F478386

General Info

Members Datasets Scaffolds Average Seq Length
738 288 738 112

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_12246288|Ga0157374_122462881
Length 129
Sequence MSGQPGGHATAEIEEETVMPEDLASQTCAPCRGGTPPLKGAELRSIQQKVPQWKVVNEHHITRAFAFPDFKQALDFVNRVGEVAEQQGHHPDILLTWGKAEITMWTHKIDGLTQSDFIMAAKIDKLLPS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
134 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 1.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.18
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9582295 2162886012 Bacteria 1444
2 JGI24752J21851_1000331 3300001976 Bacteria 6590
3 JGI24747J21853_1049202 3300001978 Unclassified 511
4 JGI24737J22298_10028557 3300001990 Bacteria 1753
5 JGI24743J22301_10000093 3300001991 Bacteria 8658
6 JGI24745J21846_1013893 3300002073 Bacteria 930
7 JGI24748J21848_1009443 3300002074 Bacteria 1149
8 JGI24738J21930_10157838 3300002075 Unclassified 507
9 JGI24033J26618_1004020 3300002155 Bacteria 1573
10 JGI24034J26672_10000810 3300002239 Unclassified 4051
11 JGI24751J29686_10000635 3300002459 Bacteria 9014
12 Ga0058863_11769502 3300004799 Unclassified 1080
13 Ga0058862_10008808 3300004803 Unclassified 625
14 Ga0065712_10169285 3300005290 Bacteria 1253
15 Ga0065715_10002672 3300005293 Unclassified 4564
16 Ga0065715_10408013 3300005293 Bacteria 837
17 Ga0070658_10091494 3300005327 Unclassified 2507
18 Ga0070658_10370542 3300005327 Bacteria 1228
19 Ga0070658_10405901 3300005327 Bacteria 1171
20 Ga0070658_10415299 3300005327 Bacteria 1157
21 Ga0070676_10005283 3300005328 Bacteria 6866
22 Ga0070676_10160666 3300005328 Bacteria 1446
23 Ga0070683_100001910 3300005329 Bacteria 16302
24 Ga0070683_100021957 3300005329 Bacteria 5698
25 Ga0070683_100031689 3300005329 Bacteria 4811
26 Ga0070683_100082482 3300005329 Bacteria 3011
27 Ga0070690_100003363 3300005330 Bacteria 8732
28 Ga0070690_100145461 3300005330 Bacteria 1612
29 Ga0070690_100147599 3300005330 Bacteria 1602
30 Ga0070690_100888145 3300005330 Unclassified 696
31 Ga0070670_100001939 3300005331 Bacteria 16933
32 Ga0070670_100126500 3300005331 Unclassified 2206
33 Ga0070670_101075184 3300005331 Unclassified 733
34 Ga0070677_10003715 3300005333 Unclassified 4938
35 Ga0068869_100052848 3300005334 Unclassified 2951
36 Ga0068869_100490673 3300005334 Unclassified 1024
37 Ga0070666_10008180 3300005335 Bacteria 6481
38 Ga0070666_10011983 3300005335 Bacteria 5456
39 Ga0070680_100089047 3300005336 Unclassified 2554
40 Ga0070682_100003286 3300005337 Bacteria 8968
41 Ga0070682_100071298 3300005337 Bacteria 2223
42 Ga0070682_100209862 3300005337 Unclassified 1379
43 Ga0068868_100008382 3300005338 Bacteria 7398
44 Ga0068868_100010214 3300005338 Bacteria 6786
45 Ga0068868_100037793 3300005338 Unclassified 3744
46 Ga0068868_100106830 3300005338 Unclassified 2271
47 Ga0068868_100345696 3300005338 Bacteria 1273
48 Ga0068868_101727857 3300005338 Unclassified 590
49 Ga0070660_100044330 3300005339 Bacteria 3401
50 Ga0070660_100057478 3300005339 Bacteria 3013
51 Ga0070660_100061610 3300005339 Unclassified 2913
52 Ga0070689_100001082 3300005340 Bacteria 17081
53 Ga0070689_100277665 3300005340 Bacteria 1389
54 Ga0070687_100886103 3300005343 Bacteria 639
55 Ga0070661_100009221 3300005344 Bacteria 6822
56 Ga0070661_100033165 3300005344 Bacteria 3740
57 Ga0070661_100107608 3300005344 Bacteria 2079
58 Ga0070661_100162808 3300005344 Bacteria 1690
59 Ga0070668_100055194 3300005347 Bacteria 3066
60 Ga0070668_100635676 3300005347 Bacteria 937
61 Ga0070669_100001365 3300005353 Bacteria 17595
62 Ga0070675_100219209 3300005354 Bacteria 1656
63 Ga0070671_100106068 3300005355 Unclassified 2358
64 Ga0070674_100158283 3300005356 Bacteria 1716
65 Ga0070673_100009008 3300005364 Bacteria 6679
66 Ga0070673_100153144 3300005364 Bacteria 1954
67 Ga0070688_100000289 3300005365 Bacteria 25802
68 Ga0070659_100002441 3300005366 Bacteria 13204
69 Ga0070659_100014097 3300005366 Bacteria 5966
70 Ga0070667_100144235 3300005367 Unclassified 2087
71 Ga0070667_100278847 3300005367 Bacteria 1500
72 Ga0070709_10052109 3300005434 Bacteria 2570
73 Ga0070709_10064095 3300005434 Bacteria 2349
74 Ga0070709_10181912 3300005434 Unclassified 1477
75 Ga0070709_10205448 3300005434 Bacteria 1397
76 Ga0070709_10395508 3300005434 Unclassified 1031
77 Ga0070714_100025598 3300005435 Bacteria 4870
78 Ga0070714_100658023 3300005435 Bacteria 1009
79 Ga0070714_100945325 3300005435 Unclassified 838
80 Ga0070714_102337374 3300005435 Unclassified 520
81 Ga0070713_100005444 3300005436 Bacteria 8699
82 Ga0070713_100019826 3300005436 Bacteria 5146
83 Ga0070713_100054319 3300005436 Bacteria 3323
84 Ga0070713_100086907 3300005436 Archaea 2682
85 Ga0070713_100121506 3300005436 Unclassified 2291
86 Ga0070713_100384492 3300005436 Unclassified 1308
87 Ga0070713_100923606 3300005436 Bacteria 840
88 Ga0070710_10008104 3300005437 Bacteria 5108
89 Ga0070710_10273287 3300005437 Bacteria 1094
90 Ga0070710_10312298 3300005437 Bacteria 1029
91 Ga0070701_10884135 3300005438 Bacteria 616
92 Ga0070711_100002248 3300005439 Bacteria 10959
93 Ga0070711_100129574 3300005439 Bacteria 1877
94 Ga0070711_100307198 3300005439 Bacteria 1263
95 Ga0070711_100351526 3300005439 Bacteria 1185
96 Ga0070711_101634368 3300005439 Bacteria 564
97 Ga0070700_100196077 3300005441 Bacteria 1415
98 Ga0070694_100083271 3300005444 Bacteria 2229
99 Ga0070694_100354565 3300005444 Bacteria 1137
100 Ga0070708_100059755 3300005445 Bacteria 3399
101 Ga0070663_100010379 3300005455 Bacteria 5805
102 Ga0070663_100063087 3300005455 Bacteria 2674
103 Ga0070663_100926013 3300005455 Bacteria 754
104 Ga0070678_100002783 3300005456 Bacteria 9666
105 Ga0070662_100002426 3300005457 Bacteria 11463
106 Ga0070662_100004251 3300005457 Bacteria 9028
107 Ga0070662_100352213 3300005457 Bacteria 1206
108 Ga0070681_10000316 3300005458 Bacteria 39260
109 Ga0070681_10021618 3300005458 Bacteria 6450
110 Ga0070681_10293479 3300005458 Bacteria 1536
111 Ga0070681_10293697 3300005458 Bacteria 1535
112 Ga0068867_100000749 3300005459 Bacteria 21787
113 Ga0068867_100073669 3300005459 Bacteria 2557
114 Ga0068867_100110748 3300005459 Bacteria 2109
115 Ga0068867_100462299 3300005459 Bacteria 1084
116 Ga0070685_10001601 3300005466 Bacteria 11932
117 Ga0070706_100002695 3300005467 Bacteria 17776
118 Ga0070707_100291810 3300005468 Bacteria 1585
119 Ga0070707_101935803 3300005468 Unclassified 557
120 Ga0070699_100001799 3300005518 Bacteria 19484
121 Ga0070699_100004056 3300005518 Bacteria 12944
122 Ga0070679_100069763 3300005530 Unclassified 3506
123 Ga0070679_100095462 3300005530 Bacteria 2961
124 Ga0070679_101621425 3300005530 Bacteria 595
125 Ga0070684_100001382 3300005535 Bacteria 17441
126 Ga0070684_100007536 3300005535 Bacteria 8472
127 Ga0070684_100035675 3300005535 Bacteria 4258
128 Ga0070684_100162037 3300005535 Bacteria 2029
129 Ga0070697_100006755 3300005536 Bacteria 8898
130 Ga0070697_100011980 3300005536 Bacteria 6787
131 Ga0070697_100044001 3300005536 Bacteria 3616
132 Ga0070697_101039472 3300005536 Unclassified 728
133 Ga0068853_100004139 3300005539 Bacteria 11180
134 Ga0068853_100028987 3300005539 Unclassified 4661
135 Ga0068853_100038223 3300005539 Bacteria 4087
136 Ga0068853_100067230 3300005539 Bacteria 3113
137 Ga0068853_100104817 3300005539 Bacteria 2504
138 Ga0070672_100002640 3300005543 Bacteria 11462
139 Ga0070686_100009767 3300005544 Bacteria 5392
140 Ga0070686_100040874 3300005544 Bacteria 2895
141 Ga0070695_100240649 3300005545 Bacteria 1313
142 Ga0070695_100547240 3300005545 Bacteria 902
143 Ga0070695_100664145 3300005545 Bacteria 824
144 Ga0070696_100208070 3300005546 Bacteria 1463
145 Ga0070696_100343277 3300005546 Bacteria 1154
146 Ga0070693_100007116 3300005547 Bacteria 5455
147 Ga0070693_100038385 3300005547 Bacteria 2676
148 Ga0070665_100029285 3300005548 Bacteria 5542
149 Ga0070665_100069445 3300005548 Unclassified 3531
150 Ga0070665_100610923 3300005548 Bacteria 1103
151 Ga0070665_100698832 3300005548 Bacteria 1027
152 Ga0070704_100175269 3300005549 Bacteria 1710
153 Ga0070704_101460233 3300005549 Unclassified 628
154 Ga0068855_100000903 3300005563 Bacteria 36808
155 Ga0068855_100008318 3300005563 Bacteria 12540
156 Ga0068855_100018323 3300005563 Bacteria 8410
157 Ga0068855_100070191 3300005563 Bacteria 4076
158 Ga0068855_100426688 3300005563 Bacteria 1449
159 Ga0068855_101989677 3300005563 Unclassified 587
160 Ga0070664_100006830 3300005564 Bacteria 9204
161 Ga0070664_100020221 3300005564 Bacteria 5481
162 Ga0070664_100103439 3300005564 Bacteria 2479
163 Ga0068857_100002750 3300005577 Bacteria 14452
164 Ga0068857_100006800 3300005577 Bacteria 9846
165 Ga0068857_100015007 3300005577 Bacteria 6759
166 Ga0068857_100183885 3300005577 Bacteria 1902
167 Ga0068857_101723093 3300005577 Unclassified 613
168 Ga0068854_100022350 3300005578 Bacteria 4307
169 Ga0068854_100103379 3300005578 Bacteria 2138
170 Ga0068854_100296632 3300005578 Unclassified 1306
171 Ga0068854_100345535 3300005578 Bacteria 1216
172 Ga0068856_100001036 3300005614 Bacteria 29524
173 Ga0068856_100001068 3300005614 Bacteria 29002
174 Ga0068856_100018327 3300005614 Bacteria 6786
175 Ga0068856_100216334 3300005614 Bacteria 1931
176 Ga0068856_100547126 3300005614 Bacteria 1179
177 Ga0068856_100667995 3300005614 Bacteria 1060
178 Ga0068856_102231514 3300005614 Bacteria 556
179 Ga0070702_100006493 3300005615 Bacteria 5541
180 Ga0070702_100237110 3300005615 Unclassified 1229
181 Ga0068852_100005202 3300005616 Bacteria 9279
182 Ga0068852_100025776 3300005616 Bacteria 4769
183 Ga0068852_100403406 3300005616 Unclassified 1345
184 Ga0068859_100029738 3300005617 Bacteria 5481
185 Ga0068859_100032315 3300005617 Bacteria 5257
186 Ga0068864_100003567 3300005618 Bacteria 12861
187 Ga0068864_100031399 3300005618 Bacteria 4507
188 Ga0068866_10001464 3300005718 Bacteria 10084
189 Ga0068866_10214536 3300005718 Bacteria 1157
190 Ga0068866_10298376 3300005718 Unclassified 1005
191 Ga0068861_100002752 3300005719 Bacteria 11529
192 Ga0068851_10002205 3300005834 Bacteria 8567
193 Ga0068851_10029254 3300005834 Bacteria 2727
194 Ga0068870_10000606 3300005840 Bacteria 13652
195 Ga0068863_100010061 3300005841 Bacteria 9204
196 Ga0068863_100053854 3300005841 Bacteria 3814
197 Ga0068863_100301698 3300005841 Unclassified 1554
198 Ga0068863_100312589 3300005841 Bacteria 1525
199 Ga0068863_102101971 3300005841 Unclassified 575
200 Ga0068858_100005248 3300005842 Bacteria 12695
201 Ga0068858_100021345 3300005842 Bacteria 6049
202 Ga0068858_100062982 3300005842 Unclassified 3430
203 Ga0068858_100070266 3300005842 Bacteria 3245
204 Ga0068858_100964442 3300005842 Bacteria 835
205 Ga0068860_100039000 3300005843 Bacteria 4544
206 Ga0068860_100047365 3300005843 Unclassified 4098
207 Ga0068860_100497156 3300005843 Unclassified 1217
208 Ga0068860_101065769 3300005843 Bacteria 827
209 Ga0068862_100056995 3300005844 Unclassified 3349
210 Ga0068862_100482592 3300005844 Unclassified 1173
211 Ga0070717_10001077 3300006028 Bacteria 18344
212 Ga0070717_10020671 3300006028 Bacteria 5181
213 Ga0070717_10134364 3300006028 Bacteria 2129
214 Ga0070717_11143972 3300006028 Unclassified 709
215 Ga0070715_10010457 3300006163 Unclassified 3308
216 Ga0070715_10016825 3300006163 Bacteria 2756
217 Ga0070715_10102355 3300006163 Bacteria 1338
218 Ga0070716_100026082 3300006173 Unclassified 3126
219 Ga0070716_100058390 3300006173 Bacteria 2220
220 Ga0070716_100060568 3300006173 Bacteria 2187
221 Ga0070716_100074962 3300006173 Bacteria 2001
222 Ga0070716_100109284 3300006173 Bacteria 1710
223 Ga0070716_100147367 3300006173 Bacteria 1509
224 Ga0070716_100290664 3300006173 Bacteria 1132
225 Ga0070716_100451604 3300006173 Unclassified 937
226 Ga0070712_100000566 3300006175 Bacteria 21524
227 Ga0070712_100004100 3300006175 Bacteria 8952
228 Ga0070712_100005444 3300006175 Bacteria 7883
229 Ga0070712_100039310 3300006175 Bacteria 3237
230 Ga0097621_100000216 3300006237 Bacteria 38151
231 Ga0097621_100005019 3300006237 Bacteria 9288
232 Ga0097621_100065896 3300006237 Bacteria 2982
233 Ga0097621_100083411 3300006237 Unclassified 2663
234 Ga0097621_100162180 3300006237 Bacteria 1922
235 Ga0097621_100292566 3300006237 Bacteria 1436
236 Ga0068871_100000182 3300006358 Bacteria 42634
237 Ga0068871_100007539 3300006358 Bacteria 7783
238 Ga0068871_100052698 3300006358 Bacteria 3296
239 Ga0068871_100252176 3300006358 Unclassified 1537
240 Ga0068871_100332071 3300006358 Bacteria 1341
241 Ga0068871_100523629 3300006358 Unclassified 1071
242 Ga0068871_100568285 3300006358 Bacteria 1028
243 Ga0068871_100837450 3300006358 Unclassified 850
244 Ga0075428_101157756 3300006844 Unclassified 816
245 Ga0075433_10117605 3300006852 Unclassified 2359
246 Ga0075433_10530540 3300006852 Unclassified 1035
247 Ga0075433_10997861 3300006852 Unclassified 729
248 Ga0075434_100005505 3300006871 Bacteria 11532
249 Ga0075434_100247864 3300006871 Bacteria 1800
250 Ga0075434_100541282 3300006871 Bacteria 1184
251 Ga0075434_100837917 3300006871 Unclassified 935
252 Ga0068865_100011689 3300006881 Bacteria 5500
253 Ga0068865_100093370 3300006881 Bacteria 2188
254 Ga0068865_100307328 3300006881 Unclassified 1271
255 Ga0075436_100045890 3300006914 Unclassified 3014
256 Ga0075436_100149157 3300006914 Bacteria 1645
257 Ga0075436_101383047 3300006914 Unclassified 533
258 Ga0097620_100029739 3300006931 Bacteria 5481
259 Ga0097620_100032313 3300006931 Bacteria 5257
260 Ga0075435_100092565 3300007076 Bacteria 2497
261 Ga0105250_10611913 3300009092 Unclassified 506
262 Ga0105240_10053308 3300009093 Bacteria 5077
263 Ga0105240_10075293 3300009093 Bacteria 4164
264 Ga0105240_10164065 3300009093 Bacteria 2636
265 Ga0105240_10473020 3300009093 Unclassified 1398
266 Ga0105240_10540673 3300009093 Unclassified 1290
267 Ga0105240_10731093 3300009093 Bacteria 1078
268 Ga0105240_10797934 3300009093 Bacteria 1023
269 Ga0105245_10002797 3300009098 Bacteria 15694
270 Ga0105245_10088679 3300009098 Unclassified 2842
271 Ga0105245_10745329 3300009098 Bacteria 1015
272 Ga0105247_10001769 3300009101 Bacteria 15200
273 Ga0105243_10246974 3300009148 Unclassified 1591
274 Ga0105243_10321931 3300009148 Unclassified 1409
275 Ga0105243_11466350 3300009148 Unclassified 705
276 Ga0105241_10008758 3300009174 Bacteria 7436
277 Ga0105241_10013885 3300009174 Bacteria 5901
278 Ga0105241_10022680 3300009174 Bacteria 4651
279 Ga0105241_10150024 3300009174 Bacteria 1906
280 Ga0105241_10209176 3300009174 Unclassified 1634
281 Ga0105242_10005432 3300009176 Bacteria 9856
282 Ga0105242_10014052 3300009176 Bacteria 6194
283 Ga0105242_10017241 3300009176 Bacteria 5623
284 Ga0105248_10015267 3300009177 Bacteria 8467
285 Ga0105248_10029186 3300009177 Bacteria 6151
286 Ga0105248_10039571 3300009177 Bacteria 5282
287 Ga0105248_10056843 3300009177 Unclassified 4390
288 Ga0105248_10310935 3300009177 Bacteria 1774
289 Ga0105248_11201884 3300009177 Bacteria 857
290 Ga0105237_10022385 3300009545 Bacteria 6485
291 Ga0105237_10030939 3300009545 Bacteria 5430
292 Ga0105237_10061368 3300009545 Unclassified 3759
293 Ga0105237_10278684 3300009545 Unclassified 1675
294 Ga0105237_11135032 3300009545 Unclassified 788
295 Ga0105238_10005296 3300009551 Bacteria 12753
296 Ga0105238_10022710 3300009551 Bacteria 6394
297 Ga0105238_10066624 3300009551 Bacteria 3602
298 Ga0105238_10174097 3300009551 Unclassified 2128
299 Ga0105238_10449343 3300009551 Bacteria 1286
300 Ga0105238_10648251 3300009551 Bacteria 1066
301 Ga0105249_10015359 3300009553 Bacteria 6776
302 Ga0105249_10232384 3300009553 Bacteria 1819
303 Ga0105249_10776029 3300009553 Bacteria 1021
304 Ga0099796_10247869 3300010159 Unclassified 739
305 Ga0105239_10004431 3300010375 Bacteria 16792
306 Ga0105239_10042312 3300010375 Bacteria 4993
307 Ga0105239_10088162 3300010375 Bacteria 3421
308 Ga0105239_10221123 3300010375 Bacteria 2124
309 Ga0105239_10783412 3300010375 Unclassified 1092
310 Ga0105239_10943677 3300010375 Unclassified 991
311 Ga0105246_10002416 3300011119 Bacteria 11268
312 Ga0105246_11074476 3300011119 Unclassified 733
313 Ga0157373_10006047 3300013100 Bacteria 9050
314 Ga0157373_10006948 3300013100 Bacteria 8426
315 Ga0157373_10036993 3300013100 Unclassified 3502
316 Ga0157371_10006502 3300013102 Bacteria 9624
317 Ga0157371_10020814 3300013102 Bacteria 4825
318 Ga0157371_10042811 3300013102 Archaea 3227
319 Ga0157370_10009209 3300013104 Bacteria 10585
320 Ga0157370_10655340 3300013104 Bacteria 959
321 Ga0157370_11643626 3300013104 Unclassified 577
322 Ga0157370_11695722 3300013104 Bacteria 567
323 Ga0157369_10001537 3300013105 Bacteria 28258
324 Ga0157369_10031401 3300013105 Bacteria 5849
325 Ga0157369_10036757 3300013105 Bacteria 5364
326 Ga0157369_11311365 3300013105 Unclassified 738
327 Ga0157369_12651676 3300013105 Unclassified 506
328 Ga0157374_10000090 3300013296 Bacteria 88789
329 Ga0157374_10000483 3300013296 Bacteria 36023
330 Ga0157374_10002984 3300013296 Bacteria 14164
331 Ga0157374_10019060 3300013296 Bacteria 6070
332 Ga0157374_10030042 3300013296 Bacteria 4931
333 Ga0157374_10397741 3300013296 Unclassified 1374
334 Ga0157374_10415739 3300013296 Bacteria 1343
335 Ga0157374_12246288 3300013296 Unclassified 573
336 Ga0157378_10000331 3300013297 Bacteria 46651
337 Ga0157378_10005420 3300013297 Bacteria 11188
338 Ga0157378_10039250 3300013297 Bacteria 4199
339 Ga0157378_10044277 3300013297 Bacteria 3952
340 Ga0157378_10413535 3300013297 Unclassified 1332
341 Ga0157378_12415544 3300013297 Unclassified 577
342 Ga0163162_10013974 3300013306 Bacteria 7846
343 Ga0163162_10024935 3300013306 Bacteria 5908
344 Ga0163162_10088799 3300013306 Unclassified 3170
345 Ga0163162_10205651 3300013306 Bacteria 2098
346 Ga0163162_10716344 3300013306 Unclassified 1121
347 Ga0163162_10761444 3300013306 Bacteria 1087
348 Ga0157372_10000100 3300013307 Bacteria 89828
349 Ga0157372_10009031 3300013307 Bacteria 10594
350 Ga0157372_10021173 3300013307 Bacteria 7024
351 Ga0157372_10424099 3300013307 Unclassified 1550
352 Ga0157372_11411127 3300013307 Unclassified 803
353 Ga0157372_11528981 3300013307 Unclassified 769
354 Ga0157375_10003505 3300013308 Bacteria 13607
355 Ga0157375_10127795 3300013308 Bacteria 2659
356 Ga0163163_10000958 3300014325 Bacteria 24503
357 Ga0163163_10048270 3300014325 Bacteria 4186
358 Ga0163163_10314893 3300014325 Unclassified 1618
359 Ga0163163_11227269 3300014325 Bacteria 812
360 Ga0157380_10025039 3300014326 Unclassified 4522
361 Ga0182008_10002356 3300014497 Bacteria 11893
362 Ga0157377_10000467 3300014745 Bacteria 17434
363 Ga0157379_10006291 3300014968 Bacteria 10224
364 Ga0157379_10030890 3300014968 Unclassified 4771
365 Ga0157379_10665666 3300014968 Bacteria 975
366 Ga0157376_10006340 3300014969 Bacteria 8355
367 Ga0157376_10135808 3300014969 Unclassified 2201
368 Ga0157376_10178373 3300014969 Bacteria 1940
369 Ga0157376_10346075 3300014969 Unclassified 1421
370 Ga0182006_1023091 3300015261 Unclassified 2577
371 Ga0182007_10004823 3300015262 Bacteria 6040
372 Ga0163161_10038216 3300017792 Unclassified 3443
373 Ga0206350_10233586 3300020080 Bacteria 1443
374 Ga0224712_10295021 3300022467 Unclassified 757
375 Ga0224572_1044419 3300024225 Bacteria 833
376 Ga0228598_1001121 3300024227 Bacteria 5910
377 Ga0207697_10002916 3300025315 Bacteria 8654
378 Ga0207697_10161545 3300025315 Unclassified 977
379 Ga0207656_10051754 3300025321 Bacteria 1776
380 Ga0207696_1086358 3300025711 Bacteria 863
381 Ga0207682_10003786 3300025893 Bacteria 6496
382 Ga0207692_10036336 3300025898 Unclassified 2401
383 Ga0207692_10254732 3300025898 Unclassified 1053
384 Ga0207692_10286658 3300025898 Bacteria 998
385 Ga0207642_10008335 3300025899 Bacteria 3549
386 Ga0207642_10092397 3300025899 Bacteria 1498
387 Ga0207642_11153481 3300025899 Unclassified 502
388 Ga0207710_10003898 3300025900 Bacteria 6589
389 Ga0207688_10000372 3300025901 Bacteria 20907
390 Ga0207680_10010107 3300025903 Unclassified 4709
391 Ga0207680_10082240 3300025903 Bacteria 2026
392 Ga0207647_10008793 3300025904 Bacteria 7209
393 Ga0207647_10460846 3300025904 Archaea 712
394 Ga0207685_10403643 3300025905 Unclassified 701
395 Ga0207699_10002843 3300025906 Bacteria 8200
396 Ga0207699_10052304 3300025906 Bacteria 2417
397 Ga0207699_10139708 3300025906 Bacteria 1591
398 Ga0207699_10144125 3300025906 Bacteria 1568
399 Ga0207699_10201970 3300025906 Unclassified 1347
400 Ga0207699_10321803 3300025906 Unclassified 1085
401 Ga0207645_10000051 3300025907 Bacteria 84255
402 Ga0207645_10018414 3300025907 Bacteria 4594
403 Ga0207643_10000079 3300025908 Bacteria 63366
404 Ga0207705_10030843 3300025909 Unclassified 3826
405 Ga0207705_10473411 3300025909 Bacteria 972
406 Ga0207705_10545501 3300025909 Bacteria 901
407 Ga0207684_10003578 3300025910 Bacteria 15124
408 Ga0207654_10004318 3300025911 Bacteria 7166
409 Ga0207654_10062709 3300025911 Unclassified 2179
410 Ga0207654_10073471 3300025911 Bacteria 2038
411 Ga0207654_10172651 3300025911 Bacteria 1405
412 Ga0207654_10179057 3300025911 Bacteria 1382
413 Ga0207707_10006534 3300025912 Bacteria 10174
414 Ga0207707_10038395 3300025912 Bacteria 4184
415 Ga0207707_10083377 3300025912 Bacteria 2791
416 Ga0207707_10113218 3300025912 Bacteria 2371
417 Ga0207707_10127015 3300025912 Bacteria 2230
418 Ga0207695_10053615 3300025913 Bacteria 4217
419 Ga0207695_10329497 3300025913 Unclassified 1415
420 Ga0207695_10372364 3300025913 Unclassified 1314
421 Ga0207695_10537123 3300025913 Bacteria 1051
422 Ga0207671_10009137 3300025914 Bacteria 8320
423 Ga0207671_10052117 3300025914 Bacteria 3032
424 Ga0207671_10104037 3300025914 Bacteria 2153
425 Ga0207671_10267374 3300025914 Bacteria 1347
426 Ga0207671_10561174 3300025914 Unclassified 910
427 Ga0207693_10003938 3300025915 Bacteria 12624
428 Ga0207693_10004992 3300025915 Bacteria 11129
429 Ga0207693_10005699 3300025915 Bacteria 10352
430 Ga0207693_10044528 3300025915 Unclassified 3488
431 Ga0207663_10022475 3300025916 Bacteria 3605
432 Ga0207663_10074322 3300025916 Bacteria 2202
433 Ga0207663_10406697 3300025916 Bacteria 1042
434 Ga0207663_10461684 3300025916 Bacteria 981
435 Ga0207663_10988548 3300025916 Bacteria 675
436 Ga0207660_10055524 3300025917 Bacteria 2831
437 Ga0207660_10068043 3300025917 Archaea 2582
438 Ga0207662_10355510 3300025918 Bacteria 985
439 Ga0207657_10000246 3300025919 Bacteria 57698
440 Ga0207657_10000292 3300025919 Bacteria 53366
441 Ga0207657_10001266 3300025919 Bacteria 26953
442 Ga0207649_10000242 3300025920 Bacteria 44166
443 Ga0207649_10035420 3300025920 Bacteria 2999
444 Ga0207652_10137235 3300025921 Bacteria 2185
445 Ga0207652_10265697 3300025921 Bacteria 1548
446 Ga0207646_10125198 3300025922 Bacteria 2310
447 Ga0207681_10075318 3300025923 Unclassified 2366
448 Ga0207694_10002864 3300025924 Bacteria 13898
449 Ga0207694_10005754 3300025924 Bacteria 9500
450 Ga0207694_10014163 3300025924 Bacteria 6012
451 Ga0207694_10045721 3300025924 Bacteria 3382
452 Ga0207694_10355243 3300025924 Bacteria 1213
453 Ga0207694_10555289 3300025924 Unclassified 964
454 Ga0207650_10000090 3300025925 Bacteria 118973
455 Ga0207650_11082910 3300025925 Unclassified 682
456 Ga0207659_10002035 3300025926 Bacteria 11997
457 Ga0207687_10002307 3300025927 Bacteria 12991
458 Ga0207687_10013901 3300025927 Bacteria 5260
459 Ga0207687_10329020 3300025927 Unclassified 1239
460 Ga0207700_10000685 3300025928 Bacteria 19728
461 Ga0207700_10004609 3300025928 Bacteria 8159
462 Ga0207700_10090161 3300025928 Unclassified 2419
463 Ga0207700_10118884 3300025928 Unclassified 2139
464 Ga0207700_10330357 3300025928 Bacteria 1323
465 Ga0207700_11250885 3300025928 Unclassified 662
466 Ga0207700_11349304 3300025928 Unclassified 635
467 Ga0207664_10148252 3300025929 Bacteria 1991
468 Ga0207664_10172385 3300025929 Bacteria 1852
469 Ga0207664_10347576 3300025929 Unclassified 1312
470 Ga0207664_10409035 3300025929 Bacteria 1207
471 Ga0207664_10748508 3300025929 Unclassified 879
472 Ga0207644_10002582 3300025931 Bacteria 11652
473 Ga0207690_10003087 3300025932 Bacteria 10034
474 Ga0207690_10022450 3300025932 Unclassified 3927
475 Ga0207690_10169754 3300025932 Bacteria 1633
476 Ga0207690_11575827 3300025932 Unclassified 549
477 Ga0207706_10000139 3300025933 Bacteria 79096
478 Ga0207706_10001055 3300025933 Bacteria 28007
479 Ga0207706_10084476 3300025933 Bacteria 2791
480 Ga0207686_10055788 3300025934 Bacteria 2480
481 Ga0207709_10371488 3300025935 Bacteria 1085
482 Ga0207670_10001693 3300025936 Bacteria 11493
483 Ga0207670_10593248 3300025936 Bacteria 909
484 Ga0207669_11121922 3300025937 Unclassified 664
485 Ga0207704_10020900 3300025938 Unclassified 3474
486 Ga0207704_10027609 3300025938 Bacteria 3136
487 Ga0207704_10291971 3300025938 Unclassified 1245
488 Ga0207665_10015670 3300025939 Unclassified 4975
489 Ga0207665_10074253 3300025939 Unclassified 2327
490 Ga0207665_10082116 3300025939 Bacteria 2220
491 Ga0207665_10091681 3300025939 Bacteria 2107
492 Ga0207665_10098521 3300025939 Bacteria 2037
493 Ga0207665_10099049 3300025939 Bacteria 2032
494 Ga0207665_10112571 3300025939 Bacteria 1914
495 Ga0207665_10498451 3300025939 Unclassified 940
496 Ga0207665_10901943 3300025939 Unclassified 701
497 Ga0207691_10001343 3300025940 Bacteria 24540
498 Ga0207711_10002838 3300025941 Bacteria 15224
499 Ga0207711_10018665 3300025941 Bacteria 5767
500 Ga0207711_10108962 3300025941 Bacteria 2461
501 Ga0207711_11879466 3300025941 Bacteria 542
502 Ga0207689_10000304 3300025942 Bacteria 45071
503 Ga0207689_10773812 3300025942 Unclassified 810
504 Ga0207661_10000583 3300025944 Bacteria 23334
505 Ga0207661_10019113 3300025944 Bacteria 5101
506 Ga0207661_10070730 3300025944 Bacteria 2849
507 Ga0207679_10000184 3300025945 Bacteria 51157
508 Ga0207679_10091753 3300025945 Bacteria 2351
509 Ga0207679_10202751 3300025945 Bacteria 1658
510 Ga0207667_10000170 3300025949 Bacteria 95740
511 Ga0207667_10004029 3300025949 Bacteria 18047
512 Ga0207667_10007225 3300025949 Bacteria 13401
513 Ga0207667_10128304 3300025949 Bacteria 2612
514 Ga0207667_10170718 3300025949 Bacteria 2235
515 Ga0207667_10909583 3300025949 Unclassified 871
516 Ga0207651_10002456 3300025960 Bacteria 8859
517 Ga0207651_10223679 3300025960 Unclassified 1523
518 Ga0207712_10013954 3300025961 Bacteria 5155
519 Ga0207712_10079479 3300025961 Bacteria 2383
520 Ga0207668_10052744 3300025972 Bacteria 2815
521 Ga0207668_10074687 3300025972 Unclassified 2434
522 Ga0207668_10818059 3300025972 Unclassified 825
523 Ga0207640_10022601 3300025981 Bacteria 3767
524 Ga0207640_10049454 3300025981 Bacteria 2722
525 Ga0207640_10067491 3300025981 Bacteria 2394
526 Ga0207640_10115583 3300025981 Bacteria 1911
527 Ga0207658_10001983 3300025986 Bacteria 15269
528 Ga0207658_11442689 3300025986 Bacteria 629
529 Ga0207677_10007606 3300026023 Bacteria 6009
530 Ga0207677_10011702 3300026023 Bacteria 5011
531 Ga0207677_10076939 3300026023 Unclassified 2377
532 Ga0207677_10081360 3300026023 Unclassified 2324
533 Ga0207677_10328926 3300026023 Bacteria 1273
534 Ga0207703_10005260 3300026035 Bacteria 10438
535 Ga0207703_10087059 3300026035 Bacteria 2618
536 Ga0207703_10095986 3300026035 Archaea 2502
537 Ga0207703_10115619 3300026035 Bacteria 2296
538 Ga0207639_10002287 3300026041 Bacteria 12868
539 Ga0207639_10016884 3300026041 Bacteria 5172
540 Ga0207639_10056072 3300026041 Bacteria 3019
541 Ga0207639_10421191 3300026041 Bacteria 1207
542 Ga0207678_10000204 3300026067 Bacteria 52306
543 Ga0207678_10001833 3300026067 Bacteria 19495
544 Ga0207702_10001597 3300026078 Bacteria 22421
545 Ga0207702_10005883 3300026078 Bacteria 10665
546 Ga0207702_10048664 3300026078 Unclassified 3576
547 Ga0207702_10202697 3300026078 Bacteria 1840
548 Ga0207702_10464806 3300026078 Bacteria 1229
549 Ga0207702_10578668 3300026078 Bacteria 1100
550 Ga0207702_11808931 3300026078 Bacteria 603
551 Ga0207702_11990640 3300026078 Unclassified 571
552 Ga0207641_10000894 3300026088 Bacteria 31042
553 Ga0207641_10009428 3300026088 Bacteria 8043
554 Ga0207641_10314118 3300026088 Bacteria 1484
555 Ga0207641_10382005 3300026088 Bacteria 1349
556 Ga0207648_10000757 3300026089 Bacteria 36296
557 Ga0207648_10003612 3300026089 Bacteria 16172
558 Ga0207648_10181375 3300026089 Bacteria 1864
559 Ga0207676_10000113 3300026095 Bacteria 73022
560 Ga0207676_10021492 3300026095 Bacteria 4734
561 Ga0207674_10000076 3300026116 Bacteria 104404
562 Ga0207674_10009505 3300026116 Bacteria 11102
563 Ga0207674_10012344 3300026116 Bacteria 9550
564 Ga0207674_10510987 3300026116 Bacteria 1161
565 Ga0207675_100008819 3300026118 Bacteria 9464
566 Ga0207675_100209346 3300026118 Bacteria 1875
567 Ga0207683_10001129 3300026121 Bacteria 24286
568 Ga0207683_10139318 3300026121 Bacteria 2185
569 Ga0207698_10034814 3300026142 Bacteria 3676
570 Ga0207698_10073362 3300026142 Archaea 2725
571 Ga0207698_10080537 3300026142 Unclassified 2624
572 Ga0207698_10366752 3300026142 Unclassified 1366
573 Ga0207698_10376022 3300026142 Bacteria 1350
574 Ga0265354_1003475 3300028016 Bacteria 1759
575 Ga0268266_10005373 3300028379 Bacteria 11969
576 Ga0268266_10061763 3300028379 Unclassified 3232
577 Ga0268266_10278856 3300028379 Bacteria 1553
578 Ga0268265_10002144 3300028380 Bacteria 15280
579 Ga0268264_10017158 3300028381 Bacteria 5929
580 Ga0268264_10103205 3300028381 Bacteria 2482
581 Ga0268264_10507744 3300028381 Unclassified 1177
582 Ga0265762_1000676 3300030760 Bacteria 6002
583 Ga0265762_1062789 3300030760 Bacteria 766
584 Ga0265770_1008320 3300030878 Bacteria 1477
585 Ga0265770_1117410 3300030878 Bacteria 557
586 Ga0265760_10000206 3300031090 Bacteria 15774
587 Ga0265760_10003560 3300031090 Bacteria 4520
588 Ga0265760_10033288 3300031090 Bacteria 1523
589 Ga0265760_10058278 3300031090 Bacteria 1170
590 Ga0265313_10038348 3300031595 Unclassified 2387
591 Ga0265342_10524984 3300031712 Bacteria 602
592 Ga0373940_0186662 3300035088 Unclassified 676
593 Ga0373940_0323771 3300035088 Unclassified 536
594 Ga0373952_0068054 3300035092 Unclassified 885
595 Ga0373923_0348710 3300035111 Bacteria 707
596 Ga0373923_0612287 3300035111 Unclassified 537
597 Ga0373932_0187903 3300035112 Unclassified 728
598 Ga0373936_0031150 3300035113 Bacteria 2106
599 Ga0373945_0015579 3300035116 Bacteria 2559
600 Ga0373956_0068571 3300035119 Bacteria 1616
601 Ga0373956_0629148 3300035119 Unclassified 512
602 Ga0373946_0461935 3300035171 Bacteria 647
603 Ga0373946_0704577 3300035171 Unclassified 528
604 Ga0373955_0551014 3300035172 Unclassified 705
605 Ga0373961_0273698 3300035241 Unclassified 617
606 Ga0373931_0068842 3300035691 Bacteria 1927
607 Ga0373931_0164848 3300035691 Bacteria 1301
608 Ga0373931_0179118 3300035691 Bacteria 1254
609 Ga0373935_0342165 3300035692 Bacteria 1065
610 Ga0373927_0443442 3300035695 Bacteria 857
611 Ga0373933_0111032 3300035724 Bacteria 1710
612 Ga0373933_0692894 3300035724 Bacteria 670
613 Ga0373947_0064565 3300035725 Bacteria 2232
614 Ga0373947_0383275 3300035725 Bacteria 947
615 Ga0373937_0006928 3300036401 Bacteria 9786
616 Ga0373937_0785266 3300036401 Bacteria 900
617 Ga0373937_1618714 3300036401 Unclassified 595
618 Ga0373925_0087337 3300037068 Bacteria 2380
619 Ga0373925_0493020 3300037068 Unclassified 1005
620 Ga0436363_0942494 3300039450 Bacteria 566
621 Ga0451839_0698791 3300041496 Unclassified 581
622 Ga0451576_1282436 3300045051 Unclassified 764
623 Ga0495592_0146182 3300046454 Bacteria 1639
624 Ga0495651_0448419 3300046462 Bacteria 834
625 Ga0495653_0178202 3300046463 Bacteria 1461
626 Ga0495580_0702637 3300046472 Unclassified 662
627 Ga0495662_0340690 3300046476 Unclassified 737
628 Ga0495662_0674788 3300046476 Unclassified 504
629 Ga0495664_0017250 3300046477 Bacteria 4126
630 Ga0495664_0131284 3300046477 Bacteria 1517
631 Ga0495608_0037373 3300046511 Bacteria 3265
632 Ga0495618_0203085 3300046514 Bacteria 1254
633 Ga0495628_0757193 3300046516 Unclassified 682
634 Ga0495630_0084986 3300046517 Bacteria 2389
635 Ga0495630_0121352 3300046517 Bacteria 1983
636 Ga0495642_0275056 3300046528 Unclassified 737
637 Ga0495652_0517785 3300046529 Bacteria 825
638 Ga0495640_0361501 3300046533 Bacteria 895
639 Ga0495640_0411852 3300046533 Unclassified 829
640 Ga0495587_0067745 3300046536 Bacteria 2080
641 Ga0495645_0005114 3300046543 Bacteria 8987
642 Ga0495645_0296977 3300046543 Bacteria 1057
643 Ga0495667_0016821 3300046559 Bacteria 4938
644 Ga0495667_0330784 3300046559 Unclassified 964
645 Ga0495635_0139099 3300046663 Bacteria 1654
646 Ga0495635_0512669 3300046663 Bacteria 789
647 Ga0495657_0057793 3300046675 Bacteria 2578
648 Ga0495599_0023481 3300046678 Bacteria 3856
649 Ga0495623_0121806 3300046679 Bacteria 1569
650 Ga0495623_0535569 3300046679 Bacteria 615
651 Ga0495646_0029962 3300046680 Bacteria 3399
652 Ga0495669_0270201 3300046684 Unclassified 817
653 Ga0495669_0463321 3300046684 Unclassified 616
654 Ga0495589_0496529 3300046794 Unclassified 557
655 Ga0495600_0224293 3300046809 Unclassified 1202
656 Ga0495604_0047356 3300047317 Bacteria 3348
657 Ga0495604_0797291 3300047317 Unclassified 595
658 Ga0495674_0009662 3300047319 Bacteria 9159
659 Ga0495674_0628774 3300047319 Unclassified 848
660 Ga0495680_0349915 3300047322 Bacteria 1029
661 Ga0495684_0051903 3300047471 Bacteria 3129
662 Ga0495684_0320770 3300047471 Bacteria 1108
663 Ga0495602_0000360 3300048088 Bacteria 42505
664 Ga0495602_0188241 3300048088 Bacteria 1585
665 Ga0495602_0427794 3300048088 Bacteria 939
666 Ga0496100_0031661 3300048903 Bacteria 3290
667 Ga0496100_0744742 3300048903 Unclassified 766
668 Ga0496101_0003461 3300048904 Bacteria 9848
669 Ga0496101_0069100 3300048904 Bacteria 2584
670 Ga0496101_0131212 3300048904 Bacteria 1903
671 Ga0496101_0403020 3300048904 Unclassified 1077
672 Ga0496101_0766498 3300048904 Unclassified 761
673 Ga0496102_0000537 3300048905 Bacteria 40994
674 Ga0496102_0034176 3300048905 Unclassified 4573
675 Ga0496102_0042175 3300048905 Unclassified 4135
676 Ga0496102_0084755 3300048905 Unclassified 2925
677 Ga0496103_0029061 3300048906 Bacteria 3358
678 Ga0496103_0087374 3300048906 Bacteria 1965
679 Ga0496103_0908958 3300048906 Unclassified 551
680 Ga0496104_0043291 3300048907 Bacteria 4229
681 Ga0496104_0043663 3300048907 Bacteria 4210
682 Ga0496104_0097111 3300048907 Unclassified 2819
683 Ga0496104_0193678 3300048907 Bacteria 1945
684 Ga0496104_0622441 3300048907 Unclassified 989
685 Ga0496104_0870699 3300048907 Unclassified 806
686 Ga0496105_0223019 3300048908 Unclassified 1534
687 Ga0496105_0396745 3300048908 Bacteria 1096
688 Ga0496105_0855422 3300048908 Unclassified 688
689 Ga0496106_0060516 3300048909 Bacteria 2871
690 Ga0496106_0137926 3300048909 Bacteria 1917
691 Ga0496106_0167565 3300048909 Bacteria 1740
692 Ga0496106_0844584 3300048909 Unclassified 725
693 Ga0496107_0047707 3300048910 Bacteria 3084
694 Ga0496107_0156443 3300048910 Bacteria 1688
695 Ga0496107_0581475 3300048910 Unclassified 828
696 Ga0496107_0790807 3300048910 Unclassified 695
697 Ga0496108_0002118 3300048911 Bacteria 15901
698 Ga0496109_0000008 3300048912 Bacteria 245809
699 Ga0496109_1163704 3300048912 Bacteria 708
700 Ga0496109_1361679 3300048912 Bacteria 645
701 Ga0496110_0008075 3300048913 Bacteria 8450
702 Ga0496110_0110860 3300048913 Bacteria 2466
703 Ga0496111_0005563 3300048914 Bacteria 8097
704 Ga0496112_0000334 3300048915 Bacteria 30562
705 Ga0496112_0001276 3300048915 Bacteria 19093
706 Ga0496112_0044733 3300048915 Bacteria 4339
707 Ga0496112_0072790 3300048915 Unclassified 3397
708 Ga0496112_0207500 3300048915 Unclassified 1917
709 Ga0496112_0277531 3300048915 Bacteria 1624
710 Ga0496112_0409378 3300048915 Unclassified 1295
711 Ga0496113_0006066 3300048916 Bacteria 7617
712 Ga0496113_0111874 3300048916 Unclassified 2126
713 Ga0496113_0151138 3300048916 Bacteria 1832
714 Ga0496113_0267616 3300048916 Archaea 1366
715 Ga0496114_0041204 3300048917 Bacteria 3826
716 Ga0496115_0016349 3300048918 Bacteria 5648
717 Ga0496115_0446328 3300048918 Unclassified 1045
718 Ga0496115_0629328 3300048918 Unclassified 850
719 Ga0501047_0894319 3300049581 Unclassified 701
720 Ga0501073_0258869 3300049589 Bacteria 1201
721 Ga0501044_0158399 3300049823 Bacteria 2242
722 nmdc:mga08y16_1200968_c1 3300050511 Unclassified 729
723 nmdc:mga0n895_34675_c1 3300050512 Bacteria 4860
724 nmdc:mga0n895_634_c1 3300050512 Bacteria 24414
725 nmdc:mga0rr50_711970_c1 3300050513 Unclassified 857
726 nmdc:mga08x19_1121820_c1 3300050514 Unclassified 558
727 nmdc:mga08x19_12628_c1 3300050514 Bacteria 5093
728 nmdc:mga08x19_168254_c1 3300050514 Bacteria 1491
729 nmdc:mga0a205_117991_c1 3300050515 Bacteria 2552
730 nmdc:mga0a205_493545_c1 3300050515 Unclassified 1082
731 nmdc:mga0a205_905760_c1 3300050515 Unclassified 729
732 Ga0495601_0060993 3300053077 Bacteria 2394
733 Ga0495601_0161914 3300053077 Bacteria 1462
734 Ga0495612_0005112 3300053078 Bacteria 5424
735 Ga0495612_0521841 3300053078 Unclassified 546
736 Ga0495595_0072005 3300053084 Unclassified 1635
737 Ga0495619_0358892 3300053085 Unclassified 1008
738 Ga0587077_191670 3300059493 Bacteria 560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_11074476 Ga0105246_110744761 96
2 3300046559 Ga0495667_0016821 Ga0495667_0016821_724_1038 102
3 3300005327 Ga0070658_10405901 Ga0070658_104059012 107
4 3300005338 Ga0068868_100345696 Ga0068868_1003456962 107
5 3300005435 Ga0070714_100945325 Ga0070714_1009453252 107
6 3300005436 Ga0070713_100121506 Ga0070713_1001215062 107
7 3300005439 Ga0070711_100002248 Ga0070711_10000224811 107
8 3300005439 Ga0070711_100129574 Ga0070711_1001295744 107
9 3300006028 Ga0070717_11143972 Ga0070717_111439721 107
10 3300006175 Ga0070712_100004100 Ga0070712_10000410010 107
11 3300006358 Ga0068871_100837450 Ga0068871_1008374502 107
12 3300009553 Ga0105249_10776029 Ga0105249_107760292 107
13 3300010159 Ga0099796_10247869 Ga0099796_102478691 107
14 3300013306 Ga0163162_10205651 Ga0163162_102056514 107
15 3300025909 Ga0207705_10473411 Ga0207705_104734112 107
16 3300025915 Ga0207693_10003938 Ga0207693_100039384 107
17 3300025916 Ga0207663_10074322 Ga0207663_100743222 107
18 3300025928 Ga0207700_10090161 Ga0207700_100901612 107
19 3300025929 Ga0207664_10347576 Ga0207664_103475762 107
20 3300025939 Ga0207665_10901943 Ga0207665_109019432 107
21 3300026023 Ga0207677_10328926 Ga0207677_103289263 107
22 3300026088 Ga0207641_10382005 Ga0207641_103820051 107
23 3300031090 Ga0265760_10003560 Ga0265760_100035606 107
24 3300031595 Ga0265313_10038348 Ga0265313_100383482 107
25 3300031712 Ga0265342_10524984 Ga0265342_105249841 107
26 3300035092 Ga0373952_0068054 Ga0373952_0068054_523_849 107
27 3300041496 Ga0451839_0698791 Ga0451839_0698791_185_508 107
28 3300048088 Ga0495602_0427794 Ga0495602_0427794_591_914 107
29 3300049581 Ga0501047_0894319 Ga0501047_0894319_95_448 107
30 3300049823 Ga0501044_0158399 Ga0501044_0158399_1873_2226 107
31 3300005338 Ga0068868_101727857 Ga0068868_1017278571 108
32 3300005563 Ga0068855_101989677 Ga0068855_1019896771 108
33 3300036401 Ga0373937_0785266 Ga0373937_0785266_544_882 108
34 3300004799 Ga0058863_11769502 Ga0058863_117695021 109
35 3300004803 Ga0058862_10008808 Ga0058862_100088081 109
36 3300005327 Ga0070658_10370542 Ga0070658_103705422 109
37 3300005327 Ga0070658_10415299 Ga0070658_104152992 109
38 3300005328 Ga0070676_10160666 Ga0070676_101606662 109
39 3300005329 Ga0070683_100021957 Ga0070683_1000219572 109
40 3300005329 Ga0070683_100031689 Ga0070683_1000316895 109
41 3300005329 Ga0070683_100082482 Ga0070683_1000824824 109
42 3300005330 Ga0070690_100145461 Ga0070690_1001454613 109
43 3300005330 Ga0070690_100147599 Ga0070690_1001475991 109
44 3300005330 Ga0070690_100888145 Ga0070690_1008881451 109
45 3300005331 Ga0070670_100126500 Ga0070670_1001265002 109
46 3300005331 Ga0070670_101075184 Ga0070670_1010751842 109
47 3300005334 Ga0068869_100490673 Ga0068869_1004906732 109
48 3300005335 Ga0070666_10011983 Ga0070666_100119836 109
49 3300005336 Ga0070680_100089047 Ga0070680_1000890473 109
50 3300005337 Ga0070682_100071298 Ga0070682_1000712981 109
51 3300005337 Ga0070682_100209862 Ga0070682_1002098621 109
52 3300005338 Ga0068868_100008382 Ga0068868_1000083826 109
53 3300005338 Ga0068868_100010214 Ga0068868_1000102143 109
54 3300005338 Ga0068868_100106830 Ga0068868_1001068302 109
55 3300005339 Ga0070660_100044330 Ga0070660_1000443305 109
56 3300005339 Ga0070660_100057478 Ga0070660_1000574784 109
57 3300005340 Ga0070689_100277665 Ga0070689_1002776652 109
58 3300005343 Ga0070687_100886103 Ga0070687_1008861031 109
59 3300005344 Ga0070661_100033165 Ga0070661_1000331651 109
60 3300005344 Ga0070661_100107608 Ga0070661_1001076081 109
61 3300005344 Ga0070661_100162808 Ga0070661_1001628082 109
62 3300005347 Ga0070668_100055194 Ga0070668_1000551942 109
63 3300005364 Ga0070673_100153144 Ga0070673_1001531442 109
64 3300005366 Ga0070659_100014097 Ga0070659_1000140976 109
65 3300005367 Ga0070667_100278847 Ga0070667_1002788471 109
66 3300005435 Ga0070714_100658023 Ga0070714_1006580232 109
67 3300005435 Ga0070714_102337374 Ga0070714_1023373741 109
68 3300005436 Ga0070713_100005444 Ga0070713_1000054442 109
69 3300005436 Ga0070713_100086907 Ga0070713_1000869073 109
70 3300005436 Ga0070713_100384492 Ga0070713_1003844922 109
71 3300005436 Ga0070713_100923606 Ga0070713_1009236061 109
72 3300005437 Ga0070710_10312298 Ga0070710_103122982 109
73 3300005438 Ga0070701_10884135 Ga0070701_108841352 109
74 3300005444 Ga0070694_100083271 Ga0070694_1000832712 109
75 3300005445 Ga0070708_100059755 Ga0070708_1000597553 109
76 3300005455 Ga0070663_100063087 Ga0070663_1000630873 109
77 3300005457 Ga0070662_100002426 Ga0070662_10000242610 109
78 3300005457 Ga0070662_100352213 Ga0070662_1003522132 109
79 3300005458 Ga0070681_10000316 Ga0070681_1000031629 109
80 3300005458 Ga0070681_10021618 Ga0070681_100216183 109
81 3300005458 Ga0070681_10293479 Ga0070681_102934791 109
82 3300005458 Ga0070681_10293697 Ga0070681_102936971 109
83 3300005459 Ga0068867_100073669 Ga0068867_1000736692 109
84 3300005459 Ga0068867_100110748 Ga0068867_1001107483 109
85 3300005459 Ga0068867_100462299 Ga0068867_1004622991 109
86 3300005467 Ga0070706_100002695 Ga0070706_1000026953 109
87 3300005468 Ga0070707_100291810 Ga0070707_1002918102 109
88 3300005518 Ga0070699_100001799 Ga0070699_10000179915 109
89 3300005518 Ga0070699_100004056 Ga0070699_1000040563 109
90 3300005530 Ga0070679_100069763 Ga0070679_1000697633 109
91 3300005530 Ga0070679_100095462 Ga0070679_1000954623 109
92 3300005530 Ga0070679_101621425 Ga0070679_1016214251 109
93 3300005535 Ga0070684_100007536 Ga0070684_10000753610 109
94 3300005535 Ga0070684_100035675 Ga0070684_1000356753 109
95 3300005535 Ga0070684_100162037 Ga0070684_1001620372 109
96 3300005536 Ga0070697_100006755 Ga0070697_10000675511 109
97 3300005536 Ga0070697_100011980 Ga0070697_1000119806 109
98 3300005536 Ga0070697_100044001 Ga0070697_1000440012 109
99 3300005536 Ga0070697_101039472 Ga0070697_1010394722 109
100 3300005539 Ga0068853_100004139 Ga0068853_1000041395 109
101 3300005539 Ga0068853_100038223 Ga0068853_1000382232 109
102 3300005539 Ga0068853_100067230 Ga0068853_1000672301 109
103 3300005539 Ga0068853_100104817 Ga0068853_1001048172 109
104 3300005544 Ga0070686_100040874 Ga0070686_1000408745 109
105 3300005545 Ga0070695_100547240 Ga0070695_1005472401 109
106 3300005546 Ga0070696_100343277 Ga0070696_1003432772 109
107 3300005547 Ga0070693_100007116 Ga0070693_1000071166 109
108 3300005547 Ga0070693_100038385 Ga0070693_1000383854 109
109 3300005548 Ga0070665_100029285 Ga0070665_1000292854 109
110 3300005548 Ga0070665_100069445 Ga0070665_1000694454 109
111 3300005548 Ga0070665_100698832 Ga0070665_1006988322 109
112 3300005549 Ga0070704_100175269 Ga0070704_1001752691 109
113 3300005563 Ga0068855_100000903 Ga0068855_10000090327 109
114 3300005563 Ga0068855_100008318 Ga0068855_10000831811 109
115 3300005563 Ga0068855_100018323 Ga0068855_1000183235 109
116 3300005563 Ga0068855_100070191 Ga0068855_1000701912 109
117 3300005564 Ga0070664_100020221 Ga0070664_1000202216 109
118 3300005564 Ga0070664_100103439 Ga0070664_1001034392 109
119 3300005577 Ga0068857_100006800 Ga0068857_1000068007 109
120 3300005577 Ga0068857_100015007 Ga0068857_1000150076 109
121 3300005577 Ga0068857_100183885 Ga0068857_1001838852 109
122 3300005577 Ga0068857_101723093 Ga0068857_1017230932 109
123 3300005578 Ga0068854_100022350 Ga0068854_1000223502 109
124 3300005578 Ga0068854_100296632 Ga0068854_1002966322 109
125 3300005578 Ga0068854_100345535 Ga0068854_1003455353 109
126 3300005614 Ga0068856_100001036 Ga0068856_10000103620 109
127 3300005614 Ga0068856_100001068 Ga0068856_10000106810 109
128 3300005614 Ga0068856_100216334 Ga0068856_1002163342 109
129 3300005614 Ga0068856_100667995 Ga0068856_1006679951 109
130 3300005615 Ga0070702_100237110 Ga0070702_1002371102 109
131 3300005616 Ga0068852_100025776 Ga0068852_1000257762 109
132 3300005616 Ga0068852_100403406 Ga0068852_1004034062 109
133 3300005617 Ga0068859_100029738 Ga0068859_1000297382 109
134 3300005618 Ga0068864_100031399 Ga0068864_1000313994 109
135 3300005718 Ga0068866_10214536 Ga0068866_102145362 109
136 3300005718 Ga0068866_10298376 Ga0068866_102983762 109
137 3300005834 Ga0068851_10029254 Ga0068851_100292544 109
138 3300005841 Ga0068863_100053854 Ga0068863_1000538543 109
139 3300005841 Ga0068863_100301698 Ga0068863_1003016982 109
140 3300005841 Ga0068863_102101971 Ga0068863_1021019711 109
141 3300005842 Ga0068858_100005248 Ga0068858_1000052485 109
142 3300005842 Ga0068858_100021345 Ga0068858_1000213454 109
143 3300005842 Ga0068858_100070266 Ga0068858_1000702662 109
144 3300005843 Ga0068860_100039000 Ga0068860_1000390004 109
145 3300005843 Ga0068860_100497156 Ga0068860_1004971561 109
146 3300005843 Ga0068860_101065769 Ga0068860_1010657692 109
147 3300005844 Ga0068862_100482592 Ga0068862_1004825922 109
148 3300006028 Ga0070717_10001077 Ga0070717_1000107720 109
149 3300006028 Ga0070717_10134364 Ga0070717_101343643 109
150 3300006173 Ga0070716_100147367 Ga0070716_1001473672 109
151 3300006173 Ga0070716_100451604 Ga0070716_1004516042 109
152 3300006237 Ga0097621_100000216 Ga0097621_10000021627 109
153 3300006237 Ga0097621_100005019 Ga0097621_1000050195 109
154 3300006237 Ga0097621_100162180 Ga0097621_1001621803 109
155 3300006237 Ga0097621_100292566 Ga0097621_1002925662 109
156 3300006358 Ga0068871_100000182 Ga0068871_10000018231 109
157 3300006358 Ga0068871_100007539 Ga0068871_1000075399 109
158 3300006358 Ga0068871_100252176 Ga0068871_1002521762 109
159 3300006358 Ga0068871_100332071 Ga0068871_1003320712 109
160 3300006852 Ga0075433_10117605 Ga0075433_101176054 109
161 3300006871 Ga0075434_100247864 Ga0075434_1002478642 109
162 3300006881 Ga0068865_100093370 Ga0068865_1000933702 109
163 3300006881 Ga0068865_100307328 Ga0068865_1003073282 109
164 3300006914 Ga0075436_100149157 Ga0075436_1001491572 109
165 3300006931 Ga0097620_100029739 Ga0097620_1000297392 109
166 3300007076 Ga0075435_100092565 Ga0075435_1000925651 109
167 3300009092 Ga0105250_10611913 Ga0105250_106119131 109
168 3300009093 Ga0105240_10053308 Ga0105240_100533083 109
169 3300009093 Ga0105240_10164065 Ga0105240_101640652 109
170 3300009093 Ga0105240_10473020 Ga0105240_104730202 109
171 3300009093 Ga0105240_10540673 Ga0105240_105406732 109
172 3300009093 Ga0105240_10797934 Ga0105240_107979342 109
173 3300009098 Ga0105245_10088679 Ga0105245_100886793 109
174 3300009098 Ga0105245_10745329 Ga0105245_107453292 109
175 3300009148 Ga0105243_10246974 Ga0105243_102469742 109
176 3300009148 Ga0105243_11466350 Ga0105243_114663502 109
177 3300009174 Ga0105241_10013885 Ga0105241_100138852 109
178 3300009174 Ga0105241_10150024 Ga0105241_101500242 109
179 3300009176 Ga0105242_10014052 Ga0105242_100140523 109
180 3300009176 Ga0105242_10017241 Ga0105242_100172414 109
181 3300009177 Ga0105248_10015267 Ga0105248_100152672 109
182 3300009177 Ga0105248_10039571 Ga0105248_100395716 109
183 3300009177 Ga0105248_10056843 Ga0105248_100568434 109
184 3300009177 Ga0105248_10310935 Ga0105248_103109351 109
185 3300009545 Ga0105237_10022385 Ga0105237_100223854 109
186 3300009545 Ga0105237_10030939 Ga0105237_100309395 109
187 3300009545 Ga0105237_10278684 Ga0105237_102786842 109
188 3300009545 Ga0105237_11135032 Ga0105237_111350321 109
189 3300009551 Ga0105238_10005296 Ga0105238_100052965 109
190 3300009551 Ga0105238_10022710 Ga0105238_100227102 109
191 3300009551 Ga0105238_10066624 Ga0105238_100666243 109
192 3300009551 Ga0105238_10449343 Ga0105238_104493432 109
193 3300009551 Ga0105238_10648251 Ga0105238_106482512 109
194 3300009553 Ga0105249_10015359 Ga0105249_100153593 109
195 3300010375 Ga0105239_10042312 Ga0105239_100423126 109
196 3300010375 Ga0105239_10088162 Ga0105239_100881624 109
197 3300010375 Ga0105239_10221123 Ga0105239_102211232 109
198 3300010375 Ga0105239_10783412 Ga0105239_107834122 109
199 3300013100 Ga0157373_10006948 Ga0157373_100069489 109
200 3300013100 Ga0157373_10036993 Ga0157373_100369934 109
201 3300013102 Ga0157371_10020814 Ga0157371_100208145 109
202 3300013102 Ga0157371_10042811 Ga0157371_100428114 109
203 3300013104 Ga0157370_10009209 Ga0157370_1000920911 109
204 3300013104 Ga0157370_10655340 Ga0157370_106553402 109
205 3300013104 Ga0157370_11695722 Ga0157370_116957221 109
206 3300013105 Ga0157369_10001537 Ga0157369_100015377 109
207 3300013105 Ga0157369_10031401 Ga0157369_100314016 109
208 3300013105 Ga0157369_11311365 Ga0157369_113113651 109
209 3300013105 Ga0157369_12651676 Ga0157369_126516761 109
210 3300013296 Ga0157374_10000090 Ga0157374_1000009038 109
211 3300013296 Ga0157374_10000483 Ga0157374_1000048327 109
212 3300013296 Ga0157374_10002984 Ga0157374_100029848 109
213 3300013296 Ga0157374_10019060 Ga0157374_100190608 109
214 3300013296 Ga0157374_10397741 Ga0157374_103977412 109
215 3300013297 Ga0157378_10000331 Ga0157378_1000033133 109
216 3300013297 Ga0157378_10005420 Ga0157378_100054209 109
217 3300013297 Ga0157378_10039250 Ga0157378_100392504 109
218 3300013306 Ga0163162_10013974 Ga0163162_100139747 109
219 3300013306 Ga0163162_10024935 Ga0163162_100249356 109
220 3300013306 Ga0163162_10761444 Ga0163162_107614442 109
221 3300013307 Ga0157372_10000100 Ga0157372_1000010077 109
222 3300013307 Ga0157372_10009031 Ga0157372_100090315 109
223 3300013307 Ga0157372_10424099 Ga0157372_104240992 109
224 3300013307 Ga0157372_11411127 Ga0157372_114111272 109
225 3300013307 Ga0157372_11528981 Ga0157372_115289811 109
226 3300013308 Ga0157375_10127795 Ga0157375_101277952 109
227 3300014325 Ga0163163_10048270 Ga0163163_100482704 109
228 3300014325 Ga0163163_10314893 Ga0163163_103148932 109
229 3300014497 Ga0182008_10002356 Ga0182008_1000235611 109
230 3300014968 Ga0157379_10006291 Ga0157379_100062916 109
231 3300014969 Ga0157376_10135808 Ga0157376_101358083 109
232 3300014969 Ga0157376_10346075 Ga0157376_103460752 109
233 3300015261 Ga0182006_1023091 Ga0182006_10230914 109
234 3300015262 Ga0182007_10004823 Ga0182007_100048235 109
235 3300020080 Ga0206350_10233586 Ga0206350_102335863 109
236 3300022467 Ga0224712_10295021 Ga0224712_102950211 109
237 3300024225 Ga0224572_1044419 Ga0224572_10444192 109
238 3300025315 Ga0207697_10161545 Ga0207697_101615452 109
239 3300025899 Ga0207642_10008335 Ga0207642_100083352 109
240 3300025899 Ga0207642_11153481 Ga0207642_111534811 109
241 3300025903 Ga0207680_10082240 Ga0207680_100822402 109
242 3300025904 Ga0207647_10460846 Ga0207647_104608462 109
243 3300025907 Ga0207645_10018414 Ga0207645_100184143 109
244 3300025909 Ga0207705_10545501 Ga0207705_105455012 109
245 3300025910 Ga0207684_10003578 Ga0207684_100035783 109
246 3300025911 Ga0207654_10004318 Ga0207654_100043186 109
247 3300025911 Ga0207654_10073471 Ga0207654_100734712 109
248 3300025912 Ga0207707_10006534 Ga0207707_100065344 109
249 3300025912 Ga0207707_10038395 Ga0207707_100383952 109
250 3300025912 Ga0207707_10083377 Ga0207707_100833772 109
251 3300025912 Ga0207707_10113218 Ga0207707_101132184 109
252 3300025912 Ga0207707_10127015 Ga0207707_101270151 109
253 3300025913 Ga0207695_10053615 Ga0207695_100536151 109
254 3300025913 Ga0207695_10329497 Ga0207695_103294972 109
255 3300025913 Ga0207695_10372364 Ga0207695_103723642 109
256 3300025913 Ga0207695_10537123 Ga0207695_105371232 109
257 3300025914 Ga0207671_10009137 Ga0207671_100091378 109
258 3300025914 Ga0207671_10052117 Ga0207671_100521175 109
259 3300025914 Ga0207671_10104037 Ga0207671_101040373 109
260 3300025917 Ga0207660_10055524 Ga0207660_100555242 109
261 3300025917 Ga0207660_10068043 Ga0207660_100680433 109
262 3300025918 Ga0207662_10355510 Ga0207662_103555101 109
263 3300025919 Ga0207657_10000246 Ga0207657_1000024631 109
264 3300025919 Ga0207657_10001266 Ga0207657_100012666 109
265 3300025920 Ga0207649_10035420 Ga0207649_100354203 109
266 3300025921 Ga0207652_10137235 Ga0207652_101372352 109
267 3300025921 Ga0207652_10265697 Ga0207652_102656972 109
268 3300025922 Ga0207646_10125198 Ga0207646_101251982 109
269 3300025924 Ga0207694_10002864 Ga0207694_100028647 109
270 3300025924 Ga0207694_10005754 Ga0207694_100057543 109
271 3300025924 Ga0207694_10014163 Ga0207694_100141632 109
272 3300025924 Ga0207694_10045721 Ga0207694_100457213 109
273 3300025924 Ga0207694_10555289 Ga0207694_105552892 109
274 3300025925 Ga0207650_11082910 Ga0207650_110829101 109
275 3300025927 Ga0207687_10002307 Ga0207687_100023072 109
276 3300025927 Ga0207687_10329020 Ga0207687_103290201 109
277 3300025928 Ga0207700_10118884 Ga0207700_101188842 109
278 3300025928 Ga0207700_11349304 Ga0207700_113493041 109
279 3300025929 Ga0207664_10172385 Ga0207664_101723852 109
280 3300025929 Ga0207664_10409035 Ga0207664_104090352 109
281 3300025932 Ga0207690_10022450 Ga0207690_100224504 109
282 3300025932 Ga0207690_10169754 Ga0207690_101697542 109
283 3300025932 Ga0207690_11575827 Ga0207690_115758271 109
284 3300025933 Ga0207706_10000139 Ga0207706_1000013934 109
285 3300025933 Ga0207706_10084476 Ga0207706_100844763 109
286 3300025934 Ga0207686_10055788 Ga0207686_100557882 109
287 3300025936 Ga0207670_10593248 Ga0207670_105932482 109
288 3300025937 Ga0207669_11121922 Ga0207669_111219221 109
289 3300025938 Ga0207704_10027609 Ga0207704_100276093 109
290 3300025938 Ga0207704_10291971 Ga0207704_102919712 109
291 3300025939 Ga0207665_10099049 Ga0207665_100990492 109
292 3300025941 Ga0207711_10018665 Ga0207711_100186651 109
293 3300025941 Ga0207711_10108962 Ga0207711_101089622 109
294 3300025942 Ga0207689_10773812 Ga0207689_107738122 109
295 3300025944 Ga0207661_10019113 Ga0207661_100191135 109
296 3300025944 Ga0207661_10070730 Ga0207661_100707304 109
297 3300025945 Ga0207679_10091753 Ga0207679_100917532 109
298 3300025945 Ga0207679_10202751 Ga0207679_102027513 109
299 3300025949 Ga0207667_10000170 Ga0207667_1000017011 109
300 3300025949 Ga0207667_10004029 Ga0207667_100040298 109
301 3300025949 Ga0207667_10007225 Ga0207667_1000722511 109
302 3300025949 Ga0207667_10128304 Ga0207667_101283044 109
303 3300025949 Ga0207667_10909583 Ga0207667_109095831 109
304 3300025960 Ga0207651_10223679 Ga0207651_102236792 109
305 3300025961 Ga0207712_10013954 Ga0207712_100139546 109
306 3300025972 Ga0207668_10052744 Ga0207668_100527443 109
307 3300025972 Ga0207668_10818059 Ga0207668_108180591 109
308 3300025981 Ga0207640_10022601 Ga0207640_100226014 109
309 3300025981 Ga0207640_10067491 Ga0207640_100674912 109
310 3300025981 Ga0207640_10115583 Ga0207640_101155832 109
311 3300025986 Ga0207658_11442689 Ga0207658_114426891 109
312 3300026023 Ga0207677_10007606 Ga0207677_100076063 109
313 3300026023 Ga0207677_10011702 Ga0207677_100117025 109
314 3300026023 Ga0207677_10081360 Ga0207677_100813603 109
315 3300026035 Ga0207703_10087059 Ga0207703_100870592 109
316 3300026035 Ga0207703_10095986 Ga0207703_100959863 109
317 3300026035 Ga0207703_10115619 Ga0207703_101156192 109
318 3300026041 Ga0207639_10002287 Ga0207639_100022878 109
319 3300026041 Ga0207639_10056072 Ga0207639_100560723 109
320 3300026041 Ga0207639_10421191 Ga0207639_104211911 109
321 3300026067 Ga0207678_10001833 Ga0207678_100018333 109
322 3300026078 Ga0207702_10001597 Ga0207702_1000159715 109
323 3300026078 Ga0207702_10005883 Ga0207702_100058832 109
324 3300026088 Ga0207641_10009428 Ga0207641_100094288 109
325 3300026088 Ga0207641_10314118 Ga0207641_103141182 109
326 3300026089 Ga0207648_10003612 Ga0207648_1000361213 109
327 3300026089 Ga0207648_10181375 Ga0207648_101813752 109
328 3300026095 Ga0207676_10021492 Ga0207676_100214924 109
329 3300026116 Ga0207674_10009505 Ga0207674_1000950512 109
330 3300026116 Ga0207674_10012344 Ga0207674_100123447 109
331 3300026116 Ga0207674_10510987 Ga0207674_105109871 109
332 3300026118 Ga0207675_100209346 Ga0207675_1002093461 109
333 3300026121 Ga0207683_10139318 Ga0207683_101393183 109
334 3300026142 Ga0207698_10034814 Ga0207698_100348144 109
335 3300026142 Ga0207698_10073362 Ga0207698_100733623 109
336 3300026142 Ga0207698_10366752 Ga0207698_103667522 109
337 3300026142 Ga0207698_10376022 Ga0207698_103760222 109
338 3300028379 Ga0268266_10061763 Ga0268266_100617634 109
339 3300028379 Ga0268266_10278856 Ga0268266_102788562 109
340 3300028381 Ga0268264_10103205 Ga0268264_101032052 109
341 3300028381 Ga0268264_10507744 Ga0268264_105077442 109
342 3300031090 Ga0265760_10033288 Ga0265760_100332882 109
343 3300035088 Ga0373940_0323771 Ga0373940_0323771_171_503 109
344 3300035112 Ga0373932_0187903 Ga0373932_0187903_297_635 109
345 3300035241 Ga0373961_0273698 Ga0373961_0273698_112_444 109
346 3300035691 Ga0373931_0068842 Ga0373931_0068842_828_1160 109
347 3300035691 Ga0373931_0164848 Ga0373931_0164848_787_1125 109
348 3300037068 Ga0373925_0087337 Ga0373925_0087337_10_342 109
349 3300039450 Ga0436363_0942494 Ga0436363_0942494_109_447 109
350 3300045051 Ga0451576_1282436 Ga0451576_1282436_131_469 109
351 3300046533 Ga0495640_0361501 Ga0495640_0361501_113_445 109
352 3300046684 Ga0495669_0463321 Ga0495669_0463321_235_567 109
353 3300048904 Ga0496101_0069100 Ga0496101_0069100_802_1131 109
354 3300048905 Ga0496102_0034176 Ga0496102_0034176_15_353 109
355 3300048905 Ga0496102_0084755 Ga0496102_0084755_2565_2897 109
356 3300048906 Ga0496103_0087374 Ga0496103_0087374_241_573 109
357 3300048907 Ga0496104_0043663 Ga0496104_0043663_742_1071 109
358 3300048907 Ga0496104_0622441 Ga0496104_0622441_100_438 109
359 3300048908 Ga0496105_0223019 Ga0496105_0223019_571_909 109
360 3300048908 Ga0496105_0396745 Ga0496105_0396745_252_584 109
361 3300048909 Ga0496106_0844584 Ga0496106_0844584_136_468 109
362 3300048910 Ga0496107_0047707 Ga0496107_0047707_50_382 109
363 3300048910 Ga0496107_0790807 Ga0496107_0790807_308_646 109
364 3300048912 Ga0496109_1163704 Ga0496109_1163704_71_403 109
365 3300048913 Ga0496110_0110860 Ga0496110_0110860_1546_1878 109
366 3300048915 Ga0496112_0001276 Ga0496112_0001276_8317_8655 109
367 3300048915 Ga0496112_0044733 Ga0496112_0044733_2362_2691 109
368 3300048915 Ga0496112_0072790 Ga0496112_0072790_484_816 109
369 3300048915 Ga0496112_0207500 Ga0496112_0207500_1029_1358 109
370 3300048915 Ga0496112_0277531 Ga0496112_0277531_1161_1499 109
371 3300048916 Ga0496113_0111874 Ga0496113_0111874_1530_1859 109
372 3300048916 Ga0496113_0151138 Ga0496113_0151138_93_425 109
373 3300048916 Ga0496113_0267616 Ga0496113_0267616_588_926 109
374 3300048918 Ga0496115_0446328 Ga0496115_0446328_253_591 109
375 3300049589 Ga0501073_0258869 Ga0501073_0258869_235_564 109
376 3300050512 nmdc:mga0n895_634_c1 nmdc:mga0n895_634_c1_12894_13223 109
377 3300050513 nmdc:mga0rr50_711970_c1 nmdc:mga0rr50_711970_c1_337_666 109
378 3300050514 nmdc:mga08x19_168254_c1 nmdc:mga08x19_168254_c1_115_453 109
379 3300050515 nmdc:mga0a205_117991_c1 nmdc:mga0a205_117991_c1_1032_1361 109
380 3300059493 Ga0587077_191670 Ga0587077_191670_172_501 109
381 3300005293 Ga0065715_10408013 Ga0065715_104080132 110
382 3300005434 Ga0070709_10052109 Ga0070709_100521092 110
383 3300005434 Ga0070709_10064095 Ga0070709_100640952 110
384 3300005434 Ga0070709_10181912 Ga0070709_101819122 110
385 3300005434 Ga0070709_10205448 Ga0070709_102054482 110
386 3300005436 Ga0070713_100054319 Ga0070713_1000543193 110
387 3300005437 Ga0070710_10273287 Ga0070710_102732872 110
388 3300005439 Ga0070711_100351526 Ga0070711_1003515262 110
389 3300005439 Ga0070711_101634368 Ga0070711_1016343681 110
390 3300005455 Ga0070663_100926013 Ga0070663_1009260132 110
391 3300005468 Ga0070707_101935803 Ga0070707_1019358031 110
392 3300005545 Ga0070695_100664145 Ga0070695_1006641451 110
393 3300005614 Ga0068856_102231514 Ga0068856_1022315141 110
394 3300005841 Ga0068863_100312589 Ga0068863_1003125893 110
395 3300005842 Ga0068858_100964442 Ga0068858_1009644421 110
396 3300006028 Ga0070717_10020671 Ga0070717_100206714 110
397 3300006163 Ga0070715_10102355 Ga0070715_101023553 110
398 3300006173 Ga0070716_100060568 Ga0070716_1000605682 110
399 3300006173 Ga0070716_100074962 Ga0070716_1000749622 110
400 3300006173 Ga0070716_100290664 Ga0070716_1002906642 110
401 3300006175 Ga0070712_100005444 Ga0070712_1000054442 110
402 3300006237 Ga0097621_100065896 Ga0097621_1000658962 110
403 3300006358 Ga0068871_100052698 Ga0068871_1000526984 110
404 3300006358 Ga0068871_100523629 Ga0068871_1005236292 110
405 3300006844 Ga0075428_101157756 Ga0075428_1011577562 110
406 3300006852 Ga0075433_10530540 Ga0075433_105305401 110
407 3300006852 Ga0075433_10997861 Ga0075433_109978612 110
408 3300006871 Ga0075434_100005505 Ga0075434_10000550511 110
409 3300006871 Ga0075434_100837917 Ga0075434_1008379172 110
410 3300006914 Ga0075436_100045890 Ga0075436_1000458903 110
411 3300009093 Ga0105240_10075293 Ga0105240_100752935 110
412 3300009174 Ga0105241_10022680 Ga0105241_100226802 110
413 3300009174 Ga0105241_10209176 Ga0105241_102091762 110
414 3300009177 Ga0105248_11201884 Ga0105248_112018841 110
415 3300009551 Ga0105238_10174097 Ga0105238_101740972 110
416 3300010375 Ga0105239_10943677 Ga0105239_109436772 110
417 3300013296 Ga0157374_10030042 Ga0157374_100300425 110
418 3300013296 Ga0157374_12246288 Ga0157374_122462881 110
419 3300013297 Ga0157378_10044277 Ga0157378_100442776 110
420 3300013297 Ga0157378_10413535 Ga0157378_104135352 110
421 3300013306 Ga0163162_10716344 Ga0163162_107163442 110
422 3300014325 Ga0163163_11227269 Ga0163163_112272691 110
423 3300014968 Ga0157379_10665666 Ga0157379_106656661 110
424 3300014969 Ga0157376_10178373 Ga0157376_101783732 110
425 3300024227 Ga0228598_1001121 Ga0228598_10011216 110
426 3300025898 Ga0207692_10286658 Ga0207692_102866582 110
427 3300025905 Ga0207685_10403643 Ga0207685_104036432 110
428 3300025906 Ga0207699_10052304 Ga0207699_100523042 110
429 3300025906 Ga0207699_10139708 Ga0207699_101397083 110
430 3300025906 Ga0207699_10201970 Ga0207699_102019702 110
431 3300025906 Ga0207699_10321803 Ga0207699_103218032 110
432 3300025911 Ga0207654_10172651 Ga0207654_101726512 110
433 3300025911 Ga0207654_10179057 Ga0207654_101790571 110
434 3300025915 Ga0207693_10044528 Ga0207693_100445284 110
435 3300025916 Ga0207663_10406697 Ga0207663_104066972 110
436 3300025916 Ga0207663_10988548 Ga0207663_109885482 110
437 3300025924 Ga0207694_10355243 Ga0207694_103552432 110
438 3300025928 Ga0207700_10004609 Ga0207700_100046097 110
439 3300025928 Ga0207700_11250885 Ga0207700_112508852 110
440 3300025929 Ga0207664_10748508 Ga0207664_107485082 110
441 3300025939 Ga0207665_10074253 Ga0207665_100742532 110
442 3300025939 Ga0207665_10082116 Ga0207665_100821162 110
443 3300025939 Ga0207665_10112571 Ga0207665_101125712 110
444 3300025939 Ga0207665_10498451 Ga0207665_104984511 110
445 3300025941 Ga0207711_11879466 Ga0207711_118794661 110
446 3300026078 Ga0207702_10464806 Ga0207702_104648062 110
447 3300026078 Ga0207702_10578668 Ga0207702_105786681 110
448 3300026078 Ga0207702_11808931 Ga0207702_118089312 110
449 3300026078 Ga0207702_11990640 Ga0207702_119906401 110
450 3300028016 Ga0265354_1003475 Ga0265354_10034752 110
451 3300030760 Ga0265762_1000676 Ga0265762_10006763 110
452 3300030878 Ga0265770_1008320 Ga0265770_10083202 110
453 3300030878 Ga0265770_1117410 Ga0265770_11174101 110
454 3300031090 Ga0265760_10000206 Ga0265760_1000020616 110
455 3300031090 Ga0265760_10058278 Ga0265760_100582781 110
456 3300035088 Ga0373940_0186662 Ga0373940_0186662_127_462 110
457 3300035113 Ga0373936_0031150 Ga0373936_0031150_326_661 110
458 3300035116 Ga0373945_0015579 Ga0373945_0015579_99_434 110
459 3300035119 Ga0373956_0068571 Ga0373956_0068571_585_920 110
460 3300035119 Ga0373956_0629148 Ga0373956_0629148_58_393 110
461 3300035171 Ga0373946_0461935 Ga0373946_0461935_65_400 110
462 3300035172 Ga0373955_0551014 Ga0373955_0551014_57_392 110
463 3300035724 Ga0373933_0692894 Ga0373933_0692894_116_451 110
464 3300035725 Ga0373947_0064565 Ga0373947_0064565_353_688 110
465 3300036401 Ga0373937_1618714 Ga0373937_1618714_132_467 110
466 3300037068 Ga0373925_0493020 Ga0373925_0493020_114_449 110
467 3300046462 Ga0495651_0448419 Ga0495651_0448419_366_701 110
468 3300046472 Ga0495580_0702637 Ga0495580_0702637_10_345 110
469 3300046476 Ga0495662_0340690 Ga0495662_0340690_183_518 110
470 3300046477 Ga0495664_0131284 Ga0495664_0131284_238_573 110
471 3300046516 Ga0495628_0757193 Ga0495628_0757193_151_486 110
472 3300046517 Ga0495630_0084986 Ga0495630_0084986_1539_1874 110
473 3300046529 Ga0495652_0517785 Ga0495652_0517785_15_350 110
474 3300046533 Ga0495640_0411852 Ga0495640_0411852_156_491 110
475 3300046543 Ga0495645_0296977 Ga0495645_0296977_691_1026 110
476 3300046559 Ga0495667_0330784 Ga0495667_0330784_302_637 110
477 3300046679 Ga0495623_0535569 Ga0495623_0535569_204_539 110
478 3300046794 Ga0495589_0496529 Ga0495589_0496529_91_426 110
479 3300047317 Ga0495604_0797291 Ga0495604_0797291_124_459 110
480 3300047319 Ga0495674_0009662 Ga0495674_0009662_5888_6223 110
481 3300048088 Ga0495602_0188241 Ga0495602_0188241_337_672 110
482 3300048903 Ga0496100_0031661 Ga0496100_0031661_253_642 110
483 3300048904 Ga0496101_0003461 Ga0496101_0003461_2748_3137 110
484 3300048904 Ga0496101_0766498 Ga0496101_0766498_123_458 110
485 3300048905 Ga0496102_0000537 Ga0496102_0000537_10622_11011 110
486 3300048906 Ga0496103_0029061 Ga0496103_0029061_1586_1921 110
487 3300048907 Ga0496104_0043291 Ga0496104_0043291_3608_3943 110
488 3300048907 Ga0496104_0097111 Ga0496104_0097111_2372_2713 110
489 3300048907 Ga0496104_0193678 Ga0496104_0193678_346_735 110
490 3300048909 Ga0496106_0060516 Ga0496106_0060516_2439_2828 110
491 3300048910 Ga0496107_0581475 Ga0496107_0581475_224_613 110
492 3300048912 Ga0496109_1361679 Ga0496109_1361679_46_381 110
493 3300048915 Ga0496112_0409378 Ga0496112_0409378_904_1239 110
494 3300048917 Ga0496114_0041204 Ga0496114_0041204_3035_3370 110
495 3300048918 Ga0496115_0016349 Ga0496115_0016349_670_1059 110
496 3300050512 nmdc:mga0n895_34675_c1 nmdc:mga0n895_34675_c1_3907_4239 110
497 3300050514 nmdc:mga08x19_12628_c1 nmdc:mga08x19_12628_c1_2203_2535 110
498 3300050515 nmdc:mga0a205_493545_c1 nmdc:mga0a205_493545_c1_527_859 110
499 3300050515 nmdc:mga0a205_905760_c1 nmdc:mga0a205_905760_c1_123_458 110
500 3300053077 Ga0495601_0060993 Ga0495601_0060993_829_1164 110
501 3300053078 Ga0495612_0521841 Ga0495612_0521841_97_432 110
502 3300053085 Ga0495619_0358892 Ga0495619_0358892_402_737 110
503 2162886012 MBSR1b_contig_9582295 MBSR1b_0037.00004250 111
504 3300001976 JGI24752J21851_1000331 JGI24752J21851_10003313 111
505 3300001978 JGI24747J21853_1049202 JGI24747J21853_10492022 111
506 3300001990 JGI24737J22298_10028557 JGI24737J22298_100285571 111
507 3300001991 JGI24743J22301_10000093 JGI24743J22301_100000937 111
508 3300002073 JGI24745J21846_1013893 JGI24745J21846_10138932 111
509 3300002074 JGI24748J21848_1009443 JGI24748J21848_10094431 111
510 3300002075 JGI24738J21930_10157838 JGI24738J21930_101578382 111
511 3300002155 JGI24033J26618_1004020 JGI24033J26618_10040202 111
512 3300002239 JGI24034J26672_10000810 JGI24034J26672_100008106 111
513 3300002459 JGI24751J29686_10000635 JGI24751J29686_100006356 111
514 3300005290 Ga0065712_10169285 Ga0065712_101692853 111
515 3300005293 Ga0065715_10002672 Ga0065715_100026723 111
516 3300005327 Ga0070658_10091494 Ga0070658_100914944 111
517 3300005328 Ga0070676_10005283 Ga0070676_100052833 111
518 3300005329 Ga0070683_100001910 Ga0070683_10000191010 111
519 3300005330 Ga0070690_100003363 Ga0070690_1000033639 111
520 3300005331 Ga0070670_100001939 Ga0070670_10000193911 111
521 3300005333 Ga0070677_10003715 Ga0070677_100037152 111
522 3300005334 Ga0068869_100052848 Ga0068869_1000528484 111
523 3300005335 Ga0070666_10008180 Ga0070666_100081807 111
524 3300005337 Ga0070682_100003286 Ga0070682_1000032868 111
525 3300005338 Ga0068868_100037793 Ga0068868_1000377935 111
526 3300005339 Ga0070660_100061610 Ga0070660_1000616104 111
527 3300005340 Ga0070689_100001082 Ga0070689_10000108211 111
528 3300005344 Ga0070661_100009221 Ga0070661_1000092215 111
529 3300005347 Ga0070668_100635676 Ga0070668_1006356762 111
530 3300005353 Ga0070669_100001365 Ga0070669_10000136518 111
531 3300005354 Ga0070675_100219209 Ga0070675_1002192093 111
532 3300005355 Ga0070671_100106068 Ga0070671_1001060683 111
533 3300005356 Ga0070674_100158283 Ga0070674_1001582833 111
534 3300005364 Ga0070673_100009008 Ga0070673_1000090083 111
535 3300005365 Ga0070688_100000289 Ga0070688_10000028911 111
536 3300005366 Ga0070659_100002441 Ga0070659_1000024419 111
537 3300005367 Ga0070667_100144235 Ga0070667_1001442353 111
538 3300005434 Ga0070709_10395508 Ga0070709_103955081 111
539 3300005435 Ga0070714_100025598 Ga0070714_1000255984 111
540 3300005436 Ga0070713_100019826 Ga0070713_1000198264 111
541 3300005437 Ga0070710_10008104 Ga0070710_100081042 111
542 3300005439 Ga0070711_100307198 Ga0070711_1003071982 111
543 3300005441 Ga0070700_100196077 Ga0070700_1001960772 111
544 3300005444 Ga0070694_100354565 Ga0070694_1003545652 111
545 3300005455 Ga0070663_100010379 Ga0070663_1000103793 111
546 3300005456 Ga0070678_100002783 Ga0070678_1000027837 111
547 3300005457 Ga0070662_100004251 Ga0070662_1000042512 111
548 3300005459 Ga0068867_100000749 Ga0068867_10000074920 111
549 3300005466 Ga0070685_10001601 Ga0070685_100016017 111
550 3300005535 Ga0070684_100001382 Ga0070684_10000138211 111
551 3300005539 Ga0068853_100028987 Ga0068853_1000289876 111
552 3300005543 Ga0070672_100002640 Ga0070672_1000026408 111
553 3300005544 Ga0070686_100009767 Ga0070686_1000097677 111
554 3300005545 Ga0070695_100240649 Ga0070695_1002406492 111
555 3300005546 Ga0070696_100208070 Ga0070696_1002080702 111
556 3300005548 Ga0070665_100610923 Ga0070665_1006109233 111
557 3300005549 Ga0070704_101460233 Ga0070704_1014602331 111
558 3300005563 Ga0068855_100426688 Ga0068855_1004266882 111
559 3300005564 Ga0070664_100006830 Ga0070664_1000068306 111
560 3300005577 Ga0068857_100002750 Ga0068857_1000027508 111
561 3300005578 Ga0068854_100103379 Ga0068854_1001033793 111
562 3300005614 Ga0068856_100018327 Ga0068856_1000183276 111
563 3300005614 Ga0068856_100547126 Ga0068856_1005471262 111
564 3300005615 Ga0070702_100006493 Ga0070702_1000064934 111
565 3300005616 Ga0068852_100005202 Ga0068852_1000052026 111
566 3300005617 Ga0068859_100032315 Ga0068859_1000323157 111
567 3300005618 Ga0068864_100003567 Ga0068864_1000035677 111
568 3300005718 Ga0068866_10001464 Ga0068866_100014644 111
569 3300005719 Ga0068861_100002752 Ga0068861_1000027527 111
570 3300005834 Ga0068851_10002205 Ga0068851_100022059 111
571 3300005840 Ga0068870_10000606 Ga0068870_1000060615 111
572 3300005841 Ga0068863_100010061 Ga0068863_1000100617 111
573 3300005842 Ga0068858_100062982 Ga0068858_1000629822 111
574 3300005843 Ga0068860_100047365 Ga0068860_1000473655 111
575 3300005844 Ga0068862_100056995 Ga0068862_1000569952 111
576 3300006163 Ga0070715_10010457 Ga0070715_100104571 111
577 3300006163 Ga0070715_10016825 Ga0070715_100168254 111
578 3300006173 Ga0070716_100026082 Ga0070716_1000260823 111
579 3300006173 Ga0070716_100058390 Ga0070716_1000583903 111
580 3300006173 Ga0070716_100109284 Ga0070716_1001092842 111
581 3300006175 Ga0070712_100000566 Ga0070712_10000056614 111
582 3300006175 Ga0070712_100039310 Ga0070712_1000393104 111
583 3300006237 Ga0097621_100083411 Ga0097621_1000834112 111
584 3300006358 Ga0068871_100568285 Ga0068871_1005682852 111
585 3300006871 Ga0075434_100541282 Ga0075434_1005412822 111
586 3300006881 Ga0068865_100011689 Ga0068865_1000116897 111
587 3300006914 Ga0075436_101383047 Ga0075436_1013830471 111
588 3300006931 Ga0097620_100032313 Ga0097620_1000323131 111
589 3300009093 Ga0105240_10731093 Ga0105240_107310931 111
590 3300009098 Ga0105245_10002797 Ga0105245_100027977 111
591 3300009101 Ga0105247_10001769 Ga0105247_1000176910 111
592 3300009148 Ga0105243_10321931 Ga0105243_103219313 111
593 3300009174 Ga0105241_10008758 Ga0105241_100087587 111
594 3300009176 Ga0105242_10005432 Ga0105242_100054327 111
595 3300009177 Ga0105248_10029186 Ga0105248_100291867 111
596 3300009545 Ga0105237_10061368 Ga0105237_100613685 111
597 3300009553 Ga0105249_10232384 Ga0105249_102323843 111
598 3300010375 Ga0105239_10004431 Ga0105239_1000443116 111
599 3300011119 Ga0105246_10002416 Ga0105246_1000241610 111
600 3300013100 Ga0157373_10006047 Ga0157373_100060472 111
601 3300013102 Ga0157371_10006502 Ga0157371_100065023 111
602 3300013104 Ga0157370_11643626 Ga0157370_116436262 111
603 3300013105 Ga0157369_10036757 Ga0157369_100367573 111
604 3300013296 Ga0157374_10415739 Ga0157374_104157392 111
605 3300013297 Ga0157378_12415544 Ga0157378_124155442 111
606 3300013306 Ga0163162_10088799 Ga0163162_100887994 111
607 3300013307 Ga0157372_10021173 Ga0157372_100211738 111
608 3300013308 Ga0157375_10003505 Ga0157375_1000350510 111
609 3300014325 Ga0163163_10000958 Ga0163163_1000095810 111
610 3300014326 Ga0157380_10025039 Ga0157380_100250395 111
611 3300014745 Ga0157377_10000467 Ga0157377_1000046711 111
612 3300014968 Ga0157379_10030890 Ga0157379_100308903 111
613 3300014969 Ga0157376_10006340 Ga0157376_100063406 111
614 3300017792 Ga0163161_10038216 Ga0163161_100382164 111
615 3300025315 Ga0207697_10002916 Ga0207697_100029165 111
616 3300025321 Ga0207656_10051754 Ga0207656_100517543 111
617 3300025711 Ga0207696_1086358 Ga0207696_10863581 111
618 3300025893 Ga0207682_10003786 Ga0207682_100037864 111
619 3300025898 Ga0207692_10036336 Ga0207692_100363363 111
620 3300025898 Ga0207692_10254732 Ga0207692_102547322 111
621 3300025899 Ga0207642_10092397 Ga0207642_100923971 111
622 3300025900 Ga0207710_10003898 Ga0207710_100038988 111
623 3300025901 Ga0207688_10000372 Ga0207688_1000037214 111
624 3300025903 Ga0207680_10010107 Ga0207680_100101074 111
625 3300025904 Ga0207647_10008793 Ga0207647_100087937 111
626 3300025906 Ga0207699_10002843 Ga0207699_100028435 111
627 3300025906 Ga0207699_10144125 Ga0207699_101441252 111
628 3300025907 Ga0207645_10000051 Ga0207645_1000005135 111
629 3300025908 Ga0207643_10000079 Ga0207643_1000007936 111
630 3300025909 Ga0207705_10030843 Ga0207705_100308433 111
631 3300025911 Ga0207654_10062709 Ga0207654_100627092 111
632 3300025914 Ga0207671_10267374 Ga0207671_102673742 111
633 3300025914 Ga0207671_10561174 Ga0207671_105611742 111
634 3300025915 Ga0207693_10004992 Ga0207693_1000499212 111
635 3300025915 Ga0207693_10005699 Ga0207693_1000569911 111
636 3300025916 Ga0207663_10022475 Ga0207663_100224754 111
637 3300025916 Ga0207663_10461684 Ga0207663_104616842 111
638 3300025919 Ga0207657_10000292 Ga0207657_1000029234 111
639 3300025920 Ga0207649_10000242 Ga0207649_1000024211 111
640 3300025923 Ga0207681_10075318 Ga0207681_100753183 111
641 3300025925 Ga0207650_10000090 Ga0207650_10000090132 111
642 3300025926 Ga0207659_10002035 Ga0207659_100020357 111
643 3300025927 Ga0207687_10013901 Ga0207687_100139013 111
644 3300025928 Ga0207700_10000685 Ga0207700_1000068511 111
645 3300025928 Ga0207700_10330357 Ga0207700_103303572 111
646 3300025929 Ga0207664_10148252 Ga0207664_101482524 111
647 3300025931 Ga0207644_10002582 Ga0207644_100025829 111
648 3300025932 Ga0207690_10003087 Ga0207690_100030877 111
649 3300025933 Ga0207706_10001055 Ga0207706_100010552 111
650 3300025935 Ga0207709_10371488 Ga0207709_103714882 111
651 3300025936 Ga0207670_10001693 Ga0207670_100016935 111
652 3300025938 Ga0207704_10020900 Ga0207704_100209005 111
653 3300025939 Ga0207665_10015670 Ga0207665_100156705 111
654 3300025939 Ga0207665_10091681 Ga0207665_100916813 111
655 3300025939 Ga0207665_10098521 Ga0207665_100985212 111
656 3300025940 Ga0207691_10001343 Ga0207691_1000134314 111
657 3300025941 Ga0207711_10002838 Ga0207711_100028389 111
658 3300025942 Ga0207689_10000304 Ga0207689_1000030421 111
659 3300025944 Ga0207661_10000583 Ga0207661_100005837 111
660 3300025945 Ga0207679_10000184 Ga0207679_1000018458 111
661 3300025949 Ga0207667_10170718 Ga0207667_101707181 111
662 3300025960 Ga0207651_10002456 Ga0207651_100024566 111
663 3300025961 Ga0207712_10079479 Ga0207712_100794793 111
664 3300025972 Ga0207668_10074687 Ga0207668_100746872 111
665 3300025981 Ga0207640_10049454 Ga0207640_100494544 111
666 3300025986 Ga0207658_10001983 Ga0207658_100019836 111
667 3300026023 Ga0207677_10076939 Ga0207677_100769393 111
668 3300026035 Ga0207703_10005260 Ga0207703_100052606 111
669 3300026041 Ga0207639_10016884 Ga0207639_100168846 111
670 3300026067 Ga0207678_10000204 Ga0207678_1000020434 111
671 3300026078 Ga0207702_10048664 Ga0207702_100486643 111
672 3300026078 Ga0207702_10202697 Ga0207702_102026972 111
673 3300026088 Ga0207641_10000894 Ga0207641_1000089421 111
674 3300026089 Ga0207648_10000757 Ga0207648_1000075721 111
675 3300026095 Ga0207676_10000113 Ga0207676_1000011330 111
676 3300026116 Ga0207674_10000076 Ga0207674_1000007667 111
677 3300026118 Ga0207675_100008819 Ga0207675_1000088197 111
678 3300026121 Ga0207683_10001129 Ga0207683_1000112910 111
679 3300026142 Ga0207698_10080537 Ga0207698_100805373 111
680 3300028379 Ga0268266_10005373 Ga0268266_100053737 111
681 3300028380 Ga0268265_10002144 Ga0268265_1000214414 111
682 3300028381 Ga0268264_10017158 Ga0268264_100171582 111
683 3300030760 Ga0265762_1062789 Ga0265762_10627891 111
684 3300035111 Ga0373923_0348710 Ga0373923_0348710_135_485 111
685 3300035111 Ga0373923_0612287 Ga0373923_0612287_20_388 111
686 3300035171 Ga0373946_0704577 Ga0373946_0704577_20_388 111
687 3300035691 Ga0373931_0179118 Ga0373931_0179118_514_849 111
688 3300035692 Ga0373935_0342165 Ga0373935_0342165_635_1003 111
689 3300035695 Ga0373927_0443442 Ga0373927_0443442_356_724 111
690 3300035724 Ga0373933_0111032 Ga0373933_0111032_388_756 111
691 3300035725 Ga0373947_0383275 Ga0373947_0383275_323_691 111
692 3300036401 Ga0373937_0006928 Ga0373937_0006928_8264_8632 111
693 3300046454 Ga0495592_0146182 Ga0495592_0146182_1088_1456 111
694 3300046463 Ga0495653_0178202 Ga0495653_0178202_68_436 111
695 3300046476 Ga0495662_0674788 Ga0495662_0674788_31_399 111
696 3300046477 Ga0495664_0017250 Ga0495664_0017250_2887_3255 111
697 3300046511 Ga0495608_0037373 Ga0495608_0037373_2710_3078 111
698 3300046514 Ga0495618_0203085 Ga0495618_0203085_638_1006 111
699 3300046517 Ga0495630_0121352 Ga0495630_0121352_40_408 111
700 3300046528 Ga0495642_0275056 Ga0495642_0275056_90_425 111
701 3300046536 Ga0495587_0067745 Ga0495587_0067745_1075_1443 111
702 3300046543 Ga0495645_0005114 Ga0495645_0005114_8323_8691 111
703 3300046663 Ga0495635_0139099 Ga0495635_0139099_691_1059 111
704 3300046663 Ga0495635_0512669 Ga0495635_0512669_110_478 111
705 3300046675 Ga0495657_0057793 Ga0495657_0057793_1895_2263 111
706 3300046678 Ga0495599_0023481 Ga0495599_0023481_2396_2764 111
707 3300046679 Ga0495623_0121806 Ga0495623_0121806_19_387 111
708 3300046680 Ga0495646_0029962 Ga0495646_0029962_2481_2849 111
709 3300046684 Ga0495669_0270201 Ga0495669_0270201_379_714 111
710 3300046809 Ga0495600_0224293 Ga0495600_0224293_657_1025 111
711 3300047317 Ga0495604_0047356 Ga0495604_0047356_809_1177 111
712 3300047319 Ga0495674_0628774 Ga0495674_0628774_350_718 111
713 3300047322 Ga0495680_0349915 Ga0495680_0349915_519_887 111
714 3300047471 Ga0495684_0051903 Ga0495684_0051903_2718_3086 111
715 3300047471 Ga0495684_0320770 Ga0495684_0320770_697_1065 111
716 3300048088 Ga0495602_0000360 Ga0495602_0000360_34135_34503 111
717 3300048903 Ga0496100_0744742 Ga0496100_0744742_139_474 111
718 3300048904 Ga0496101_0131212 Ga0496101_0131212_1004_1339 111
719 3300048904 Ga0496101_0403020 Ga0496101_0403020_357_704 111
720 3300048905 Ga0496102_0042175 Ga0496102_0042175_629_964 111
721 3300048906 Ga0496103_0908958 Ga0496103_0908958_181_516 111
722 3300048907 Ga0496104_0870699 Ga0496104_0870699_179_514 111
723 3300048908 Ga0496105_0855422 Ga0496105_0855422_136_471 111
724 3300048909 Ga0496106_0137926 Ga0496106_0137926_1485_1820 111
725 3300048909 Ga0496106_0167565 Ga0496106_0167565_632_991 111
726 3300048910 Ga0496107_0156443 Ga0496107_0156443_1001_1336 111
727 3300048911 Ga0496108_0002118 Ga0496108_0002118_4554_4889 111
728 3300048912 Ga0496109_0000008 Ga0496109_0000008_18613_18948 111
729 3300048913 Ga0496110_0008075 Ga0496110_0008075_7390_7725 111
730 3300048914 Ga0496111_0005563 Ga0496111_0005563_7444_7779 111
731 3300048915 Ga0496112_0000334 Ga0496112_0000334_16510_16845 111
732 3300048916 Ga0496113_0006066 Ga0496113_0006066_31_366 111
733 3300048918 Ga0496115_0629328 Ga0496115_0629328_321_656 111
734 3300050511 nmdc:mga08y16_1200968_c1 nmdc:mga08y16_1200968_c1_94_429 111
735 3300050514 nmdc:mga08x19_1121820_c1 nmdc:mga08x19_1121820_c1_157_495 111
736 3300053077 Ga0495601_0161914 Ga0495601_0161914_1029_1397 111
737 3300053078 Ga0495612_0005112 Ga0495612_0005112_966_1334 111
738 3300053084 Ga0495595_0072005 Ga0495595_0072005_530_898 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

36

126

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9755 33 109
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9459 33 107
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9446 18 110
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9387 33 109
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9314 18 107
ID Description Score Start End Superfamily
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9455 33 107 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9446 18 110 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9413 16 108 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9356 18 110 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9222 16 108 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A554JES3-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9959 23 108 GO:0006729
GO:0008124
AF-A0A2U3L9A9-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9944 19 109 GO:0006729
GO:0008124
AF-A0A2V9LDX8-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9922 1 110 GO:0006729
GO:0008124
AF-A0A7C2TT88-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9921 26 106 GO:0006729
GO:0008124
AF-A0A1E3XEU2-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9887 3 106 GO:0006729
GO:0008124

Feature Viewer

pLDDT pTM Quality
92.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map