_100044001 | Ga0070697_1000440012 | 109 |
| 99 | 3300005536 | Ga0070697_101039472 | Ga0070697_1010394722 | 109 |
| 100 | 3300005539 | Ga0068853_100004139 | Ga0068853_1000041395 | 109 |
| 101 | 3300005539 | Ga0068853_100038223 | Ga0068853_1000382232 | 109 |
| 102 | 3300005539 | Ga0068853_100067230 | Ga0068853_1000672301 | 109 |
| 103 | 3300005539 | Ga0068853_100104817 | Ga0068853_1001048172 | 109 |
| 104 | 3300005544 | Ga0070686_100040874 | Ga0070686_1000408745 | 109 |
| 105 | 3300005545 | Ga0070695_100547240 | Ga0070695_1005472401 | 109 |
| 106 | 3300005546 | Ga0070696_100343277 | Ga0070696_1003432772 | 109 |
| 107 | 3300005547 | Ga0070693_100007116 | Ga0070693_1000071166 | 109 |
| 108 | 3300005547 | Ga0070693_100038385 | Ga0070693_1000383854 | 109 |
| 109 | 3300005548 | Ga0070665_100029285 | Ga0070665_1000292854 | 109 |
| 110 | 3300005548 | Ga0070665_100069445 | Ga0070665_1000694454 | 109 |
| 111 | 3300005548 | Ga0070665_100698832 | Ga0070665_1006988322 | 109 |
| 112 | 3300005549 | Ga0070704_100175269 | Ga0070704_1001752691 | 109 |
| 113 | 3300005563 | Ga0068855_100000903 | Ga0068855_10000090327 | 109 |
| 114 | 3300005563 | Ga0068855_100008318 | Ga0068855_10000831811 | 109 |
| 115 | 3300005563 | Ga0068855_100018323 | Ga0068855_1000183235 | 109 |
| 116 | 3300005563 | Ga0068855_100070191 | Ga0068855_1000701912 | 109 |
| 117 | 3300005564 | Ga0070664_100020221 | Ga0070664_1000202216 | 109 |
| 118 | 3300005564 | Ga0070664_100103439 | Ga0070664_1001034392 | 109 |
| 119 | 3300005577 | Ga0068857_100006800 | Ga0068857_1000068007 | 109 |
| 120 | 3300005577 | Ga0068857_100015007 | Ga0068857_1000150076 | 109 |
| 121 | 3300005577 | Ga0068857_100183885 | Ga0068857_1001838852 | 109 |
| 122 | 3300005577 | Ga0068857_101723093 | Ga0068857_1017230932 | 109 |
| 123 | 3300005578 | Ga0068854_100022350 | Ga0068854_1000223502 | 109 |
| 124 | 3300005578 | Ga0068854_100296632 | Ga0068854_1002966322 | 109 |
| 125 | 3300005578 | Ga0068854_100345535 | Ga0068854_1003455353 | 109 |
| 126 | 3300005614 | Ga0068856_100001036 | Ga0068856_10000103620 | 109 |
| 127 | 3300005614 | Ga0068856_100001068 | Ga0068856_10000106810 | 109 |
| 128 | 3300005614 | Ga0068856_100216334 | Ga0068856_1002163342 | 109 |
| 129 | 3300005614 | Ga0068856_100667995 | Ga0068856_1006679951 | 109 |
| 130 | 3300005615 | Ga0070702_100237110 | Ga0070702_1002371102 | 109 |
| 131 | 3300005616 | Ga0068852_100025776 | Ga0068852_1000257762 | 109 |
| 132 | 3300005616 | Ga0068852_100403406 | Ga0068852_1004034062 | 109 |
| 133 | 3300005617 | Ga0068859_100029738 | Ga0068859_1000297382 | 109 |
| 134 | 3300005618 | Ga0068864_100031399 | Ga0068864_1000313994 | 109 |
| 135 | 3300005718 | Ga0068866_10214536 | Ga0068866_102145362 | 109 |
| 136 | 3300005718 | Ga0068866_10298376 | Ga0068866_102983762 | 109 |
| 137 | 3300005834 | Ga0068851_10029254 | Ga0068851_100292544 | 109 |
| 138 | 3300005841 | Ga0068863_100053854 | Ga0068863_1000538543 | 109 |
| 139 | 3300005841 | Ga0068863_100301698 | Ga0068863_1003016982 | 109 |
| 140 | 3300005841 | Ga0068863_102101971 | Ga0068863_1021019711 | 109 |
| 141 | 3300005842 | Ga0068858_100005248 | Ga0068858_1000052485 | 109 |
| 142 | 3300005842 | Ga0068858_100021345 | Ga0068858_1000213454 | 109 |
| 143 | 3300005842 | Ga0068858_100070266 | Ga0068858_1000702662 | 109 |
| 144 | 3300005843 | Ga0068860_100039000 | Ga0068860_1000390004 | 109 |
| 145 | 3300005843 | Ga0068860_100497156 | Ga0068860_1004971561 | 109 |
| 146 | 3300005843 | Ga0068860_101065769 | Ga0068860_1010657692 | 109 |
| 147 | 3300005844 | Ga0068862_100482592 | Ga0068862_1004825922 | 109 |
| 148 | 3300006028 | Ga0070717_10001077 | Ga0070717_1000107720 | 109 |
| 149 | 3300006028 | Ga0070717_10134364 | Ga0070717_101343643 | 109 |
| 150 | 3300006173 | Ga0070716_100147367 | Ga0070716_1001473672 | 109 |
| 151 | 3300006173 | Ga0070716_100451604 | Ga0070716_1004516042 | 109 |
| 152 | 3300006237 | Ga0097621_100000216 | Ga0097621_10000021627 | 109 |
| 153 | 3300006237 | Ga0097621_100005019 | Ga0097621_1000050195 | 109 |
| 154 | 3300006237 | Ga0097621_100162180 | Ga0097621_1001621803 | 109 |
| 155 | 3300006237 | Ga0097621_100292566 | Ga0097621_1002925662 | 109 |
| 156 | 3300006358 | Ga0068871_100000182 | Ga0068871_10000018231 | 109 |
| 157 | 3300006358 | Ga0068871_100007539 | Ga0068871_1000075399 | 109 |
| 158 | 3300006358 | Ga0068871_100252176 | Ga0068871_1002521762 | 109 |
| 159 | 3300006358 | Ga0068871_100332071 | Ga0068871_1003320712 | 109 |
| 160 | 3300006852 | Ga0075433_10117605 | Ga0075433_101176054 | 109 |
| 161 | 3300006871 | Ga0075434_100247864 | Ga0075434_1002478642 | 109 |
| 162 | 3300006881 | Ga0068865_100093370 | Ga0068865_1000933702 | 109 |
| 163 | 3300006881 | Ga0068865_100307328 | Ga0068865_1003073282 | 109 |
| 164 | 3300006914 | Ga0075436_100149157 | Ga0075436_1001491572 | 109 |
| 165 | 3300006931 | Ga0097620_100029739 | Ga0097620_1000297392 | 109 |
| 166 | 3300007076 | Ga0075435_100092565 | Ga0075435_1000925651 | 109 |
| 167 | 3300009092 | Ga0105250_10611913 | Ga0105250_106119131 | 109 |
| 168 | 3300009093 | Ga0105240_10053308 | Ga0105240_100533083 | 109 |
| 169 | 3300009093 | Ga0105240_10164065 | Ga0105240_101640652 | 109 |
| 170 | 3300009093 | Ga0105240_10473020 | Ga0105240_104730202 | 109 |
| 171 | 3300009093 | Ga0105240_10540673 | Ga0105240_105406732 | 109 |
| 172 | 3300009093 | Ga0105240_10797934 | Ga0105240_107979342 | 109 |
| 173 | 3300009098 | Ga0105245_10088679 | Ga0105245_100886793 | 109 |
| 174 | 3300009098 | Ga0105245_10745329 | Ga0105245_107453292 | 109 |
| 175 | 3300009148 | Ga0105243_10246974 | Ga0105243_102469742 | 109 |
| 176 | 3300009148 | Ga0105243_11466350 | Ga0105243_114663502 | 109 |
| 177 | 3300009174 | Ga0105241_10013885 | Ga0105241_100138852 | 109 |
| 178 | 3300009174 | Ga0105241_10150024 | Ga0105241_101500242 | 109 |
| 179 | 3300009176 | Ga0105242_10014052 | Ga0105242_100140523 | 109 |
| 180 | 3300009176 | Ga0105242_10017241 | Ga0105242_100172414 | 109 |
| 181 | 3300009177 | Ga0105248_10015267 | Ga0105248_100152672 | 109 |
| 182 | 3300009177 | Ga0105248_10039571 | Ga0105248_100395716 | 109 |
| 183 | 3300009177 | Ga0105248_10056843 | Ga0105248_100568434 | 109 |
| 184 | 3300009177 | Ga0105248_10310935 | Ga0105248_103109351 | 109 |
| 185 | 3300009545 | Ga0105237_10022385 | Ga0105237_100223854 | 109 |
| 186 | 3300009545 | Ga0105237_10030939 | Ga0105237_100309395 | 109 |
| 187 | 3300009545 | Ga0105237_10278684 | Ga0105237_102786842 | 109 |
| 188 | 3300009545 | Ga0105237_11135032 | Ga0105237_111350321 | 109 |
| 189 | 3300009551 | Ga0105238_10005296 | Ga0105238_100052965 | 109 |
| 190 | 3300009551 | Ga0105238_10022710 | Ga0105238_100227102 | 109 |
| 191 | 3300009551 | Ga0105238_10066624 | Ga0105238_100666243 | 109 |
| 192 | 3300009551 | Ga0105238_10449343 | Ga0105238_104493432 | 109 |
| 193 | 3300009551 | Ga0105238_10648251 | Ga0105238_106482512 | 109 |
| 194 | 3300009553 | Ga0105249_10015359 | Ga0105249_100153593 | 109 |
| 195 | 3300010375 | Ga0105239_10042312 | Ga0105239_100423126 | 109 |
| 196 | 3300010375 | Ga0105239_10088162 | Ga0105239_100881624 | 109 |
| 197 | 3300010375 | Ga0105239_10221123 | Ga0105239_102211232 | 109 |
| 198 | 3300010375 | Ga0105239_10783412 | Ga0105239_107834122 | 109 |
| 199 | 3300013100 | Ga0157373_10006948 | Ga0157373_100069489 | 109 |
| 200 | 3300013100 | Ga0157373_10036993 | Ga0157373_100369934 | 109 |
| 201 | 3300013102 | Ga0157371_10020814 | Ga0157371_100208145 | 109 |
| 202 | 3300013102 | Ga0157371_10042811 | Ga0157371_100428114 | 109 |
| 203 | 3300013104 | Ga0157370_10009209 | Ga0157370_1000920911 | 109 |
| 204 | 3300013104 | Ga0157370_10655340 | Ga0157370_106553402 | 109 |
| 205 | 3300013104 | Ga0157370_11695722 | Ga0157370_116957221 | 109 |
| 206 | 3300013105 | Ga0157369_10001537 | Ga0157369_100015377 | 109 |
| 207 | 3300013105 | Ga0157369_10031401 | Ga0157369_100314016 | 109 |
| 208 | 3300013105 | Ga0157369_11311365 | Ga0157369_113113651 | 109 |
| 209 | 3300013105 | Ga0157369_12651676 | Ga0157369_126516761 | 109 |
| 210 | 3300013296 | Ga0157374_10000090 | Ga0157374_1000009038 | 109 |
| 211 | 3300013296 | Ga0157374_10000483 | Ga0157374_1000048327 | 109 |
| 212 | 3300013296 | Ga0157374_10002984 | Ga0157374_100029848 | 109 |
| 213 | 3300013296 | Ga0157374_10019060 | Ga0157374_100190608 | 109 |
| 214 | 3300013296 | Ga0157374_10397741 | Ga0157374_103977412 | 109 |
| 215 | 3300013297 | Ga0157378_10000331 | Ga0157378_1000033133 | 109 |
| 216 | 3300013297 | Ga0157378_10005420 | Ga0157378_100054209 | 109 |
| 217 | 3300013297 | Ga0157378_10039250 | Ga0157378_100392504 | 109 |
| 218 | 3300013306 | Ga0163162_10013974 | Ga0163162_100139747 | 109 |
| 219 | 3300013306 | Ga0163162_10024935 | Ga0163162_100249356 | 109 |
| 220 | 3300013306 | Ga0163162_10761444 | Ga0163162_107614442 | 109 |
| 221 | 3300013307 | Ga0157372_10000100 | Ga0157372_1000010077 | 109 |
| 222 | 3300013307 | Ga0157372_10009031 | Ga0157372_100090315 | 109 |
| 223 | 3300013307 | Ga0157372_10424099 | Ga0157372_104240992 | 109 |
| 224 | 3300013307 | Ga0157372_11411127 | Ga0157372_114111272 | 109 |
| 225 | 3300013307 | Ga0157372_11528981 | Ga0157372_115289811 | 109 |
| 226 | 3300013308 | Ga0157375_10127795 | Ga0157375_101277952 | 109 |
| 227 | 3300014325 | Ga0163163_10048270 | Ga0163163_100482704 | 109 |
| 228 | 3300014325 | Ga0163163_10314893 | Ga0163163_103148932 | 109 |
| 229 | 3300014497 | Ga0182008_10002356 | Ga0182008_1000235611 | 109 |
| 230 | 3300014968 | Ga0157379_10006291 | Ga0157379_100062916 | 109 |
| 231 | 3300014969 | Ga0157376_10135808 | Ga0157376_101358083 | 109 |
| 232 | 3300014969 | Ga0157376_10346075 | Ga0157376_103460752 | 109 |
| 233 | 3300015261 | Ga0182006_1023091 | Ga0182006_10230914 | 109 |
| 234 | 3300015262 | Ga0182007_10004823 | Ga0182007_100048235 | 109 |
| 235 | 3300020080 | Ga0206350_10233586 | Ga0206350_102335863 | 109 |
| 236 | 3300022467 | Ga0224712_10295021 | Ga0224712_102950211 | 109 |
| 237 | 3300024225 | Ga0224572_1044419 | Ga0224572_10444192 | 109 |
| 238 | 3300025315 | Ga0207697_10161545 | Ga0207697_101615452 | 109 |
| 239 | 3300025899 | Ga0207642_10008335 | Ga0207642_100083352 | 109 |
| 240 | 3300025899 | Ga0207642_11153481 | Ga0207642_111534811 | 109 |
| 241 | 3300025903 | Ga0207680_10082240 | Ga0207680_100822402 | 109 |
| 242 | 3300025904 | Ga0207647_10460846 | Ga0207647_104608462 | 109 |
| 243 | 3300025907 | Ga0207645_10018414 | Ga0207645_100184143 | 109 |
| 244 | 3300025909 | Ga0207705_10545501 | Ga0207705_105455012 | 109 |
| 245 | 3300025910 | Ga0207684_10003578 | Ga0207684_100035783 | 109 |
| 246 | 3300025911 | Ga0207654_10004318 | Ga0207654_100043186 | 109 |
| 247 | 3300025911 | Ga0207654_10073471 | Ga0207654_100734712 | 109 |
| 248 | 3300025912 | Ga0207707_10006534 | Ga0207707_100065344 | 109 |
| 249 | 3300025912 | Ga0207707_10038395 | Ga0207707_100383952 | 109 |
| 250 | 3300025912 | Ga0207707_10083377 | Ga0207707_100833772 | 109 |
| 251 | 3300025912 | Ga0207707_10113218 | Ga0207707_101132184 | 109 |
| 252 | 3300025912 | Ga0207707_10127015 | Ga0207707_101270151 | 109 |
| 253 | 3300025913 | Ga0207695_10053615 | Ga0207695_100536151 | 109 |
| 254 | 3300025913 | Ga0207695_10329497 | Ga0207695_103294972 | 109 |
| 255 | 3300025913 | Ga0207695_10372364 | Ga0207695_103723642 | 109 |
| 256 | 3300025913 | Ga0207695_10537123 | Ga0207695_105371232 | 109 |
| 257 | 3300025914 | Ga0207671_10009137 | Ga0207671_100091378 | 109 |
| 258 | 3300025914 | Ga0207671_10052117 | Ga0207671_100521175 | 109 |
| 259 | 3300025914 | Ga0207671_10104037 | Ga0207671_101040373 | 109 |
| 260 | 3300025917 | Ga0207660_10055524 | Ga0207660_100555242 | 109 |
| 261 | 3300025917 | Ga0207660_10068043 | Ga0207660_100680433 | 109 |
| 262 | 3300025918 | Ga0207662_10355510 | Ga0207662_103555101 | 109 |
| 263 | 3300025919 | Ga0207657_10000246 | Ga0207657_1000024631 | 109 |
| 264 | 3300025919 | Ga0207657_10001266 | Ga0207657_100012666 | 109 |
| 265 | 3300025920 | Ga0207649_10035420 | Ga0207649_100354203 | 109 |
| 266 | 3300025921 | Ga0207652_10137235 | Ga0207652_101372352 | 109 |
| 267 | 3300025921 | Ga0207652_10265697 | Ga0207652_102656972 | 109 |
| 268 | 3300025922 | Ga0207646_10125198 | Ga0207646_101251982 | 109 |
| 269 | 3300025924 | Ga0207694_10002864 | Ga0207694_100028647 | 109 |
| 270 | 3300025924 | Ga0207694_10005754 | Ga0207694_100057543 | 109 |
| 271 | 3300025924 | Ga0207694_10014163 | Ga0207694_100141632 | 109 |
| 272 | 3300025924 | Ga0207694_10045721 | Ga0207694_100457213 | 109 |
| 273 | 3300025924 | Ga0207694_10555289 | Ga0207694_105552892 | 109 |
| 274 | 3300025925 | Ga0207650_11082910 | Ga0207650_110829101 | 109 |
| 275 | 3300025927 | Ga0207687_10002307 | Ga0207687_100023072 | 109 |
| 276 | 3300025927 | Ga0207687_10329020 | Ga0207687_103290201 | 109 |
| 277 | 3300025928 | Ga0207700_10118884 | Ga0207700_101188842 | 109 |
| 278 | 3300025928 | Ga0207700_11349304 | Ga0207700_113493041 | 109 |
| 279 | 3300025929 | Ga0207664_10172385 | Ga0207664_101723852 | 109 |
| 280 | 3300025929 | Ga0207664_10409035 | Ga0207664_104090352 | 109 |
| 281 | 3300025932 | Ga0207690_10022450 | Ga0207690_100224504 | 109 |
| 282 | 3300025932 | Ga0207690_10169754 | Ga0207690_101697542 | 109 |
| 283 | 3300025932 | Ga0207690_11575827 | Ga0207690_115758271 | 109 |
| 284 | 3300025933 | Ga0207706_10000139 | Ga0207706_1000013934 | 109 |
| 285 | 3300025933 | Ga0207706_10084476 | Ga0207706_100844763 | 109 |
| 286 | 3300025934 | Ga0207686_10055788 | Ga0207686_100557882 | 109 |
| 287 | 3300025936 | Ga0207670_10593248 | Ga0207670_105932482 | 109 |
| 288 | 3300025937 | Ga0207669_11121922 | Ga0207669_111219221 | 109 |
| 289 | 3300025938 | Ga0207704_10027609 | Ga0207704_100276093 | 109 |
| 290 | 3300025938 | Ga0207704_10291971 | Ga0207704_102919712 | 109 |
| 291 | 3300025939 | Ga0207665_10099049 | Ga0207665_100990492 | 109 |
| 292 | 3300025941 | Ga0207711_10018665 | Ga0207711_100186651 | 109 |
| 293 | 3300025941 | Ga0207711_10108962 | Ga0207711_101089622 | 109 |
| 294 | 3300025942 | Ga0207689_10773812 | Ga0207689_107738122 | 109 |
| 295 | 3300025944 | Ga0207661_10019113 | Ga0207661_100191135 | 109 |
| 296 | 3300025944 | Ga0207661_10070730 | Ga0207661_100707304 | 109 |
| 297 | 3300025945 | Ga0207679_10091753 | Ga0207679_100917532 | 109 |
| 298 | 3300025945 | Ga0207679_10202751 | Ga0207679_102027513 | 109 |
| 299 | 3300025949 | Ga0207667_10000170 | Ga0207667_1000017011 | 109 |
| 300 | 3300025949 | Ga0207667_10004029 | Ga0207667_100040298 | 109 |
| 301 | 3300025949 | Ga0207667_10007225 | Ga0207667_1000722511 | 109 |
| 302 | 3300025949 | Ga0207667_10128304 | Ga0207667_101283044 | 109 |
| 303 | 3300025949 | Ga0207667_10909583 | Ga0207667_109095831 | 109 |
| 304 | 3300025960 | Ga0207651_10223679 | Ga0207651_102236792 | 109 |
| 305 | 3300025961 | Ga0207712_10013954 | Ga0207712_100139546 | 109 |
| 306 | 3300025972 | Ga0207668_10052744 | Ga0207668_100527443 | 109 |
| 307 | 3300025972 | Ga0207668_10818059 | Ga0207668_108180591 | 109 |
| 308 | 3300025981 | Ga0207640_10022601 | Ga0207640_100226014 | 109 |
| 309 | 3300025981 | Ga0207640_10067491 | Ga0207640_100674912 | 109 |
| 310 | 3300025981 | Ga0207640_10115583 | Ga0207640_101155832 | 109 |
| 311 | 3300025986 | Ga0207658_11442689 | Ga0207658_114426891 | 109 |
| 312 | 3300026023 | Ga0207677_10007606 | Ga0207677_100076063 | 109 |
| 313 | 3300026023 | Ga0207677_10011702 | Ga0207677_100117025 | 109 |
| 314 | 3300026023 | Ga0207677_10081360 | Ga0207677_100813603 | 109 |
| 315 | 3300026035 | Ga0207703_10087059 | Ga0207703_100870592 | 109 |
| 316 | 3300026035 | Ga0207703_10095986 | Ga0207703_100959863 | 109 |
| 317 | 3300026035 | Ga0207703_10115619 | Ga0207703_101156192 | 109 |
| 318 | 3300026041 | Ga0207639_10002287 | Ga0207639_100022878 | 109 |
| 319 | 3300026041 | Ga0207639_10056072 | Ga0207639_100560723 | 109 |
| 320 | 3300026041 | Ga0207639_10421191 | Ga0207639_104211911 | 109 |
| 321 | 3300026067 | Ga0207678_10001833 | Ga0207678_100018333 | 109 |
| 322 | 3300026078 | Ga0207702_10001597 | Ga0207702_1000159715 | 109 |
| 323 | 3300026078 | Ga0207702_10005883 | Ga0207702_100058832 | 109 |
| 324 | 3300026088 | Ga0207641_10009428 | Ga0207641_100094288 | 109 |
| 325 | 3300026088 | Ga0207641_10314118 | Ga0207641_103141182 | 109 |
| 326 | 3300026089 | Ga0207648_10003612 | Ga0207648_1000361213 | 109 |
| 327 | 3300026089 | Ga0207648_10181375 | Ga0207648_101813752 | 109 |
| 328 | 3300026095 | Ga0207676_10021492 | Ga0207676_100214924 | 109 |
| 329 | 3300026116 | Ga0207674_10009505 | Ga0207674_1000950512 | 109 |
| 330 | 3300026116 | Ga0207674_10012344 | Ga0207674_100123447 | 109 |
| 331 | 3300026116 | Ga0207674_10510987 | Ga0207674_105109871 | 109 |
| 332 | 3300026118 | Ga0207675_100209346 | Ga0207675_1002093461 | 109 |
| 333 | 3300026121 | Ga0207683_10139318 | Ga0207683_101393183 | 109 |
| 334 | 3300026142 | Ga0207698_10034814 | Ga0207698_100348144 | 109 |
| 335 | 3300026142 | Ga0207698_10073362 | Ga0207698_100733623 | 109 |
| 336 | 3300026142 | Ga0207698_10366752 | Ga0207698_103667522 | 109 |
| 337 | 3300026142 | Ga0207698_10376022 | Ga0207698_103760222 | 109 |
| 338 | 3300028379 | Ga0268266_10061763 | Ga0268266_100617634 | 109 |
| 339 | 3300028379 | Ga0268266_10278856 | Ga0268266_102788562 | 109 |
| 340 | 3300028381 | Ga0268264_10103205 | Ga0268264_101032052 | 109 |
| 341 | 3300028381 | Ga0268264_10507744 | Ga0268264_105077442 | 109 |
| 342 | 3300031090 | Ga0265760_10033288 | Ga0265760_100332882 | 109 |
| 343 | 3300035088 | Ga0373940_0323771 | Ga0373940_0323771_171_503 | 109 |
| 344 | 3300035112 | Ga0373932_0187903 | Ga0373932_0187903_297_635 | 109 |
| 345 | 3300035241 | Ga0373961_0273698 | Ga0373961_0273698_112_444 | 109 |
| 346 | 3300035691 | Ga0373931_0068842 | Ga0373931_0068842_828_1160 | 109 |
| 347 | 3300035691 | Ga0373931_0164848 | Ga0373931_0164848_787_1125 | 109 |
| 348 | 3300037068 | Ga0373925_0087337 | Ga0373925_0087337_10_342 | 109 |
| 349 | 3300039450 | Ga0436363_0942494 | Ga0436363_0942494_109_447 | 109 |
| 350 | 3300045051 | Ga0451576_1282436 | Ga0451576_1282436_131_469 | 109 |
| 351 | 3300046533 | Ga0495640_0361501 | Ga0495640_0361501_113_445 | 109 |
| 352 | 3300046684 | Ga0495669_0463321 | Ga0495669_0463321_235_567 | 109 |
| 353 | 3300048904 | Ga0496101_0069100 | Ga0496101_0069100_802_1131 | 109 |
| 354 | 3300048905 | Ga0496102_0034176 | Ga0496102_0034176_15_353 | 109 |
| 355 | 3300048905 | Ga0496102_0084755 | Ga0496102_0084755_2565_2897 | 109 |
| 356 | 3300048906 | Ga0496103_0087374 | Ga0496103_0087374_241_573 | 109 |
| 357 | 3300048907 | Ga0496104_0043663 | Ga0496104_0043663_742_1071 | 109 |
| 358 | 3300048907 | Ga0496104_0622441 | Ga0496104_0622441_100_438 | 109 |
| 359 | 3300048908 | Ga0496105_0223019 | Ga0496105_0223019_571_909 | 109 |
| 360 | 3300048908 | Ga0496105_0396745 | Ga0496105_0396745_252_584 | 109 |
| 361 | 3300048909 | Ga0496106_0844584 | Ga0496106_0844584_136_468 | 109 |
| 362 | 3300048910 | Ga0496107_0047707 | Ga0496107_0047707_50_382 | 109 |
| 363 | 3300048910 | Ga0496107_0790807 | Ga0496107_0790807_308_646 | 109 |
| 364 | 3300048912 | Ga0496109_1163704 | Ga0496109_1163704_71_403 | 109 |
| 365 | 3300048913 | Ga0496110_0110860 | Ga0496110_0110860_1546_1878 | 109 |
| 366 | 3300048915 | Ga0496112_0001276 | Ga0496112_0001276_8317_8655 | 109 |
| 367 | 3300048915 | Ga0496112_0044733 | Ga0496112_0044733_2362_2691 | 109 |
| 368 | 3300048915 | Ga0496112_0072790 | Ga0496112_0072790_484_816 | 109 |
| 369 | 3300048915 | Ga0496112_0207500 | Ga0496112_0207500_1029_1358 | 109 |
| 370 | 3300048915 | Ga0496112_0277531 | Ga0496112_0277531_1161_1499 | 109 |
| 371 | 3300048916 | Ga0496113_0111874 | Ga0496113_0111874_1530_1859 | 109 |
| 372 | 3300048916 | Ga0496113_0151138 | Ga0496113_0151138_93_425 | 109 |
| 373 | 3300048916 | Ga0496113_0267616 | Ga0496113_0267616_588_926 | 109 |
| 374 | 3300048918 | Ga0496115_0446328 | Ga0496115_0446328_253_591 | 109 |
| 375 | 3300049589 | Ga0501073_0258869 | Ga0501073_0258869_235_564 | 109 |
| 376 | 3300050512 | nmdc:mga0n895_634_c1 | nmdc:mga0n895_634_c1_12894_13223 | 109 |
| 377 | 3300050513 | nmdc:mga0rr50_711970_c1 | nmdc:mga0rr50_711970_c1_337_666 | 109 |
| 378 | 3300050514 | nmdc:mga08x19_168254_c1 | nmdc:mga08x19_168254_c1_115_453 | 109 |
| 379 | 3300050515 | nmdc:mga0a205_117991_c1 | nmdc:mga0a205_117991_c1_1032_1361 | 109 |
| 380 | 3300059493 | Ga0587077_191670 | Ga0587077_191670_172_501 | 109 |
| 381 | 3300005293 | Ga0065715_10408013 | Ga0065715_104080132 | 110 |
| 382 | 3300005434 | Ga0070709_10052109 | Ga0070709_100521092 | 110 |
| 383 | 3300005434 | Ga0070709_10064095 | Ga0070709_100640952 | 110 |
| 384 | 3300005434 | Ga0070709_10181912 | Ga0070709_101819122 | 110 |
| 385 | 3300005434 | Ga0070709_10205448 | Ga0070709_102054482 | 110 |
| 386 | 3300005436 | Ga0070713_100054319 | Ga0070713_1000543193 | 110 |
| 387 | 3300005437 | Ga0070710_10273287 | Ga0070710_102732872 | 110 |
| 388 | 3300005439 | Ga0070711_100351526 | Ga0070711_1003515262 | 110 |
| 389 | 3300005439 | Ga0070711_101634368 | Ga0070711_1016343681 | 110 |
| 390 | 3300005455 | Ga0070663_100926013 | Ga0070663_1009260132 | 110 |
| 391 | 3300005468 | Ga0070707_101935803 | Ga0070707_1019358031 | 110 |
| 392 | 3300005545 | Ga0070695_100664145 | Ga0070695_1006641451 | 110 |
| 393 | 3300005614 | Ga0068856_102231514 | Ga0068856_1022315141 | 110 |
| 394 | 3300005841 | Ga0068863_100312589 | Ga0068863_1003125893 | 110 |
| 395 | 3300005842 | Ga0068858_100964442 | Ga0068858_1009644421 | 110 |
| 396 | 3300006028 | Ga0070717_10020671 | Ga0070717_100206714 | 110 |
| 397 | 3300006163 | Ga0070715_10102355 | Ga0070715_101023553 | 110 |
| 398 | 3300006173 | Ga0070716_100060568 | Ga0070716_1000605682 | 110 |
| 399 | 3300006173 | Ga0070716_100074962 | Ga0070716_1000749622 | 110 |
| 400 | 3300006173 | Ga0070716_100290664 | Ga0070716_1002906642 | 110 |
| 401 | 3300006175 | Ga0070712_100005444 | Ga0070712_1000054442 | 110 |
| 402 | 3300006237 | Ga0097621_100065896 | Ga0097621_1000658962 | 110 |
| 403 | 3300006358 | Ga0068871_100052698 | Ga0068871_1000526984 | 110 |
| 404 | 3300006358 | Ga0068871_100523629 | Ga0068871_1005236292 | 110 |
| 405 | 3300006844 | Ga0075428_101157756 | Ga0075428_1011577562 | 110 |
| 406 | 3300006852 | Ga0075433_10530540 | Ga0075433_105305401 | 110 |
| 407 | 3300006852 | Ga0075433_10997861 | Ga0075433_109978612 | 110 |
| 408 | 3300006871 | Ga0075434_100005505 | Ga0075434_10000550511 | 110 |
| 409 | 3300006871 | Ga0075434_100837917 | Ga0075434_1008379172 | 110 |
| 410 | 3300006914 | Ga0075436_100045890 | Ga0075436_1000458903 | 110 |
| 411 | 3300009093 | Ga0105240_10075293 | Ga0105240_100752935 | 110 |
| 412 | 3300009174 | Ga0105241_10022680 | Ga0105241_100226802 | 110 |
| 413 | 3300009174 | Ga0105241_10209176 | Ga0105241_102091762 | 110 |
| 414 | 3300009177 | Ga0105248_11201884 | Ga0105248_112018841 | 110 |
| 415 | 3300009551 | Ga0105238_10174097 | Ga0105238_101740972 | 110 |
| 416 | 3300010375 | Ga0105239_10943677 | Ga0105239_109436772 | 110 |
| 417 | 3300013296 | Ga0157374_10030042 | Ga0157374_100300425 | 110 |
| 418 | 3300013296 | Ga0157374_12246288 | Ga0157374_122462881 | 110 |
| 419 | 3300013297 | Ga0157378_10044277 | Ga0157378_100442776 | 110 |
| 420 | 3300013297 | Ga0157378_10413535 | Ga0157378_104135352 | 110 |
| 421 | 3300013306 | Ga0163162_10716344 | Ga0163162_107163442 | 110 |
| 422 | 3300014325 | Ga0163163_11227269 | Ga0163163_112272691 | 110 |
| 423 | 3300014968 | Ga0157379_10665666 | Ga0157379_106656661 | 110 |
| 424 | 3300014969 | Ga0157376_10178373 | Ga0157376_101783732 | 110 |
| 425 | 3300024227 | Ga0228598_1001121 | Ga0228598_10011216 | 110 |
| 426 | 3300025898 | Ga0207692_10286658 | Ga0207692_102866582 | 110 |
| 427 | 3300025905 | Ga0207685_10403643 | Ga0207685_104036432 | 110 |
| 428 | 3300025906 | Ga0207699_10052304 | Ga0207699_100523042 | 110 |
| 429 | 3300025906 | Ga0207699_10139708 | Ga0207699_101397083 | 110 |
| 430 | 3300025906 | Ga0207699_10201970 | Ga0207699_102019702 | 110 |
| 431 | 3300025906 | Ga0207699_10321803 | Ga0207699_103218032 | 110 |
| 432 | 3300025911 | Ga0207654_10172651 | Ga0207654_101726512 | 110 |
| 433 | 3300025911 | Ga0207654_10179057 | Ga0207654_101790571 | 110 |
| 434 | 3300025915 | Ga0207693_10044528 | Ga0207693_100445284 | 110 |
| 435 | 3300025916 | Ga0207663_10406697 | Ga0207663_104066972 | 110 |
| 436 | 3300025916 | Ga0207663_10988548 | Ga0207663_109885482 | 110 |
| 437 | 3300025924 | Ga0207694_10355243 | Ga0207694_103552432 | 110 |
| 438 | 3300025928 | Ga0207700_10004609 | Ga0207700_100046097 | 110 |
| 439 | 3300025928 | Ga0207700_11250885 | Ga0207700_112508852 | 110 |
| 440 | 3300025929 | Ga0207664_10748508 | Ga0207664_107485082 | 110 |
| 441 | 3300025939 | Ga0207665_10074253 | Ga0207665_100742532 | 110 |
| 442 | 3300025939 | Ga0207665_10082116 | Ga0207665_100821162 | 110 |
| 443 | 3300025939 | Ga0207665_10112571 | Ga0207665_101125712 | 110 |
| 444 | 3300025939 | Ga0207665_10498451 | Ga0207665_104984511 | 110 |
| 445 | 3300025941 | Ga0207711_11879466 | Ga0207711_118794661 | 110 |
| 446 | 3300026078 | Ga0207702_10464806 | Ga0207702_104648062 | 110 |
| 447 | 3300026078 | Ga0207702_10578668 | Ga0207702_105786681 | 110 |
| 448 | 3300026078 | Ga0207702_11808931 | Ga0207702_118089312 | 110 |
| 449 | 3300026078 | Ga0207702_11990640 | Ga0207702_119906401 | 110 |
| 450 | 3300028016 | Ga0265354_1003475 | Ga0265354_10034752 | 110 |
| 451 | 3300030760 | Ga0265762_1000676 | Ga0265762_10006763 | 110 |
| 452 | 3300030878 | Ga0265770_1008320 | Ga0265770_10083202 | 110 |
| 453 | 3300030878 | Ga0265770_1117410 | Ga0265770_11174101 | 110 |
| 454 | 3300031090 | Ga0265760_10000206 | Ga0265760_1000020616 | 110 |
| 455 | 3300031090 | Ga0265760_10058278 | Ga0265760_100582781 | 110 |
| 456 | 3300035088 | Ga0373940_0186662 | Ga0373940_0186662_127_462 | 110 |
| 457 | 3300035113 | Ga0373936_0031150 | Ga0373936_0031150_326_661 | 110 |
| 458 | 3300035116 | Ga0373945_0015579 | Ga0373945_0015579_99_434 | 110 |
| 459 | 3300035119 | Ga0373956_0068571 | Ga0373956_0068571_585_920 | 110 |
| 460 | 3300035119 | Ga0373956_0629148 | Ga0373956_0629148_58_393 | 110 |
| 461 | 3300035171 | Ga0373946_0461935 | Ga0373946_0461935_65_400 | 110 |
| 462 | 3300035172 | Ga0373955_0551014 | Ga0373955_0551014_57_392 | 110 |
| 463 | 3300035724 | Ga0373933_0692894 | Ga0373933_0692894_116_451 | 110 |
| 464 | 3300035725 | Ga0373947_0064565 | Ga0373947_0064565_353_688 | 110 |
| 465 | 3300036401 | Ga0373937_1618714 | Ga0373937_1618714_132_467 | 110 |
| 466 | 3300037068 | Ga0373925_0493020 | Ga0373925_0493020_114_449 | 110 |
| 467 | 3300046462 | Ga0495651_0448419 | Ga0495651_0448419_366_701 | 110 |
| 468 | 3300046472 | Ga0495580_0702637 | Ga0495580_0702637_10_345 | 110 |
| 469 | 3300046476 | Ga0495662_0340690 | Ga0495662_0340690_183_518 | 110 |
| 470 | 3300046477 | Ga0495664_0131284 | Ga0495664_0131284_238_573 | 110 |
| 471 | 3300046516 | Ga0495628_0757193 | Ga0495628_0757193_151_486 | 110 |
| 472 | 3300046517 | Ga0495630_0084986 | Ga0495630_0084986_1539_1874 | 110 |
| 473 | 3300046529 | Ga0495652_0517785 | Ga0495652_0517785_15_350 | 110 |
| 474 | 3300046533 | Ga0495640_0411852 | Ga0495640_0411852_156_491 | 110 |
| 475 | 3300046543 | Ga0495645_0296977 | Ga0495645_0296977_691_1026 | 110 |
| 476 | 3300046559 | Ga0495667_0330784 | Ga0495667_0330784_302_637 | 110 |
| 477 | 3300046679 | Ga0495623_0535569 | Ga0495623_0535569_204_539 | 110 |
| 478 | 3300046794 | Ga0495589_0496529 | Ga0495589_0496529_91_426 | 110 |
| 479 | 3300047317 | Ga0495604_0797291 | Ga0495604_0797291_124_459 | 110 |
| 480 | 3300047319 | Ga0495674_0009662 | Ga0495674_0009662_5888_6223 | 110 |
| 481 | 3300048088 | Ga0495602_0188241 | Ga0495602_0188241_337_672 | 110 |
| 482 | 3300048903 | Ga0496100_0031661 | Ga0496100_0031661_253_642 | 110 |
| 483 | 3300048904 | Ga0496101_0003461 | Ga0496101_0003461_2748_3137 | 110 |
| 484 | 3300048904 | Ga0496101_0766498 | Ga0496101_0766498_123_458 | 110 |
| 485 | 3300048905 | Ga0496102_0000537 | Ga0496102_0000537_10622_11011 | 110 |
| 486 | 3300048906 | Ga0496103_0029061 | Ga0496103_0029061_1586_1921 | 110 |
| 487 | 3300048907 | Ga0496104_0043291 | Ga0496104_0043291_3608_3943 | 110 |
| 488 | 3300048907 | Ga0496104_0097111 | Ga0496104_0097111_2372_2713 | 110 |
| 489 | 3300048907 | Ga0496104_0193678 | Ga0496104_0193678_346_735 | 110 |
| 490 | 3300048909 | Ga0496106_0060516 | Ga0496106_0060516_2439_2828 | 110 |
| 491 | 3300048910 | Ga0496107_0581475 | Ga0496107_0581475_224_613 | 110 |
| 492 | 3300048912 | Ga0496109_1361679 | Ga0496109_1361679_46_381 | 110 |
| 493 | 3300048915 | Ga0496112_0409378 | Ga0496112_0409378_904_1239 | 110 |
| 494 | 3300048917 | Ga0496114_0041204 | Ga0496114_0041204_3035_3370 | 110 |
| 495 | 3300048918 | Ga0496115_0016349 | Ga0496115_0016349_670_1059 | 110 |
| 496 | 3300050512 | nmdc:mga0n895_34675_c1 | nmdc:mga0n895_34675_c1_3907_4239 | 110 |
| 497 | 3300050514 | nmdc:mga08x19_12628_c1 | nmdc:mga08x19_12628_c1_2203_2535 | 110 |
| 498 | 3300050515 | nmdc:mga0a205_493545_c1 | nmdc:mga0a205_493545_c1_527_859 | 110 |
| 499 | 3300050515 | nmdc:mga0a205_905760_c1 | nmdc:mga0a205_905760_c1_123_458 | 110 |
| 500 | 3300053077 | Ga0495601_0060993 | Ga0495601_0060993_829_1164 | 110 |
| 501 | 3300053078 | Ga0495612_0521841 | Ga0495612_0521841_97_432 | 110 |
| 502 | 3300053085 | Ga0495619_0358892 | Ga0495619_0358892_402_737 | 110 |
| 503 | 2162886012 | MBSR1b_contig_9582295 | MBSR1b_0037.00004250 | 111 |
| 504 | 3300001976 | JGI24752J21851_1000331 | JGI24752J21851_10003313 | 111 |
| 505 | 3300001978 | JGI24747J21853_1049202 | JGI24747J21853_10492022 | 111 |
| 506 | 3300001990 | JGI24737J22298_10028557 | JGI24737J22298_100285571 | 111 |
| 507 | 3300001991 | JGI24743J22301_10000093 | JGI24743J22301_100000937 | 111 |
| 508 | 3300002073 | JGI24745J21846_1013893 | JGI24745J21846_10138932 | 111 |
| 509 | 3300002074 | JGI24748J21848_1009443 | JGI24748J21848_10094431 | 111 |
| 510 | 3300002075 | JGI24738J21930_10157838 | JGI24738J21930_101578382 | 111 |
| 511 | 3300002155 | JGI24033J26618_1004020 | JGI24033J26618_10040202 | 111 |
| 512 | 3300002239 | JGI24034J26672_10000810 | JGI24034J26672_100008106 | 111 |
| 513 | 3300002459 | JGI24751J29686_10000635 | JGI24751J29686_100006356 | 111 |
| 514 | 3300005290 | Ga0065712_10169285 | Ga0065712_101692853 | 111 |
| 515 | 3300005293 | Ga0065715_10002672 | Ga0065715_100026723 | 111 |
| 516 | 3300005327 | Ga0070658_10091494 | Ga0070658_100914944 | 111 |
| 517 | 3300005328 | Ga0070676_10005283 | Ga0070676_100052833 | 111 |
| 518 | 3300005329 | Ga0070683_100001910 | Ga0070683_10000191010 | 111 |
| 519 | 3300005330 | Ga0070690_100003363 | Ga0070690_1000033639 | 111 |
| 520 | 3300005331 | Ga0070670_100001939 | Ga0070670_10000193911 | 111 |
| 521 | 3300005333 | Ga0070677_10003715 | Ga0070677_100037152 | 111 |
| 522 | 3300005334 | Ga0068869_100052848 | Ga0068869_1000528484 | 111 |
| 523 | 3300005335 | Ga0070666_10008180 | Ga0070666_100081807 | 111 |
| 524 | 3300005337 | Ga0070682_100003286 | Ga0070682_1000032868 | 111 |
| 525 | 3300005338 | Ga0068868_100037793 | Ga0068868_1000377935 | 111 |
| 526 | 3300005339 | Ga0070660_100061610 | Ga0070660_1000616104 | 111 |
| 527 | 3300005340 | Ga0070689_100001082 | Ga0070689_10000108211 | 111 |
| 528 | 3300005344 | Ga0070661_100009221 | Ga0070661_1000092215 | 111 |
| 529 | 3300005347 | Ga0070668_100635676 | Ga0070668_1006356762 | 111 |
| 530 | 3300005353 | Ga0070669_100001365 | Ga0070669_10000136518 | 111 |
| 531 | 3300005354 | Ga0070675_100219209 | Ga0070675_1002192093 | 111 |
| 532 | 3300005355 | Ga0070671_100106068 | Ga0070671_1001060683 | 111 |
| 533 | 3300005356 | Ga0070674_100158283 | Ga0070674_1001582833 | 111 |
| 534 | 3300005364 | Ga0070673_100009008 | Ga0070673_1000090083 | 111 |
| 535 | 3300005365 | Ga0070688_100000289 | Ga0070688_10000028911 | 111 |
| 536 | 3300005366 | Ga0070659_100002441 | Ga0070659_1000024419 | 111 |
| 537 | 3300005367 | Ga0070667_100144235 | Ga0070667_1001442353 | 111 |
| 538 | 3300005434 | Ga0070709_10395508 | Ga0070709_103955081 | 111 |
| 539 | 3300005435 | Ga0070714_100025598 | Ga0070714_1000255984 | 111 |
| 540 | 3300005436 | Ga0070713_100019826 | Ga0070713_1000198264 | 111 |
| 541 | 3300005437 | Ga0070710_10008104 | Ga0070710_100081042 | 111 |
| 542 | 3300005439 | Ga0070711_100307198 | Ga0070711_1003071982 | 111 |
| 543 | 3300005441 | Ga0070700_100196077 | Ga0070700_1001960772 | 111 |
| 544 | 3300005444 | Ga0070694_100354565 | Ga0070694_1003545652 | 111 |
| 545 | 3300005455 | Ga0070663_100010379 | Ga0070663_1000103793 | 111 |
| 546 | 3300005456 | Ga0070678_100002783 | Ga0070678_1000027837 | 111 |
| 547 | 3300005457 | Ga0070662_100004251 | Ga0070662_1000042512 | 111 |
| 548 | 3300005459 | Ga0068867_100000749 | Ga0068867_10000074920 | 111 |
| 549 | 3300005466 | Ga0070685_10001601 | Ga0070685_100016017 | 111 |
| 550 | 3300005535 | Ga0070684_100001382 | Ga0070684_10000138211 | 111 |
| 551 | 3300005539 | Ga0068853_100028987 | Ga0068853_1000289876 | 111 |
| 552 | 3300005543 | Ga0070672_100002640 | Ga0070672_1000026408 | 111 |
| 553 | 3300005544 | Ga0070686_100009767 | Ga0070686_1000097677 | 111 |
| 554 | 3300005545 | Ga0070695_100240649 | Ga0070695_1002406492 | 111 |
| 555 | 3300005546 | Ga0070696_100208070 | Ga0070696_1002080702 | 111 |
| 556 | 3300005548 | Ga0070665_100610923 | Ga0070665_1006109233 | 111 |
| 557 | 3300005549 | Ga0070704_101460233 | Ga0070704_1014602331 | 111 |
| 558 | 3300005563 | Ga0068855_100426688 | Ga0068855_1004266882 | 111 |
| 559 | 3300005564 | Ga0070664_100006830 | Ga0070664_1000068306 | 111 |
| 560 | 3300005577 | Ga0068857_100002750 | Ga0068857_1000027508 | 111 |
| 561 | 3300005578 | Ga0068854_100103379 | Ga0068854_1001033793 | 111 |
| 562 | 3300005614 | Ga0068856_100018327 | Ga0068856_1000183276 | 111 |
| 563 | 3300005614 | Ga0068856_100547126 | Ga0068856_1005471262 | 111 |
| 564 | 3300005615 | Ga0070702_100006493 | Ga0070702_1000064934 | 111 |
| 565 | 3300005616 | Ga0068852_100005202 | Ga0068852_1000052026 | 111 |
| 566 | 3300005617 | Ga0068859_100032315 | Ga0068859_1000323157 | 111 |
| 567 | 3300005618 | Ga0068864_100003567 | Ga0068864_1000035677 | 111 |
| 568 | 3300005718 | Ga0068866_10001464 | Ga0068866_100014644 | 111 |
| 569 | 3300005719 | Ga0068861_100002752 | Ga0068861_1000027527 | 111 |
| 570 | 3300005834 | Ga0068851_10002205 | Ga0068851_100022059 | 111 |
| 571 | 3300005840 | Ga0068870_10000606 | Ga0068870_1000060615 | 111 |
| 572 | 3300005841 | Ga0068863_100010061 | Ga0068863_1000100617 | 111 |
| 573 | 3300005842 | Ga0068858_100062982 | Ga0068858_1000629822 | 111 |
| 574 | 3300005843 | Ga0068860_100047365 | Ga0068860_1000473655 | 111 |
| 575 | 3300005844 | Ga0068862_100056995 | Ga0068862_1000569952 | 111 |
| 576 | 3300006163 | Ga0070715_10010457 | Ga0070715_100104571 | 111 |
| 577 | 3300006163 | Ga0070715_10016825 | Ga0070715_100168254 | 111 |
| 578 | 3300006173 | Ga0070716_100026082 | Ga0070716_1000260823 | 111 |
| 579 | 3300006173 | Ga0070716_100058390 | Ga0070716_1000583903 | 111 |
| 580 | 3300006173 | Ga0070716_100109284 | Ga0070716_1001092842 | 111 |
| 581 | 3300006175 | Ga0070712_100000566 | Ga0070712_10000056614 | 111 |
| 582 | 3300006175 | Ga0070712_100039310 | Ga0070712_1000393104 | 111 |
| 583 | 3300006237 | Ga0097621_100083411 | Ga0097621_1000834112 | 111 |
| 584 | 3300006358 | Ga0068871_100568285 | Ga0068871_1005682852 | 111 |
| 585 | 3300006871 | Ga0075434_100541282 | Ga0075434_1005412822 | 111 |
| 586 | 3300006881 | Ga0068865_100011689 | Ga0068865_1000116897 | 111 |
| 587 | 3300006914 | Ga0075436_101383047 | Ga0075436_1013830471 | 111 |
| 588 | 3300006931 | Ga0097620_100032313 | Ga0097620_1000323131 | 111 |
| 589 | 3300009093 | Ga0105240_10731093 | Ga0105240_107310931 | 111 |
| 590 | 3300009098 | Ga0105245_10002797 | Ga0105245_100027977 | 111 |
| 591 | 3300009101 | Ga0105247_10001769 | Ga0105247_1000176910 | 111 |
| 592 | 3300009148 | Ga0105243_10321931 | Ga0105243_103219313 | 111 |
| 593 | 3300009174 | Ga0105241_10008758 | Ga0105241_100087587 | 111 |
| 594 | 3300009176 | Ga0105242_10005432 | Ga0105242_100054327 | 111 |
| 595 | 3300009177 | Ga0105248_10029186 | Ga0105248_100291867 | 111 |
| 596 | 3300009545 | Ga0105237_10061368 | Ga0105237_100613685 | 111 |
| 597 | 3300009553 | Ga0105249_10232384 | Ga0105249_102323843 | 111 |
| 598 | 3300010375 | Ga0105239_10004431 | Ga0105239_1000443116 | 111 |
| 599 | 3300011119 | Ga0105246_10002416 | Ga0105246_1000241610 | 111 |
| 600 | 3300013100 | Ga0157373_10006047 | Ga0157373_100060472 | 111 |
| 601 | 3300013102 | Ga0157371_10006502 | Ga0157371_100065023 | 111 |
| 602 | 3300013104 | Ga0157370_11643626 | Ga0157370_116436262 | 111 |
| 603 | 3300013105 | Ga0157369_10036757 | Ga0157369_100367573 | 111 |
| 604 | 3300013296 | Ga0157374_10415739 | Ga0157374_104157392 | 111 |
| 605 | 3300013297 | Ga0157378_12415544 | Ga0157378_124155442 | 111 |
| 606 | 3300013306 | Ga0163162_10088799 | Ga0163162_100887994 | 111 |
| 607 | 3300013307 | Ga0157372_10021173 | Ga0157372_100211738 | 111 |
| 608 | 3300013308 | Ga0157375_10003505 | Ga0157375_1000350510 | 111 |
| 609 | 3300014325 | Ga0163163_10000958 | Ga0163163_1000095810 | 111 |
| 610 | 3300014326 | Ga0157380_10025039 | Ga0157380_100250395 | 111 |
| 611 | 3300014745 | Ga0157377_10000467 | Ga0157377_1000046711 | 111 |
| 612 | 3300014968 | Ga0157379_10030890 | Ga0157379_100308903 | 111 |
| 613 | 3300014969 | Ga0157376_10006340 | Ga0157376_100063406 | 111 |
| 614 | 3300017792 | Ga0163161_10038216 | Ga0163161_100382164 | 111 |
| 615 | 3300025315 | Ga0207697_10002916 | Ga0207697_100029165 | 111 |
| 616 | 3300025321 | Ga0207656_10051754 | Ga0207656_100517543 | 111 |
| 617 | 3300025711 | Ga0207696_1086358 | Ga0207696_10863581 | 111 |
| 618 | 3300025893 | Ga0207682_10003786 | Ga0207682_100037864 | 111 |
| 619 | 3300025898 | Ga0207692_10036336 | Ga0207692_100363363 | 111 |
| 620 | 3300025898 | Ga0207692_10254732 | Ga0207692_102547322 | 111 |
| 621 | 3300025899 | Ga0207642_10092397 | Ga0207642_100923971 | 111 |
| 622 | 3300025900 | Ga0207710_10003898 | Ga0207710_100038988 | 111 |
| 623 | 3300025901 | Ga0207688_10000372 | Ga0207688_1000037214 | 111 |
| 624 | 3300025903 | Ga0207680_10010107 | Ga0207680_100101074 | 111 |
| 625 | 3300025904 | Ga0207647_10008793 | Ga0207647_100087937 | 111 |
| 626 | 3300025906 | Ga0207699_10002843 | Ga0207699_100028435 | 111 |
| 627 | 3300025906 | Ga0207699_10144125 | Ga0207699_101441252 | 111 |
| 628 | 3300025907 | Ga0207645_10000051 | Ga0207645_1000005135 | 111 |
| 629 | 3300025908 | Ga0207643_10000079 | Ga0207643_1000007936 | 111 |
| 630 | 3300025909 | Ga0207705_10030843 | Ga0207705_100308433 | 111 |
| 631 | 3300025911 | Ga0207654_10062709 | Ga0207654_100627092 | 111 |
| 632 | 3300025914 | Ga0207671_10267374 | Ga0207671_102673742 | 111 |
| 633 | 3300025914 | Ga0207671_10561174 | Ga0207671_105611742 | 111 |
| 634 | 3300025915 | Ga0207693_10004992 | Ga0207693_1000499212 | 111 |
| 635 | 3300025915 | Ga0207693_10005699 | Ga0207693_1000569911 | 111 |
| 636 | 3300025916 | Ga0207663_10022475 | Ga0207663_100224754 | 111 |
| 637 | 3300025916 | Ga0207663_10461684 | Ga0207663_104616842 | 111 |
| 638 | 3300025919 | Ga0207657_10000292 | Ga0207657_1000029234 | 111 |
| 639 | 3300025920 | Ga0207649_10000242 | Ga0207649_1000024211 | 111 |
| 640 | 3300025923 | Ga0207681_10075318 | Ga0207681_100753183 | 111 |
| 641 | 3300025925 | Ga0207650_10000090 | Ga0207650_10000090132 | 111 |
| 642 | 3300025926 | Ga0207659_10002035 | Ga0207659_100020357 | 111 |
| 643 | 3300025927 | Ga0207687_10013901 | Ga0207687_100139013 | 111 |
| 644 | 3300025928 | Ga0207700_10000685 | Ga0207700_1000068511 | 111 |
| 645 | 3300025928 | Ga0207700_10330357 | Ga0207700_103303572 | 111 |
| 646 | 3300025929 | Ga0207664_10148252 | Ga0207664_101482524 | 111 |
| 647 | 3300025931 | Ga0207644_10002582 | Ga0207644_100025829 | 111 |
| 648 | 3300025932 | Ga0207690_10003087 | Ga0207690_100030877 | 111 |
| 649 | 3300025933 | Ga0207706_10001055 | Ga0207706_100010552 | 111 |
| 650 | 3300025935 | Ga0207709_10371488 | Ga0207709_103714882 | 111 |
| 651 | 3300025936 | Ga0207670_10001693 | Ga0207670_100016935 | 111 |
| 652 | 3300025938 | Ga0207704_10020900 | Ga0207704_100209005 | 111 |
| 653 | 3300025939 | Ga0207665_10015670 | Ga0207665_100156705 | 111 |
| 654 | 3300025939 | Ga0207665_10091681 | Ga0207665_100916813 | 111 |
| 655 | 3300025939 | Ga0207665_10098521 | Ga0207665_100985212 | 111 |
| 656 | 3300025940 | Ga0207691_10001343 | Ga0207691_1000134314 | 111 |
| 657 | 3300025941 | Ga0207711_10002838 | Ga0207711_100028389 | 111 |
| 658 | 3300025942 | Ga0207689_10000304 | Ga0207689_1000030421 | 111 |
| 659 | 3300025944 | Ga0207661_10000583 | Ga0207661_100005837 | 111 |
| 660 | 3300025945 | Ga0207679_10000184 | Ga0207679_1000018458 | 111 |
| 661 | 3300025949 | Ga0207667_10170718 | Ga0207667_101707181 | 111 |
| 662 | 3300025960 | Ga0207651_10002456 | Ga0207651_100024566 | 111 |
| 663 | 3300025961 | Ga0207712_10079479 | Ga0207712_100794793 | 111 |
| 664 | 3300025972 | Ga0207668_10074687 | Ga0207668_100746872 | 111 |
| 665 | 3300025981 | Ga0207640_10049454 | Ga0207640_100494544 | 111 |
| 666 | 3300025986 | Ga0207658_10001983 | Ga0207658_100019836 | 111 |
| 667 | 3300026023 | Ga0207677_10076939 | Ga0207677_100769393 | 111 |
| 668 | 3300026035 | Ga0207703_10005260 | Ga0207703_100052606 | 111 |
| 669 | 3300026041 | Ga0207639_10016884 | Ga0207639_100168846 | 111 |
| 670 | 3300026067 | Ga0207678_10000204 | Ga0207678_1000020434 | 111 |
| 671 | 3300026078 | Ga0207702_10048664 | Ga0207702_100486643 | 111 |
| 672 | 3300026078 | Ga0207702_10202697 | Ga0207702_102026972 | 111 |
| 673 | 3300026088 | Ga0207641_10000894 | Ga0207641_1000089421 | 111 |
| 674 | 3300026089 | Ga0207648_10000757 | Ga0207648_1000075721 | 111 |
| 675 | 3300026095 | Ga0207676_10000113 | Ga0207676_1000011330 | 111 |
| 676 | 3300026116 | Ga0207674_10000076 | Ga0207674_1000007667 | 111 |
| 677 | 3300026118 | Ga0207675_100008819 | Ga0207675_1000088197 | 111 |
| 678 | 3300026121 | Ga0207683_10001129 | Ga0207683_1000112910 | 111 |
| 679 | 3300026142 | Ga0207698_10080537 | Ga0207698_100805373 | 111 |
| 680 | 3300028379 | Ga0268266_10005373 | Ga0268266_100053737 | 111 |
| 681 | 3300028380 | Ga0268265_10002144 | Ga0268265_1000214414 | 111 |
| 682 | 3300028381 | Ga0268264_10017158 | Ga0268264_100171582 | 111 |
| 683 | 3300030760 | Ga0265762_1062789 | Ga0265762_10627891 | 111 |
| 684 | 3300035111 | Ga0373923_0348710 | Ga0373923_0348710_135_485 | 111 |
| 685 | 3300035111 | Ga0373923_0612287 | Ga0373923_0612287_20_388 | 111 |
| 686 | 3300035171 | Ga0373946_0704577 | Ga0373946_0704577_20_388 | 111 |
| 687 | 3300035691 | Ga0373931_0179118 | Ga0373931_0179118_514_849 | 111 |
| 688 | 3300035692 | Ga0373935_0342165 | Ga0373935_0342165_635_1003 | 111 |
| 689 | 3300035695 | Ga0373927_0443442 | Ga0373927_0443442_356_724 | 111 |
| 690 | 3300035724 | Ga0373933_0111032 | Ga0373933_0111032_388_756 | 111 |
| 691 | 3300035725 | Ga0373947_0383275 | Ga0373947_0383275_323_691 | 111 |
| 692 | 3300036401 | Ga0373937_0006928 | Ga0373937_0006928_8264_8632 | 111 |
| 693 | 3300046454 | Ga0495592_0146182 | Ga0495592_0146182_1088_1456 | 111 |
| 694 | 3300046463 | Ga0495653_0178202 | Ga0495653_0178202_68_436 | 111 |
| 695 | 3300046476 | Ga0495662_0674788 | Ga0495662_0674788_31_399 | 111 |
| 696 | 3300046477 | Ga0495664_0017250 | Ga0495664_0017250_2887_3255 | 111 |
| 697 | 3300046511 | Ga0495608_0037373 | Ga0495608_0037373_2710_3078 | 111 |
| 698 | 3300046514 | Ga0495618_0203085 | Ga0495618_0203085_638_1006 | 111 |
| 699 | 3300046517 | Ga0495630_0121352 | Ga0495630_0121352_40_408 | 111 |
| 700 | 3300046528 | Ga0495642_0275056 | Ga0495642_0275056_90_425 | 111 |
| 701 | 3300046536 | Ga0495587_0067745 | Ga0495587_0067745_1075_1443 | 111 |
| 702 | 3300046543 | Ga0495645_0005114 | Ga0495645_0005114_8323_8691 | 111 |
| 703 | 3300046663 | Ga0495635_0139099 | Ga0495635_0139099_691_1059 | 111 |
| 704 | 3300046663 | Ga0495635_0512669 | Ga0495635_0512669_110_478 | 111 |
| 705 | 3300046675 | Ga0495657_0057793 | Ga0495657_0057793_1895_2263 | 111 |
| 706 | 3300046678 | Ga0495599_0023481 | Ga0495599_0023481_2396_2764 | 111 |
| 707 | 3300046679 | Ga0495623_0121806 | Ga0495623_0121806_19_387 | 111 |
| 708 | 3300046680 | Ga0495646_0029962 | Ga0495646_0029962_2481_2849 | 111 |
| 709 | 3300046684 | Ga0495669_0270201 | Ga0495669_0270201_379_714 | 111 |
| 710 | 3300046809 | Ga0495600_0224293 | Ga0495600_0224293_657_1025 | 111 |
| 711 | 3300047317 | Ga0495604_0047356 | Ga0495604_0047356_809_1177 | 111 |
| 712 | 3300047319 | Ga0495674_0628774 | Ga0495674_0628774_350_718 | 111 |
| 713 | 3300047322 | Ga0495680_0349915 | Ga0495680_0349915_519_887 | 111 |
| 714 | 3300047471 | Ga0495684_0051903 | Ga0495684_0051903_2718_3086 | 111 |
| 715 | 3300047471 | Ga0495684_0320770 | Ga0495684_0320770_697_1065 | 111 |
| 716 | 3300048088 | Ga0495602_0000360 | Ga0495602_0000360_34135_34503 | 111 |
| 717 | 3300048903 | Ga0496100_0744742 | Ga0496100_0744742_139_474 | 111 |
| 718 | 3300048904 | Ga0496101_0131212 | Ga0496101_0131212_1004_1339 | 111 |
| 719 | 3300048904 | Ga0496101_0403020 | Ga0496101_0403020_357_704 | 111 |
| 720 | 3300048905 | Ga0496102_0042175 | Ga0496102_0042175_629_964 | 111 |
| 721 | 3300048906 | Ga0496103_0908958 | Ga0496103_0908958_181_516 | 111 |
| 722 | 3300048907 | Ga0496104_0870699 | Ga0496104_0870699_179_514 | 111 |
| 723 | 3300048908 | Ga0496105_0855422 | Ga0496105_0855422_136_471 | 111 |
| 724 | 3300048909 | Ga0496106_0137926 | Ga0496106_0137926_1485_1820 | 111 |
| 725 | 3300048909 | Ga0496106_0167565 | Ga0496106_0167565_632_991 | 111 |
| 726 | 3300048910 | Ga0496107_0156443 | Ga0496107_0156443_1001_1336 | 111 |
| 727 | 3300048911 | Ga0496108_0002118 | Ga0496108_0002118_4554_4889 | 111 |
| 728 | 3300048912 | Ga0496109_0000008 | Ga0496109_0000008_18613_18948 | 111 |
| 729 | 3300048913 | Ga0496110_0008075 | Ga0496110_0008075_7390_7725 | 111 |
| 730 | 3300048914 | Ga0496111_0005563 | Ga0496111_0005563_7444_7779 | 111 |
| 731 | 3300048915 | Ga0496112_0000334 | Ga0496112_0000334_16510_16845 | 111 |
| 732 | 3300048916 | Ga0496113_0006066 | Ga0496113_0006066_31_366 | 111 |
| 733 | 3300048918 | Ga0496115_0629328 | Ga0496115_0629328_321_656 | 111 |
| 734 | 3300050511 | nmdc:mga08y16_1200968_c1 | nmdc:mga08y16_1200968_c1_94_429 | 111 |
| 735 | 3300050514 | nmdc:mga08x19_1121820_c1 | nmdc:mga08x19_1121820_c1_157_495 | 111 |
| 736 | 3300053077 | Ga0495601_0161914 | Ga0495601_0161914_1029_1397 | 111 |
| 737 | 3300053078 | Ga0495612_0005112 | Ga0495612_0005112_966_1334 | 111 |
| 738 | 3300053084 | Ga0495595_0072005 | Ga0495595_0072005_530_898 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9755 | 33 | 109 |
| 1uso-assembly1.cif.gz_A | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9459 | 33 | 107 |
| 2ebb-assembly1.cif.gz_A-2 | crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 | 0.9446 | 18 | 110 |
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9387 | 33 | 109 |
| 3jst-assembly2.cif.gz_B | crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis | 0.9314 | 18 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1usoB00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9455 | 33 | 107 | 3.30.1360.20 |
| 2ebbA00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9446 | 18 | 110 | 3.30.1360.20 |
| af_P9WI93_1_93_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9413 | 16 | 108 | 3.30.1360.20 |
| af_Q6MX13_31_126_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9356 | 18 | 110 | 3.30.1360.20 |
| af_P9WI93_1_93_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9222 | 16 | 108 | 3.30.1360.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554JES3-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9959 | 23 | 108 |
GO:0006729
GO:0008124 |
| AF-A0A2U3L9A9-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9944 | 19 | 109 |
GO:0006729
GO:0008124 |
| AF-A0A2V9LDX8-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) | 0.9922 | 1 | 110 |
GO:0006729
GO:0008124 |
| AF-A0A7C2TT88-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9921 | 26 | 106 |
GO:0006729
GO:0008124 |
| AF-A0A1E3XEU2-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) | 0.9887 | 3 | 106 |
GO:0006729
GO:0008124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar