F478394

General Info

Members Datasets Scaffolds Average Seq Length
738 255 738 262

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10455080|Ga0207679_104550801
Length 297
Sequence VGVLGEELAQAVESCLPGRAPLLDPALGGAQRLGPHLAGAHPSALLRADEAAGLQHLEELRRRIIYSIIAVGVGFFFCWGYASRIYALMQKPIIDVLHSHNLPEKLVFLSPTEPFNLYLKIGFMSGIFVASPFVLYQLWMFISPGLYRNEKRYVFPFMGSTIILFAAGAVFGYKLVYPQALNFLIEYGVQFQPMITIGEYTDLFLTIILGLGVIFELPILVFFLALMGVVSAGWMWRNLRYSILGIFTIAAIVTPTTDIMNMCLFAAPMIILYVISIAIAWFVHPRQRKARQARKNQ

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
248 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
249 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
250 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.2
Rhizosphere 94.58
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_9212784 2162886011 Unclassified 1242
2 JGI24737J22298_10050251 3300001990 Unclassified 1268
3 JGI24743J22301_10031702 3300001991 Synthetic 1042
4 Ga0065712_10117106 3300005290 Bacteria 1714
5 Ga0065712_10117566 3300005290 Unclassified 1718
6 Ga0065712_10246933 3300005290 Bacteria 969
7 Ga0065712_10272610 3300005290 Bacteria 912
8 Ga0065715_10145026 3300005293 Bacteria 1799
9 Ga0065715_10407363 3300005293 Bacteria 874
10 Ga0070658_10552986 3300005327 Bacteria 996
11 Ga0070676_10170230 3300005328 Unclassified 1408
12 Ga0070683_100000996 3300005329 Bacteria 21213
13 Ga0070683_100073142 3300005329 Unclassified 3201
14 Ga0070683_100100788 3300005329 Unclassified 2719
15 Ga0070683_100200734 3300005329 Unclassified 1894
16 Ga0070690_100130224 3300005330 Bacteria 1698
17 Ga0070690_100178498 3300005330 Unclassified 1466
18 Ga0070670_100010214 3300005331 Bacteria 8011
19 Ga0070670_100022664 3300005331 Bacteria 5404
20 Ga0070670_100186273 3300005331 Unclassified 1802
21 Ga0070670_100217955 3300005331 Bacteria 1660
22 Ga0070677_10022501 3300005333 Bacteria 2323
23 Ga0068869_100006311 3300005334 Bacteria 7506
24 Ga0068869_100401888 3300005334 Bacteria 1127
25 Ga0070666_10034392 3300005335 Unclassified 3358
26 Ga0070680_100023130 3300005336 Unclassified 4954
27 Ga0070680_100076357 3300005336 Bacteria 2758
28 Ga0070682_100002535 3300005337 Bacteria 10083
29 Ga0068868_100003985 3300005338 Bacteria 10312
30 Ga0068868_100006259 3300005338 Bacteria 8418
31 Ga0068868_100282120 3300005338 Bacteria 1406
32 Ga0070660_100006382 3300005339 Bacteria 8171
33 Ga0070660_100032389 3300005339 Bacteria 3933
34 Ga0070660_100043786 3300005339 Unclassified 3421
35 Ga0070660_100421576 3300005339 Bacteria 1105
36 Ga0070689_100000844 3300005340 Bacteria 19045
37 Ga0070689_100028593 3300005340 Bacteria 4215
38 Ga0070689_100320977 3300005340 Bacteria 1293
39 Ga0070687_100002055 3300005343 Bacteria 7398
40 Ga0070687_100331765 3300005343 Bacteria 975
41 Ga0070661_100019010 3300005344 Bacteria 4891
42 Ga0070661_100034867 3300005344 Bacteria 3651
43 Ga0070668_100008093 3300005347 Bacteria 7809
44 Ga0070668_100078168 3300005347 Bacteria 2587
45 Ga0070669_100177950 3300005353 Unclassified 1662
46 Ga0070675_100002781 3300005354 Bacteria 13167
47 Ga0070675_100342055 3300005354 Bacteria 1325
48 Ga0070671_100122780 3300005355 Bacteria 2186
49 Ga0070674_100022355 3300005356 Unclassified 4078
50 Ga0070673_100016252 3300005364 Bacteria 5257
51 Ga0070673_100457923 3300005364 Bacteria 1148
52 Ga0070688_100014009 3300005365 Unclassified 4535
53 Ga0070659_100015849 3300005366 Bacteria 5651
54 Ga0070667_100012738 3300005367 Bacteria 6953
55 Ga0070709_10008666 3300005434 Bacteria 5595
56 Ga0070709_10119965 3300005434 Unclassified 1781
57 Ga0070709_10204510 3300005434 Bacteria 1400
58 Ga0070709_10334746 3300005434 Unclassified 1115
59 Ga0070709_10357201 3300005434 Bacteria 1081
60 Ga0070714_100062248 3300005435 Bacteria 3207
61 Ga0070714_100081406 3300005435 Bacteria 2818
62 Ga0070714_100114506 3300005435 Bacteria 2392
63 Ga0070714_100145420 3300005435 Unclassified 2132
64 Ga0070714_100230099 3300005435 Unclassified 1707
65 Ga0070714_100369035 3300005435 Bacteria 1351
66 Ga0070713_100027201 3300005436 Unclassified 4501
67 Ga0070713_100062242 3300005436 Bacteria 3125
68 Ga0070713_100076581 3300005436 Bacteria 2842
69 Ga0070713_100127102 3300005436 Bacteria 2244
70 Ga0070713_100128753 3300005436 Bacteria 2230
71 Ga0070713_100173917 3300005436 Bacteria 1930
72 Ga0070710_10022575 3300005437 Bacteria 3293
73 Ga0070710_10024862 3300005437 Unclassified 3164
74 Ga0070710_10159208 3300005437 Bacteria 1399
75 Ga0070711_100017703 3300005439 Bacteria 4539
76 Ga0070711_100033693 3300005439 Bacteria 3412
77 Ga0070711_100039331 3300005439 Bacteria 3185
78 Ga0070711_100052965 3300005439 Unclassified 2795
79 Ga0070711_100057485 3300005439 Unclassified 2694
80 Ga0070711_100075664 3300005439 Bacteria 2385
81 Ga0070711_100292029 3300005439 Bacteria 1293
82 Ga0070705_100150946 3300005440 Bacteria 1541
83 Ga0070694_100075969 3300005444 Bacteria 2325
84 Ga0070708_100003146 3300005445 Bacteria 12861
85 Ga0070708_100003966 3300005445 Bacteria 11615
86 Ga0070708_100023212 3300005445 Bacteria 5272
87 Ga0070708_100037006 3300005445 Unclassified 4256
88 Ga0070708_100081114 3300005445 Bacteria 2937
89 Ga0070708_100089157 3300005445 Unclassified 2806
90 Ga0070708_100158945 3300005445 Bacteria 2105
91 Ga0070708_100189306 3300005445 Bacteria 1924
92 Ga0070708_100660189 3300005445 Unclassified 985
93 Ga0070708_100790906 3300005445 Unclassified 892
94 Ga0070663_100016064 3300005455 Bacteria 4849
95 Ga0070663_100020172 3300005455 Unclassified 4409
96 Ga0070678_100003297 3300005456 Bacteria 8975
97 Ga0070678_100022663 3300005456 Bacteria 4167
98 Ga0070662_100002565 3300005457 Bacteria 11188
99 Ga0070662_100068638 3300005457 Unclassified 2607
100 Ga0070662_100100888 3300005457 Bacteria 2184
101 Ga0070681_10000988 3300005458 Bacteria 24052
102 Ga0070681_10011272 3300005458 Bacteria 8842
103 Ga0070681_10012120 3300005458 Bacteria 8551
104 Ga0070681_10206078 3300005458 Bacteria 1883
105 Ga0070681_10224946 3300005458 Bacteria 1791
106 Ga0070681_10283619 3300005458 Bacteria 1567
107 Ga0068867_100016423 3300005459 Bacteria 5255
108 Ga0068867_100201820 3300005459 Bacteria 1592
109 Ga0068867_100232568 3300005459 Bacteria 1491
110 Ga0070685_10001933 3300005466 Bacteria 10758
111 Ga0070685_10093357 3300005466 Bacteria 1825
112 Ga0070706_100000499 3300005467 Bacteria 45986
113 Ga0070706_100017064 3300005467 Bacteria 6707
114 Ga0070706_100022122 3300005467 Bacteria 5854
115 Ga0070706_100109918 3300005467 Bacteria 2565
116 Ga0070706_100116070 3300005467 Bacteria 2493
117 Ga0070707_100037132 3300005468 Unclassified 4649
118 Ga0070707_100184084 3300005468 Bacteria 2037
119 Ga0070707_100209000 3300005468 Unclassified 1902
120 Ga0070707_100251525 3300005468 Bacteria 1720
121 Ga0070698_100013058 3300005471 Bacteria 8794
122 Ga0070698_100223136 3300005471 Bacteria 1818
123 Ga0070699_100001027 3300005518 Bacteria 25921
124 Ga0070699_100007250 3300005518 Bacteria 9648
125 Ga0070699_100096021 3300005518 Bacteria 2596
126 Ga0070699_100183731 3300005518 Bacteria 1856
127 Ga0070699_100387798 3300005518 Bacteria 1262
128 Ga0070699_100489442 3300005518 Bacteria 1117
129 Ga0070679_100014737 3300005530 Bacteria 7512
130 Ga0070679_100172263 3300005530 Bacteria 2137
131 Ga0070679_100464459 3300005530 Unclassified 1210
132 Ga0070684_100001677 3300005535 Bacteria 16089
133 Ga0070684_100014670 3300005535 Bacteria 6355
134 Ga0070684_100015349 3300005535 Bacteria 6236
135 Ga0070684_100037540 3300005535 Unclassified 4157
136 Ga0070684_100106170 3300005535 Bacteria 2514
137 Ga0070697_100000111 3300005536 Bacteria 63543
138 Ga0070697_100000237 3300005536 Bacteria 44549
139 Ga0070697_100001234 3300005536 Bacteria 19331
140 Ga0070697_100022916 3300005536 Bacteria 4965
141 Ga0070697_100025982 3300005536 Unclassified 4672
142 Ga0070697_100279249 3300005536 Bacteria 1433
143 Ga0068853_100005375 3300005539 Bacteria 10029
144 Ga0068853_100014856 3300005539 Bacteria 6394
145 Ga0068853_100018379 3300005539 Bacteria 5785
146 Ga0068853_100157381 3300005539 Bacteria 2048
147 Ga0070672_100128080 3300005543 Bacteria 2084
148 Ga0070695_100015812 3300005545 Unclassified 4559
149 Ga0070696_100141341 3300005546 Bacteria 1760
150 Ga0070693_100008310 3300005547 Bacteria 5109
151 Ga0070693_100113701 3300005547 Unclassified 1669
152 Ga0070665_100008351 3300005548 Bacteria 10476
153 Ga0070665_100124026 3300005548 Bacteria 2585
154 Ga0070665_100815155 3300005548 Bacteria 946
155 Ga0068855_100000440 3300005563 Bacteria 51346
156 Ga0068855_100001467 3300005563 Bacteria 29462
157 Ga0068855_100033223 3300005563 Bacteria 6159
158 Ga0068855_100058930 3300005563 Bacteria 4495
159 Ga0068855_100119682 3300005563 Bacteria 3015
160 Ga0068855_100133493 3300005563 Unclassified 2833
161 Ga0070664_100000079 3300005564 Bacteria 61393
162 Ga0070664_100020262 3300005564 Bacteria 5476
163 Ga0070664_100054375 3300005564 Unclassified 3396
164 Ga0070664_100090314 3300005564 Unclassified 2651
165 Ga0068857_100004770 3300005577 Bacteria 11483
166 Ga0068857_100040124 3300005577 Unclassified 4151
167 Ga0068857_100107688 3300005577 Unclassified 2503
168 Ga0068854_100014008 3300005578 Bacteria 5276
169 Ga0068854_100022674 3300005578 Unclassified 4283
170 Ga0068854_100037953 3300005578 Bacteria 3385
171 Ga0068854_100047532 3300005578 Bacteria 3059
172 Ga0068854_100335242 3300005578 Bacteria 1234
173 Ga0068856_100000314 3300005614 Bacteria 53174
174 Ga0068856_100000884 3300005614 Bacteria 32074
175 Ga0068856_100001689 3300005614 Bacteria 23073
176 Ga0068856_100013950 3300005614 Bacteria 7769
177 Ga0068856_100013970 3300005614 Bacteria 7765
178 Ga0068856_100045755 3300005614 Unclassified 4310
179 Ga0068856_100195303 3300005614 Bacteria 2038
180 Ga0068856_100202881 3300005614 Bacteria 1997
181 Ga0068856_100282874 3300005614 Bacteria 1675
182 Ga0070702_100131113 3300005615 Unclassified 1583
183 Ga0068852_100005106 3300005616 Bacteria 9349
184 Ga0068852_100008868 3300005616 Bacteria 7439
185 Ga0068852_100073044 3300005616 Unclassified 3016
186 Ga0068852_100237967 3300005616 Unclassified 1738
187 Ga0068859_100000743 3300005617 Bacteria 32840
188 Ga0068859_100029696 3300005617 Bacteria 5486
189 Ga0068859_100107366 3300005617 Bacteria 2852
190 Ga0068859_100617244 3300005617 Unclassified 1177
191 Ga0068866_10000598 3300005718 Bacteria 16433
192 Ga0068866_10105674 3300005718 Bacteria 1561
193 Ga0068866_10109412 3300005718 Bacteria 1539
194 Ga0068861_100004952 3300005719 Bacteria 8971
195 Ga0068861_100058819 3300005719 Unclassified 2941
196 Ga0068861_100068073 3300005719 Bacteria 2750
197 Ga0068861_100086440 3300005719 Bacteria 2465
198 Ga0068851_10029758 3300005834 Bacteria 2705
199 Ga0068870_10001859 3300005840 Bacteria 8688
200 Ga0068870_10034485 3300005840 Unclassified 2590
201 Ga0068863_100007633 3300005841 Bacteria 10579
202 Ga0068863_100027936 3300005841 Bacteria 5385
203 Ga0068863_100033173 3300005841 Bacteria 4918
204 Ga0068863_100076640 3300005841 Bacteria 3163
205 Ga0068863_100119501 3300005841 Bacteria 2512
206 Ga0068863_100169603 3300005841 Unclassified 2093
207 Ga0068863_100278670 3300005841 Bacteria 1620
208 Ga0068858_100008051 3300005842 Bacteria 10151
209 Ga0068858_100010361 3300005842 Bacteria 8830
210 Ga0068858_100037929 3300005842 Bacteria 4469
211 Ga0068858_100400035 3300005842 Bacteria 1319
212 Ga0068860_100011415 3300005843 Bacteria 8752
213 Ga0068860_100017651 3300005843 Bacteria 6953
214 Ga0068860_100072721 3300005843 Bacteria 3268
215 Ga0068860_100132368 3300005843 Bacteria 2394
216 Ga0068862_100039922 3300005844 Bacteria 3988
217 Ga0068862_100040805 3300005844 Unclassified 3946
218 Ga0068862_100048021 3300005844 Unclassified 3644
219 Ga0070717_10001917 3300006028 Bacteria 14536
220 Ga0070717_10003179 3300006028 Bacteria 11734
221 Ga0070717_10005046 3300006028 Bacteria 9617
222 Ga0070717_10009320 3300006028 Bacteria 7377
223 Ga0070717_10014384 3300006028 Bacteria 6087
224 Ga0070717_10037304 3300006028 Unclassified 3946
225 Ga0070717_10198906 3300006028 Unclassified 1754
226 Ga0070717_10223765 3300006028 Bacteria 1655
227 Ga0070717_10278980 3300006028 Unclassified 1482
228 Ga0070717_10290734 3300006028 Bacteria 1451
229 Ga0070717_10326139 3300006028 Unclassified 1369
230 Ga0070717_10506851 3300006028 Bacteria 1091
231 Ga0070716_100000963 3300006173 Bacteria 12483
232 Ga0070716_100009156 3300006173 Bacteria 4928
233 Ga0070716_100017261 3300006173 Bacteria 3738
234 Ga0070716_100037014 3300006173 Unclassified 2694
235 Ga0070716_100037319 3300006173 Bacteria 2685
236 Ga0070716_100059096 3300006173 Unclassified 2209
237 Ga0070712_100001489 3300006175 Bacteria 14297
238 Ga0070712_100004426 3300006175 Bacteria 8668
239 Ga0070712_100028835 3300006175 Bacteria 3716
240 Ga0070712_100319851 3300006175 Unclassified 1261
241 Ga0070712_100394155 3300006175 Unclassified 1142
242 Ga0097621_100000088 3300006237 Bacteria 49698
243 Ga0097621_100000731 3300006237 Bacteria 22963
244 Ga0097621_100001934 3300006237 Bacteria 14133
245 Ga0097621_100009212 3300006237 Bacteria 7159
246 Ga0097621_100032470 3300006237 Unclassified 4150
247 Ga0097621_100083976 3300006237 Bacteria 2654
248 Ga0097621_100576711 3300006237 Unclassified 1026
249 Ga0097621_100666514 3300006237 Bacteria 956
250 Ga0068871_100000266 3300006358 Bacteria 35937
251 Ga0068871_100000428 3300006358 Bacteria 29019
252 Ga0068871_100008870 3300006358 Bacteria 7249
253 Ga0068871_100017378 3300006358 Bacteria 5441
254 Ga0068871_100026158 3300006358 Unclassified 4551
255 Ga0068871_100076855 3300006358 Bacteria 2758
256 Ga0068871_100535561 3300006358 Bacteria 1059
257 Ga0068871_100537222 3300006358 Unclassified 1057
258 Ga0075433_10000048 3300006852 Bacteria 50702
259 Ga0075433_10003910 3300006852 Bacteria 11533
260 Ga0075434_100007179 3300006871 Bacteria 10301
261 Ga0075434_100034614 3300006871 Bacteria 4989
262 Ga0075434_100065078 3300006871 Unclassified 3631
263 Ga0075434_100138002 3300006871 Bacteria 2458
264 Ga0075434_100175929 3300006871 Bacteria 2160
265 Ga0075434_100273872 3300006871 Bacteria 1707
266 Ga0068865_100007069 3300006881 Bacteria 6892
267 Ga0068865_100046813 3300006881 Unclassified 2969
268 Ga0068865_100085305 3300006881 Bacteria 2278
269 Ga0075436_100003918 3300006914 Bacteria 10201
270 Ga0075436_100006016 3300006914 Bacteria 8330
271 Ga0075436_100024846 3300006914 Bacteria 4120
272 Ga0075436_100032947 3300006914 Unclassified 3570
273 Ga0097620_100000743 3300006931 Bacteria 32840
274 Ga0097620_100029691 3300006931 Bacteria 5486
275 Ga0097620_100107371 3300006931 Bacteria 2852
276 Ga0097620_100617320 3300006931 Unclassified 1177
277 Ga0075435_100002276 3300007076 Bacteria 12672
278 Ga0075435_100028468 3300007076 Unclassified 4383
279 Ga0075435_100030477 3300007076 Bacteria 4242
280 Ga0075435_100108003 3300007076 Bacteria 2312
281 Ga0075435_100159998 3300007076 Unclassified 1896
282 Ga0105250_10059427 3300009092 Unclassified 1535
283 Ga0105240_10005076 3300009093 Bacteria 19734
284 Ga0105240_10009676 3300009093 Bacteria 13622
285 Ga0105240_10046006 3300009093 Bacteria 5533
286 Ga0105240_10130352 3300009093 Unclassified 3017
287 Ga0105240_10354797 3300009093 Bacteria 1663
288 Ga0105245_10021687 3300009098 Bacteria 5639
289 Ga0105245_10043511 3300009098 Bacteria 4006
290 Ga0105245_10134582 3300009098 Unclassified 2321
291 Ga0105245_10188012 3300009098 Bacteria 1977
292 Ga0105245_10318767 3300009098 Bacteria 1531
293 Ga0105247_10117309 3300009101 Bacteria 1720
294 Ga0105247_10170366 3300009101 Bacteria 1447
295 Ga0114129_10263397 3300009147 Bacteria 2309
296 Ga0105243_10065709 3300009148 Unclassified 2915
297 Ga0105241_10021553 3300009174 Unclassified 4765
298 Ga0105241_10028616 3300009174 Unclassified 4153
299 Ga0105241_10068900 3300009174 Bacteria 2742
300 Ga0105241_10805168 3300009174 Bacteria 866
301 Ga0105242_10066838 3300009176 Unclassified 2970
302 Ga0105248_10002754 3300009177 Bacteria 19526
303 Ga0105248_10024617 3300009177 Bacteria 6694
304 Ga0105248_10054467 3300009177 Bacteria 4485
305 Ga0105248_10057988 3300009177 Bacteria 4347
306 Ga0105248_10061141 3300009177 Bacteria 4228
307 Ga0105248_10097481 3300009177 Unclassified 3313
308 Ga0105237_10010940 3300009545 Bacteria 9628
309 Ga0105237_10037740 3300009545 Bacteria 4882
310 Ga0105237_10090403 3300009545 Bacteria 3051
311 Ga0105237_10127258 3300009545 Bacteria 2542
312 Ga0105237_10129749 3300009545 Unclassified 2515
313 Ga0105237_10274245 3300009545 Bacteria 1689
314 Ga0105238_10001256 3300009551 Bacteria 25520
315 Ga0105238_10011948 3300009551 Bacteria 8748
316 Ga0105238_10076516 3300009551 Bacteria 3338
317 Ga0105238_10195438 3300009551 Bacteria 1999
318 Ga0105249_10010877 3300009553 Bacteria 7996
319 Ga0105249_10110523 3300009553 Unclassified 2597
320 Ga0105239_10020769 3300010375 Bacteria 7247
321 Ga0105239_10027319 3300010375 Bacteria 6282
322 Ga0105239_10066265 3300010375 Bacteria 3967
323 Ga0105239_10131950 3300010375 Bacteria 2779
324 Ga0105239_10133705 3300010375 Bacteria 2761
325 Ga0105239_10170577 3300010375 Bacteria 2433
326 Ga0105246_10130306 3300011119 Unclassified 1878
327 Ga0157373_10009346 3300013100 Bacteria 7244
328 Ga0157373_10181386 3300013100 Bacteria 1482
329 Ga0157371_10011620 3300013102 Bacteria 6769
330 Ga0157371_10042533 3300013102 Unclassified 3238
331 Ga0157371_10068655 3300013102 Bacteria 2509
332 Ga0157369_10000196 3300013105 Bacteria 84536
333 Ga0157369_10001722 3300013105 Bacteria 26646
334 Ga0157369_10010846 3300013105 Bacteria 10379
335 Ga0157369_10014078 3300013105 Bacteria 9038
336 Ga0157369_10021606 3300013105 Bacteria 7197
337 Ga0157369_10047180 3300013105 Bacteria 4679
338 Ga0157369_10124427 3300013105 Bacteria 2735
339 Ga0157369_10252144 3300013105 Bacteria 1842
340 Ga0157369_10406164 3300013105 Bacteria 1413
341 Ga0157369_10428591 3300013105 Bacteria 1371
342 Ga0157374_10000312 3300013296 Bacteria 45142
343 Ga0157374_10000989 3300013296 Bacteria 24633
344 Ga0157374_10001078 3300013296 Bacteria 23634
345 Ga0157374_10003563 3300013296 Bacteria 13110
346 Ga0157374_10069754 3300013296 Bacteria 3310
347 Ga0157374_10093357 3300013296 Unclassified 2873
348 Ga0157374_10292023 3300013296 Unclassified 1611
349 Ga0157378_10000057 3300013297 Bacteria 96589
350 Ga0157378_10000058 3300013297 Bacteria 96172
351 Ga0157378_10000304 3300013297 Bacteria 47798
352 Ga0157378_10001335 3300013297 Bacteria 22158
353 Ga0157378_10014035 3300013297 Bacteria 7013
354 Ga0157378_10017752 3300013297 Bacteria 6247
355 Ga0157378_10077210 3300013297 Unclassified 3002
356 Ga0157378_10314628 3300013297 Bacteria 1519
357 Ga0163162_10013577 3300013306 Bacteria 7957
358 Ga0163162_10108566 3300013306 Bacteria 2871
359 Ga0163162_10117086 3300013306 Bacteria 2766
360 Ga0163162_10134902 3300013306 Bacteria 2579
361 Ga0163162_10477484 3300013306 Bacteria 1378
362 Ga0157372_10000200 3300013307 Bacteria 66086
363 Ga0157372_10000379 3300013307 Bacteria 49273
364 Ga0157372_10000714 3300013307 Bacteria 36499
365 Ga0157372_10003854 3300013307 Bacteria 16121
366 Ga0157372_10008585 3300013307 Bacteria 10857
367 Ga0157372_10018945 3300013307 Bacteria 7406
368 Ga0157372_10070788 3300013307 Unclassified 3925
369 Ga0157372_10114379 3300013307 Bacteria 3093
370 Ga0157372_10202191 3300013307 Unclassified 2301
371 Ga0157375_10335189 3300013308 Bacteria 1678
372 Ga0163163_10011964 3300014325 Bacteria 7895
373 Ga0163163_10028994 3300014325 Bacteria 5322
374 Ga0163163_10047416 3300014325 Bacteria 4224
375 Ga0163163_10052362 3300014325 Bacteria 4027
376 Ga0163163_10082546 3300014325 Unclassified 3218
377 Ga0163163_10231656 3300014325 Bacteria 1896
378 Ga0163163_10466176 3300014325 Bacteria 1324
379 Ga0157377_10122308 3300014745 Bacteria 1579
380 Ga0157379_10002438 3300014968 Bacteria 15569
381 Ga0157379_10041098 3300014968 Unclassified 4127
382 Ga0157379_10329788 3300014968 Bacteria 1394
383 Ga0157376_10003037 3300014969 Bacteria 11495
384 Ga0157376_10018903 3300014969 Bacteria 5298
385 Ga0157376_10120856 3300014969 Unclassified 2321
386 Ga0157376_10150773 3300014969 Unclassified 2096
387 Ga0157376_10150939 3300014969 Unclassified 2095
388 Ga0157376_10842264 3300014969 Unclassified 932
389 Ga0157376_10851861 3300014969 Unclassified 927
390 Ga0163161_10003804 3300017792 Bacteria 10582
391 Ga0213873_10020184 3300021358 Unclassified 1554
392 Ga0213874_10005028 3300021377 Bacteria 3060
393 Ga0213874_10074028 3300021377 Bacteria 1092
394 Ga0224572_1003559 3300024225 Unclassified 2640
395 Ga0228598_1003592 3300024227 Unclassified 3330
396 Ga0207697_10024904 3300025315 Unclassified 2447
397 Ga0207656_10072464 3300025321 Bacteria 1534
398 Ga0207656_10084586 3300025321 Unclassified 1431
399 Ga0207656_10202119 3300025321 Unclassified 960
400 Ga0207682_10063867 3300025893 Unclassified 1546
401 Ga0207692_10029019 3300025898 Unclassified 2624
402 Ga0207692_10049371 3300025898 Bacteria 2123
403 Ga0207692_10150872 3300025898 Bacteria 1331
404 Ga0207642_10049092 3300025899 Bacteria 1895
405 Ga0207642_10167243 3300025899 Bacteria 1186
406 Ga0207688_10093312 3300025901 Unclassified 1731
407 Ga0207680_10067798 3300025903 Unclassified 2199
408 Ga0207647_10005883 3300025904 Bacteria 8937
409 Ga0207647_10024407 3300025904 Bacteria 3986
410 Ga0207699_10008930 3300025906 Unclassified 4969
411 Ga0207699_10021420 3300025906 Bacteria 3484
412 Ga0207699_10036191 3300025906 Unclassified 2812
413 Ga0207699_10238930 3300025906 Bacteria 1247
414 Ga0207699_10338704 3300025906 Bacteria 1059
415 Ga0207699_10358348 3300025906 Bacteria 1031
416 Ga0207699_10448100 3300025906 Bacteria 925
417 Ga0207645_10000551 3300025907 Bacteria 31119
418 Ga0207645_10004243 3300025907 Bacteria 10640
419 Ga0207643_10002140 3300025908 Bacteria 10851
420 Ga0207684_10016288 3300025910 Bacteria 6383
421 Ga0207684_10033830 3300025910 Unclassified 4347
422 Ga0207684_10064619 3300025910 Unclassified 3107
423 Ga0207684_10077797 3300025910 Bacteria 2821
424 Ga0207684_10279783 3300025910 Bacteria 1439
425 Ga0207684_10487378 3300025910 Unclassified 1057
426 Ga0207654_10048036 3300025911 Bacteria 2441
427 Ga0207707_10000617 3300025912 Bacteria 35411
428 Ga0207707_10002456 3300025912 Bacteria 16676
429 Ga0207707_10129771 3300025912 Bacteria 2205
430 Ga0207695_10005582 3300025913 Bacteria 16616
431 Ga0207695_10016407 3300025913 Bacteria 8665
432 Ga0207695_10024396 3300025913 Bacteria 6808
433 Ga0207695_10053870 3300025913 Bacteria 4205
434 Ga0207695_10058048 3300025913 Bacteria 4018
435 Ga0207695_10176066 3300025913 Unclassified 2062
436 Ga0207695_10252313 3300025913 Bacteria 1663
437 Ga0207695_10312606 3300025913 Bacteria 1461
438 Ga0207695_10440108 3300025913 Bacteria 1187
439 Ga0207695_10577129 3300025913 Unclassified 1006
440 Ga0207671_10009068 3300025914 Bacteria 8362
441 Ga0207671_10131643 3300025914 Bacteria 1920
442 Ga0207671_10258684 3300025914 Bacteria 1369
443 Ga0207693_10009791 3300025915 Bacteria 7801
444 Ga0207693_10010388 3300025915 Bacteria 7558
445 Ga0207693_10026726 3300025915 Bacteria 4566
446 Ga0207693_10053913 3300025915 Unclassified 3155
447 Ga0207663_10070270 3300025916 Bacteria 2255
448 Ga0207663_10122908 3300025916 Bacteria 1781
449 Ga0207663_10177613 3300025916 Bacteria 1518
450 Ga0207663_10217699 3300025916 Bacteria 1388
451 Ga0207663_10286619 3300025916 Bacteria 1225
452 Ga0207660_10234598 3300025917 Bacteria 1443
453 Ga0207662_10004460 3300025918 Bacteria 7368
454 Ga0207662_10314459 3300025918 Bacteria 1044
455 Ga0207657_10002740 3300025919 Bacteria 18981
456 Ga0207657_10003665 3300025919 Bacteria 16357
457 Ga0207657_10009009 3300025919 Bacteria 10078
458 Ga0207649_10001493 3300025920 Bacteria 13728
459 Ga0207649_10035538 3300025920 Bacteria 2995
460 Ga0207649_10127147 3300025920 Bacteria 1726
461 Ga0207652_10031964 3300025921 Unclassified 4421
462 Ga0207652_10049802 3300025921 Bacteria 3587
463 Ga0207646_10217352 3300025922 Bacteria 1726
464 Ga0207681_10184901 3300025923 Unclassified 1590
465 Ga0207694_10000743 3300025924 Bacteria 29301
466 Ga0207694_10020189 3300025924 Bacteria 5039
467 Ga0207694_10068819 3300025924 Unclassified 2765
468 Ga0207650_10000045 3300025925 Bacteria 181507
469 Ga0207650_10042503 3300025925 Bacteria 3334
470 Ga0207650_10257958 3300025925 Bacteria 1413
471 Ga0207687_10047387 3300025927 Unclassified 2980
472 Ga0207687_10114864 3300025927 Bacteria 2005
473 Ga0207700_10026354 3300025928 Unclassified 4051
474 Ga0207700_10034264 3300025928 Unclassified 3644
475 Ga0207700_10146715 3300025928 Unclassified 1945
476 Ga0207700_10147114 3300025928 Bacteria 1943
477 Ga0207700_10202860 3300025928 Bacteria 1672
478 Ga0207700_10203610 3300025928 Bacteria 1669
479 Ga0207700_10217446 3300025928 Unclassified 1618
480 Ga0207700_10339306 3300025928 Bacteria 1306
481 Ga0207700_10645546 3300025928 Bacteria 943
482 Ga0207664_10011058 3300025929 Bacteria 6395
483 Ga0207664_10048706 3300025929 Unclassified 3334
484 Ga0207664_10124402 3300025929 Bacteria 2163
485 Ga0207664_10653603 3300025929 Bacteria 945
486 Ga0207664_10746112 3300025929 Unclassified 880
487 Ga0207644_10234750 3300025931 Bacteria 1458
488 Ga0207644_10328554 3300025931 Bacteria 1238
489 Ga0207706_10003060 3300025933 Bacteria 16104
490 Ga0207706_10037894 3300025933 Bacteria 4278
491 Ga0207686_10131534 3300025934 Unclassified 1717
492 Ga0207686_10147256 3300025934 Bacteria 1635
493 Ga0207709_10050443 3300025935 Unclassified 2545
494 Ga0207670_10186756 3300025936 Unclassified 1565
495 Ga0207670_10308095 3300025936 Bacteria 1242
496 Ga0207704_10013405 3300025938 Bacteria 4099
497 Ga0207665_10001295 3300025939 Bacteria 16905
498 Ga0207665_10004259 3300025939 Bacteria 9510
499 Ga0207665_10017745 3300025939 Bacteria 4677
500 Ga0207665_10060541 3300025939 Bacteria 2564
501 Ga0207665_10066960 3300025939 Bacteria 2445
502 Ga0207665_10067636 3300025939 Unclassified 2433
503 Ga0207665_10203739 3300025939 Bacteria 1443
504 Ga0207665_10272350 3300025939 Bacteria 1258
505 Ga0207665_10287210 3300025939 Unclassified 1226
506 Ga0207691_10004307 3300025940 Bacteria 13821
507 Ga0207691_10483887 3300025940 Bacteria 1052
508 Ga0207711_10021084 3300025941 Bacteria 5442
509 Ga0207711_10035712 3300025941 Bacteria 4215
510 Ga0207711_10057050 3300025941 Bacteria 3357
511 Ga0207711_10118544 3300025941 Unclassified 2361
512 Ga0207711_10204551 3300025941 Bacteria 1802
513 Ga0207689_10004596 3300025942 Bacteria 12489
514 Ga0207689_10009031 3300025942 Bacteria 8631
515 Ga0207689_10018148 3300025942 Bacteria 5941
516 Ga0207661_10000131 3300025944 Bacteria 47673
517 Ga0207661_10125130 3300025944 Unclassified 2194
518 Ga0207679_10000283 3300025945 Bacteria 38405
519 Ga0207679_10073991 3300025945 Unclassified 2580
520 Ga0207679_10234442 3300025945 Bacteria 1551
521 Ga0207679_10251611 3300025945 Unclassified 1502
522 Ga0207679_10455080 3300025945 Bacteria 1136
523 Ga0207667_10001753 3300025949 Bacteria 27293
524 Ga0207667_10022333 3300025949 Bacteria 6991
525 Ga0207667_10047229 3300025949 Unclassified 4557
526 Ga0207667_10056561 3300025949 Bacteria 4121
527 Ga0207667_10095084 3300025949 Bacteria 3076
528 Ga0207667_10129991 3300025949 Bacteria 2594
529 Ga0207667_10305979 3300025949 Bacteria 1624
530 Ga0207667_10846263 3300025949 Bacteria 909
531 Ga0207651_10029577 3300025960 Bacteria 3473
532 Ga0207651_10039352 3300025960 Unclassified 3117
533 Ga0207651_10414784 3300025960 Bacteria 1148
534 Ga0207712_10011555 3300025961 Bacteria 5628
535 Ga0207668_10017040 3300025972 Unclassified 4546
536 Ga0207640_10010779 3300025981 Bacteria 5158
537 Ga0207640_10031062 3300025981 Bacteria 3297
538 Ga0207640_10042734 3300025981 Bacteria 2892
539 Ga0207640_10059925 3300025981 Bacteria 2514
540 Ga0207640_10156562 3300025981 Unclassified 1680
541 Ga0207640_10302945 3300025981 Bacteria 1265
542 Ga0207658_10003108 3300025986 Bacteria 11881
543 Ga0207677_10002125 3300026023 Bacteria 10402
544 Ga0207677_10163209 3300026023 Bacteria 1733
545 Ga0207677_10253370 3300026023 Bacteria 1431
546 Ga0207703_10003528 3300026035 Bacteria 13086
547 Ga0207703_10008464 3300026035 Bacteria 8128
548 Ga0207703_10011057 3300026035 Bacteria 7033
549 Ga0207703_10039474 3300026035 Unclassified 3773
550 Ga0207639_10005137 3300026041 Bacteria 8821
551 Ga0207639_10089777 3300026041 Bacteria 2456
552 Ga0207639_10131743 3300026041 Bacteria 2071
553 Ga0207639_10286015 3300026041 Bacteria 1452
554 Ga0207678_10000026 3300026067 Bacteria 116850
555 Ga0207678_10001488 3300026067 Bacteria 21502
556 Ga0207702_10001299 3300026078 Bacteria 25024
557 Ga0207702_10001432 3300026078 Bacteria 23781
558 Ga0207702_10005337 3300026078 Bacteria 11266
559 Ga0207702_10056905 3300026078 Bacteria 3321
560 Ga0207702_10076023 3300026078 Bacteria 2902
561 Ga0207702_10145132 3300026078 Bacteria 2152
562 Ga0207641_10000021 3300026088 Bacteria 279851
563 Ga0207641_10010380 3300026088 Bacteria 7657
564 Ga0207641_10070055 3300026088 Bacteria 3013
565 Ga0207641_10102549 3300026088 Bacteria 2523
566 Ga0207641_10112651 3300026088 Bacteria 2414
567 Ga0207641_10626665 3300026088 Unclassified 1055
568 Ga0207648_10000611 3300026089 Bacteria 40065
569 Ga0207648_10006630 3300026089 Bacteria 11501
570 Ga0207648_10030195 3300026089 Unclassified 4802
571 Ga0207648_10070587 3300026089 Bacteria 3045
572 Ga0207648_10111193 3300026089 Bacteria 2405
573 Ga0207676_10000096 3300026095 Bacteria 80353
574 Ga0207676_10091337 3300026095 Bacteria 2501
575 Ga0207676_10541104 3300026095 Bacteria 1111
576 Ga0207674_10000246 3300026116 Bacteria 67486
577 Ga0207674_10006208 3300026116 Bacteria 14082
578 Ga0207674_10009607 3300026116 Bacteria 11035
579 Ga0207674_10022219 3300026116 Bacteria 6818
580 Ga0207674_10052593 3300026116 Unclassified 4154
581 Ga0207675_100048302 3300026118 Bacteria 3973
582 Ga0207675_100099837 3300026118 Bacteria 2734
583 Ga0207683_10000259 3300026121 Bacteria 47186
584 Ga0207683_10113947 3300026121 Bacteria 2422
585 Ga0207698_10029830 3300026142 Unclassified 3913
586 Ga0265356_1012459 3300028017 Bacteria 934
587 Ga0268266_10006040 3300028379 Bacteria 11164
588 Ga0268266_10016584 3300028379 Bacteria 6295
589 Ga0268266_10433877 3300028379 Bacteria 1247
590 Ga0268265_10005648 3300028380 Bacteria 8545
591 Ga0268265_10082287 3300028380 Unclassified 2545
592 Ga0268264_10004345 3300028381 Bacteria 12099
593 Ga0268264_10044109 3300028381 Unclassified 3698
594 Ga0268264_10140172 3300028381 Bacteria 2155
595 Ga0265338_10001717 3300028800 Bacteria 34748
596 Ga0265338_10119471 3300028800 Bacteria 2104
597 Ga0265773_1005274 3300031018 Bacteria 934
598 Ga0265760_10000564 3300031090 Bacteria 10531
599 Ga0265760_10002887 3300031090 Bacteria 5024
600 Ga0265760_10003748 3300031090 Bacteria 4403
601 Ga0265760_10004692 3300031090 Unclassified 3913
602 Ga0265760_10043850 3300031090 Bacteria 1337
603 Ga0265330_10009079 3300031235 Bacteria 4741
604 Ga0265340_10037738 3300031247 Bacteria 2392
605 Ga0265339_10001780 3300031249 Bacteria 15833
606 Ga0265339_10079860 3300031249 Bacteria 1730
607 Ga0265331_10061776 3300031250 Bacteria 1768
608 Ga0265316_10006906 3300031344 Bacteria 10767
609 Ga0265316_10012757 3300031344 Bacteria 7510
610 Ga0307408_100242572 3300031548 Bacteria 1482
611 Ga0265314_10004769 3300031711 Bacteria 12427
612 Ga0307405_10018003 3300031731 Bacteria 3889
613 Ga0307410_10026642 3300031852 Bacteria 3643
614 Ga0307410_10156905 3300031852 Bacteria 1701
615 Ga0307409_100313410 3300031995 Bacteria 1465
616 Ga0307416_100183907 3300032002 Bacteria 1962
617 Ga0307411_10314839 3300032005 Bacteria 1261
618 Ga0307415_100016974 3300032126 Bacteria 4355
619 Ga0373944_0015522 3300035089 Unclassified 2139
620 Ga0373936_0029250 3300035113 Bacteria 2168
621 Ga0373954_0083902 3300035118 Bacteria 1525
622 Ga0373931_0025139 3300035691 Unclassified 3024
623 Ga0373931_0103142 3300035691 Bacteria 1607
624 Ga0373935_0157587 3300035692 Bacteria 1545
625 Ga0373935_0392149 3300035692 Unclassified 996
626 Ga0373927_0012227 3300035695 Bacteria 5710
627 Ga0373933_0104999 3300035724 Unclassified 1757
628 Ga0373947_0271652 3300035725 Bacteria 1125
629 Ga0373947_0556858 3300035725 Bacteria 781
630 Ga0373937_0018912 3300036401 Bacteria 6159
631 Ga0373925_0004417 3300037068 Bacteria 10624
632 Ga0373925_0017930 3300037068 Bacteria 5139
633 Ga0395900_0392383 3300037418 Bacteria 1354
634 Ga0395905_0005720 3300037471 Bacteria 12640
635 Ga0395905_0009325 3300037471 Bacteria 9600
636 Ga0395905_0015774 3300037471 Bacteria 7177
637 Ga0395905_0339925 3300037471 Bacteria 1392
638 Ga0436365_0117660 3300039437 Bacteria 2357
639 Ga0436365_0913571 3300039437 Bacteria 1395
640 Ga0436365_1528334 3300039437 Bacteria 2533
641 Ga0436363_0108166 3300039450 Bacteria 1068
642 Ga0436363_0644861 3300039450 Bacteria 2894
643 Ga0436363_1342541 3300039450 Bacteria 2221
644 Ga0436363_1700190 3300039450 Bacteria 4540
645 Ga0436362_0155418 3300039453 Unclassified 2386
646 Ga0451577_0000157 3300042876 Bacteria 151953
647 Ga0451577_0041769 3300042876 Unclassified 4116
648 Ga0453683_0025944 3300044673 Bacteria 3721
649 Ga0453683_0369661 3300044673 Unclassified 922
650 Ga0466963_0014508 3300044694 Bacteria 4860
651 Ga0453684_0001152 3300044712 Bacteria 82543
652 Ga0451576_0108517 3300045051 Unclassified 2888
653 Ga0451576_0221217 3300045051 Bacteria 1977
654 Ga0451576_0283887 3300045051 Bacteria 1731
655 Ga0466967_0002974 3300045976 Bacteria 10843
656 Ga0466967_0824223 3300045976 Bacteria 922
657 Ga0495653_0272272 3300046463 Bacteria 1115
658 Ga0495580_0002108 3300046472 Bacteria 17453
659 Ga0495580_0002151 3300046472 Bacteria 17310
660 Ga0495580_0002538 3300046472 Bacteria 15898
661 Ga0495580_0004470 3300046472 Bacteria 11745
662 Ga0495580_0005568 3300046472 Bacteria 10385
663 Ga0495580_0009075 3300046472 Bacteria 7844
664 Ga0495580_0042668 3300046472 Bacteria 3230
665 Ga0495580_0096651 3300046472 Bacteria 2054
666 Ga0495580_0282665 3300046472 Bacteria 1132
667 Ga0495582_0000074 3300046473 Bacteria 50012
668 Ga0495594_0159038 3300046499 Bacteria 1284
669 Ga0495608_0206802 3300046511 Bacteria 1235
670 Ga0495628_0404339 3300046516 Bacteria 997
671 Ga0495665_0000640 3300046531 Bacteria 17853
672 Ga0495665_0018105 3300046531 Unclassified 3787
673 Ga0495645_0291642 3300046543 Bacteria 1069
674 Ga0495667_0123160 3300046559 Bacteria 1674
675 Ga0495656_0012753 3300046615 Bacteria 3110
676 Ga0495657_0093540 3300046675 Bacteria 1924
677 Ga0495657_0239335 3300046675 Unclassified 1096
678 Ga0495623_0064777 3300046679 Bacteria 2287
679 Ga0495669_0013822 3300046684 Unclassified 3446
680 Ga0495669_0027789 3300046684 Bacteria 2475
681 Ga0495581_0026361 3300047315 Bacteria 3370
682 Ga0495581_0122147 3300047315 Bacteria 1516
683 Ga0495674_0487601 3300047319 Bacteria 987
684 Ga0495675_0032498 3300047444 Bacteria 3330
685 Ga0495675_0052458 3300047444 Bacteria 2589
686 Ga0495677_0166123 3300047445 Bacteria 853
687 Ga0495684_0153451 3300047471 Bacteria 1721
688 Ga0496100_0106014 3300048903 Unclassified 1945
689 Ga0496101_0127407 3300048904 Unclassified 1930
690 Ga0496102_0008569 3300048905 Bacteria 8769
691 Ga0496102_0013555 3300048905 Bacteria 7065
692 Ga0496102_0111535 3300048905 Bacteria 2550
693 Ga0496102_0327715 3300048905 Bacteria 1442
694 Ga0496103_0022061 3300048906 Unclassified 3832
695 Ga0496104_0206179 3300048907 Unclassified 1878
696 Ga0496104_0599097 3300048907 Unclassified 1012
697 Ga0496105_0575347 3300048908 Unclassified 877
698 Ga0496106_0077026 3300048909 Bacteria 2557
699 Ga0496106_0110030 3300048909 Bacteria 2144
700 Ga0496107_0070997 3300048910 Unclassified 2530
701 Ga0496108_0000605 3300048911 Bacteria 28095
702 Ga0496108_0101207 3300048911 Bacteria 2458
703 Ga0496109_0000132 3300048912 Bacteria 76436
704 Ga0496109_0011172 3300048912 Bacteria 7705
705 Ga0496109_0075326 3300048912 Unclassified 3103
706 Ga0496109_0148872 3300048912 Bacteria 2191
707 Ga0496110_0001437 3300048913 Bacteria 17222
708 Ga0496110_0053666 3300048913 Bacteria 3544
709 Ga0496111_0017498 3300048914 Bacteria 4956
710 Ga0496111_0367603 3300048914 Unclassified 1064
711 Ga0496112_0000399 3300048915 Bacteria 28374
712 Ga0496112_0000464 3300048915 Bacteria 27058
713 Ga0496112_0046418 3300048915 Bacteria 4260
714 Ga0496112_0073440 3300048915 Bacteria 3381
715 Ga0496112_0102212 3300048915 Bacteria 2836
716 Ga0496112_0148660 3300048915 Bacteria 2310
717 Ga0496112_0422625 3300048915 Unclassified 1271
718 Ga0496112_0645398 3300048915 Unclassified 988
719 Ga0501294_007687 3300049517 Bacteria 1044
720 Ga0501296_010667 3300049519 Bacteria 1092
721 Ga0501298_020448 3300049521 Bacteria 1233
722 Ga0501272_004372 3300049769 Bacteria 1467
723 nmdc:mga0n895_128602_c1 3300050512 Unclassified 2557
724 nmdc:mga0n895_1448_c1 3300050512 Bacteria 17728
725 nmdc:mga0n895_31071_c1 3300050512 Bacteria 5110
726 nmdc:mga0n895_31483_c1 3300050512 Bacteria 5080
727 nmdc:mga0n895_345_c1 3300050512 Bacteria 31108
728 nmdc:mga0n895_46359_c2 3300050512 Bacteria 3705
729 nmdc:mga0rr50_143165_c1 3300050513 Unclassified 1925
730 nmdc:mga0rr50_1877_c1 3300050513 Bacteria 11667
731 nmdc:mga0rr50_31563_c1 3300050513 Bacteria 3764
732 nmdc:mga08x19_18672_c1 3300050514 Unclassified 4249
733 nmdc:mga08x19_2129_c2 3300050514 Bacteria 5083
734 nmdc:mga08x19_43978_c1 3300050514 Bacteria 2850
735 nmdc:mga08x19_6332_c1 3300050514 Bacteria 7009
736 nmdc:mga0a205_107_c2 3300050515 Bacteria 46625
737 nmdc:mga0a205_7634_c1 3300050515 Bacteria 9808
738 Ga0501084_0254946 3300054114 Unclassified 1481

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100183731 Ga0070699_1001837312 225
2 3300054114 Ga0501084_0254946 Ga0501084_0254946_275_1012 226
3 3300005338 Ga0068868_100282120 Ga0068868_1002821202 227
4 3300005364 Ga0070673_100457923 Ga0070673_1004579231 227
5 3300005445 Ga0070708_100003966 Ga0070708_1000039664 227
6 3300005471 Ga0070698_100013058 Ga0070698_1000130587 227
7 3300005518 Ga0070699_100001027 Ga0070699_1000010274 227
8 3300005518 Ga0070699_100096021 Ga0070699_1000960212 227
9 3300005530 Ga0070679_100014737 Ga0070679_1000147371 227
10 3300005535 Ga0070684_100037540 Ga0070684_1000375403 227
11 3300005547 Ga0070693_100008310 Ga0070693_1000083103 227
12 3300005563 Ga0068855_100001467 Ga0068855_1000014677 227
13 3300005564 Ga0070664_100090314 Ga0070664_1000903142 227
14 3300005614 Ga0068856_100000884 Ga0068856_10000088421 227
15 3300006173 Ga0070716_100037014 Ga0070716_1000370143 227
16 3300006237 Ga0097621_100000731 Ga0097621_1000007314 227
17 3300006358 Ga0068871_100000266 Ga0068871_10000026619 227
18 3300025912 Ga0207707_10000617 Ga0207707_1000061719 227
19 3300025924 Ga0207694_10000743 Ga0207694_1000074318 227
20 3300025945 Ga0207679_10073991 Ga0207679_100739913 227
21 3300025949 Ga0207667_10001753 Ga0207667_1000175324 227
22 3300026078 Ga0207702_10001299 Ga0207702_100012997 227
23 3300046684 Ga0495669_0027789 Ga0495669_0027789_1555_2295 227
24 3300047445 Ga0495677_0166123 Ga0495677_0166123_86_826 227
25 3300049519 Ga0501296_010667 Ga0501296_010667_322_1062 227
26 3300005435 Ga0070714_100369035 Ga0070714_1003690352 228
27 3300005436 Ga0070713_100027201 Ga0070713_1000272013 228
28 3300005437 Ga0070710_10024862 Ga0070710_100248622 228
29 3300005439 Ga0070711_100039331 Ga0070711_1000393311 228
30 3300005439 Ga0070711_100052965 Ga0070711_1000529652 228
31 3300005439 Ga0070711_100057485 Ga0070711_1000574852 228
32 3300005445 Ga0070708_100003146 Ga0070708_10000314611 228
33 3300005445 Ga0070708_100660189 Ga0070708_1006601892 228
34 3300005530 Ga0070679_100464459 Ga0070679_1004644592 228
35 3300005536 Ga0070697_100000237 Ga0070697_10000023712 228
36 3300005564 Ga0070664_100000079 Ga0070664_10000007937 228
37 3300005614 Ga0068856_100001689 Ga0068856_1000016894 228
38 3300005617 Ga0068859_100000743 Ga0068859_10000074318 228
39 3300006931 Ga0097620_100000743 Ga0097620_10000074313 228
40 3300013297 Ga0157378_10077210 Ga0157378_100772103 228
41 3300025898 Ga0207692_10029019 Ga0207692_100290193 228
42 3300025925 Ga0207650_10042503 Ga0207650_100425034 228
43 3300025949 Ga0207667_10056561 Ga0207667_100565612 228
44 3300025949 Ga0207667_10129991 Ga0207667_101299915 228
45 3300025981 Ga0207640_10010779 Ga0207640_100107795 228
46 3300035725 Ga0373947_0556858 Ga0373947_0556858_17_760 228
47 3300005336 Ga0070680_100076357 Ga0070680_1000763573 229
48 3300005458 Ga0070681_10012120 Ga0070681_100121205 229
49 3300005445 Ga0070708_100089157 Ga0070708_1000891572 230
50 3300005467 Ga0070706_100116070 Ga0070706_1001160703 230
51 3300005468 Ga0070707_100209000 Ga0070707_1002090002 230
52 3300005471 Ga0070698_100223136 Ga0070698_1002231362 230
53 3300006237 Ga0097621_100576711 Ga0097621_1005767112 230
54 3300013105 Ga0157369_10001722 Ga0157369_100017226 230
55 3300005437 Ga0070710_10159208 Ga0070710_101592082 231
56 3300005468 Ga0070707_100251525 Ga0070707_1002515251 231
57 3300005578 Ga0068854_100335242 Ga0068854_1003352423 231
58 3300005614 Ga0068856_100282874 Ga0068856_1002828742 231
59 3300006028 Ga0070717_10278980 Ga0070717_102789802 231
60 3300025913 Ga0207695_10053870 Ga0207695_100538703 231
61 3300025915 Ga0207693_10053913 Ga0207693_100539132 231
62 3300025928 Ga0207700_10034264 Ga0207700_100342643 231
63 3300025929 Ga0207664_10653603 Ga0207664_106536031 231
64 3300025949 Ga0207667_10305979 Ga0207667_103059792 231
65 3300025981 Ga0207640_10059925 Ga0207640_100599252 231
66 3300026078 Ga0207702_10056905 Ga0207702_100569054 231
67 3300031090 Ga0265760_10000564 Ga0265760_100005642 231
68 3300025910 Ga0207684_10033830 Ga0207684_100338303 233
69 3300005439 Ga0070711_100292029 Ga0070711_1002920292 234
70 3300025916 Ga0207663_10177613 Ga0207663_101776132 234
71 3300006028 Ga0070717_10198906 Ga0070717_101989062 235
72 3300025940 Ga0207691_10483887 Ga0207691_104838872 235
73 3300048915 Ga0496112_0102212 Ga0496112_0102212_140_919 236
74 3300005445 Ga0070708_100023212 Ga0070708_1000232123 237
75 3300005458 Ga0070681_10283619 Ga0070681_102836191 237
76 3300005468 Ga0070707_100037132 Ga0070707_1000371324 237
77 3300031090 Ga0265760_10002887 Ga0265760_100028872 237
78 3300031090 Ga0265760_10043850 Ga0265760_100438501 237
79 3300005536 Ga0070697_100001234 Ga0070697_10000123415 238
80 3300006028 Ga0070717_10506851 Ga0070717_105068512 238
81 3300006173 Ga0070716_100009156 Ga0070716_1000091567 238
82 3300006871 Ga0075434_100034614 Ga0075434_1000346145 238
83 3300025906 Ga0207699_10338704 Ga0207699_103387041 238
84 3300025910 Ga0207684_10487378 Ga0207684_104873781 238
85 3300025928 Ga0207700_10202860 Ga0207700_102028602 238
86 3300025939 Ga0207665_10017745 Ga0207665_100177452 238
87 3300031090 Ga0265760_10004692 Ga0265760_100046922 238
88 3300050512 nmdc:mga0n895_31483_c1 nmdc:mga0n895_31483_c1_2278_3057 238
89 3300028800 Ga0265338_10119471 Ga0265338_101194712 239
90 3300046615 Ga0495656_0012753 Ga0495656_0012753_1637_2413 239
91 3300007076 Ga0075435_100030477 Ga0075435_1000304775 241
92 3300025939 Ga0207665_10066960 Ga0207665_100669603 241
93 3300045051 Ga0451576_0283887 Ga0451576_0283887_699_1487 241
94 3300050513 nmdc:mga0rr50_31563_c1 nmdc:mga0rr50_31563_c1_1023_1832 241
95 3300050514 nmdc:mga08x19_43978_c1 nmdc:mga08x19_43978_c1_76_885 241
96 3300026023 Ga0207677_10163209 Ga0207677_101632092 242
97 3300042876 Ga0451577_0000157 Ga0451577_0000157_41002_41793 242
98 3300044673 Ga0453683_0369661 Ga0453683_0369661_111_902 242
99 3300044712 Ga0453684_0001152 Ga0453684_0001152_63775_64566 242
100 3300037471 Ga0395905_0009325 Ga0395905_0009325_5910_6701 243
101 3300042876 Ga0451577_0041769 Ga0451577_0041769_3270_4061 243
102 3300045051 Ga0451576_0108517 Ga0451576_0108517_786_1577 243
103 3300046499 Ga0495594_0159038 Ga0495594_0159038_25_813 243
104 3300046516 Ga0495628_0404339 Ga0495628_0404339_162_950 243
105 3300046559 Ga0495667_0123160 Ga0495667_0123160_415_1203 243
106 3300046675 Ga0495657_0093540 Ga0495657_0093540_680_1468 243
107 3300046675 Ga0495657_0239335 Ga0495657_0239335_276_1064 243
108 3300046679 Ga0495623_0064777 Ga0495623_0064777_453_1241 243
109 3300047444 Ga0495675_0032498 Ga0495675_0032498_771_1559 243
110 3300047444 Ga0495675_0052458 Ga0495675_0052458_1709_2497 243
111 3300006852 Ga0075433_10003910 Ga0075433_1000391013 244
112 3300006871 Ga0075434_100175929 Ga0075434_1001759294 244
113 3300009174 Ga0105241_10805168 Ga0105241_108051681 244
114 3300021377 Ga0213874_10005028 Ga0213874_100050284 244
115 3300037418 Ga0395900_0392383 Ga0395900_0392383_549_1340 244
116 3300037471 Ga0395905_0339925 Ga0395905_0339925_463_1257 244
117 3300039437 Ga0436365_0117660 Ga0436365_0117660_1548_2339 244
118 3300039437 Ga0436365_1528334 Ga0436365_1528334_270_1073 244
119 3300039450 Ga0436363_1700190 Ga0436363_1700190_440_1243 244
120 3300044694 Ga0466963_0014508 Ga0466963_0014508_3816_4616 244
121 3300045976 Ga0466967_0002974 Ga0466967_0002974_5597_6397 244
122 3300050512 nmdc:mga0n895_31071_c1 nmdc:mga0n895_31071_c1_215_1018 244
123 3300050513 nmdc:mga0rr50_143165_c1 nmdc:mga0rr50_143165_c1_424_1227 244
124 3300050515 nmdc:mga0a205_7634_c1 nmdc:mga0a205_7634_c1_8827_9630 244
125 3300005329 Ga0070683_100073142 Ga0070683_1000731423 245
126 3300005330 Ga0070690_100178498 Ga0070690_1001784982 245
127 3300005338 Ga0068868_100003985 Ga0068868_1000039858 245
128 3300005339 Ga0070660_100421576 Ga0070660_1004215761 245
129 3300005355 Ga0070671_100122780 Ga0070671_1001227803 245
130 3300005458 Ga0070681_10000988 Ga0070681_100009883 245
131 3300005458 Ga0070681_10224946 Ga0070681_102249462 245
132 3300005459 Ga0068867_100201820 Ga0068867_1002018203 245
133 3300005530 Ga0070679_100172263 Ga0070679_1001722632 245
134 3300005539 Ga0068853_100014856 Ga0068853_1000148563 245
135 3300005563 Ga0068855_100000440 Ga0068855_10000044019 245
136 3300005577 Ga0068857_100040124 Ga0068857_1000401243 245
137 3300005578 Ga0068854_100037953 Ga0068854_1000379533 245
138 3300005614 Ga0068856_100000314 Ga0068856_10000031421 245
139 3300005616 Ga0068852_100005106 Ga0068852_1000051066 245
140 3300005617 Ga0068859_100617244 Ga0068859_1006172442 245
141 3300005834 Ga0068851_10029758 Ga0068851_100297581 245
142 3300005841 Ga0068863_100007633 Ga0068863_1000076334 245
143 3300005842 Ga0068858_100010361 Ga0068858_1000103614 245
144 3300005843 Ga0068860_100132368 Ga0068860_1001323682 245
145 3300006237 Ga0097621_100000088 Ga0097621_10000008817 245
146 3300006358 Ga0068871_100000428 Ga0068871_1000004284 245
147 3300006881 Ga0068865_100007069 Ga0068865_1000070693 245
148 3300006931 Ga0097620_100617320 Ga0097620_1006173202 245
149 3300009093 Ga0105240_10005076 Ga0105240_1000507615 245
150 3300009093 Ga0105240_10130352 Ga0105240_101303523 245
151 3300009177 Ga0105248_10002754 Ga0105248_1000275414 245
152 3300009545 Ga0105237_10274245 Ga0105237_102742452 245
153 3300009551 Ga0105238_10001256 Ga0105238_100012563 245
154 3300010375 Ga0105239_10027319 Ga0105239_100273194 245
155 3300013102 Ga0157371_10068655 Ga0157371_100686553 245
156 3300013105 Ga0157369_10000196 Ga0157369_1000019653 245
157 3300013296 Ga0157374_10000312 Ga0157374_100003124 245
158 3300013296 Ga0157374_10000989 Ga0157374_1000098910 245
159 3300013297 Ga0157378_10000058 Ga0157378_1000005865 245
160 3300013297 Ga0157378_10001335 Ga0157378_100013354 245
161 3300013307 Ga0157372_10000379 Ga0157372_1000037927 245
162 3300013307 Ga0157372_10000714 Ga0157372_1000071425 245
163 3300014969 Ga0157376_10003037 Ga0157376_100030373 245
164 3300024225 Ga0224572_1003559 Ga0224572_10035593 245
165 3300025321 Ga0207656_10202119 Ga0207656_102021191 245
166 3300025912 Ga0207707_10129771 Ga0207707_101297712 245
167 3300025913 Ga0207695_10005582 Ga0207695_100055828 245
168 3300025913 Ga0207695_10312606 Ga0207695_103126063 245
169 3300025914 Ga0207671_10258684 Ga0207671_102586842 245
170 3300025917 Ga0207660_10234598 Ga0207660_102345982 245
171 3300025921 Ga0207652_10031964 Ga0207652_100319642 245
172 3300025921 Ga0207652_10049802 Ga0207652_100498023 245
173 3300025924 Ga0207694_10068819 Ga0207694_100688192 245
174 3300025928 Ga0207700_10339306 Ga0207700_103393062 245
175 3300025931 Ga0207644_10234750 Ga0207644_102347501 245
176 3300025938 Ga0207704_10013405 Ga0207704_100134053 245
177 3300025949 Ga0207667_10022333 Ga0207667_100223336 245
178 3300025960 Ga0207651_10414784 Ga0207651_104147842 245
179 3300025981 Ga0207640_10042734 Ga0207640_100427343 245
180 3300026023 Ga0207677_10002125 Ga0207677_100021252 245
181 3300026023 Ga0207677_10253370 Ga0207677_102533702 245
182 3300026035 Ga0207703_10011057 Ga0207703_100110573 245
183 3300026041 Ga0207639_10005137 Ga0207639_100051374 245
184 3300026078 Ga0207702_10001432 Ga0207702_100014324 245
185 3300026088 Ga0207641_10010380 Ga0207641_100103805 245
186 3300026089 Ga0207648_10111193 Ga0207648_101111931 245
187 3300026095 Ga0207676_10091337 Ga0207676_100913373 245
188 3300026116 Ga0207674_10052593 Ga0207674_100525932 245
189 3300026142 Ga0207698_10029830 Ga0207698_100298302 245
190 3300035691 Ga0373931_0103142 Ga0373931_0103142_164_964 245
191 3300048905 Ga0496102_0111535 Ga0496102_0111535_252_1052 245
192 3300048914 Ga0496111_0367603 Ga0496111_0367603_237_1037 245
193 3300048915 Ga0496112_0000399 Ga0496112_0000399_6404_7204 245
194 3300001990 JGI24737J22298_10050251 JGI24737J22298_100502513 246
195 3300001991 JGI24743J22301_10031702 JGI24743J22301_100317021 246
196 3300005290 Ga0065712_10117106 Ga0065712_101171063 246
197 3300005290 Ga0065712_10272610 Ga0065712_102726101 246
198 3300005327 Ga0070658_10552986 Ga0070658_105529861 246
199 3300005329 Ga0070683_100000996 Ga0070683_10000099621 246
200 3300005331 Ga0070670_100010214 Ga0070670_1000102145 246
201 3300005331 Ga0070670_100022664 Ga0070670_1000226644 246
202 3300005331 Ga0070670_100217955 Ga0070670_1002179552 246
203 3300005333 Ga0070677_10022501 Ga0070677_100225013 246
204 3300005338 Ga0068868_100006259 Ga0068868_1000062594 246
205 3300005339 Ga0070660_100006382 Ga0070660_10000638210 246
206 3300005340 Ga0070689_100000844 Ga0070689_1000008442 246
207 3300005340 Ga0070689_100320977 Ga0070689_1003209772 246
208 3300005343 Ga0070687_100002055 Ga0070687_1000020552 246
209 3300005347 Ga0070668_100078168 Ga0070668_1000781683 246
210 3300005354 Ga0070675_100002781 Ga0070675_10000278111 246
211 3300005356 Ga0070674_100022355 Ga0070674_1000223553 246
212 3300005364 Ga0070673_100016252 Ga0070673_1000162523 246
213 3300005365 Ga0070688_100014009 Ga0070688_1000140096 246
214 3300005434 Ga0070709_10119965 Ga0070709_101199653 246
215 3300005435 Ga0070714_100230099 Ga0070714_1002300992 246
216 3300005436 Ga0070713_100062242 Ga0070713_1000622421 246
217 3300005439 Ga0070711_100017703 Ga0070711_1000177034 246
218 3300005440 Ga0070705_100150946 Ga0070705_1001509462 246
219 3300005445 Ga0070708_100037006 Ga0070708_1000370063 246
220 3300005445 Ga0070708_100189306 Ga0070708_1001893062 246
221 3300005455 Ga0070663_100020172 Ga0070663_1000201722 246
222 3300005456 Ga0070678_100003297 Ga0070678_10000329710 246
223 3300005456 Ga0070678_100022663 Ga0070678_1000226633 246
224 3300005457 Ga0070662_100100888 Ga0070662_1001008883 246
225 3300005458 Ga0070681_10011272 Ga0070681_100112724 246
226 3300005466 Ga0070685_10001933 Ga0070685_100019336 246
227 3300005535 Ga0070684_100001677 Ga0070684_10000167718 246
228 3300005535 Ga0070684_100014670 Ga0070684_1000146704 246
229 3300005535 Ga0070684_100106170 Ga0070684_1001061702 246
230 3300005539 Ga0068853_100005375 Ga0068853_1000053756 246
231 3300005543 Ga0070672_100128080 Ga0070672_1001280802 246
232 3300005563 Ga0068855_100058930 Ga0068855_1000589302 246
233 3300005577 Ga0068857_100004770 Ga0068857_1000047705 246
234 3300005577 Ga0068857_100107688 Ga0068857_1001076882 246
235 3300005578 Ga0068854_100014008 Ga0068854_1000140084 246
236 3300005578 Ga0068854_100047532 Ga0068854_1000475323 246
237 3300005614 Ga0068856_100013970 Ga0068856_1000139705 246
238 3300005614 Ga0068856_100195303 Ga0068856_1001953032 246
239 3300005614 Ga0068856_100202881 Ga0068856_1002028811 246
240 3300005615 Ga0070702_100131113 Ga0070702_1001311131 246
241 3300005616 Ga0068852_100073044 Ga0068852_1000730442 246
242 3300005718 Ga0068866_10000598 Ga0068866_100005983 246
243 3300005718 Ga0068866_10105674 Ga0068866_101056742 246
244 3300005719 Ga0068861_100004952 Ga0068861_1000049524 246
245 3300005719 Ga0068861_100086440 Ga0068861_1000864402 246
246 3300005840 Ga0068870_10001859 Ga0068870_100018596 246
247 3300005841 Ga0068863_100033173 Ga0068863_1000331732 246
248 3300005841 Ga0068863_100076640 Ga0068863_1000766403 246
249 3300005841 Ga0068863_100119501 Ga0068863_1001195013 246
250 3300005843 Ga0068860_100072721 Ga0068860_1000727213 246
251 3300005844 Ga0068862_100040805 Ga0068862_1000408052 246
252 3300006028 Ga0070717_10001917 Ga0070717_1000191713 246
253 3300006028 Ga0070717_10003179 Ga0070717_100031799 246
254 3300006173 Ga0070716_100000963 Ga0070716_10000096312 246
255 3300006175 Ga0070712_100001489 Ga0070712_1000014894 246
256 3300006175 Ga0070712_100004426 Ga0070712_1000044267 246
257 3300006175 Ga0070712_100319851 Ga0070712_1003198512 246
258 3300006237 Ga0097621_100001934 Ga0097621_1000019345 246
259 3300006237 Ga0097621_100009212 Ga0097621_1000092123 246
260 3300006358 Ga0068871_100008870 Ga0068871_1000088704 246
261 3300006358 Ga0068871_100076855 Ga0068871_1000768553 246
262 3300006852 Ga0075433_10000048 Ga0075433_1000004844 246
263 3300006871 Ga0075434_100007179 Ga0075434_1000071792 246
264 3300006871 Ga0075434_100065078 Ga0075434_1000650784 246
265 3300006914 Ga0075436_100003918 Ga0075436_1000039182 246
266 3300007076 Ga0075435_100002276 Ga0075435_1000022763 246
267 3300009093 Ga0105240_10046006 Ga0105240_100460065 246
268 3300009093 Ga0105240_10354797 Ga0105240_103547972 246
269 3300009098 Ga0105245_10043511 Ga0105245_100435113 246
270 3300009098 Ga0105245_10188012 Ga0105245_101880121 246
271 3300009147 Ga0114129_10263397 Ga0114129_102633972 246
272 3300009174 Ga0105241_10028616 Ga0105241_100286162 246
273 3300009174 Ga0105241_10068900 Ga0105241_100689003 246
274 3300009176 Ga0105242_10066838 Ga0105242_100668383 246
275 3300009177 Ga0105248_10024617 Ga0105248_100246176 246
276 3300009177 Ga0105248_10054467 Ga0105248_100544672 246
277 3300009177 Ga0105248_10061141 Ga0105248_100611412 246
278 3300009545 Ga0105237_10010940 Ga0105237_100109408 246
279 3300009551 Ga0105238_10076516 Ga0105238_100765164 246
280 3300009551 Ga0105238_10195438 Ga0105238_101954382 246
281 3300009553 Ga0105249_10110523 Ga0105249_101105234 246
282 3300010375 Ga0105239_10020769 Ga0105239_100207694 246
283 3300010375 Ga0105239_10131950 Ga0105239_101319503 246
284 3300010375 Ga0105239_10170577 Ga0105239_101705773 246
285 3300013100 Ga0157373_10009346 Ga0157373_100093464 246
286 3300013100 Ga0157373_10181386 Ga0157373_101813862 246
287 3300013102 Ga0157371_10042533 Ga0157371_100425335 246
288 3300013105 Ga0157369_10010846 Ga0157369_1001084610 246
289 3300013105 Ga0157369_10021606 Ga0157369_100216066 246
290 3300013105 Ga0157369_10047180 Ga0157369_100471804 246
291 3300013105 Ga0157369_10252144 Ga0157369_102521443 246
292 3300013105 Ga0157369_10428591 Ga0157369_104285912 246
293 3300013296 Ga0157374_10001078 Ga0157374_100010789 246
294 3300013297 Ga0157378_10000057 Ga0157378_1000005772 246
295 3300013297 Ga0157378_10000304 Ga0157378_1000030441 246
296 3300013306 Ga0163162_10108566 Ga0163162_101085662 246
297 3300013306 Ga0163162_10134902 Ga0163162_101349022 246
298 3300013307 Ga0157372_10000200 Ga0157372_1000020018 246
299 3300013307 Ga0157372_10003854 Ga0157372_100038543 246
300 3300013307 Ga0157372_10008585 Ga0157372_100085859 246
301 3300013307 Ga0157372_10018945 Ga0157372_100189452 246
302 3300013307 Ga0157372_10114379 Ga0157372_101143793 246
303 3300014325 Ga0163163_10011964 Ga0163163_100119648 246
304 3300014325 Ga0163163_10028994 Ga0163163_100289944 246
305 3300014325 Ga0163163_10047416 Ga0163163_100474162 246
306 3300014325 Ga0163163_10052362 Ga0163163_100523623 246
307 3300014325 Ga0163163_10231656 Ga0163163_102316562 246
308 3300014745 Ga0157377_10122308 Ga0157377_101223081 246
309 3300014969 Ga0157376_10150773 Ga0157376_101507732 246
310 3300014969 Ga0157376_10842264 Ga0157376_108422641 246
311 3300014969 Ga0157376_10851861 Ga0157376_108518612 246
312 3300017792 Ga0163161_10003804 Ga0163161_100038046 246
313 3300021358 Ga0213873_10020184 Ga0213873_100201842 246
314 3300025315 Ga0207697_10024904 Ga0207697_100249041 246
315 3300025893 Ga0207682_10063867 Ga0207682_100638673 246
316 3300025898 Ga0207692_10150872 Ga0207692_101508722 246
317 3300025904 Ga0207647_10024407 Ga0207647_100244073 246
318 3300025906 Ga0207699_10448100 Ga0207699_104481001 246
319 3300025907 Ga0207645_10000551 Ga0207645_1000055116 246
320 3300025908 Ga0207643_10002140 Ga0207643_100021403 246
321 3300025910 Ga0207684_10279783 Ga0207684_102797832 246
322 3300025911 Ga0207654_10048036 Ga0207654_100480363 246
323 3300025912 Ga0207707_10002456 Ga0207707_100024563 246
324 3300025913 Ga0207695_10058048 Ga0207695_100580484 246
325 3300025913 Ga0207695_10252313 Ga0207695_102523132 246
326 3300025915 Ga0207693_10009791 Ga0207693_100097917 246
327 3300025915 Ga0207693_10026726 Ga0207693_100267262 246
328 3300025916 Ga0207663_10070270 Ga0207663_100702702 246
329 3300025916 Ga0207663_10286619 Ga0207663_102866192 246
330 3300025918 Ga0207662_10004460 Ga0207662_100044606 246
331 3300025919 Ga0207657_10003665 Ga0207657_1000366517 246
332 3300025920 Ga0207649_10001493 Ga0207649_100014934 246
333 3300025922 Ga0207646_10217352 Ga0207646_102173522 246
334 3300025925 Ga0207650_10000045 Ga0207650_10000045142 246
335 3300025927 Ga0207687_10047387 Ga0207687_100473874 246
336 3300025928 Ga0207700_10146715 Ga0207700_101467153 246
337 3300025928 Ga0207700_10645546 Ga0207700_106455461 246
338 3300025929 Ga0207664_10048706 Ga0207664_100487063 246
339 3300025934 Ga0207686_10131534 Ga0207686_101315341 246
340 3300025936 Ga0207670_10308095 Ga0207670_103080952 246
341 3300025939 Ga0207665_10001295 Ga0207665_1000129516 246
342 3300025939 Ga0207665_10287210 Ga0207665_102872102 246
343 3300025940 Ga0207691_10004307 Ga0207691_1000430710 246
344 3300025941 Ga0207711_10021084 Ga0207711_100210846 246
345 3300025941 Ga0207711_10057050 Ga0207711_100570502 246
346 3300025941 Ga0207711_10204551 Ga0207711_102045513 246
347 3300025942 Ga0207689_10004596 Ga0207689_100045966 246
348 3300025944 Ga0207661_10000131 Ga0207661_1000013119 246
349 3300025945 Ga0207679_10000283 Ga0207679_1000028312 246
350 3300025945 Ga0207679_10234442 Ga0207679_102344422 246
351 3300025949 Ga0207667_10846263 Ga0207667_108462631 246
352 3300025960 Ga0207651_10029577 Ga0207651_100295773 246
353 3300025960 Ga0207651_10039352 Ga0207651_100393524 246
354 3300025981 Ga0207640_10031062 Ga0207640_100310622 246
355 3300025986 Ga0207658_10003108 Ga0207658_1000310810 246
356 3300026035 Ga0207703_10008464 Ga0207703_100084644 246
357 3300026041 Ga0207639_10286015 Ga0207639_102860151 246
358 3300026067 Ga0207678_10000026 Ga0207678_100000266 246
359 3300026078 Ga0207702_10005337 Ga0207702_100053377 246
360 3300026078 Ga0207702_10145132 Ga0207702_101451321 246
361 3300026088 Ga0207641_10000021 Ga0207641_1000002111 246
362 3300026088 Ga0207641_10112651 Ga0207641_101126512 246
363 3300026089 Ga0207648_10000611 Ga0207648_1000061130 246
364 3300026089 Ga0207648_10070587 Ga0207648_100705873 246
365 3300026095 Ga0207676_10000096 Ga0207676_1000009629 246
366 3300026095 Ga0207676_10541104 Ga0207676_105411041 246
367 3300026116 Ga0207674_10000246 Ga0207674_1000024629 246
368 3300026116 Ga0207674_10006208 Ga0207674_100062087 246
369 3300026116 Ga0207674_10009607 Ga0207674_100096075 246
370 3300026118 Ga0207675_100048302 Ga0207675_1000483024 246
371 3300026121 Ga0207683_10000259 Ga0207683_1000025938 246
372 3300026121 Ga0207683_10113947 Ga0207683_101139472 246
373 3300028379 Ga0268266_10006040 Ga0268266_100060403 246
374 3300028380 Ga0268265_10005648 Ga0268265_100056486 246
375 3300028381 Ga0268264_10004345 Ga0268264_1000434511 246
376 3300028381 Ga0268264_10140172 Ga0268264_101401721 246
377 3300028800 Ga0265338_10001717 Ga0265338_1000171720 246
378 3300031249 Ga0265339_10001780 Ga0265339_1000178012 246
379 3300031250 Ga0265331_10061776 Ga0265331_100617762 246
380 3300031344 Ga0265316_10012757 Ga0265316_100127575 246
381 3300031548 Ga0307408_100242572 Ga0307408_1002425722 246
382 3300031731 Ga0307405_10018003 Ga0307405_100180031 246
383 3300031852 Ga0307410_10026642 Ga0307410_100266422 246
384 3300031852 Ga0307410_10156905 Ga0307410_101569052 246
385 3300031995 Ga0307409_100313410 Ga0307409_1003134102 246
386 3300032002 Ga0307416_100183907 Ga0307416_1001839072 246
387 3300032005 Ga0307411_10314839 Ga0307411_103148392 246
388 3300032126 Ga0307415_100016974 Ga0307415_1000169743 246
389 3300035118 Ga0373954_0083902 Ga0373954_0083902_136_939 246
390 3300035692 Ga0373935_0392149 Ga0373935_0392149_176_973 246
391 3300035724 Ga0373933_0104999 Ga0373933_0104999_465_1268 246
392 3300037471 Ga0395905_0005720 Ga0395905_0005720_4501_5298 246
393 3300037471 Ga0395905_0015774 Ga0395905_0015774_4414_5211 246
394 3300039453 Ga0436362_0155418 Ga0436362_0155418_1324_2127 246
395 3300044673 Ga0453683_0025944 Ga0453683_0025944_1700_2509 246
396 3300045976 Ga0466967_0824223 Ga0466967_0824223_58_861 246
397 3300046463 Ga0495653_0272272 Ga0495653_0272272_212_1015 246
398 3300046472 Ga0495580_0002151 Ga0495580_0002151_1382_2182 246
399 3300046472 Ga0495580_0005568 Ga0495580_0005568_9268_10065 246
400 3300046472 Ga0495580_0282665 Ga0495580_0282665_211_1011 246
401 3300046511 Ga0495608_0206802 Ga0495608_0206802_371_1174 246
402 3300046543 Ga0495645_0291642 Ga0495645_0291642_97_900 246
403 3300046684 Ga0495669_0013822 Ga0495669_0013822_1282_2085 246
404 3300047319 Ga0495674_0487601 Ga0495674_0487601_141_944 246
405 3300047471 Ga0495684_0153451 Ga0495684_0153451_532_1335 246
406 3300048911 Ga0496108_0000605 Ga0496108_0000605_8275_9072 246
407 3300048912 Ga0496109_0000132 Ga0496109_0000132_5434_6231 246
408 3300048912 Ga0496109_0011172 Ga0496109_0011172_5929_6732 246
409 3300048913 Ga0496110_0001437 Ga0496110_0001437_10312_11109 246
410 3300048915 Ga0496112_0000464 Ga0496112_0000464_12045_12842 246
411 3300048915 Ga0496112_0148660 Ga0496112_0148660_181_984 246
412 3300049517 Ga0501294_007687 Ga0501294_007687_173_985 246
413 3300049521 Ga0501298_020448 Ga0501298_020448_180_986 246
414 3300049769 Ga0501272_004372 Ga0501272_004372_589_1395 246
415 3300050512 nmdc:mga0n895_128602_c1 nmdc:mga0n895_128602_c1_1528_2337 246
416 3300050512 nmdc:mga0n895_345_c1 nmdc:mga0n895_345_c1_29696_30493 246
417 3300050513 nmdc:mga0rr50_1877_c1 nmdc:mga0rr50_1877_c1_9690_10487 246
418 3300050515 nmdc:mga0a205_107_c2 nmdc:mga0a205_107_c2_1199_1996 246
419 3300005434 Ga0070709_10008666 Ga0070709_100086662 247
420 3300005434 Ga0070709_10204510 Ga0070709_102045102 247
421 3300005434 Ga0070709_10334746 Ga0070709_103347461 247
422 3300005435 Ga0070714_100062248 Ga0070714_1000622484 247
423 3300005435 Ga0070714_100114506 Ga0070714_1001145062 247
424 3300005435 Ga0070714_100145420 Ga0070714_1001454203 247
425 3300005436 Ga0070713_100127102 Ga0070713_1001271022 247
426 3300005436 Ga0070713_100128753 Ga0070713_1001287532 247
427 3300005436 Ga0070713_100173917 Ga0070713_1001739172 247
428 3300005439 Ga0070711_100033693 Ga0070711_1000336933 247
429 3300005439 Ga0070711_100075664 Ga0070711_1000756641 247
430 3300005445 Ga0070708_100081114 Ga0070708_1000811143 247
431 3300005445 Ga0070708_100158945 Ga0070708_1001589452 247
432 3300005445 Ga0070708_100790906 Ga0070708_1007909061 247
433 3300005467 Ga0070706_100017064 Ga0070706_1000170644 247
434 3300005467 Ga0070706_100022122 Ga0070706_1000221221 247
435 3300005468 Ga0070707_100184084 Ga0070707_1001840842 247
436 3300005518 Ga0070699_100007250 Ga0070699_10000725010 247
437 3300005536 Ga0070697_100000111 Ga0070697_10000011143 247
438 3300005536 Ga0070697_100022916 Ga0070697_1000229164 247
439 3300005536 Ga0070697_100025982 Ga0070697_1000259823 247
440 3300005536 Ga0070697_100279249 Ga0070697_1002792492 247
441 3300005842 Ga0068858_100037929 Ga0068858_1000379294 247
442 3300006028 Ga0070717_10005046 Ga0070717_100050465 247
443 3300006028 Ga0070717_10014384 Ga0070717_100143844 247
444 3300006028 Ga0070717_10037304 Ga0070717_100373045 247
445 3300006028 Ga0070717_10290734 Ga0070717_102907342 247
446 3300006028 Ga0070717_10326139 Ga0070717_103261392 247
447 3300006173 Ga0070716_100037319 Ga0070716_1000373193 247
448 3300006173 Ga0070716_100059096 Ga0070716_1000590962 247
449 3300006175 Ga0070712_100394155 Ga0070712_1003941552 247
450 3300006237 Ga0097621_100032470 Ga0097621_1000324704 247
451 3300006358 Ga0068871_100026158 Ga0068871_1000261582 247
452 3300006358 Ga0068871_100535561 Ga0068871_1005355612 247
453 3300006358 Ga0068871_100537222 Ga0068871_1005372222 247
454 3300006914 Ga0075436_100024846 Ga0075436_1000248464 247
455 3300006914 Ga0075436_100032947 Ga0075436_1000329473 247
456 3300007076 Ga0075435_100028468 Ga0075435_1000284683 247
457 3300009093 Ga0105240_10009676 Ga0105240_100096766 247
458 3300009101 Ga0105247_10117309 Ga0105247_101173092 247
459 3300013296 Ga0157374_10292023 Ga0157374_102920232 247
460 3300013307 Ga0157372_10202191 Ga0157372_102021911 247
461 3300014968 Ga0157379_10002438 Ga0157379_100024389 247
462 3300014969 Ga0157376_10018903 Ga0157376_100189036 247
463 3300021377 Ga0213874_10074028 Ga0213874_100740281 247
464 3300024227 Ga0228598_1003592 Ga0228598_10035924 247
465 3300025901 Ga0207688_10093312 Ga0207688_100933122 247
466 3300025906 Ga0207699_10008930 Ga0207699_100089304 247
467 3300025906 Ga0207699_10021420 Ga0207699_100214204 247
468 3300025906 Ga0207699_10036191 Ga0207699_100361915 247
469 3300025906 Ga0207699_10238930 Ga0207699_102389302 247
470 3300025910 Ga0207684_10064619 Ga0207684_100646192 247
471 3300025913 Ga0207695_10024396 Ga0207695_100243968 247
472 3300025913 Ga0207695_10176066 Ga0207695_101760663 247
473 3300025916 Ga0207663_10122908 Ga0207663_101229082 247
474 3300025928 Ga0207700_10147114 Ga0207700_101471143 247
475 3300025928 Ga0207700_10203610 Ga0207700_102036102 247
476 3300025929 Ga0207664_10011058 Ga0207664_100110587 247
477 3300025929 Ga0207664_10124402 Ga0207664_101244023 247
478 3300025929 Ga0207664_10746112 Ga0207664_107461121 247
479 3300025939 Ga0207665_10067636 Ga0207665_100676364 247
480 3300025939 Ga0207665_10203739 Ga0207665_102037392 247
481 3300025945 Ga0207679_10455080 Ga0207679_104550801 247
482 3300031235 Ga0265330_10009079 Ga0265330_100090792 247
483 3300031247 Ga0265340_10037738 Ga0265340_100377383 247
484 3300031249 Ga0265339_10079860 Ga0265339_100798602 247
485 3300035725 Ga0373947_0271652 Ga0373947_0271652_232_1035 247
486 3300036401 Ga0373937_0018912 Ga0373937_0018912_746_1549 247
487 3300039437 Ga0436365_0913571 Ga0436365_0913571_335_1138 247
488 3300039450 Ga0436363_0108166 Ga0436363_0108166_175_978 247
489 3300039450 Ga0436363_0644861 Ga0436363_0644861_139_942 247
490 3300039450 Ga0436363_1342541 Ga0436363_1342541_835_1638 247
491 3300046472 Ga0495580_0004470 Ga0495580_0004470_1418_2224 247
492 3300046472 Ga0495580_0042668 Ga0495580_0042668_931_1737 247
493 3300046472 Ga0495580_0096651 Ga0495580_0096651_1187_1990 247
494 3300046531 Ga0495665_0018105 Ga0495665_0018105_194_1000 247
495 3300047315 Ga0495581_0122147 Ga0495581_0122147_467_1273 247
496 3300048904 Ga0496101_0127407 Ga0496101_0127407_425_1228 247
497 3300048905 Ga0496102_0008569 Ga0496102_0008569_1085_1888 247
498 3300048905 Ga0496102_0013555 Ga0496102_0013555_477_1277 247
499 3300048906 Ga0496103_0022061 Ga0496103_0022061_1641_2444 247
500 3300048907 Ga0496104_0206179 Ga0496104_0206179_182_985 247
501 3300050512 nmdc:mga0n895_1448_c1 nmdc:mga0n895_1448_c1_4048_4851 247
502 3300050514 nmdc:mga08x19_18672_c1 nmdc:mga08x19_18672_c1_2637_3440 247
503 3300050514 nmdc:mga08x19_2129_c2 nmdc:mga08x19_2129_c2_1446_2264 247
504 3300005290 Ga0065712_10246933 Ga0065712_102469331 248
505 3300005293 Ga0065715_10145026 Ga0065715_101450261 248
506 3300005293 Ga0065715_10407363 Ga0065715_104073631 248
507 3300005329 Ga0070683_100100788 Ga0070683_1001007882 248
508 3300005330 Ga0070690_100130224 Ga0070690_1001302242 248
509 3300005334 Ga0068869_100006311 Ga0068869_1000063118 248
510 3300005334 Ga0068869_100401888 Ga0068869_1004018882 248
511 3300005335 Ga0070666_10034392 Ga0070666_100343923 248
512 3300005336 Ga0070680_100023130 Ga0070680_1000231306 248
513 3300005337 Ga0070682_100002535 Ga0070682_1000025355 248
514 3300005339 Ga0070660_100043786 Ga0070660_1000437863 248
515 3300005340 Ga0070689_100028593 Ga0070689_1000285932 248
516 3300005343 Ga0070687_100331765 Ga0070687_1003317652 248
517 3300005344 Ga0070661_100019010 Ga0070661_1000190105 248
518 3300005347 Ga0070668_100008093 Ga0070668_1000080936 248
519 3300005353 Ga0070669_100177950 Ga0070669_1001779502 248
520 3300005354 Ga0070675_100342055 Ga0070675_1003420552 248
521 3300005366 Ga0070659_100015849 Ga0070659_1000158496 248
522 3300005367 Ga0070667_100012738 Ga0070667_1000127386 248
523 3300005434 Ga0070709_10357201 Ga0070709_103572012 248
524 3300005435 Ga0070714_100081406 Ga0070714_1000814062 248
525 3300005436 Ga0070713_100076581 Ga0070713_1000765812 248
526 3300005437 Ga0070710_10022575 Ga0070710_100225752 248
527 3300005444 Ga0070694_100075969 Ga0070694_1000759691 248
528 3300005455 Ga0070663_100016064 Ga0070663_1000160642 248
529 3300005457 Ga0070662_100002565 Ga0070662_1000025659 248
530 3300005459 Ga0068867_100016423 Ga0068867_1000164234 248
531 3300005459 Ga0068867_100232568 Ga0068867_1002325681 248
532 3300005466 Ga0070685_10093357 Ga0070685_100933572 248
533 3300005467 Ga0070706_100000499 Ga0070706_10000049938 248
534 3300005467 Ga0070706_100109918 Ga0070706_1001099183 248
535 3300005518 Ga0070699_100387798 Ga0070699_1003877982 248
536 3300005518 Ga0070699_100489442 Ga0070699_1004894422 248
537 3300005535 Ga0070684_100015349 Ga0070684_1000153493 248
538 3300005539 Ga0068853_100018379 Ga0068853_1000183797 248
539 3300005539 Ga0068853_100157381 Ga0068853_1001573812 248
540 3300005545 Ga0070695_100015812 Ga0070695_1000158125 248
541 3300005546 Ga0070696_100141341 Ga0070696_1001413411 248
542 3300005548 Ga0070665_100008351 Ga0070665_1000083518 248
543 3300005548 Ga0070665_100124026 Ga0070665_1001240263 248
544 3300005548 Ga0070665_100815155 Ga0070665_1008151551 248
545 3300005563 Ga0068855_100119682 Ga0068855_1001196823 248
546 3300005563 Ga0068855_100133493 Ga0068855_1001334933 248
547 3300005564 Ga0070664_100054375 Ga0070664_1000543752 248
548 3300005578 Ga0068854_100022674 Ga0068854_1000226742 248
549 3300005614 Ga0068856_100045755 Ga0068856_1000457552 248
550 3300005616 Ga0068852_100008868 Ga0068852_1000088685 248
551 3300005617 Ga0068859_100029696 Ga0068859_1000296965 248
552 3300005617 Ga0068859_100107366 Ga0068859_1001073663 248
553 3300005718 Ga0068866_10109412 Ga0068866_101094123 248
554 3300005719 Ga0068861_100058819 Ga0068861_1000588192 248
555 3300005719 Ga0068861_100068073 Ga0068861_1000680732 248
556 3300005840 Ga0068870_10034485 Ga0068870_100344853 248
557 3300005841 Ga0068863_100027936 Ga0068863_1000279365 248
558 3300005841 Ga0068863_100169603 Ga0068863_1001696033 248
559 3300005841 Ga0068863_100278670 Ga0068863_1002786701 248
560 3300005842 Ga0068858_100008051 Ga0068858_10000805111 248
561 3300005842 Ga0068858_100400035 Ga0068858_1004000352 248
562 3300005843 Ga0068860_100011415 Ga0068860_1000114154 248
563 3300005843 Ga0068860_100017651 Ga0068860_1000176514 248
564 3300005844 Ga0068862_100039922 Ga0068862_1000399222 248
565 3300005844 Ga0068862_100048021 Ga0068862_1000480211 248
566 3300006028 Ga0070717_10009320 Ga0070717_100093207 248
567 3300006028 Ga0070717_10223765 Ga0070717_102237651 248
568 3300006173 Ga0070716_100017261 Ga0070716_1000172613 248
569 3300006175 Ga0070712_100028835 Ga0070712_1000288353 248
570 3300006237 Ga0097621_100083976 Ga0097621_1000839763 248
571 3300006237 Ga0097621_100666514 Ga0097621_1006665141 248
572 3300006358 Ga0068871_100017378 Ga0068871_1000173787 248
573 3300006871 Ga0075434_100138002 Ga0075434_1001380023 248
574 3300006871 Ga0075434_100273872 Ga0075434_1002738722 248
575 3300006881 Ga0068865_100046813 Ga0068865_1000468132 248
576 3300006881 Ga0068865_100085305 Ga0068865_1000853052 248
577 3300006914 Ga0075436_100006016 Ga0075436_10000601611 248
578 3300006931 Ga0097620_100029691 Ga0097620_1000296915 248
579 3300006931 Ga0097620_100107371 Ga0097620_1001073713 248
580 3300007076 Ga0075435_100108003 Ga0075435_1001080033 248
581 3300007076 Ga0075435_100159998 Ga0075435_1001599983 248
582 3300009092 Ga0105250_10059427 Ga0105250_100594272 248
583 3300009098 Ga0105245_10021687 Ga0105245_100216877 248
584 3300009098 Ga0105245_10134582 Ga0105245_101345823 248
585 3300009098 Ga0105245_10318767 Ga0105245_103187672 248
586 3300009101 Ga0105247_10170366 Ga0105247_101703662 248
587 3300009148 Ga0105243_10065709 Ga0105243_100657092 248
588 3300009174 Ga0105241_10021553 Ga0105241_100215533 248
589 3300009177 Ga0105248_10097481 Ga0105248_100974813 248
590 3300009545 Ga0105237_10090403 Ga0105237_100904032 248
591 3300009545 Ga0105237_10127258 Ga0105237_101272583 248
592 3300009545 Ga0105237_10129749 Ga0105237_101297492 248
593 3300009551 Ga0105238_10011948 Ga0105238_100119485 248
594 3300009553 Ga0105249_10010877 Ga0105249_100108778 248
595 3300010375 Ga0105239_10066265 Ga0105239_100662654 248
596 3300011119 Ga0105246_10130306 Ga0105246_101303061 248
597 3300013102 Ga0157371_10011620 Ga0157371_100116202 248
598 3300013105 Ga0157369_10014078 Ga0157369_100140787 248
599 3300013105 Ga0157369_10406164 Ga0157369_104061641 248
600 3300013296 Ga0157374_10003563 Ga0157374_1000356313 248
601 3300013296 Ga0157374_10069754 Ga0157374_100697542 248
602 3300013296 Ga0157374_10093357 Ga0157374_100933573 248
603 3300013297 Ga0157378_10014035 Ga0157378_100140353 248
604 3300013297 Ga0157378_10314628 Ga0157378_103146282 248
605 3300013306 Ga0163162_10013577 Ga0163162_100135778 248
606 3300013306 Ga0163162_10477484 Ga0163162_104774841 248
607 3300013307 Ga0157372_10070788 Ga0157372_100707884 248
608 3300013308 Ga0157375_10335189 Ga0157375_103351891 248
609 3300014325 Ga0163163_10082546 Ga0163163_100825462 248
610 3300014968 Ga0157379_10041098 Ga0157379_100410984 248
611 3300014968 Ga0157379_10329788 Ga0157379_103297882 248
612 3300014969 Ga0157376_10120856 Ga0157376_101208563 248
613 3300014969 Ga0157376_10150939 Ga0157376_101509391 248
614 3300025321 Ga0207656_10072464 Ga0207656_100724642 248
615 3300025898 Ga0207692_10049371 Ga0207692_100493711 248
616 3300025899 Ga0207642_10049092 Ga0207642_100490922 248
617 3300025899 Ga0207642_10167243 Ga0207642_101672431 248
618 3300025903 Ga0207680_10067798 Ga0207680_100677982 248
619 3300025904 Ga0207647_10005883 Ga0207647_100058834 248
620 3300025906 Ga0207699_10358348 Ga0207699_103583482 248
621 3300025907 Ga0207645_10004243 Ga0207645_100042434 248
622 3300025910 Ga0207684_10016288 Ga0207684_100162886 248
623 3300025910 Ga0207684_10077797 Ga0207684_100777973 248
624 3300025913 Ga0207695_10016407 Ga0207695_100164077 248
625 3300025913 Ga0207695_10440108 Ga0207695_104401082 248
626 3300025914 Ga0207671_10009068 Ga0207671_100090686 248
627 3300025914 Ga0207671_10131643 Ga0207671_101316431 248
628 3300025915 Ga0207693_10010388 Ga0207693_100103884 248
629 3300025916 Ga0207663_10217699 Ga0207663_102176991 248
630 3300025918 Ga0207662_10314459 Ga0207662_103144591 248
631 3300025919 Ga0207657_10009009 Ga0207657_100090098 248
632 3300025920 Ga0207649_10127147 Ga0207649_101271472 248
633 3300025923 Ga0207681_10184901 Ga0207681_101849012 248
634 3300025925 Ga0207650_10257958 Ga0207650_102579582 248
635 3300025927 Ga0207687_10114864 Ga0207687_101148642 248
636 3300025928 Ga0207700_10026354 Ga0207700_100263544 248
637 3300025928 Ga0207700_10217446 Ga0207700_102174462 248
638 3300025933 Ga0207706_10003060 Ga0207706_100030601 248
639 3300025934 Ga0207686_10147256 Ga0207686_101472562 248
640 3300025935 Ga0207709_10050443 Ga0207709_100504431 248
641 3300025936 Ga0207670_10186756 Ga0207670_101867562 248
642 3300025939 Ga0207665_10004259 Ga0207665_100042597 248
643 3300025939 Ga0207665_10060541 Ga0207665_100605413 248
644 3300025939 Ga0207665_10272350 Ga0207665_102723502 248
645 3300025941 Ga0207711_10118544 Ga0207711_101185441 248
646 3300025942 Ga0207689_10009031 Ga0207689_100090312 248
647 3300025942 Ga0207689_10018148 Ga0207689_100181483 248
648 3300025944 Ga0207661_10125130 Ga0207661_101251303 248
649 3300025949 Ga0207667_10047229 Ga0207667_100472295 248
650 3300025961 Ga0207712_10011555 Ga0207712_100115557 248
651 3300025972 Ga0207668_10017040 Ga0207668_100170402 248
652 3300025981 Ga0207640_10156562 Ga0207640_101565622 248
653 3300025981 Ga0207640_10302945 Ga0207640_103029452 248
654 3300026035 Ga0207703_10003528 Ga0207703_1000352811 248
655 3300026035 Ga0207703_10039474 Ga0207703_100394743 248
656 3300026041 Ga0207639_10131743 Ga0207639_101317432 248
657 3300026067 Ga0207678_10001488 Ga0207678_100014888 248
658 3300026088 Ga0207641_10070055 Ga0207641_100700552 248
659 3300026088 Ga0207641_10102549 Ga0207641_101025492 248
660 3300026089 Ga0207648_10006630 Ga0207648_100066309 248
661 3300026089 Ga0207648_10030195 Ga0207648_100301954 248
662 3300026116 Ga0207674_10022219 Ga0207674_100222193 248
663 3300026118 Ga0207675_100099837 Ga0207675_1000998373 248
664 3300028017 Ga0265356_1012459 Ga0265356_10124591 248
665 3300028379 Ga0268266_10016584 Ga0268266_100165843 248
666 3300028379 Ga0268266_10433877 Ga0268266_104338771 248
667 3300028380 Ga0268265_10082287 Ga0268265_100822871 248
668 3300028381 Ga0268264_10044109 Ga0268264_100441094 248
669 3300031018 Ga0265773_1005274 Ga0265773_10052741 248
670 3300031090 Ga0265760_10003748 Ga0265760_100037485 248
671 3300031344 Ga0265316_10006906 Ga0265316_100069064 248
672 3300031711 Ga0265314_10004769 Ga0265314_100047697 248
673 3300035089 Ga0373944_0015522 Ga0373944_0015522_718_1521 248
674 3300035113 Ga0373936_0029250 Ga0373936_0029250_181_993 248
675 3300035691 Ga0373931_0025139 Ga0373931_0025139_1499_2302 248
676 3300035692 Ga0373935_0157587 Ga0373935_0157587_109_918 248
677 3300035695 Ga0373927_0012227 Ga0373927_0012227_2216_3028 248
678 3300037068 Ga0373925_0004417 Ga0373925_0004417_3404_4216 248
679 3300037068 Ga0373925_0017930 Ga0373925_0017930_2947_3756 248
680 3300045051 Ga0451576_0221217 Ga0451576_0221217_488_1291 248
681 3300046472 Ga0495580_0002108 Ga0495580_0002108_13295_14107 248
682 3300046472 Ga0495580_0002538 Ga0495580_0002538_4030_4833 248
683 3300046472 Ga0495580_0009075 Ga0495580_0009075_1224_2033 248
684 3300046473 Ga0495582_0000074 Ga0495582_0000074_13535_14347 248
685 3300046531 Ga0495665_0000640 Ga0495665_0000640_5565_6377 248
686 3300047315 Ga0495581_0026361 Ga0495581_0026361_1922_2734 248
687 3300048903 Ga0496100_0106014 Ga0496100_0106014_143_946 248
688 3300048905 Ga0496102_0327715 Ga0496102_0327715_49_852 248
689 3300048908 Ga0496105_0575347 Ga0496105_0575347_10_813 248
690 3300048909 Ga0496106_0110030 Ga0496106_0110030_338_1141 248
691 3300048910 Ga0496107_0070997 Ga0496107_0070997_739_1542 248
692 3300048912 Ga0496109_0075326 Ga0496109_0075326_333_1136 248
693 3300048915 Ga0496112_0046418 Ga0496112_0046418_511_1314 248
694 3300048915 Ga0496112_0073440 Ga0496112_0073440_2300_3103 248
695 3300048915 Ga0496112_0645398 Ga0496112_0645398_146_949 248
696 3300050512 nmdc:mga0n895_46359_c2 nmdc:mga0n895_46359_c2_1179_1982 248
697 3300050514 nmdc:mga08x19_6332_c1 nmdc:mga08x19_6332_c1_1232_2044 248
698 2162886011 MRS1b_contig_9212784 MRS1b_0256.00001640 249
699 3300005290 Ga0065712_10117566 Ga0065712_101175662 249
700 3300005328 Ga0070676_10170230 Ga0070676_101702302 249
701 3300005329 Ga0070683_100200734 Ga0070683_1002007342 249
702 3300005331 Ga0070670_100186273 Ga0070670_1001862732 249
703 3300005339 Ga0070660_100032389 Ga0070660_1000323892 249
704 3300005344 Ga0070661_100034867 Ga0070661_1000348672 249
705 3300005457 Ga0070662_100068638 Ga0070662_1000686381 249
706 3300005458 Ga0070681_10206078 Ga0070681_102060781 249
707 3300005547 Ga0070693_100113701 Ga0070693_1001137013 249
708 3300005563 Ga0068855_100033223 Ga0068855_1000332236 249
709 3300005564 Ga0070664_100020262 Ga0070664_1000202624 249
710 3300005614 Ga0068856_100013950 Ga0068856_1000139506 249
711 3300005616 Ga0068852_100237967 Ga0068852_1002379672 249
712 3300009177 Ga0105248_10057988 Ga0105248_100579885 249
713 3300009545 Ga0105237_10037740 Ga0105237_100377406 249
714 3300010375 Ga0105239_10133705 Ga0105239_101337053 249
715 3300013105 Ga0157369_10124427 Ga0157369_101244272 249
716 3300013297 Ga0157378_10017752 Ga0157378_100177524 249
717 3300013306 Ga0163162_10117086 Ga0163162_101170863 249
718 3300014325 Ga0163163_10466176 Ga0163163_104661762 249
719 3300025321 Ga0207656_10084586 Ga0207656_100845862 249
720 3300025913 Ga0207695_10577129 Ga0207695_105771291 249
721 3300025919 Ga0207657_10002740 Ga0207657_1000274012 249
722 3300025920 Ga0207649_10035538 Ga0207649_100355383 249
723 3300025924 Ga0207694_10020189 Ga0207694_100201895 249
724 3300025931 Ga0207644_10328554 Ga0207644_103285541 249
725 3300025933 Ga0207706_10037894 Ga0207706_100378944 249
726 3300025941 Ga0207711_10035712 Ga0207711_100357122 249
727 3300025945 Ga0207679_10251611 Ga0207679_102516112 249
728 3300025949 Ga0207667_10095084 Ga0207667_100950843 249
729 3300026041 Ga0207639_10089777 Ga0207639_100897772 249
730 3300026078 Ga0207702_10076023 Ga0207702_100760233 249
731 3300026088 Ga0207641_10626665 Ga0207641_106266652 249
732 3300048907 Ga0496104_0599097 Ga0496104_0599097_122_928 249
733 3300048909 Ga0496106_0077026 Ga0496106_0077026_1098_1904 249
734 3300048911 Ga0496108_0101207 Ga0496108_0101207_1255_2061 249
735 3300048912 Ga0496109_0148872 Ga0496109_0148872_741_1547 249
736 3300048913 Ga0496110_0053666 Ga0496110_0053666_600_1406 249
737 3300048914 Ga0496111_0017498 Ga0496111_0017498_824_1630 249
738 3300048915 Ga0496112_0422625 Ga0496112_0422625_294_1100 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

55

268

0.97

Feature Viewer

pLDDT pTM Quality
57.59 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map