F478394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 255 | 738 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300025945|Ga0207679_10455080|Ga0207679_104550801 |
| Length | 297 |
| Sequence | VGVLGEELAQAVESCLPGRAPLLDPALGGAQRLGPHLAGAHPSALLRADEAAGLQHLEELRRRIIYSIIAVGVGFFFCWGYASRIYALMQKPIIDVLHSHNLPEKLVFLSPTEPFNLYLKIGFMSGIFVASPFVLYQLWMFISPGLYRNEKRYVFPFMGSTIILFAAGAVFGYKLVYPQALNFLIEYGVQFQPMITIGEYTDLFLTIILGLGVIFELPILVFFLALMGVVSAGWMWRNLRYSILGIFTIAAIVTPTTDIMNMCLFAAPMIILYVISIAIAWFVHPRQRKARQARKNQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 248 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 249 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 250 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.2 |
| Rhizosphere | 94.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_9212784 | 2162886011 | Unclassified | 1242 |
| 2 | JGI24737J22298_10050251 | 3300001990 | Unclassified | 1268 |
| 3 | JGI24743J22301_10031702 | 3300001991 | Synthetic | 1042 |
| 4 | Ga0065712_10117106 | 3300005290 | Bacteria | 1714 |
| 5 | Ga0065712_10117566 | 3300005290 | Unclassified | 1718 |
| 6 | Ga0065712_10246933 | 3300005290 | Bacteria | 969 |
| 7 | Ga0065712_10272610 | 3300005290 | Bacteria | 912 |
| 8 | Ga0065715_10145026 | 3300005293 | Bacteria | 1799 |
| 9 | Ga0065715_10407363 | 3300005293 | Bacteria | 874 |
| 10 | Ga0070658_10552986 | 3300005327 | Bacteria | 996 |
| 11 | Ga0070676_10170230 | 3300005328 | Unclassified | 1408 |
| 12 | Ga0070683_100000996 | 3300005329 | Bacteria | 21213 |
| 13 | Ga0070683_100073142 | 3300005329 | Unclassified | 3201 |
| 14 | Ga0070683_100100788 | 3300005329 | Unclassified | 2719 |
| 15 | Ga0070683_100200734 | 3300005329 | Unclassified | 1894 |
| 16 | Ga0070690_100130224 | 3300005330 | Bacteria | 1698 |
| 17 | Ga0070690_100178498 | 3300005330 | Unclassified | 1466 |
| 18 | Ga0070670_100010214 | 3300005331 | Bacteria | 8011 |
| 19 | Ga0070670_100022664 | 3300005331 | Bacteria | 5404 |
| 20 | Ga0070670_100186273 | 3300005331 | Unclassified | 1802 |
| 21 | Ga0070670_100217955 | 3300005331 | Bacteria | 1660 |
| 22 | Ga0070677_10022501 | 3300005333 | Bacteria | 2323 |
| 23 | Ga0068869_100006311 | 3300005334 | Bacteria | 7506 |
| 24 | Ga0068869_100401888 | 3300005334 | Bacteria | 1127 |
| 25 | Ga0070666_10034392 | 3300005335 | Unclassified | 3358 |
| 26 | Ga0070680_100023130 | 3300005336 | Unclassified | 4954 |
| 27 | Ga0070680_100076357 | 3300005336 | Bacteria | 2758 |
| 28 | Ga0070682_100002535 | 3300005337 | Bacteria | 10083 |
| 29 | Ga0068868_100003985 | 3300005338 | Bacteria | 10312 |
| 30 | Ga0068868_100006259 | 3300005338 | Bacteria | 8418 |
| 31 | Ga0068868_100282120 | 3300005338 | Bacteria | 1406 |
| 32 | Ga0070660_100006382 | 3300005339 | Bacteria | 8171 |
| 33 | Ga0070660_100032389 | 3300005339 | Bacteria | 3933 |
| 34 | Ga0070660_100043786 | 3300005339 | Unclassified | 3421 |
| 35 | Ga0070660_100421576 | 3300005339 | Bacteria | 1105 |
| 36 | Ga0070689_100000844 | 3300005340 | Bacteria | 19045 |
| 37 | Ga0070689_100028593 | 3300005340 | Bacteria | 4215 |
| 38 | Ga0070689_100320977 | 3300005340 | Bacteria | 1293 |
| 39 | Ga0070687_100002055 | 3300005343 | Bacteria | 7398 |
| 40 | Ga0070687_100331765 | 3300005343 | Bacteria | 975 |
| 41 | Ga0070661_100019010 | 3300005344 | Bacteria | 4891 |
| 42 | Ga0070661_100034867 | 3300005344 | Bacteria | 3651 |
| 43 | Ga0070668_100008093 | 3300005347 | Bacteria | 7809 |
| 44 | Ga0070668_100078168 | 3300005347 | Bacteria | 2587 |
| 45 | Ga0070669_100177950 | 3300005353 | Unclassified | 1662 |
| 46 | Ga0070675_100002781 | 3300005354 | Bacteria | 13167 |
| 47 | Ga0070675_100342055 | 3300005354 | Bacteria | 1325 |
| 48 | Ga0070671_100122780 | 3300005355 | Bacteria | 2186 |
| 49 | Ga0070674_100022355 | 3300005356 | Unclassified | 4078 |
| 50 | Ga0070673_100016252 | 3300005364 | Bacteria | 5257 |
| 51 | Ga0070673_100457923 | 3300005364 | Bacteria | 1148 |
| 52 | Ga0070688_100014009 | 3300005365 | Unclassified | 4535 |
| 53 | Ga0070659_100015849 | 3300005366 | Bacteria | 5651 |
| 54 | Ga0070667_100012738 | 3300005367 | Bacteria | 6953 |
| 55 | Ga0070709_10008666 | 3300005434 | Bacteria | 5595 |
| 56 | Ga0070709_10119965 | 3300005434 | Unclassified | 1781 |
| 57 | Ga0070709_10204510 | 3300005434 | Bacteria | 1400 |
| 58 | Ga0070709_10334746 | 3300005434 | Unclassified | 1115 |
| 59 | Ga0070709_10357201 | 3300005434 | Bacteria | 1081 |
| 60 | Ga0070714_100062248 | 3300005435 | Bacteria | 3207 |
| 61 | Ga0070714_100081406 | 3300005435 | Bacteria | 2818 |
| 62 | Ga0070714_100114506 | 3300005435 | Bacteria | 2392 |
| 63 | Ga0070714_100145420 | 3300005435 | Unclassified | 2132 |
| 64 | Ga0070714_100230099 | 3300005435 | Unclassified | 1707 |
| 65 | Ga0070714_100369035 | 3300005435 | Bacteria | 1351 |
| 66 | Ga0070713_100027201 | 3300005436 | Unclassified | 4501 |
| 67 | Ga0070713_100062242 | 3300005436 | Bacteria | 3125 |
| 68 | Ga0070713_100076581 | 3300005436 | Bacteria | 2842 |
| 69 | Ga0070713_100127102 | 3300005436 | Bacteria | 2244 |
| 70 | Ga0070713_100128753 | 3300005436 | Bacteria | 2230 |
| 71 | Ga0070713_100173917 | 3300005436 | Bacteria | 1930 |
| 72 | Ga0070710_10022575 | 3300005437 | Bacteria | 3293 |
| 73 | Ga0070710_10024862 | 3300005437 | Unclassified | 3164 |
| 74 | Ga0070710_10159208 | 3300005437 | Bacteria | 1399 |
| 75 | Ga0070711_100017703 | 3300005439 | Bacteria | 4539 |
| 76 | Ga0070711_100033693 | 3300005439 | Bacteria | 3412 |
| 77 | Ga0070711_100039331 | 3300005439 | Bacteria | 3185 |
| 78 | Ga0070711_100052965 | 3300005439 | Unclassified | 2795 |
| 79 | Ga0070711_100057485 | 3300005439 | Unclassified | 2694 |
| 80 | Ga0070711_100075664 | 3300005439 | Bacteria | 2385 |
| 81 | Ga0070711_100292029 | 3300005439 | Bacteria | 1293 |
| 82 | Ga0070705_100150946 | 3300005440 | Bacteria | 1541 |
| 83 | Ga0070694_100075969 | 3300005444 | Bacteria | 2325 |
| 84 | Ga0070708_100003146 | 3300005445 | Bacteria | 12861 |
| 85 | Ga0070708_100003966 | 3300005445 | Bacteria | 11615 |
| 86 | Ga0070708_100023212 | 3300005445 | Bacteria | 5272 |
| 87 | Ga0070708_100037006 | 3300005445 | Unclassified | 4256 |
| 88 | Ga0070708_100081114 | 3300005445 | Bacteria | 2937 |
| 89 | Ga0070708_100089157 | 3300005445 | Unclassified | 2806 |
| 90 | Ga0070708_100158945 | 3300005445 | Bacteria | 2105 |
| 91 | Ga0070708_100189306 | 3300005445 | Bacteria | 1924 |
| 92 | Ga0070708_100660189 | 3300005445 | Unclassified | 985 |
| 93 | Ga0070708_100790906 | 3300005445 | Unclassified | 892 |
| 94 | Ga0070663_100016064 | 3300005455 | Bacteria | 4849 |
| 95 | Ga0070663_100020172 | 3300005455 | Unclassified | 4409 |
| 96 | Ga0070678_100003297 | 3300005456 | Bacteria | 8975 |
| 97 | Ga0070678_100022663 | 3300005456 | Bacteria | 4167 |
| 98 | Ga0070662_100002565 | 3300005457 | Bacteria | 11188 |
| 99 | Ga0070662_100068638 | 3300005457 | Unclassified | 2607 |
| 100 | Ga0070662_100100888 | 3300005457 | Bacteria | 2184 |
| 101 | Ga0070681_10000988 | 3300005458 | Bacteria | 24052 |
| 102 | Ga0070681_10011272 | 3300005458 | Bacteria | 8842 |
| 103 | Ga0070681_10012120 | 3300005458 | Bacteria | 8551 |
| 104 | Ga0070681_10206078 | 3300005458 | Bacteria | 1883 |
| 105 | Ga0070681_10224946 | 3300005458 | Bacteria | 1791 |
| 106 | Ga0070681_10283619 | 3300005458 | Bacteria | 1567 |
| 107 | Ga0068867_100016423 | 3300005459 | Bacteria | 5255 |
| 108 | Ga0068867_100201820 | 3300005459 | Bacteria | 1592 |
| 109 | Ga0068867_100232568 | 3300005459 | Bacteria | 1491 |
| 110 | Ga0070685_10001933 | 3300005466 | Bacteria | 10758 |
| 111 | Ga0070685_10093357 | 3300005466 | Bacteria | 1825 |
| 112 | Ga0070706_100000499 | 3300005467 | Bacteria | 45986 |
| 113 | Ga0070706_100017064 | 3300005467 | Bacteria | 6707 |
| 114 | Ga0070706_100022122 | 3300005467 | Bacteria | 5854 |
| 115 | Ga0070706_100109918 | 3300005467 | Bacteria | 2565 |
| 116 | Ga0070706_100116070 | 3300005467 | Bacteria | 2493 |
| 117 | Ga0070707_100037132 | 3300005468 | Unclassified | 4649 |
| 118 | Ga0070707_100184084 | 3300005468 | Bacteria | 2037 |
| 119 | Ga0070707_100209000 | 3300005468 | Unclassified | 1902 |
| 120 | Ga0070707_100251525 | 3300005468 | Bacteria | 1720 |
| 121 | Ga0070698_100013058 | 3300005471 | Bacteria | 8794 |
| 122 | Ga0070698_100223136 | 3300005471 | Bacteria | 1818 |
| 123 | Ga0070699_100001027 | 3300005518 | Bacteria | 25921 |
| 124 | Ga0070699_100007250 | 3300005518 | Bacteria | 9648 |
| 125 | Ga0070699_100096021 | 3300005518 | Bacteria | 2596 |
| 126 | Ga0070699_100183731 | 3300005518 | Bacteria | 1856 |
| 127 | Ga0070699_100387798 | 3300005518 | Bacteria | 1262 |
| 128 | Ga0070699_100489442 | 3300005518 | Bacteria | 1117 |
| 129 | Ga0070679_100014737 | 3300005530 | Bacteria | 7512 |
| 130 | Ga0070679_100172263 | 3300005530 | Bacteria | 2137 |
| 131 | Ga0070679_100464459 | 3300005530 | Unclassified | 1210 |
| 132 | Ga0070684_100001677 | 3300005535 | Bacteria | 16089 |
| 133 | Ga0070684_100014670 | 3300005535 | Bacteria | 6355 |
| 134 | Ga0070684_100015349 | 3300005535 | Bacteria | 6236 |
| 135 | Ga0070684_100037540 | 3300005535 | Unclassified | 4157 |
| 136 | Ga0070684_100106170 | 3300005535 | Bacteria | 2514 |
| 137 | Ga0070697_100000111 | 3300005536 | Bacteria | 63543 |
| 138 | Ga0070697_100000237 | 3300005536 | Bacteria | 44549 |
| 139 | Ga0070697_100001234 | 3300005536 | Bacteria | 19331 |
| 140 | Ga0070697_100022916 | 3300005536 | Bacteria | 4965 |
| 141 | Ga0070697_100025982 | 3300005536 | Unclassified | 4672 |
| 142 | Ga0070697_100279249 | 3300005536 | Bacteria | 1433 |
| 143 | Ga0068853_100005375 | 3300005539 | Bacteria | 10029 |
| 144 | Ga0068853_100014856 | 3300005539 | Bacteria | 6394 |
| 145 | Ga0068853_100018379 | 3300005539 | Bacteria | 5785 |
| 146 | Ga0068853_100157381 | 3300005539 | Bacteria | 2048 |
| 147 | Ga0070672_100128080 | 3300005543 | Bacteria | 2084 |
| 148 | Ga0070695_100015812 | 3300005545 | Unclassified | 4559 |
| 149 | Ga0070696_100141341 | 3300005546 | Bacteria | 1760 |
| 150 | Ga0070693_100008310 | 3300005547 | Bacteria | 5109 |
| 151 | Ga0070693_100113701 | 3300005547 | Unclassified | 1669 |
| 152 | Ga0070665_100008351 | 3300005548 | Bacteria | 10476 |
| 153 | Ga0070665_100124026 | 3300005548 | Bacteria | 2585 |
| 154 | Ga0070665_100815155 | 3300005548 | Bacteria | 946 |
| 155 | Ga0068855_100000440 | 3300005563 | Bacteria | 51346 |
| 156 | Ga0068855_100001467 | 3300005563 | Bacteria | 29462 |
| 157 | Ga0068855_100033223 | 3300005563 | Bacteria | 6159 |
| 158 | Ga0068855_100058930 | 3300005563 | Bacteria | 4495 |
| 159 | Ga0068855_100119682 | 3300005563 | Bacteria | 3015 |
| 160 | Ga0068855_100133493 | 3300005563 | Unclassified | 2833 |
| 161 | Ga0070664_100000079 | 3300005564 | Bacteria | 61393 |
| 162 | Ga0070664_100020262 | 3300005564 | Bacteria | 5476 |
| 163 | Ga0070664_100054375 | 3300005564 | Unclassified | 3396 |
| 164 | Ga0070664_100090314 | 3300005564 | Unclassified | 2651 |
| 165 | Ga0068857_100004770 | 3300005577 | Bacteria | 11483 |
| 166 | Ga0068857_100040124 | 3300005577 | Unclassified | 4151 |
| 167 | Ga0068857_100107688 | 3300005577 | Unclassified | 2503 |
| 168 | Ga0068854_100014008 | 3300005578 | Bacteria | 5276 |
| 169 | Ga0068854_100022674 | 3300005578 | Unclassified | 4283 |
| 170 | Ga0068854_100037953 | 3300005578 | Bacteria | 3385 |
| 171 | Ga0068854_100047532 | 3300005578 | Bacteria | 3059 |
| 172 | Ga0068854_100335242 | 3300005578 | Bacteria | 1234 |
| 173 | Ga0068856_100000314 | 3300005614 | Bacteria | 53174 |
| 174 | Ga0068856_100000884 | 3300005614 | Bacteria | 32074 |
| 175 | Ga0068856_100001689 | 3300005614 | Bacteria | 23073 |
| 176 | Ga0068856_100013950 | 3300005614 | Bacteria | 7769 |
| 177 | Ga0068856_100013970 | 3300005614 | Bacteria | 7765 |
| 178 | Ga0068856_100045755 | 3300005614 | Unclassified | 4310 |
| 179 | Ga0068856_100195303 | 3300005614 | Bacteria | 2038 |
| 180 | Ga0068856_100202881 | 3300005614 | Bacteria | 1997 |
| 181 | Ga0068856_100282874 | 3300005614 | Bacteria | 1675 |
| 182 | Ga0070702_100131113 | 3300005615 | Unclassified | 1583 |
| 183 | Ga0068852_100005106 | 3300005616 | Bacteria | 9349 |
| 184 | Ga0068852_100008868 | 3300005616 | Bacteria | 7439 |
| 185 | Ga0068852_100073044 | 3300005616 | Unclassified | 3016 |
| 186 | Ga0068852_100237967 | 3300005616 | Unclassified | 1738 |
| 187 | Ga0068859_100000743 | 3300005617 | Bacteria | 32840 |
| 188 | Ga0068859_100029696 | 3300005617 | Bacteria | 5486 |
| 189 | Ga0068859_100107366 | 3300005617 | Bacteria | 2852 |
| 190 | Ga0068859_100617244 | 3300005617 | Unclassified | 1177 |
| 191 | Ga0068866_10000598 | 3300005718 | Bacteria | 16433 |
| 192 | Ga0068866_10105674 | 3300005718 | Bacteria | 1561 |
| 193 | Ga0068866_10109412 | 3300005718 | Bacteria | 1539 |
| 194 | Ga0068861_100004952 | 3300005719 | Bacteria | 8971 |
| 195 | Ga0068861_100058819 | 3300005719 | Unclassified | 2941 |
| 196 | Ga0068861_100068073 | 3300005719 | Bacteria | 2750 |
| 197 | Ga0068861_100086440 | 3300005719 | Bacteria | 2465 |
| 198 | Ga0068851_10029758 | 3300005834 | Bacteria | 2705 |
| 199 | Ga0068870_10001859 | 3300005840 | Bacteria | 8688 |
| 200 | Ga0068870_10034485 | 3300005840 | Unclassified | 2590 |
| 201 | Ga0068863_100007633 | 3300005841 | Bacteria | 10579 |
| 202 | Ga0068863_100027936 | 3300005841 | Bacteria | 5385 |
| 203 | Ga0068863_100033173 | 3300005841 | Bacteria | 4918 |
| 204 | Ga0068863_100076640 | 3300005841 | Bacteria | 3163 |
| 205 | Ga0068863_100119501 | 3300005841 | Bacteria | 2512 |
| 206 | Ga0068863_100169603 | 3300005841 | Unclassified | 2093 |
| 207 | Ga0068863_100278670 | 3300005841 | Bacteria | 1620 |
| 208 | Ga0068858_100008051 | 3300005842 | Bacteria | 10151 |
| 209 | Ga0068858_100010361 | 3300005842 | Bacteria | 8830 |
| 210 | Ga0068858_100037929 | 3300005842 | Bacteria | 4469 |
| 211 | Ga0068858_100400035 | 3300005842 | Bacteria | 1319 |
| 212 | Ga0068860_100011415 | 3300005843 | Bacteria | 8752 |
| 213 | Ga0068860_100017651 | 3300005843 | Bacteria | 6953 |
| 214 | Ga0068860_100072721 | 3300005843 | Bacteria | 3268 |
| 215 | Ga0068860_100132368 | 3300005843 | Bacteria | 2394 |
| 216 | Ga0068862_100039922 | 3300005844 | Bacteria | 3988 |
| 217 | Ga0068862_100040805 | 3300005844 | Unclassified | 3946 |
| 218 | Ga0068862_100048021 | 3300005844 | Unclassified | 3644 |
| 219 | Ga0070717_10001917 | 3300006028 | Bacteria | 14536 |
| 220 | Ga0070717_10003179 | 3300006028 | Bacteria | 11734 |
| 221 | Ga0070717_10005046 | 3300006028 | Bacteria | 9617 |
| 222 | Ga0070717_10009320 | 3300006028 | Bacteria | 7377 |
| 223 | Ga0070717_10014384 | 3300006028 | Bacteria | 6087 |
| 224 | Ga0070717_10037304 | 3300006028 | Unclassified | 3946 |
| 225 | Ga0070717_10198906 | 3300006028 | Unclassified | 1754 |
| 226 | Ga0070717_10223765 | 3300006028 | Bacteria | 1655 |
| 227 | Ga0070717_10278980 | 3300006028 | Unclassified | 1482 |
| 228 | Ga0070717_10290734 | 3300006028 | Bacteria | 1451 |
| 229 | Ga0070717_10326139 | 3300006028 | Unclassified | 1369 |
| 230 | Ga0070717_10506851 | 3300006028 | Bacteria | 1091 |
| 231 | Ga0070716_100000963 | 3300006173 | Bacteria | 12483 |
| 232 | Ga0070716_100009156 | 3300006173 | Bacteria | 4928 |
| 233 | Ga0070716_100017261 | 3300006173 | Bacteria | 3738 |
| 234 | Ga0070716_100037014 | 3300006173 | Unclassified | 2694 |
| 235 | Ga0070716_100037319 | 3300006173 | Bacteria | 2685 |
| 236 | Ga0070716_100059096 | 3300006173 | Unclassified | 2209 |
| 237 | Ga0070712_100001489 | 3300006175 | Bacteria | 14297 |
| 238 | Ga0070712_100004426 | 3300006175 | Bacteria | 8668 |
| 239 | Ga0070712_100028835 | 3300006175 | Bacteria | 3716 |
| 240 | Ga0070712_100319851 | 3300006175 | Unclassified | 1261 |
| 241 | Ga0070712_100394155 | 3300006175 | Unclassified | 1142 |
| 242 | Ga0097621_100000088 | 3300006237 | Bacteria | 49698 |
| 243 | Ga0097621_100000731 | 3300006237 | Bacteria | 22963 |
| 244 | Ga0097621_100001934 | 3300006237 | Bacteria | 14133 |
| 245 | Ga0097621_100009212 | 3300006237 | Bacteria | 7159 |
| 246 | Ga0097621_100032470 | 3300006237 | Unclassified | 4150 |
| 247 | Ga0097621_100083976 | 3300006237 | Bacteria | 2654 |
| 248 | Ga0097621_100576711 | 3300006237 | Unclassified | 1026 |
| 249 | Ga0097621_100666514 | 3300006237 | Bacteria | 956 |
| 250 | Ga0068871_100000266 | 3300006358 | Bacteria | 35937 |
| 251 | Ga0068871_100000428 | 3300006358 | Bacteria | 29019 |
| 252 | Ga0068871_100008870 | 3300006358 | Bacteria | 7249 |
| 253 | Ga0068871_100017378 | 3300006358 | Bacteria | 5441 |
| 254 | Ga0068871_100026158 | 3300006358 | Unclassified | 4551 |
| 255 | Ga0068871_100076855 | 3300006358 | Bacteria | 2758 |
| 256 | Ga0068871_100535561 | 3300006358 | Bacteria | 1059 |
| 257 | Ga0068871_100537222 | 3300006358 | Unclassified | 1057 |
| 258 | Ga0075433_10000048 | 3300006852 | Bacteria | 50702 |
| 259 | Ga0075433_10003910 | 3300006852 | Bacteria | 11533 |
| 260 | Ga0075434_100007179 | 3300006871 | Bacteria | 10301 |
| 261 | Ga0075434_100034614 | 3300006871 | Bacteria | 4989 |
| 262 | Ga0075434_100065078 | 3300006871 | Unclassified | 3631 |
| 263 | Ga0075434_100138002 | 3300006871 | Bacteria | 2458 |
| 264 | Ga0075434_100175929 | 3300006871 | Bacteria | 2160 |
| 265 | Ga0075434_100273872 | 3300006871 | Bacteria | 1707 |
| 266 | Ga0068865_100007069 | 3300006881 | Bacteria | 6892 |
| 267 | Ga0068865_100046813 | 3300006881 | Unclassified | 2969 |
| 268 | Ga0068865_100085305 | 3300006881 | Bacteria | 2278 |
| 269 | Ga0075436_100003918 | 3300006914 | Bacteria | 10201 |
| 270 | Ga0075436_100006016 | 3300006914 | Bacteria | 8330 |
| 271 | Ga0075436_100024846 | 3300006914 | Bacteria | 4120 |
| 272 | Ga0075436_100032947 | 3300006914 | Unclassified | 3570 |
| 273 | Ga0097620_100000743 | 3300006931 | Bacteria | 32840 |
| 274 | Ga0097620_100029691 | 3300006931 | Bacteria | 5486 |
| 275 | Ga0097620_100107371 | 3300006931 | Bacteria | 2852 |
| 276 | Ga0097620_100617320 | 3300006931 | Unclassified | 1177 |
| 277 | Ga0075435_100002276 | 3300007076 | Bacteria | 12672 |
| 278 | Ga0075435_100028468 | 3300007076 | Unclassified | 4383 |
| 279 | Ga0075435_100030477 | 3300007076 | Bacteria | 4242 |
| 280 | Ga0075435_100108003 | 3300007076 | Bacteria | 2312 |
| 281 | Ga0075435_100159998 | 3300007076 | Unclassified | 1896 |
| 282 | Ga0105250_10059427 | 3300009092 | Unclassified | 1535 |
| 283 | Ga0105240_10005076 | 3300009093 | Bacteria | 19734 |
| 284 | Ga0105240_10009676 | 3300009093 | Bacteria | 13622 |
| 285 | Ga0105240_10046006 | 3300009093 | Bacteria | 5533 |
| 286 | Ga0105240_10130352 | 3300009093 | Unclassified | 3017 |
| 287 | Ga0105240_10354797 | 3300009093 | Bacteria | 1663 |
| 288 | Ga0105245_10021687 | 3300009098 | Bacteria | 5639 |
| 289 | Ga0105245_10043511 | 3300009098 | Bacteria | 4006 |
| 290 | Ga0105245_10134582 | 3300009098 | Unclassified | 2321 |
| 291 | Ga0105245_10188012 | 3300009098 | Bacteria | 1977 |
| 292 | Ga0105245_10318767 | 3300009098 | Bacteria | 1531 |
| 293 | Ga0105247_10117309 | 3300009101 | Bacteria | 1720 |
| 294 | Ga0105247_10170366 | 3300009101 | Bacteria | 1447 |
| 295 | Ga0114129_10263397 | 3300009147 | Bacteria | 2309 |
| 296 | Ga0105243_10065709 | 3300009148 | Unclassified | 2915 |
| 297 | Ga0105241_10021553 | 3300009174 | Unclassified | 4765 |
| 298 | Ga0105241_10028616 | 3300009174 | Unclassified | 4153 |
| 299 | Ga0105241_10068900 | 3300009174 | Bacteria | 2742 |
| 300 | Ga0105241_10805168 | 3300009174 | Bacteria | 866 |
| 301 | Ga0105242_10066838 | 3300009176 | Unclassified | 2970 |
| 302 | Ga0105248_10002754 | 3300009177 | Bacteria | 19526 |
| 303 | Ga0105248_10024617 | 3300009177 | Bacteria | 6694 |
| 304 | Ga0105248_10054467 | 3300009177 | Bacteria | 4485 |
| 305 | Ga0105248_10057988 | 3300009177 | Bacteria | 4347 |
| 306 | Ga0105248_10061141 | 3300009177 | Bacteria | 4228 |
| 307 | Ga0105248_10097481 | 3300009177 | Unclassified | 3313 |
| 308 | Ga0105237_10010940 | 3300009545 | Bacteria | 9628 |
| 309 | Ga0105237_10037740 | 3300009545 | Bacteria | 4882 |
| 310 | Ga0105237_10090403 | 3300009545 | Bacteria | 3051 |
| 311 | Ga0105237_10127258 | 3300009545 | Bacteria | 2542 |
| 312 | Ga0105237_10129749 | 3300009545 | Unclassified | 2515 |
| 313 | Ga0105237_10274245 | 3300009545 | Bacteria | 1689 |
| 314 | Ga0105238_10001256 | 3300009551 | Bacteria | 25520 |
| 315 | Ga0105238_10011948 | 3300009551 | Bacteria | 8748 |
| 316 | Ga0105238_10076516 | 3300009551 | Bacteria | 3338 |
| 317 | Ga0105238_10195438 | 3300009551 | Bacteria | 1999 |
| 318 | Ga0105249_10010877 | 3300009553 | Bacteria | 7996 |
| 319 | Ga0105249_10110523 | 3300009553 | Unclassified | 2597 |
| 320 | Ga0105239_10020769 | 3300010375 | Bacteria | 7247 |
| 321 | Ga0105239_10027319 | 3300010375 | Bacteria | 6282 |
| 322 | Ga0105239_10066265 | 3300010375 | Bacteria | 3967 |
| 323 | Ga0105239_10131950 | 3300010375 | Bacteria | 2779 |
| 324 | Ga0105239_10133705 | 3300010375 | Bacteria | 2761 |
| 325 | Ga0105239_10170577 | 3300010375 | Bacteria | 2433 |
| 326 | Ga0105246_10130306 | 3300011119 | Unclassified | 1878 |
| 327 | Ga0157373_10009346 | 3300013100 | Bacteria | 7244 |
| 328 | Ga0157373_10181386 | 3300013100 | Bacteria | 1482 |
| 329 | Ga0157371_10011620 | 3300013102 | Bacteria | 6769 |
| 330 | Ga0157371_10042533 | 3300013102 | Unclassified | 3238 |
| 331 | Ga0157371_10068655 | 3300013102 | Bacteria | 2509 |
| 332 | Ga0157369_10000196 | 3300013105 | Bacteria | 84536 |
| 333 | Ga0157369_10001722 | 3300013105 | Bacteria | 26646 |
| 334 | Ga0157369_10010846 | 3300013105 | Bacteria | 10379 |
| 335 | Ga0157369_10014078 | 3300013105 | Bacteria | 9038 |
| 336 | Ga0157369_10021606 | 3300013105 | Bacteria | 7197 |
| 337 | Ga0157369_10047180 | 3300013105 | Bacteria | 4679 |
| 338 | Ga0157369_10124427 | 3300013105 | Bacteria | 2735 |
| 339 | Ga0157369_10252144 | 3300013105 | Bacteria | 1842 |
| 340 | Ga0157369_10406164 | 3300013105 | Bacteria | 1413 |
| 341 | Ga0157369_10428591 | 3300013105 | Bacteria | 1371 |
| 342 | Ga0157374_10000312 | 3300013296 | Bacteria | 45142 |
| 343 | Ga0157374_10000989 | 3300013296 | Bacteria | 24633 |
| 344 | Ga0157374_10001078 | 3300013296 | Bacteria | 23634 |
| 345 | Ga0157374_10003563 | 3300013296 | Bacteria | 13110 |
| 346 | Ga0157374_10069754 | 3300013296 | Bacteria | 3310 |
| 347 | Ga0157374_10093357 | 3300013296 | Unclassified | 2873 |
| 348 | Ga0157374_10292023 | 3300013296 | Unclassified | 1611 |
| 349 | Ga0157378_10000057 | 3300013297 | Bacteria | 96589 |
| 350 | Ga0157378_10000058 | 3300013297 | Bacteria | 96172 |
| 351 | Ga0157378_10000304 | 3300013297 | Bacteria | 47798 |
| 352 | Ga0157378_10001335 | 3300013297 | Bacteria | 22158 |
| 353 | Ga0157378_10014035 | 3300013297 | Bacteria | 7013 |
| 354 | Ga0157378_10017752 | 3300013297 | Bacteria | 6247 |
| 355 | Ga0157378_10077210 | 3300013297 | Unclassified | 3002 |
| 356 | Ga0157378_10314628 | 3300013297 | Bacteria | 1519 |
| 357 | Ga0163162_10013577 | 3300013306 | Bacteria | 7957 |
| 358 | Ga0163162_10108566 | 3300013306 | Bacteria | 2871 |
| 359 | Ga0163162_10117086 | 3300013306 | Bacteria | 2766 |
| 360 | Ga0163162_10134902 | 3300013306 | Bacteria | 2579 |
| 361 | Ga0163162_10477484 | 3300013306 | Bacteria | 1378 |
| 362 | Ga0157372_10000200 | 3300013307 | Bacteria | 66086 |
| 363 | Ga0157372_10000379 | 3300013307 | Bacteria | 49273 |
| 364 | Ga0157372_10000714 | 3300013307 | Bacteria | 36499 |
| 365 | Ga0157372_10003854 | 3300013307 | Bacteria | 16121 |
| 366 | Ga0157372_10008585 | 3300013307 | Bacteria | 10857 |
| 367 | Ga0157372_10018945 | 3300013307 | Bacteria | 7406 |
| 368 | Ga0157372_10070788 | 3300013307 | Unclassified | 3925 |
| 369 | Ga0157372_10114379 | 3300013307 | Bacteria | 3093 |
| 370 | Ga0157372_10202191 | 3300013307 | Unclassified | 2301 |
| 371 | Ga0157375_10335189 | 3300013308 | Bacteria | 1678 |
| 372 | Ga0163163_10011964 | 3300014325 | Bacteria | 7895 |
| 373 | Ga0163163_10028994 | 3300014325 | Bacteria | 5322 |
| 374 | Ga0163163_10047416 | 3300014325 | Bacteria | 4224 |
| 375 | Ga0163163_10052362 | 3300014325 | Bacteria | 4027 |
| 376 | Ga0163163_10082546 | 3300014325 | Unclassified | 3218 |
| 377 | Ga0163163_10231656 | 3300014325 | Bacteria | 1896 |
| 378 | Ga0163163_10466176 | 3300014325 | Bacteria | 1324 |
| 379 | Ga0157377_10122308 | 3300014745 | Bacteria | 1579 |
| 380 | Ga0157379_10002438 | 3300014968 | Bacteria | 15569 |
| 381 | Ga0157379_10041098 | 3300014968 | Unclassified | 4127 |
| 382 | Ga0157379_10329788 | 3300014968 | Bacteria | 1394 |
| 383 | Ga0157376_10003037 | 3300014969 | Bacteria | 11495 |
| 384 | Ga0157376_10018903 | 3300014969 | Bacteria | 5298 |
| 385 | Ga0157376_10120856 | 3300014969 | Unclassified | 2321 |
| 386 | Ga0157376_10150773 | 3300014969 | Unclassified | 2096 |
| 387 | Ga0157376_10150939 | 3300014969 | Unclassified | 2095 |
| 388 | Ga0157376_10842264 | 3300014969 | Unclassified | 932 |
| 389 | Ga0157376_10851861 | 3300014969 | Unclassified | 927 |
| 390 | Ga0163161_10003804 | 3300017792 | Bacteria | 10582 |
| 391 | Ga0213873_10020184 | 3300021358 | Unclassified | 1554 |
| 392 | Ga0213874_10005028 | 3300021377 | Bacteria | 3060 |
| 393 | Ga0213874_10074028 | 3300021377 | Bacteria | 1092 |
| 394 | Ga0224572_1003559 | 3300024225 | Unclassified | 2640 |
| 395 | Ga0228598_1003592 | 3300024227 | Unclassified | 3330 |
| 396 | Ga0207697_10024904 | 3300025315 | Unclassified | 2447 |
| 397 | Ga0207656_10072464 | 3300025321 | Bacteria | 1534 |
| 398 | Ga0207656_10084586 | 3300025321 | Unclassified | 1431 |
| 399 | Ga0207656_10202119 | 3300025321 | Unclassified | 960 |
| 400 | Ga0207682_10063867 | 3300025893 | Unclassified | 1546 |
| 401 | Ga0207692_10029019 | 3300025898 | Unclassified | 2624 |
| 402 | Ga0207692_10049371 | 3300025898 | Bacteria | 2123 |
| 403 | Ga0207692_10150872 | 3300025898 | Bacteria | 1331 |
| 404 | Ga0207642_10049092 | 3300025899 | Bacteria | 1895 |
| 405 | Ga0207642_10167243 | 3300025899 | Bacteria | 1186 |
| 406 | Ga0207688_10093312 | 3300025901 | Unclassified | 1731 |
| 407 | Ga0207680_10067798 | 3300025903 | Unclassified | 2199 |
| 408 | Ga0207647_10005883 | 3300025904 | Bacteria | 8937 |
| 409 | Ga0207647_10024407 | 3300025904 | Bacteria | 3986 |
| 410 | Ga0207699_10008930 | 3300025906 | Unclassified | 4969 |
| 411 | Ga0207699_10021420 | 3300025906 | Bacteria | 3484 |
| 412 | Ga0207699_10036191 | 3300025906 | Unclassified | 2812 |
| 413 | Ga0207699_10238930 | 3300025906 | Bacteria | 1247 |
| 414 | Ga0207699_10338704 | 3300025906 | Bacteria | 1059 |
| 415 | Ga0207699_10358348 | 3300025906 | Bacteria | 1031 |
| 416 | Ga0207699_10448100 | 3300025906 | Bacteria | 925 |
| 417 | Ga0207645_10000551 | 3300025907 | Bacteria | 31119 |
| 418 | Ga0207645_10004243 | 3300025907 | Bacteria | 10640 |
| 419 | Ga0207643_10002140 | 3300025908 | Bacteria | 10851 |
| 420 | Ga0207684_10016288 | 3300025910 | Bacteria | 6383 |
| 421 | Ga0207684_10033830 | 3300025910 | Unclassified | 4347 |
| 422 | Ga0207684_10064619 | 3300025910 | Unclassified | 3107 |
| 423 | Ga0207684_10077797 | 3300025910 | Bacteria | 2821 |
| 424 | Ga0207684_10279783 | 3300025910 | Bacteria | 1439 |
| 425 | Ga0207684_10487378 | 3300025910 | Unclassified | 1057 |
| 426 | Ga0207654_10048036 | 3300025911 | Bacteria | 2441 |
| 427 | Ga0207707_10000617 | 3300025912 | Bacteria | 35411 |
| 428 | Ga0207707_10002456 | 3300025912 | Bacteria | 16676 |
| 429 | Ga0207707_10129771 | 3300025912 | Bacteria | 2205 |
| 430 | Ga0207695_10005582 | 3300025913 | Bacteria | 16616 |
| 431 | Ga0207695_10016407 | 3300025913 | Bacteria | 8665 |
| 432 | Ga0207695_10024396 | 3300025913 | Bacteria | 6808 |
| 433 | Ga0207695_10053870 | 3300025913 | Bacteria | 4205 |
| 434 | Ga0207695_10058048 | 3300025913 | Bacteria | 4018 |
| 435 | Ga0207695_10176066 | 3300025913 | Unclassified | 2062 |
| 436 | Ga0207695_10252313 | 3300025913 | Bacteria | 1663 |
| 437 | Ga0207695_10312606 | 3300025913 | Bacteria | 1461 |
| 438 | Ga0207695_10440108 | 3300025913 | Bacteria | 1187 |
| 439 | Ga0207695_10577129 | 3300025913 | Unclassified | 1006 |
| 440 | Ga0207671_10009068 | 3300025914 | Bacteria | 8362 |
| 441 | Ga0207671_10131643 | 3300025914 | Bacteria | 1920 |
| 442 | Ga0207671_10258684 | 3300025914 | Bacteria | 1369 |
| 443 | Ga0207693_10009791 | 3300025915 | Bacteria | 7801 |
| 444 | Ga0207693_10010388 | 3300025915 | Bacteria | 7558 |
| 445 | Ga0207693_10026726 | 3300025915 | Bacteria | 4566 |
| 446 | Ga0207693_10053913 | 3300025915 | Unclassified | 3155 |
| 447 | Ga0207663_10070270 | 3300025916 | Bacteria | 2255 |
| 448 | Ga0207663_10122908 | 3300025916 | Bacteria | 1781 |
| 449 | Ga0207663_10177613 | 3300025916 | Bacteria | 1518 |
| 450 | Ga0207663_10217699 | 3300025916 | Bacteria | 1388 |
| 451 | Ga0207663_10286619 | 3300025916 | Bacteria | 1225 |
| 452 | Ga0207660_10234598 | 3300025917 | Bacteria | 1443 |
| 453 | Ga0207662_10004460 | 3300025918 | Bacteria | 7368 |
| 454 | Ga0207662_10314459 | 3300025918 | Bacteria | 1044 |
| 455 | Ga0207657_10002740 | 3300025919 | Bacteria | 18981 |
| 456 | Ga0207657_10003665 | 3300025919 | Bacteria | 16357 |
| 457 | Ga0207657_10009009 | 3300025919 | Bacteria | 10078 |
| 458 | Ga0207649_10001493 | 3300025920 | Bacteria | 13728 |
| 459 | Ga0207649_10035538 | 3300025920 | Bacteria | 2995 |
| 460 | Ga0207649_10127147 | 3300025920 | Bacteria | 1726 |
| 461 | Ga0207652_10031964 | 3300025921 | Unclassified | 4421 |
| 462 | Ga0207652_10049802 | 3300025921 | Bacteria | 3587 |
| 463 | Ga0207646_10217352 | 3300025922 | Bacteria | 1726 |
| 464 | Ga0207681_10184901 | 3300025923 | Unclassified | 1590 |
| 465 | Ga0207694_10000743 | 3300025924 | Bacteria | 29301 |
| 466 | Ga0207694_10020189 | 3300025924 | Bacteria | 5039 |
| 467 | Ga0207694_10068819 | 3300025924 | Unclassified | 2765 |
| 468 | Ga0207650_10000045 | 3300025925 | Bacteria | 181507 |
| 469 | Ga0207650_10042503 | 3300025925 | Bacteria | 3334 |
| 470 | Ga0207650_10257958 | 3300025925 | Bacteria | 1413 |
| 471 | Ga0207687_10047387 | 3300025927 | Unclassified | 2980 |
| 472 | Ga0207687_10114864 | 3300025927 | Bacteria | 2005 |
| 473 | Ga0207700_10026354 | 3300025928 | Unclassified | 4051 |
| 474 | Ga0207700_10034264 | 3300025928 | Unclassified | 3644 |
| 475 | Ga0207700_10146715 | 3300025928 | Unclassified | 1945 |
| 476 | Ga0207700_10147114 | 3300025928 | Bacteria | 1943 |
| 477 | Ga0207700_10202860 | 3300025928 | Bacteria | 1672 |
| 478 | Ga0207700_10203610 | 3300025928 | Bacteria | 1669 |
| 479 | Ga0207700_10217446 | 3300025928 | Unclassified | 1618 |
| 480 | Ga0207700_10339306 | 3300025928 | Bacteria | 1306 |
| 481 | Ga0207700_10645546 | 3300025928 | Bacteria | 943 |
| 482 | Ga0207664_10011058 | 3300025929 | Bacteria | 6395 |
| 483 | Ga0207664_10048706 | 3300025929 | Unclassified | 3334 |
| 484 | Ga0207664_10124402 | 3300025929 | Bacteria | 2163 |
| 485 | Ga0207664_10653603 | 3300025929 | Bacteria | 945 |
| 486 | Ga0207664_10746112 | 3300025929 | Unclassified | 880 |
| 487 | Ga0207644_10234750 | 3300025931 | Bacteria | 1458 |
| 488 | Ga0207644_10328554 | 3300025931 | Bacteria | 1238 |
| 489 | Ga0207706_10003060 | 3300025933 | Bacteria | 16104 |
| 490 | Ga0207706_10037894 | 3300025933 | Bacteria | 4278 |
| 491 | Ga0207686_10131534 | 3300025934 | Unclassified | 1717 |
| 492 | Ga0207686_10147256 | 3300025934 | Bacteria | 1635 |
| 493 | Ga0207709_10050443 | 3300025935 | Unclassified | 2545 |
| 494 | Ga0207670_10186756 | 3300025936 | Unclassified | 1565 |
| 495 | Ga0207670_10308095 | 3300025936 | Bacteria | 1242 |
| 496 | Ga0207704_10013405 | 3300025938 | Bacteria | 4099 |
| 497 | Ga0207665_10001295 | 3300025939 | Bacteria | 16905 |
| 498 | Ga0207665_10004259 | 3300025939 | Bacteria | 9510 |
| 499 | Ga0207665_10017745 | 3300025939 | Bacteria | 4677 |
| 500 | Ga0207665_10060541 | 3300025939 | Bacteria | 2564 |
| 501 | Ga0207665_10066960 | 3300025939 | Bacteria | 2445 |
| 502 | Ga0207665_10067636 | 3300025939 | Unclassified | 2433 |
| 503 | Ga0207665_10203739 | 3300025939 | Bacteria | 1443 |
| 504 | Ga0207665_10272350 | 3300025939 | Bacteria | 1258 |
| 505 | Ga0207665_10287210 | 3300025939 | Unclassified | 1226 |
| 506 | Ga0207691_10004307 | 3300025940 | Bacteria | 13821 |
| 507 | Ga0207691_10483887 | 3300025940 | Bacteria | 1052 |
| 508 | Ga0207711_10021084 | 3300025941 | Bacteria | 5442 |
| 509 | Ga0207711_10035712 | 3300025941 | Bacteria | 4215 |
| 510 | Ga0207711_10057050 | 3300025941 | Bacteria | 3357 |
| 511 | Ga0207711_10118544 | 3300025941 | Unclassified | 2361 |
| 512 | Ga0207711_10204551 | 3300025941 | Bacteria | 1802 |
| 513 | Ga0207689_10004596 | 3300025942 | Bacteria | 12489 |
| 514 | Ga0207689_10009031 | 3300025942 | Bacteria | 8631 |
| 515 | Ga0207689_10018148 | 3300025942 | Bacteria | 5941 |
| 516 | Ga0207661_10000131 | 3300025944 | Bacteria | 47673 |
| 517 | Ga0207661_10125130 | 3300025944 | Unclassified | 2194 |
| 518 | Ga0207679_10000283 | 3300025945 | Bacteria | 38405 |
| 519 | Ga0207679_10073991 | 3300025945 | Unclassified | 2580 |
| 520 | Ga0207679_10234442 | 3300025945 | Bacteria | 1551 |
| 521 | Ga0207679_10251611 | 3300025945 | Unclassified | 1502 |
| 522 | Ga0207679_10455080 | 3300025945 | Bacteria | 1136 |
| 523 | Ga0207667_10001753 | 3300025949 | Bacteria | 27293 |
| 524 | Ga0207667_10022333 | 3300025949 | Bacteria | 6991 |
| 525 | Ga0207667_10047229 | 3300025949 | Unclassified | 4557 |
| 526 | Ga0207667_10056561 | 3300025949 | Bacteria | 4121 |
| 527 | Ga0207667_10095084 | 3300025949 | Bacteria | 3076 |
| 528 | Ga0207667_10129991 | 3300025949 | Bacteria | 2594 |
| 529 | Ga0207667_10305979 | 3300025949 | Bacteria | 1624 |
| 530 | Ga0207667_10846263 | 3300025949 | Bacteria | 909 |
| 531 | Ga0207651_10029577 | 3300025960 | Bacteria | 3473 |
| 532 | Ga0207651_10039352 | 3300025960 | Unclassified | 3117 |
| 533 | Ga0207651_10414784 | 3300025960 | Bacteria | 1148 |
| 534 | Ga0207712_10011555 | 3300025961 | Bacteria | 5628 |
| 535 | Ga0207668_10017040 | 3300025972 | Unclassified | 4546 |
| 536 | Ga0207640_10010779 | 3300025981 | Bacteria | 5158 |
| 537 | Ga0207640_10031062 | 3300025981 | Bacteria | 3297 |
| 538 | Ga0207640_10042734 | 3300025981 | Bacteria | 2892 |
| 539 | Ga0207640_10059925 | 3300025981 | Bacteria | 2514 |
| 540 | Ga0207640_10156562 | 3300025981 | Unclassified | 1680 |
| 541 | Ga0207640_10302945 | 3300025981 | Bacteria | 1265 |
| 542 | Ga0207658_10003108 | 3300025986 | Bacteria | 11881 |
| 543 | Ga0207677_10002125 | 3300026023 | Bacteria | 10402 |
| 544 | Ga0207677_10163209 | 3300026023 | Bacteria | 1733 |
| 545 | Ga0207677_10253370 | 3300026023 | Bacteria | 1431 |
| 546 | Ga0207703_10003528 | 3300026035 | Bacteria | 13086 |
| 547 | Ga0207703_10008464 | 3300026035 | Bacteria | 8128 |
| 548 | Ga0207703_10011057 | 3300026035 | Bacteria | 7033 |
| 549 | Ga0207703_10039474 | 3300026035 | Unclassified | 3773 |
| 550 | Ga0207639_10005137 | 3300026041 | Bacteria | 8821 |
| 551 | Ga0207639_10089777 | 3300026041 | Bacteria | 2456 |
| 552 | Ga0207639_10131743 | 3300026041 | Bacteria | 2071 |
| 553 | Ga0207639_10286015 | 3300026041 | Bacteria | 1452 |
| 554 | Ga0207678_10000026 | 3300026067 | Bacteria | 116850 |
| 555 | Ga0207678_10001488 | 3300026067 | Bacteria | 21502 |
| 556 | Ga0207702_10001299 | 3300026078 | Bacteria | 25024 |
| 557 | Ga0207702_10001432 | 3300026078 | Bacteria | 23781 |
| 558 | Ga0207702_10005337 | 3300026078 | Bacteria | 11266 |
| 559 | Ga0207702_10056905 | 3300026078 | Bacteria | 3321 |
| 560 | Ga0207702_10076023 | 3300026078 | Bacteria | 2902 |
| 561 | Ga0207702_10145132 | 3300026078 | Bacteria | 2152 |
| 562 | Ga0207641_10000021 | 3300026088 | Bacteria | 279851 |
| 563 | Ga0207641_10010380 | 3300026088 | Bacteria | 7657 |
| 564 | Ga0207641_10070055 | 3300026088 | Bacteria | 3013 |
| 565 | Ga0207641_10102549 | 3300026088 | Bacteria | 2523 |
| 566 | Ga0207641_10112651 | 3300026088 | Bacteria | 2414 |
| 567 | Ga0207641_10626665 | 3300026088 | Unclassified | 1055 |
| 568 | Ga0207648_10000611 | 3300026089 | Bacteria | 40065 |
| 569 | Ga0207648_10006630 | 3300026089 | Bacteria | 11501 |
| 570 | Ga0207648_10030195 | 3300026089 | Unclassified | 4802 |
| 571 | Ga0207648_10070587 | 3300026089 | Bacteria | 3045 |
| 572 | Ga0207648_10111193 | 3300026089 | Bacteria | 2405 |
| 573 | Ga0207676_10000096 | 3300026095 | Bacteria | 80353 |
| 574 | Ga0207676_10091337 | 3300026095 | Bacteria | 2501 |
| 575 | Ga0207676_10541104 | 3300026095 | Bacteria | 1111 |
| 576 | Ga0207674_10000246 | 3300026116 | Bacteria | 67486 |
| 577 | Ga0207674_10006208 | 3300026116 | Bacteria | 14082 |
| 578 | Ga0207674_10009607 | 3300026116 | Bacteria | 11035 |
| 579 | Ga0207674_10022219 | 3300026116 | Bacteria | 6818 |
| 580 | Ga0207674_10052593 | 3300026116 | Unclassified | 4154 |
| 581 | Ga0207675_100048302 | 3300026118 | Bacteria | 3973 |
| 582 | Ga0207675_100099837 | 3300026118 | Bacteria | 2734 |
| 583 | Ga0207683_10000259 | 3300026121 | Bacteria | 47186 |
| 584 | Ga0207683_10113947 | 3300026121 | Bacteria | 2422 |
| 585 | Ga0207698_10029830 | 3300026142 | Unclassified | 3913 |
| 586 | Ga0265356_1012459 | 3300028017 | Bacteria | 934 |
| 587 | Ga0268266_10006040 | 3300028379 | Bacteria | 11164 |
| 588 | Ga0268266_10016584 | 3300028379 | Bacteria | 6295 |
| 589 | Ga0268266_10433877 | 3300028379 | Bacteria | 1247 |
| 590 | Ga0268265_10005648 | 3300028380 | Bacteria | 8545 |
| 591 | Ga0268265_10082287 | 3300028380 | Unclassified | 2545 |
| 592 | Ga0268264_10004345 | 3300028381 | Bacteria | 12099 |
| 593 | Ga0268264_10044109 | 3300028381 | Unclassified | 3698 |
| 594 | Ga0268264_10140172 | 3300028381 | Bacteria | 2155 |
| 595 | Ga0265338_10001717 | 3300028800 | Bacteria | 34748 |
| 596 | Ga0265338_10119471 | 3300028800 | Bacteria | 2104 |
| 597 | Ga0265773_1005274 | 3300031018 | Bacteria | 934 |
| 598 | Ga0265760_10000564 | 3300031090 | Bacteria | 10531 |
| 599 | Ga0265760_10002887 | 3300031090 | Bacteria | 5024 |
| 600 | Ga0265760_10003748 | 3300031090 | Bacteria | 4403 |
| 601 | Ga0265760_10004692 | 3300031090 | Unclassified | 3913 |
| 602 | Ga0265760_10043850 | 3300031090 | Bacteria | 1337 |
| 603 | Ga0265330_10009079 | 3300031235 | Bacteria | 4741 |
| 604 | Ga0265340_10037738 | 3300031247 | Bacteria | 2392 |
| 605 | Ga0265339_10001780 | 3300031249 | Bacteria | 15833 |
| 606 | Ga0265339_10079860 | 3300031249 | Bacteria | 1730 |
| 607 | Ga0265331_10061776 | 3300031250 | Bacteria | 1768 |
| 608 | Ga0265316_10006906 | 3300031344 | Bacteria | 10767 |
| 609 | Ga0265316_10012757 | 3300031344 | Bacteria | 7510 |
| 610 | Ga0307408_100242572 | 3300031548 | Bacteria | 1482 |
| 611 | Ga0265314_10004769 | 3300031711 | Bacteria | 12427 |
| 612 | Ga0307405_10018003 | 3300031731 | Bacteria | 3889 |
| 613 | Ga0307410_10026642 | 3300031852 | Bacteria | 3643 |
| 614 | Ga0307410_10156905 | 3300031852 | Bacteria | 1701 |
| 615 | Ga0307409_100313410 | 3300031995 | Bacteria | 1465 |
| 616 | Ga0307416_100183907 | 3300032002 | Bacteria | 1962 |
| 617 | Ga0307411_10314839 | 3300032005 | Bacteria | 1261 |
| 618 | Ga0307415_100016974 | 3300032126 | Bacteria | 4355 |
| 619 | Ga0373944_0015522 | 3300035089 | Unclassified | 2139 |
| 620 | Ga0373936_0029250 | 3300035113 | Bacteria | 2168 |
| 621 | Ga0373954_0083902 | 3300035118 | Bacteria | 1525 |
| 622 | Ga0373931_0025139 | 3300035691 | Unclassified | 3024 |
| 623 | Ga0373931_0103142 | 3300035691 | Bacteria | 1607 |
| 624 | Ga0373935_0157587 | 3300035692 | Bacteria | 1545 |
| 625 | Ga0373935_0392149 | 3300035692 | Unclassified | 996 |
| 626 | Ga0373927_0012227 | 3300035695 | Bacteria | 5710 |
| 627 | Ga0373933_0104999 | 3300035724 | Unclassified | 1757 |
| 628 | Ga0373947_0271652 | 3300035725 | Bacteria | 1125 |
| 629 | Ga0373947_0556858 | 3300035725 | Bacteria | 781 |
| 630 | Ga0373937_0018912 | 3300036401 | Bacteria | 6159 |
| 631 | Ga0373925_0004417 | 3300037068 | Bacteria | 10624 |
| 632 | Ga0373925_0017930 | 3300037068 | Bacteria | 5139 |
| 633 | Ga0395900_0392383 | 3300037418 | Bacteria | 1354 |
| 634 | Ga0395905_0005720 | 3300037471 | Bacteria | 12640 |
| 635 | Ga0395905_0009325 | 3300037471 | Bacteria | 9600 |
| 636 | Ga0395905_0015774 | 3300037471 | Bacteria | 7177 |
| 637 | Ga0395905_0339925 | 3300037471 | Bacteria | 1392 |
| 638 | Ga0436365_0117660 | 3300039437 | Bacteria | 2357 |
| 639 | Ga0436365_0913571 | 3300039437 | Bacteria | 1395 |
| 640 | Ga0436365_1528334 | 3300039437 | Bacteria | 2533 |
| 641 | Ga0436363_0108166 | 3300039450 | Bacteria | 1068 |
| 642 | Ga0436363_0644861 | 3300039450 | Bacteria | 2894 |
| 643 | Ga0436363_1342541 | 3300039450 | Bacteria | 2221 |
| 644 | Ga0436363_1700190 | 3300039450 | Bacteria | 4540 |
| 645 | Ga0436362_0155418 | 3300039453 | Unclassified | 2386 |
| 646 | Ga0451577_0000157 | 3300042876 | Bacteria | 151953 |
| 647 | Ga0451577_0041769 | 3300042876 | Unclassified | 4116 |
| 648 | Ga0453683_0025944 | 3300044673 | Bacteria | 3721 |
| 649 | Ga0453683_0369661 | 3300044673 | Unclassified | 922 |
| 650 | Ga0466963_0014508 | 3300044694 | Bacteria | 4860 |
| 651 | Ga0453684_0001152 | 3300044712 | Bacteria | 82543 |
| 652 | Ga0451576_0108517 | 3300045051 | Unclassified | 2888 |
| 653 | Ga0451576_0221217 | 3300045051 | Bacteria | 1977 |
| 654 | Ga0451576_0283887 | 3300045051 | Bacteria | 1731 |
| 655 | Ga0466967_0002974 | 3300045976 | Bacteria | 10843 |
| 656 | Ga0466967_0824223 | 3300045976 | Bacteria | 922 |
| 657 | Ga0495653_0272272 | 3300046463 | Bacteria | 1115 |
| 658 | Ga0495580_0002108 | 3300046472 | Bacteria | 17453 |
| 659 | Ga0495580_0002151 | 3300046472 | Bacteria | 17310 |
| 660 | Ga0495580_0002538 | 3300046472 | Bacteria | 15898 |
| 661 | Ga0495580_0004470 | 3300046472 | Bacteria | 11745 |
| 662 | Ga0495580_0005568 | 3300046472 | Bacteria | 10385 |
| 663 | Ga0495580_0009075 | 3300046472 | Bacteria | 7844 |
| 664 | Ga0495580_0042668 | 3300046472 | Bacteria | 3230 |
| 665 | Ga0495580_0096651 | 3300046472 | Bacteria | 2054 |
| 666 | Ga0495580_0282665 | 3300046472 | Bacteria | 1132 |
| 667 | Ga0495582_0000074 | 3300046473 | Bacteria | 50012 |
| 668 | Ga0495594_0159038 | 3300046499 | Bacteria | 1284 |
| 669 | Ga0495608_0206802 | 3300046511 | Bacteria | 1235 |
| 670 | Ga0495628_0404339 | 3300046516 | Bacteria | 997 |
| 671 | Ga0495665_0000640 | 3300046531 | Bacteria | 17853 |
| 672 | Ga0495665_0018105 | 3300046531 | Unclassified | 3787 |
| 673 | Ga0495645_0291642 | 3300046543 | Bacteria | 1069 |
| 674 | Ga0495667_0123160 | 3300046559 | Bacteria | 1674 |
| 675 | Ga0495656_0012753 | 3300046615 | Bacteria | 3110 |
| 676 | Ga0495657_0093540 | 3300046675 | Bacteria | 1924 |
| 677 | Ga0495657_0239335 | 3300046675 | Unclassified | 1096 |
| 678 | Ga0495623_0064777 | 3300046679 | Bacteria | 2287 |
| 679 | Ga0495669_0013822 | 3300046684 | Unclassified | 3446 |
| 680 | Ga0495669_0027789 | 3300046684 | Bacteria | 2475 |
| 681 | Ga0495581_0026361 | 3300047315 | Bacteria | 3370 |
| 682 | Ga0495581_0122147 | 3300047315 | Bacteria | 1516 |
| 683 | Ga0495674_0487601 | 3300047319 | Bacteria | 987 |
| 684 | Ga0495675_0032498 | 3300047444 | Bacteria | 3330 |
| 685 | Ga0495675_0052458 | 3300047444 | Bacteria | 2589 |
| 686 | Ga0495677_0166123 | 3300047445 | Bacteria | 853 |
| 687 | Ga0495684_0153451 | 3300047471 | Bacteria | 1721 |
| 688 | Ga0496100_0106014 | 3300048903 | Unclassified | 1945 |
| 689 | Ga0496101_0127407 | 3300048904 | Unclassified | 1930 |
| 690 | Ga0496102_0008569 | 3300048905 | Bacteria | 8769 |
| 691 | Ga0496102_0013555 | 3300048905 | Bacteria | 7065 |
| 692 | Ga0496102_0111535 | 3300048905 | Bacteria | 2550 |
| 693 | Ga0496102_0327715 | 3300048905 | Bacteria | 1442 |
| 694 | Ga0496103_0022061 | 3300048906 | Unclassified | 3832 |
| 695 | Ga0496104_0206179 | 3300048907 | Unclassified | 1878 |
| 696 | Ga0496104_0599097 | 3300048907 | Unclassified | 1012 |
| 697 | Ga0496105_0575347 | 3300048908 | Unclassified | 877 |
| 698 | Ga0496106_0077026 | 3300048909 | Bacteria | 2557 |
| 699 | Ga0496106_0110030 | 3300048909 | Bacteria | 2144 |
| 700 | Ga0496107_0070997 | 3300048910 | Unclassified | 2530 |
| 701 | Ga0496108_0000605 | 3300048911 | Bacteria | 28095 |
| 702 | Ga0496108_0101207 | 3300048911 | Bacteria | 2458 |
| 703 | Ga0496109_0000132 | 3300048912 | Bacteria | 76436 |
| 704 | Ga0496109_0011172 | 3300048912 | Bacteria | 7705 |
| 705 | Ga0496109_0075326 | 3300048912 | Unclassified | 3103 |
| 706 | Ga0496109_0148872 | 3300048912 | Bacteria | 2191 |
| 707 | Ga0496110_0001437 | 3300048913 | Bacteria | 17222 |
| 708 | Ga0496110_0053666 | 3300048913 | Bacteria | 3544 |
| 709 | Ga0496111_0017498 | 3300048914 | Bacteria | 4956 |
| 710 | Ga0496111_0367603 | 3300048914 | Unclassified | 1064 |
| 711 | Ga0496112_0000399 | 3300048915 | Bacteria | 28374 |
| 712 | Ga0496112_0000464 | 3300048915 | Bacteria | 27058 |
| 713 | Ga0496112_0046418 | 3300048915 | Bacteria | 4260 |
| 714 | Ga0496112_0073440 | 3300048915 | Bacteria | 3381 |
| 715 | Ga0496112_0102212 | 3300048915 | Bacteria | 2836 |
| 716 | Ga0496112_0148660 | 3300048915 | Bacteria | 2310 |
| 717 | Ga0496112_0422625 | 3300048915 | Unclassified | 1271 |
| 718 | Ga0496112_0645398 | 3300048915 | Unclassified | 988 |
| 719 | Ga0501294_007687 | 3300049517 | Bacteria | 1044 |
| 720 | Ga0501296_010667 | 3300049519 | Bacteria | 1092 |
| 721 | Ga0501298_020448 | 3300049521 | Bacteria | 1233 |
| 722 | Ga0501272_004372 | 3300049769 | Bacteria | 1467 |
| 723 | nmdc:mga0n895_128602_c1 | 3300050512 | Unclassified | 2557 |
| 724 | nmdc:mga0n895_1448_c1 | 3300050512 | Bacteria | 17728 |
| 725 | nmdc:mga0n895_31071_c1 | 3300050512 | Bacteria | 5110 |
| 726 | nmdc:mga0n895_31483_c1 | 3300050512 | Bacteria | 5080 |
| 727 | nmdc:mga0n895_345_c1 | 3300050512 | Bacteria | 31108 |
| 728 | nmdc:mga0n895_46359_c2 | 3300050512 | Bacteria | 3705 |
| 729 | nmdc:mga0rr50_143165_c1 | 3300050513 | Unclassified | 1925 |
| 730 | nmdc:mga0rr50_1877_c1 | 3300050513 | Bacteria | 11667 |
| 731 | nmdc:mga0rr50_31563_c1 | 3300050513 | Bacteria | 3764 |
| 732 | nmdc:mga08x19_18672_c1 | 3300050514 | Unclassified | 4249 |
| 733 | nmdc:mga08x19_2129_c2 | 3300050514 | Bacteria | 5083 |
| 734 | nmdc:mga08x19_43978_c1 | 3300050514 | Bacteria | 2850 |
| 735 | nmdc:mga08x19_6332_c1 | 3300050514 | Bacteria | 7009 |
| 736 | nmdc:mga0a205_107_c2 | 3300050515 | Bacteria | 46625 |
| 737 | nmdc:mga0a205_7634_c1 | 3300050515 | Bacteria | 9808 |
| 738 | Ga0501084_0254946 | 3300054114 | Unclassified | 1481 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005518 | Ga0070699_100183731 | Ga0070699_1001837312 | 225 |
| 2 | 3300054114 | Ga0501084_0254946 | Ga0501084_0254946_275_1012 | 226 |
| 3 | 3300005338 | Ga0068868_100282120 | Ga0068868_1002821202 | 227 |
| 4 | 3300005364 | Ga0070673_100457923 | Ga0070673_1004579231 | 227 |
| 5 | 3300005445 | Ga0070708_100003966 | Ga0070708_1000039664 | 227 |
| 6 | 3300005471 | Ga0070698_100013058 | Ga0070698_1000130587 | 227 |
| 7 | 3300005518 | Ga0070699_100001027 | Ga0070699_1000010274 | 227 |
| 8 | 3300005518 | Ga0070699_100096021 | Ga0070699_1000960212 | 227 |
| 9 | 3300005530 | Ga0070679_100014737 | Ga0070679_1000147371 | 227 |
| 10 | 3300005535 | Ga0070684_100037540 | Ga0070684_1000375403 | 227 |
| 11 | 3300005547 | Ga0070693_100008310 | Ga0070693_1000083103 | 227 |
| 12 | 3300005563 | Ga0068855_100001467 | Ga0068855_1000014677 | 227 |
| 13 | 3300005564 | Ga0070664_100090314 | Ga0070664_1000903142 | 227 |
| 14 | 3300005614 | Ga0068856_100000884 | Ga0068856_10000088421 | 227 |
| 15 | 3300006173 | Ga0070716_100037014 | Ga0070716_1000370143 | 227 |
| 16 | 3300006237 | Ga0097621_100000731 | Ga0097621_1000007314 | 227 |
| 17 | 3300006358 | Ga0068871_100000266 | Ga0068871_10000026619 | 227 |
| 18 | 3300025912 | Ga0207707_10000617 | Ga0207707_1000061719 | 227 |
| 19 | 3300025924 | Ga0207694_10000743 | Ga0207694_1000074318 | 227 |
| 20 | 3300025945 | Ga0207679_10073991 | Ga0207679_100739913 | 227 |
| 21 | 3300025949 | Ga0207667_10001753 | Ga0207667_1000175324 | 227 |
| 22 | 3300026078 | Ga0207702_10001299 | Ga0207702_100012997 | 227 |
| 23 | 3300046684 | Ga0495669_0027789 | Ga0495669_0027789_1555_2295 | 227 |
| 24 | 3300047445 | Ga0495677_0166123 | Ga0495677_0166123_86_826 | 227 |
| 25 | 3300049519 | Ga0501296_010667 | Ga0501296_010667_322_1062 | 227 |
| 26 | 3300005435 | Ga0070714_100369035 | Ga0070714_1003690352 | 228 |
| 27 | 3300005436 | Ga0070713_100027201 | Ga0070713_1000272013 | 228 |
| 28 | 3300005437 | Ga0070710_10024862 | Ga0070710_100248622 | 228 |
| 29 | 3300005439 | Ga0070711_100039331 | Ga0070711_1000393311 | 228 |
| 30 | 3300005439 | Ga0070711_100052965 | Ga0070711_1000529652 | 228 |
| 31 | 3300005439 | Ga0070711_100057485 | Ga0070711_1000574852 | 228 |
| 32 | 3300005445 | Ga0070708_100003146 | Ga0070708_10000314611 | 228 |
| 33 | 3300005445 | Ga0070708_100660189 | Ga0070708_1006601892 | 228 |
| 34 | 3300005530 | Ga0070679_100464459 | Ga0070679_1004644592 | 228 |
| 35 | 3300005536 | Ga0070697_100000237 | Ga0070697_10000023712 | 228 |
| 36 | 3300005564 | Ga0070664_100000079 | Ga0070664_10000007937 | 228 |
| 37 | 3300005614 | Ga0068856_100001689 | Ga0068856_1000016894 | 228 |
| 38 | 3300005617 | Ga0068859_100000743 | Ga0068859_10000074318 | 228 |
| 39 | 3300006931 | Ga0097620_100000743 | Ga0097620_10000074313 | 228 |
| 40 | 3300013297 | Ga0157378_10077210 | Ga0157378_100772103 | 228 |
| 41 | 3300025898 | Ga0207692_10029019 | Ga0207692_100290193 | 228 |
| 42 | 3300025925 | Ga0207650_10042503 | Ga0207650_100425034 | 228 |
| 43 | 3300025949 | Ga0207667_10056561 | Ga0207667_100565612 | 228 |
| 44 | 3300025949 | Ga0207667_10129991 | Ga0207667_101299915 | 228 |
| 45 | 3300025981 | Ga0207640_10010779 | Ga0207640_100107795 | 228 |
| 46 | 3300035725 | Ga0373947_0556858 | Ga0373947_0556858_17_760 | 228 |
| 47 | 3300005336 | Ga0070680_100076357 | Ga0070680_1000763573 | 229 |
| 48 | 3300005458 | Ga0070681_10012120 | Ga0070681_100121205 | 229 |
| 49 | 3300005445 | Ga0070708_100089157 | Ga0070708_1000891572 | 230 |
| 50 | 3300005467 | Ga0070706_100116070 | Ga0070706_1001160703 | 230 |
| 51 | 3300005468 | Ga0070707_100209000 | Ga0070707_1002090002 | 230 |
| 52 | 3300005471 | Ga0070698_100223136 | Ga0070698_1002231362 | 230 |
| 53 | 3300006237 | Ga0097621_100576711 | Ga0097621_1005767112 | 230 |
| 54 | 3300013105 | Ga0157369_10001722 | Ga0157369_100017226 | 230 |
| 55 | 3300005437 | Ga0070710_10159208 | Ga0070710_101592082 | 231 |
| 56 | 3300005468 | Ga0070707_100251525 | Ga0070707_1002515251 | 231 |
| 57 | 3300005578 | Ga0068854_100335242 | Ga0068854_1003352423 | 231 |
| 58 | 3300005614 | Ga0068856_100282874 | Ga0068856_1002828742 | 231 |
| 59 | 3300006028 | Ga0070717_10278980 | Ga0070717_102789802 | 231 |
| 60 | 3300025913 | Ga0207695_10053870 | Ga0207695_100538703 | 231 |
| 61 | 3300025915 | Ga0207693_10053913 | Ga0207693_100539132 | 231 |
| 62 | 3300025928 | Ga0207700_10034264 | Ga0207700_100342643 | 231 |
| 63 | 3300025929 | Ga0207664_10653603 | Ga0207664_106536031 | 231 |
| 64 | 3300025949 | Ga0207667_10305979 | Ga0207667_103059792 | 231 |
| 65 | 3300025981 | Ga0207640_10059925 | Ga0207640_100599252 | 231 |
| 66 | 3300026078 | Ga0207702_10056905 | Ga0207702_100569054 | 231 |
| 67 | 3300031090 | Ga0265760_10000564 | Ga0265760_100005642 | 231 |
| 68 | 3300025910 | Ga0207684_10033830 | Ga0207684_100338303 | 233 |
| 69 | 3300005439 | Ga0070711_100292029 | Ga0070711_1002920292 | 234 |
| 70 | 3300025916 | Ga0207663_10177613 | Ga0207663_101776132 | 234 |
| 71 | 3300006028 | Ga0070717_10198906 | Ga0070717_101989062 | 235 |
| 72 | 3300025940 | Ga0207691_10483887 | Ga0207691_104838872 | 235 |
| 73 | 3300048915 | Ga0496112_0102212 | Ga0496112_0102212_140_919 | 236 |
| 74 | 3300005445 | Ga0070708_100023212 | Ga0070708_1000232123 | 237 |
| 75 | 3300005458 | Ga0070681_10283619 | Ga0070681_102836191 | 237 |
| 76 | 3300005468 | Ga0070707_100037132 | Ga0070707_1000371324 | 237 |
| 77 | 3300031090 | Ga0265760_10002887 | Ga0265760_100028872 | 237 |
| 78 | 3300031090 | Ga0265760_10043850 | Ga0265760_100438501 | 237 |
| 79 | 3300005536 | Ga0070697_100001234 | Ga0070697_10000123415 | 238 |
| 80 | 3300006028 | Ga0070717_10506851 | Ga0070717_105068512 | 238 |
| 81 | 3300006173 | Ga0070716_100009156 | Ga0070716_1000091567 | 238 |
| 82 | 3300006871 | Ga0075434_100034614 | Ga0075434_1000346145 | 238 |
| 83 | 3300025906 | Ga0207699_10338704 | Ga0207699_103387041 | 238 |
| 84 | 3300025910 | Ga0207684_10487378 | Ga0207684_104873781 | 238 |
| 85 | 3300025928 | Ga0207700_10202860 | Ga0207700_102028602 | 238 |
| 86 | 3300025939 | Ga0207665_10017745 | Ga0207665_100177452 | 238 |
| 87 | 3300031090 | Ga0265760_10004692 | Ga0265760_100046922 | 238 |
| 88 | 3300050512 | nmdc:mga0n895_31483_c1 | nmdc:mga0n895_31483_c1_2278_3057 | 238 |
| 89 | 3300028800 | Ga0265338_10119471 | Ga0265338_101194712 | 239 |
| 90 | 3300046615 | Ga0495656_0012753 | Ga0495656_0012753_1637_2413 | 239 |
| 91 | 3300007076 | Ga0075435_100030477 | Ga0075435_1000304775 | 241 |
| 92 | 3300025939 | Ga0207665_10066960 | Ga0207665_100669603 | 241 |
| 93 | 3300045051 | Ga0451576_0283887 | Ga0451576_0283887_699_1487 | 241 |
| 94 | 3300050513 | nmdc:mga0rr50_31563_c1 | nmdc:mga0rr50_31563_c1_1023_1832 | 241 |
| 95 | 3300050514 | nmdc:mga08x19_43978_c1 | nmdc:mga08x19_43978_c1_76_885 | 241 |
| 96 | 3300026023 | Ga0207677_10163209 | Ga0207677_101632092 | 242 |
| 97 | 3300042876 | Ga0451577_0000157 | Ga0451577_0000157_41002_41793 | 242 |
| 98 | 3300044673 | Ga0453683_0369661 | Ga0453683_0369661_111_902 | 242 |
| 99 | 3300044712 | Ga0453684_0001152 | Ga0453684_0001152_63775_64566 | 242 |
| 100 | 3300037471 | Ga0395905_0009325 | Ga0395905_0009325_5910_6701 | 243 |
| 101 | 3300042876 | Ga0451577_0041769 | Ga0451577_0041769_3270_4061 | 243 |
| 102 | 3300045051 | Ga0451576_0108517 | Ga0451576_0108517_786_1577 | 243 |
| 103 | 3300046499 | Ga0495594_0159038 | Ga0495594_0159038_25_813 | 243 |
| 104 | 3300046516 | Ga0495628_0404339 | Ga0495628_0404339_162_950 | 243 |
| 105 | 3300046559 | Ga0495667_0123160 | Ga0495667_0123160_415_1203 | 243 |
| 106 | 3300046675 | Ga0495657_0093540 | Ga0495657_0093540_680_1468 | 243 |
| 107 | 3300046675 | Ga0495657_0239335 | Ga0495657_0239335_276_1064 | 243 |
| 108 | 3300046679 | Ga0495623_0064777 | Ga0495623_0064777_453_1241 | 243 |
| 109 | 3300047444 | Ga0495675_0032498 | Ga0495675_0032498_771_1559 | 243 |
| 110 | 3300047444 | Ga0495675_0052458 | Ga0495675_0052458_1709_2497 | 243 |
| 111 | 3300006852 | Ga0075433_10003910 | Ga0075433_1000391013 | 244 |
| 112 | 3300006871 | Ga0075434_100175929 | Ga0075434_1001759294 | 244 |
| 113 | 3300009174 | Ga0105241_10805168 | Ga0105241_108051681 | 244 |
| 114 | 3300021377 | Ga0213874_10005028 | Ga0213874_100050284 | 244 |
| 115 | 3300037418 | Ga0395900_0392383 | Ga0395900_0392383_549_1340 | 244 |
| 116 | 3300037471 | Ga0395905_0339925 | Ga0395905_0339925_463_1257 | 244 |
| 117 | 3300039437 | Ga0436365_0117660 | Ga0436365_0117660_1548_2339 | 244 |
| 118 | 3300039437 | Ga0436365_1528334 | Ga0436365_1528334_270_1073 | 244 |
| 119 | 3300039450 | Ga0436363_1700190 | Ga0436363_1700190_440_1243 | 244 |
| 120 | 3300044694 | Ga0466963_0014508 | Ga0466963_0014508_3816_4616 | 244 |
| 121 | 3300045976 | Ga0466967_0002974 | Ga0466967_0002974_5597_6397 | 244 |
| 122 | 3300050512 | nmdc:mga0n895_31071_c1 | nmdc:mga0n895_31071_c1_215_1018 | 244 |
| 123 | 3300050513 | nmdc:mga0rr50_143165_c1 | nmdc:mga0rr50_143165_c1_424_1227 | 244 |
| 124 | 3300050515 | nmdc:mga0a205_7634_c1 | nmdc:mga0a205_7634_c1_8827_9630 | 244 |
| 125 | 3300005329 | Ga0070683_100073142 | Ga0070683_1000731423 | 245 |
| 126 | 3300005330 | Ga0070690_100178498 | Ga0070690_1001784982 | 245 |
| 127 | 3300005338 | Ga0068868_100003985 | Ga0068868_1000039858 | 245 |
| 128 | 3300005339 | Ga0070660_100421576 | Ga0070660_1004215761 | 245 |
| 129 | 3300005355 | Ga0070671_100122780 | Ga0070671_1001227803 | 245 |
| 130 | 3300005458 | Ga0070681_10000988 | Ga0070681_100009883 | 245 |
| 131 | 3300005458 | Ga0070681_10224946 | Ga0070681_102249462 | 245 |
| 132 | 3300005459 | Ga0068867_100201820 | Ga0068867_1002018203 | 245 |
| 133 | 3300005530 | Ga0070679_100172263 | Ga0070679_1001722632 | 245 |
| 134 | 3300005539 | Ga0068853_100014856 | Ga0068853_1000148563 | 245 |
| 135 | 3300005563 | Ga0068855_100000440 | Ga0068855_10000044019 | 245 |
| 136 | 3300005577 | Ga0068857_100040124 | Ga0068857_1000401243 | 245 |
| 137 | 3300005578 | Ga0068854_100037953 | Ga0068854_1000379533 | 245 |
| 138 | 3300005614 | Ga0068856_100000314 | Ga0068856_10000031421 | 245 |
| 139 | 3300005616 | Ga0068852_100005106 | Ga0068852_1000051066 | 245 |
| 140 | 3300005617 | Ga0068859_100617244 | Ga0068859_1006172442 | 245 |
| 141 | 3300005834 | Ga0068851_10029758 | Ga0068851_100297581 | 245 |
| 142 | 3300005841 | Ga0068863_100007633 | Ga0068863_1000076334 | 245 |
| 143 | 3300005842 | Ga0068858_100010361 | Ga0068858_1000103614 | 245 |
| 144 | 3300005843 | Ga0068860_100132368 | Ga0068860_1001323682 | 245 |
| 145 | 3300006237 | Ga0097621_100000088 | Ga0097621_10000008817 | 245 |
| 146 | 3300006358 | Ga0068871_100000428 | Ga0068871_1000004284 | 245 |
| 147 | 3300006881 | Ga0068865_100007069 | Ga0068865_1000070693 | 245 |
| 148 | 3300006931 | Ga0097620_100617320 | Ga0097620_1006173202 | 245 |
| 149 | 3300009093 | Ga0105240_10005076 | Ga0105240_1000507615 | 245 |
| 150 | 3300009093 | Ga0105240_10130352 | Ga0105240_101303523 | 245 |
| 151 | 3300009177 | Ga0105248_10002754 | Ga0105248_1000275414 | 245 |
| 152 | 3300009545 | Ga0105237_10274245 | Ga0105237_102742452 | 245 |
| 153 | 3300009551 | Ga0105238_10001256 | Ga0105238_100012563 | 245 |
| 154 | 3300010375 | Ga0105239_10027319 | Ga0105239_100273194 | 245 |
| 155 | 3300013102 | Ga0157371_10068655 | Ga0157371_100686553 | 245 |
| 156 | 3300013105 | Ga0157369_10000196 | Ga0157369_1000019653 | 245 |
| 157 | 3300013296 | Ga0157374_10000312 | Ga0157374_100003124 | 245 |
| 158 | 3300013296 | Ga0157374_10000989 | Ga0157374_1000098910 | 245 |
| 159 | 3300013297 | Ga0157378_10000058 | Ga0157378_1000005865 | 245 |
| 160 | 3300013297 | Ga0157378_10001335 | Ga0157378_100013354 | 245 |
| 161 | 3300013307 | Ga0157372_10000379 | Ga0157372_1000037927 | 245 |
| 162 | 3300013307 | Ga0157372_10000714 | Ga0157372_1000071425 | 245 |
| 163 | 3300014969 | Ga0157376_10003037 | Ga0157376_100030373 | 245 |
| 164 | 3300024225 | Ga0224572_1003559 | Ga0224572_10035593 | 245 |
| 165 | 3300025321 | Ga0207656_10202119 | Ga0207656_102021191 | 245 |
| 166 | 3300025912 | Ga0207707_10129771 | Ga0207707_101297712 | 245 |
| 167 | 3300025913 | Ga0207695_10005582 | Ga0207695_100055828 | 245 |
| 168 | 3300025913 | Ga0207695_10312606 | Ga0207695_103126063 | 245 |
| 169 | 3300025914 | Ga0207671_10258684 | Ga0207671_102586842 | 245 |
| 170 | 3300025917 | Ga0207660_10234598 | Ga0207660_102345982 | 245 |
| 171 | 3300025921 | Ga0207652_10031964 | Ga0207652_100319642 | 245 |
| 172 | 3300025921 | Ga0207652_10049802 | Ga0207652_100498023 | 245 |
| 173 | 3300025924 | Ga0207694_10068819 | Ga0207694_100688192 | 245 |
| 174 | 3300025928 | Ga0207700_10339306 | Ga0207700_103393062 | 245 |
| 175 | 3300025931 | Ga0207644_10234750 | Ga0207644_102347501 | 245 |
| 176 | 3300025938 | Ga0207704_10013405 | Ga0207704_100134053 | 245 |
| 177 | 3300025949 | Ga0207667_10022333 | Ga0207667_100223336 | 245 |
| 178 | 3300025960 | Ga0207651_10414784 | Ga0207651_104147842 | 245 |
| 179 | 3300025981 | Ga0207640_10042734 | Ga0207640_100427343 | 245 |
| 180 | 3300026023 | Ga0207677_10002125 | Ga0207677_100021252 | 245 |
| 181 | 3300026023 | Ga0207677_10253370 | Ga0207677_102533702 | 245 |
| 182 | 3300026035 | Ga0207703_10011057 | Ga0207703_100110573 | 245 |
| 183 | 3300026041 | Ga0207639_10005137 | Ga0207639_100051374 | 245 |
| 184 | 3300026078 | Ga0207702_10001432 | Ga0207702_100014324 | 245 |
| 185 | 3300026088 | Ga0207641_10010380 | Ga0207641_100103805 | 245 |
| 186 | 3300026089 | Ga0207648_10111193 | Ga0207648_101111931 | 245 |
| 187 | 3300026095 | Ga0207676_10091337 | Ga0207676_100913373 | 245 |
| 188 | 3300026116 | Ga0207674_10052593 | Ga0207674_100525932 | 245 |
| 189 | 3300026142 | Ga0207698_10029830 | Ga0207698_100298302 | 245 |
| 190 | 3300035691 | Ga0373931_0103142 | Ga0373931_0103142_164_964 | 245 |
| 191 | 3300048905 | Ga0496102_0111535 | Ga0496102_0111535_252_1052 | 245 |
| 192 | 3300048914 | Ga0496111_0367603 | Ga0496111_0367603_237_1037 | 245 |
| 193 | 3300048915 | Ga0496112_0000399 | Ga0496112_0000399_6404_7204 | 245 |
| 194 | 3300001990 | JGI24737J22298_10050251 | JGI24737J22298_100502513 | 246 |
| 195 | 3300001991 | JGI24743J22301_10031702 | JGI24743J22301_100317021 | 246 |
| 196 | 3300005290 | Ga0065712_10117106 | Ga0065712_101171063 | 246 |
| 197 | 3300005290 | Ga0065712_10272610 | Ga0065712_102726101 | 246 |
| 198 | 3300005327 | Ga0070658_10552986 | Ga0070658_105529861 | 246 |
| 199 | 3300005329 | Ga0070683_100000996 | Ga0070683_10000099621 | 246 |
| 200 | 3300005331 | Ga0070670_100010214 | Ga0070670_1000102145 | 246 |
| 201 | 3300005331 | Ga0070670_100022664 | Ga0070670_1000226644 | 246 |
| 202 | 3300005331 | Ga0070670_100217955 | Ga0070670_1002179552 | 246 |
| 203 | 3300005333 | Ga0070677_10022501 | Ga0070677_100225013 | 246 |
| 204 | 3300005338 | Ga0068868_100006259 | Ga0068868_1000062594 | 246 |
| 205 | 3300005339 | Ga0070660_100006382 | Ga0070660_10000638210 | 246 |
| 206 | 3300005340 | Ga0070689_100000844 | Ga0070689_1000008442 | 246 |
| 207 | 3300005340 | Ga0070689_100320977 | Ga0070689_1003209772 | 246 |
| 208 | 3300005343 | Ga0070687_100002055 | Ga0070687_1000020552 | 246 |
| 209 | 3300005347 | Ga0070668_100078168 | Ga0070668_1000781683 | 246 |
| 210 | 3300005354 | Ga0070675_100002781 | Ga0070675_10000278111 | 246 |
| 211 | 3300005356 | Ga0070674_100022355 | Ga0070674_1000223553 | 246 |
| 212 | 3300005364 | Ga0070673_100016252 | Ga0070673_1000162523 | 246 |
| 213 | 3300005365 | Ga0070688_100014009 | Ga0070688_1000140096 | 246 |
| 214 | 3300005434 | Ga0070709_10119965 | Ga0070709_101199653 | 246 |
| 215 | 3300005435 | Ga0070714_100230099 | Ga0070714_1002300992 | 246 |
| 216 | 3300005436 | Ga0070713_100062242 | Ga0070713_1000622421 | 246 |
| 217 | 3300005439 | Ga0070711_100017703 | Ga0070711_1000177034 | 246 |
| 218 | 3300005440 | Ga0070705_100150946 | Ga0070705_1001509462 | 246 |
| 219 | 3300005445 | Ga0070708_100037006 | Ga0070708_1000370063 | 246 |
| 220 | 3300005445 | Ga0070708_100189306 | Ga0070708_1001893062 | 246 |
| 221 | 3300005455 | Ga0070663_100020172 | Ga0070663_1000201722 | 246 |
| 222 | 3300005456 | Ga0070678_100003297 | Ga0070678_10000329710 | 246 |
| 223 | 3300005456 | Ga0070678_100022663 | Ga0070678_1000226633 | 246 |
| 224 | 3300005457 | Ga0070662_100100888 | Ga0070662_1001008883 | 246 |
| 225 | 3300005458 | Ga0070681_10011272 | Ga0070681_100112724 | 246 |
| 226 | 3300005466 | Ga0070685_10001933 | Ga0070685_100019336 | 246 |
| 227 | 3300005535 | Ga0070684_100001677 | Ga0070684_10000167718 | 246 |
| 228 | 3300005535 | Ga0070684_100014670 | Ga0070684_1000146704 | 246 |
| 229 | 3300005535 | Ga0070684_100106170 | Ga0070684_1001061702 | 246 |
| 230 | 3300005539 | Ga0068853_100005375 | Ga0068853_1000053756 | 246 |
| 231 | 3300005543 | Ga0070672_100128080 | Ga0070672_1001280802 | 246 |
| 232 | 3300005563 | Ga0068855_100058930 | Ga0068855_1000589302 | 246 |
| 233 | 3300005577 | Ga0068857_100004770 | Ga0068857_1000047705 | 246 |
| 234 | 3300005577 | Ga0068857_100107688 | Ga0068857_1001076882 | 246 |
| 235 | 3300005578 | Ga0068854_100014008 | Ga0068854_1000140084 | 246 |
| 236 | 3300005578 | Ga0068854_100047532 | Ga0068854_1000475323 | 246 |
| 237 | 3300005614 | Ga0068856_100013970 | Ga0068856_1000139705 | 246 |
| 238 | 3300005614 | Ga0068856_100195303 | Ga0068856_1001953032 | 246 |
| 239 | 3300005614 | Ga0068856_100202881 | Ga0068856_1002028811 | 246 |
| 240 | 3300005615 | Ga0070702_100131113 | Ga0070702_1001311131 | 246 |
| 241 | 3300005616 | Ga0068852_100073044 | Ga0068852_1000730442 | 246 |
| 242 | 3300005718 | Ga0068866_10000598 | Ga0068866_100005983 | 246 |
| 243 | 3300005718 | Ga0068866_10105674 | Ga0068866_101056742 | 246 |
| 244 | 3300005719 | Ga0068861_100004952 | Ga0068861_1000049524 | 246 |
| 245 | 3300005719 | Ga0068861_100086440 | Ga0068861_1000864402 | 246 |
| 246 | 3300005840 | Ga0068870_10001859 | Ga0068870_100018596 | 246 |
| 247 | 3300005841 | Ga0068863_100033173 | Ga0068863_1000331732 | 246 |
| 248 | 3300005841 | Ga0068863_100076640 | Ga0068863_1000766403 | 246 |
| 249 | 3300005841 | Ga0068863_100119501 | Ga0068863_1001195013 | 246 |
| 250 | 3300005843 | Ga0068860_100072721 | Ga0068860_1000727213 | 246 |
| 251 | 3300005844 | Ga0068862_100040805 | Ga0068862_1000408052 | 246 |
| 252 | 3300006028 | Ga0070717_10001917 | Ga0070717_1000191713 | 246 |
| 253 | 3300006028 | Ga0070717_10003179 | Ga0070717_100031799 | 246 |
| 254 | 3300006173 | Ga0070716_100000963 | Ga0070716_10000096312 | 246 |
| 255 | 3300006175 | Ga0070712_100001489 | Ga0070712_1000014894 | 246 |
| 256 | 3300006175 | Ga0070712_100004426 | Ga0070712_1000044267 | 246 |
| 257 | 3300006175 | Ga0070712_100319851 | Ga0070712_1003198512 | 246 |
| 258 | 3300006237 | Ga0097621_100001934 | Ga0097621_1000019345 | 246 |
| 259 | 3300006237 | Ga0097621_100009212 | Ga0097621_1000092123 | 246 |
| 260 | 3300006358 | Ga0068871_100008870 | Ga0068871_1000088704 | 246 |
| 261 | 3300006358 | Ga0068871_100076855 | Ga0068871_1000768553 | 246 |
| 262 | 3300006852 | Ga0075433_10000048 | Ga0075433_1000004844 | 246 |
| 263 | 3300006871 | Ga0075434_100007179 | Ga0075434_1000071792 | 246 |
| 264 | 3300006871 | Ga0075434_100065078 | Ga0075434_1000650784 | 246 |
| 265 | 3300006914 | Ga0075436_100003918 | Ga0075436_1000039182 | 246 |
| 266 | 3300007076 | Ga0075435_100002276 | Ga0075435_1000022763 | 246 |
| 267 | 3300009093 | Ga0105240_10046006 | Ga0105240_100460065 | 246 |
| 268 | 3300009093 | Ga0105240_10354797 | Ga0105240_103547972 | 246 |
| 269 | 3300009098 | Ga0105245_10043511 | Ga0105245_100435113 | 246 |
| 270 | 3300009098 | Ga0105245_10188012 | Ga0105245_101880121 | 246 |
| 271 | 3300009147 | Ga0114129_10263397 | Ga0114129_102633972 | 246 |
| 272 | 3300009174 | Ga0105241_10028616 | Ga0105241_100286162 | 246 |
| 273 | 3300009174 | Ga0105241_10068900 | Ga0105241_100689003 | 246 |
| 274 | 3300009176 | Ga0105242_10066838 | Ga0105242_100668383 | 246 |
| 275 | 3300009177 | Ga0105248_10024617 | Ga0105248_100246176 | 246 |
| 276 | 3300009177 | Ga0105248_10054467 | Ga0105248_100544672 | 246 |
| 277 | 3300009177 | Ga0105248_10061141 | Ga0105248_100611412 | 246 |
| 278 | 3300009545 | Ga0105237_10010940 | Ga0105237_100109408 | 246 |
| 279 | 3300009551 | Ga0105238_10076516 | Ga0105238_100765164 | 246 |
| 280 | 3300009551 | Ga0105238_10195438 | Ga0105238_101954382 | 246 |
| 281 | 3300009553 | Ga0105249_10110523 | Ga0105249_101105234 | 246 |
| 282 | 3300010375 | Ga0105239_10020769 | Ga0105239_100207694 | 246 |
| 283 | 3300010375 | Ga0105239_10131950 | Ga0105239_101319503 | 246 |
| 284 | 3300010375 | Ga0105239_10170577 | Ga0105239_101705773 | 246 |
| 285 | 3300013100 | Ga0157373_10009346 | Ga0157373_100093464 | 246 |
| 286 | 3300013100 | Ga0157373_10181386 | Ga0157373_101813862 | 246 |
| 287 | 3300013102 | Ga0157371_10042533 | Ga0157371_100425335 | 246 |
| 288 | 3300013105 | Ga0157369_10010846 | Ga0157369_1001084610 | 246 |
| 289 | 3300013105 | Ga0157369_10021606 | Ga0157369_100216066 | 246 |
| 290 | 3300013105 | Ga0157369_10047180 | Ga0157369_100471804 | 246 |
| 291 | 3300013105 | Ga0157369_10252144 | Ga0157369_102521443 | 246 |
| 292 | 3300013105 | Ga0157369_10428591 | Ga0157369_104285912 | 246 |
| 293 | 3300013296 | Ga0157374_10001078 | Ga0157374_100010789 | 246 |
| 294 | 3300013297 | Ga0157378_10000057 | Ga0157378_1000005772 | 246 |
| 295 | 3300013297 | Ga0157378_10000304 | Ga0157378_1000030441 | 246 |
| 296 | 3300013306 | Ga0163162_10108566 | Ga0163162_101085662 | 246 |
| 297 | 3300013306 | Ga0163162_10134902 | Ga0163162_101349022 | 246 |
| 298 | 3300013307 | Ga0157372_10000200 | Ga0157372_1000020018 | 246 |
| 299 | 3300013307 | Ga0157372_10003854 | Ga0157372_100038543 | 246 |
| 300 | 3300013307 | Ga0157372_10008585 | Ga0157372_100085859 | 246 |
| 301 | 3300013307 | Ga0157372_10018945 | Ga0157372_100189452 | 246 |
| 302 | 3300013307 | Ga0157372_10114379 | Ga0157372_101143793 | 246 |
| 303 | 3300014325 | Ga0163163_10011964 | Ga0163163_100119648 | 246 |
| 304 | 3300014325 | Ga0163163_10028994 | Ga0163163_100289944 | 246 |
| 305 | 3300014325 | Ga0163163_10047416 | Ga0163163_100474162 | 246 |
| 306 | 3300014325 | Ga0163163_10052362 | Ga0163163_100523623 | 246 |
| 307 | 3300014325 | Ga0163163_10231656 | Ga0163163_102316562 | 246 |
| 308 | 3300014745 | Ga0157377_10122308 | Ga0157377_101223081 | 246 |
| 309 | 3300014969 | Ga0157376_10150773 | Ga0157376_101507732 | 246 |
| 310 | 3300014969 | Ga0157376_10842264 | Ga0157376_108422641 | 246 |
| 311 | 3300014969 | Ga0157376_10851861 | Ga0157376_108518612 | 246 |
| 312 | 3300017792 | Ga0163161_10003804 | Ga0163161_100038046 | 246 |
| 313 | 3300021358 | Ga0213873_10020184 | Ga0213873_100201842 | 246 |
| 314 | 3300025315 | Ga0207697_10024904 | Ga0207697_100249041 | 246 |
| 315 | 3300025893 | Ga0207682_10063867 | Ga0207682_100638673 | 246 |
| 316 | 3300025898 | Ga0207692_10150872 | Ga0207692_101508722 | 246 |
| 317 | 3300025904 | Ga0207647_10024407 | Ga0207647_100244073 | 246 |
| 318 | 3300025906 | Ga0207699_10448100 | Ga0207699_104481001 | 246 |
| 319 | 3300025907 | Ga0207645_10000551 | Ga0207645_1000055116 | 246 |
| 320 | 3300025908 | Ga0207643_10002140 | Ga0207643_100021403 | 246 |
| 321 | 3300025910 | Ga0207684_10279783 | Ga0207684_102797832 | 246 |
| 322 | 3300025911 | Ga0207654_10048036 | Ga0207654_100480363 | 246 |
| 323 | 3300025912 | Ga0207707_10002456 | Ga0207707_100024563 | 246 |
| 324 | 3300025913 | Ga0207695_10058048 | Ga0207695_100580484 | 246 |
| 325 | 3300025913 | Ga0207695_10252313 | Ga0207695_102523132 | 246 |
| 326 | 3300025915 | Ga0207693_10009791 | Ga0207693_100097917 | 246 |
| 327 | 3300025915 | Ga0207693_10026726 | Ga0207693_100267262 | 246 |
| 328 | 3300025916 | Ga0207663_10070270 | Ga0207663_100702702 | 246 |
| 329 | 3300025916 | Ga0207663_10286619 | Ga0207663_102866192 | 246 |
| 330 | 3300025918 | Ga0207662_10004460 | Ga0207662_100044606 | 246 |
| 331 | 3300025919 | Ga0207657_10003665 | Ga0207657_1000366517 | 246 |
| 332 | 3300025920 | Ga0207649_10001493 | Ga0207649_100014934 | 246 |
| 333 | 3300025922 | Ga0207646_10217352 | Ga0207646_102173522 | 246 |
| 334 | 3300025925 | Ga0207650_10000045 | Ga0207650_10000045142 | 246 |
| 335 | 3300025927 | Ga0207687_10047387 | Ga0207687_100473874 | 246 |
| 336 | 3300025928 | Ga0207700_10146715 | Ga0207700_101467153 | 246 |
| 337 | 3300025928 | Ga0207700_10645546 | Ga0207700_106455461 | 246 |
| 338 | 3300025929 | Ga0207664_10048706 | Ga0207664_100487063 | 246 |
| 339 | 3300025934 | Ga0207686_10131534 | Ga0207686_101315341 | 246 |
| 340 | 3300025936 | Ga0207670_10308095 | Ga0207670_103080952 | 246 |
| 341 | 3300025939 | Ga0207665_10001295 | Ga0207665_1000129516 | 246 |
| 342 | 3300025939 | Ga0207665_10287210 | Ga0207665_102872102 | 246 |
| 343 | 3300025940 | Ga0207691_10004307 | Ga0207691_1000430710 | 246 |
| 344 | 3300025941 | Ga0207711_10021084 | Ga0207711_100210846 | 246 |
| 345 | 3300025941 | Ga0207711_10057050 | Ga0207711_100570502 | 246 |
| 346 | 3300025941 | Ga0207711_10204551 | Ga0207711_102045513 | 246 |
| 347 | 3300025942 | Ga0207689_10004596 | Ga0207689_100045966 | 246 |
| 348 | 3300025944 | Ga0207661_10000131 | Ga0207661_1000013119 | 246 |
| 349 | 3300025945 | Ga0207679_10000283 | Ga0207679_1000028312 | 246 |
| 350 | 3300025945 | Ga0207679_10234442 | Ga0207679_102344422 | 246 |
| 351 | 3300025949 | Ga0207667_10846263 | Ga0207667_108462631 | 246 |
| 352 | 3300025960 | Ga0207651_10029577 | Ga0207651_100295773 | 246 |
| 353 | 3300025960 | Ga0207651_10039352 | Ga0207651_100393524 | 246 |
| 354 | 3300025981 | Ga0207640_10031062 | Ga0207640_100310622 | 246 |
| 355 | 3300025986 | Ga0207658_10003108 | Ga0207658_1000310810 | 246 |
| 356 | 3300026035 | Ga0207703_10008464 | Ga0207703_100084644 | 246 |
| 357 | 3300026041 | Ga0207639_10286015 | Ga0207639_102860151 | 246 |
| 358 | 3300026067 | Ga0207678_10000026 | Ga0207678_100000266 | 246 |
| 359 | 3300026078 | Ga0207702_10005337 | Ga0207702_100053377 | 246 |
| 360 | 3300026078 | Ga0207702_10145132 | Ga0207702_101451321 | 246 |
| 361 | 3300026088 | Ga0207641_10000021 | Ga0207641_1000002111 | 246 |
| 362 | 3300026088 | Ga0207641_10112651 | Ga0207641_101126512 | 246 |
| 363 | 3300026089 | Ga0207648_10000611 | Ga0207648_1000061130 | 246 |
| 364 | 3300026089 | Ga0207648_10070587 | Ga0207648_100705873 | 246 |
| 365 | 3300026095 | Ga0207676_10000096 | Ga0207676_1000009629 | 246 |
| 366 | 3300026095 | Ga0207676_10541104 | Ga0207676_105411041 | 246 |
| 367 | 3300026116 | Ga0207674_10000246 | Ga0207674_1000024629 | 246 |
| 368 | 3300026116 | Ga0207674_10006208 | Ga0207674_100062087 | 246 |
| 369 | 3300026116 | Ga0207674_10009607 | Ga0207674_100096075 | 246 |
| 370 | 3300026118 | Ga0207675_100048302 | Ga0207675_1000483024 | 246 |
| 371 | 3300026121 | Ga0207683_10000259 | Ga0207683_1000025938 | 246 |
| 372 | 3300026121 | Ga0207683_10113947 | Ga0207683_101139472 | 246 |
| 373 | 3300028379 | Ga0268266_10006040 | Ga0268266_100060403 | 246 |
| 374 | 3300028380 | Ga0268265_10005648 | Ga0268265_100056486 | 246 |
| 375 | 3300028381 | Ga0268264_10004345 | Ga0268264_1000434511 | 246 |
| 376 | 3300028381 | Ga0268264_10140172 | Ga0268264_101401721 | 246 |
| 377 | 3300028800 | Ga0265338_10001717 | Ga0265338_1000171720 | 246 |
| 378 | 3300031249 | Ga0265339_10001780 | Ga0265339_1000178012 | 246 |
| 379 | 3300031250 | Ga0265331_10061776 | Ga0265331_100617762 | 246 |
| 380 | 3300031344 | Ga0265316_10012757 | Ga0265316_100127575 | 246 |
| 381 | 3300031548 | Ga0307408_100242572 | Ga0307408_1002425722 | 246 |
| 382 | 3300031731 | Ga0307405_10018003 | Ga0307405_100180031 | 246 |
| 383 | 3300031852 | Ga0307410_10026642 | Ga0307410_100266422 | 246 |
| 384 | 3300031852 | Ga0307410_10156905 | Ga0307410_101569052 | 246 |
| 385 | 3300031995 | Ga0307409_100313410 | Ga0307409_1003134102 | 246 |
| 386 | 3300032002 | Ga0307416_100183907 | Ga0307416_1001839072 | 246 |
| 387 | 3300032005 | Ga0307411_10314839 | Ga0307411_103148392 | 246 |
| 388 | 3300032126 | Ga0307415_100016974 | Ga0307415_1000169743 | 246 |
| 389 | 3300035118 | Ga0373954_0083902 | Ga0373954_0083902_136_939 | 246 |
| 390 | 3300035692 | Ga0373935_0392149 | Ga0373935_0392149_176_973 | 246 |
| 391 | 3300035724 | Ga0373933_0104999 | Ga0373933_0104999_465_1268 | 246 |
| 392 | 3300037471 | Ga0395905_0005720 | Ga0395905_0005720_4501_5298 | 246 |
| 393 | 3300037471 | Ga0395905_0015774 | Ga0395905_0015774_4414_5211 | 246 |
| 394 | 3300039453 | Ga0436362_0155418 | Ga0436362_0155418_1324_2127 | 246 |
| 395 | 3300044673 | Ga0453683_0025944 | Ga0453683_0025944_1700_2509 | 246 |
| 396 | 3300045976 | Ga0466967_0824223 | Ga0466967_0824223_58_861 | 246 |
| 397 | 3300046463 | Ga0495653_0272272 | Ga0495653_0272272_212_1015 | 246 |
| 398 | 3300046472 | Ga0495580_0002151 | Ga0495580_0002151_1382_2182 | 246 |
| 399 | 3300046472 | Ga0495580_0005568 | Ga0495580_0005568_9268_10065 | 246 |
| 400 | 3300046472 | Ga0495580_0282665 | Ga0495580_0282665_211_1011 | 246 |
| 401 | 3300046511 | Ga0495608_0206802 | Ga0495608_0206802_371_1174 | 246 |
| 402 | 3300046543 | Ga0495645_0291642 | Ga0495645_0291642_97_900 | 246 |
| 403 | 3300046684 | Ga0495669_0013822 | Ga0495669_0013822_1282_2085 | 246 |
| 404 | 3300047319 | Ga0495674_0487601 | Ga0495674_0487601_141_944 | 246 |
| 405 | 3300047471 | Ga0495684_0153451 | Ga0495684_0153451_532_1335 | 246 |
| 406 | 3300048911 | Ga0496108_0000605 | Ga0496108_0000605_8275_9072 | 246 |
| 407 | 3300048912 | Ga0496109_0000132 | Ga0496109_0000132_5434_6231 | 246 |
| 408 | 3300048912 | Ga0496109_0011172 | Ga0496109_0011172_5929_6732 | 246 |
| 409 | 3300048913 | Ga0496110_0001437 | Ga0496110_0001437_10312_11109 | 246 |
| 410 | 3300048915 | Ga0496112_0000464 | Ga0496112_0000464_12045_12842 | 246 |
| 411 | 3300048915 | Ga0496112_0148660 | Ga0496112_0148660_181_984 | 246 |
| 412 | 3300049517 | Ga0501294_007687 | Ga0501294_007687_173_985 | 246 |
| 413 | 3300049521 | Ga0501298_020448 | Ga0501298_020448_180_986 | 246 |
| 414 | 3300049769 | Ga0501272_004372 | Ga0501272_004372_589_1395 | 246 |
| 415 | 3300050512 | nmdc:mga0n895_128602_c1 | nmdc:mga0n895_128602_c1_1528_2337 | 246 |
| 416 | 3300050512 | nmdc:mga0n895_345_c1 | nmdc:mga0n895_345_c1_29696_30493 | 246 |
| 417 | 3300050513 | nmdc:mga0rr50_1877_c1 | nmdc:mga0rr50_1877_c1_9690_10487 | 246 |
| 418 | 3300050515 | nmdc:mga0a205_107_c2 | nmdc:mga0a205_107_c2_1199_1996 | 246 |
| 419 | 3300005434 | Ga0070709_10008666 | Ga0070709_100086662 | 247 |
| 420 | 3300005434 | Ga0070709_10204510 | Ga0070709_102045102 | 247 |
| 421 | 3300005434 | Ga0070709_10334746 | Ga0070709_103347461 | 247 |
| 422 | 3300005435 | Ga0070714_100062248 | Ga0070714_1000622484 | 247 |
| 423 | 3300005435 | Ga0070714_100114506 | Ga0070714_1001145062 | 247 |
| 424 | 3300005435 | Ga0070714_100145420 | Ga0070714_1001454203 | 247 |
| 425 | 3300005436 | Ga0070713_100127102 | Ga0070713_1001271022 | 247 |
| 426 | 3300005436 | Ga0070713_100128753 | Ga0070713_1001287532 | 247 |
| 427 | 3300005436 | Ga0070713_100173917 | Ga0070713_1001739172 | 247 |
| 428 | 3300005439 | Ga0070711_100033693 | Ga0070711_1000336933 | 247 |
| 429 | 3300005439 | Ga0070711_100075664 | Ga0070711_1000756641 | 247 |
| 430 | 3300005445 | Ga0070708_100081114 | Ga0070708_1000811143 | 247 |
| 431 | 3300005445 | Ga0070708_100158945 | Ga0070708_1001589452 | 247 |
| 432 | 3300005445 | Ga0070708_100790906 | Ga0070708_1007909061 | 247 |
| 433 | 3300005467 | Ga0070706_100017064 | Ga0070706_1000170644 | 247 |
| 434 | 3300005467 | Ga0070706_100022122 | Ga0070706_1000221221 | 247 |
| 435 | 3300005468 | Ga0070707_100184084 | Ga0070707_1001840842 | 247 |
| 436 | 3300005518 | Ga0070699_100007250 | Ga0070699_10000725010 | 247 |
| 437 | 3300005536 | Ga0070697_100000111 | Ga0070697_10000011143 | 247 |
| 438 | 3300005536 | Ga0070697_100022916 | Ga0070697_1000229164 | 247 |
| 439 | 3300005536 | Ga0070697_100025982 | Ga0070697_1000259823 | 247 |
| 440 | 3300005536 | Ga0070697_100279249 | Ga0070697_1002792492 | 247 |
| 441 | 3300005842 | Ga0068858_100037929 | Ga0068858_1000379294 | 247 |
| 442 | 3300006028 | Ga0070717_10005046 | Ga0070717_100050465 | 247 |
| 443 | 3300006028 | Ga0070717_10014384 | Ga0070717_100143844 | 247 |
| 444 | 3300006028 | Ga0070717_10037304 | Ga0070717_100373045 | 247 |
| 445 | 3300006028 | Ga0070717_10290734 | Ga0070717_102907342 | 247 |
| 446 | 3300006028 | Ga0070717_10326139 | Ga0070717_103261392 | 247 |
| 447 | 3300006173 | Ga0070716_100037319 | Ga0070716_1000373193 | 247 |
| 448 | 3300006173 | Ga0070716_100059096 | Ga0070716_1000590962 | 247 |
| 449 | 3300006175 | Ga0070712_100394155 | Ga0070712_1003941552 | 247 |
| 450 | 3300006237 | Ga0097621_100032470 | Ga0097621_1000324704 | 247 |
| 451 | 3300006358 | Ga0068871_100026158 | Ga0068871_1000261582 | 247 |
| 452 | 3300006358 | Ga0068871_100535561 | Ga0068871_1005355612 | 247 |
| 453 | 3300006358 | Ga0068871_100537222 | Ga0068871_1005372222 | 247 |
| 454 | 3300006914 | Ga0075436_100024846 | Ga0075436_1000248464 | 247 |
| 455 | 3300006914 | Ga0075436_100032947 | Ga0075436_1000329473 | 247 |
| 456 | 3300007076 | Ga0075435_100028468 | Ga0075435_1000284683 | 247 |
| 457 | 3300009093 | Ga0105240_10009676 | Ga0105240_100096766 | 247 |
| 458 | 3300009101 | Ga0105247_10117309 | Ga0105247_101173092 | 247 |
| 459 | 3300013296 | Ga0157374_10292023 | Ga0157374_102920232 | 247 |
| 460 | 3300013307 | Ga0157372_10202191 | Ga0157372_102021911 | 247 |
| 461 | 3300014968 | Ga0157379_10002438 | Ga0157379_100024389 | 247 |
| 462 | 3300014969 | Ga0157376_10018903 | Ga0157376_100189036 | 247 |
| 463 | 3300021377 | Ga0213874_10074028 | Ga0213874_100740281 | 247 |
| 464 | 3300024227 | Ga0228598_1003592 | Ga0228598_10035924 | 247 |
| 465 | 3300025901 | Ga0207688_10093312 | Ga0207688_100933122 | 247 |
| 466 | 3300025906 | Ga0207699_10008930 | Ga0207699_100089304 | 247 |
| 467 | 3300025906 | Ga0207699_10021420 | Ga0207699_100214204 | 247 |
| 468 | 3300025906 | Ga0207699_10036191 | Ga0207699_100361915 | 247 |
| 469 | 3300025906 | Ga0207699_10238930 | Ga0207699_102389302 | 247 |
| 470 | 3300025910 | Ga0207684_10064619 | Ga0207684_100646192 | 247 |
| 471 | 3300025913 | Ga0207695_10024396 | Ga0207695_100243968 | 247 |
| 472 | 3300025913 | Ga0207695_10176066 | Ga0207695_101760663 | 247 |
| 473 | 3300025916 | Ga0207663_10122908 | Ga0207663_101229082 | 247 |
| 474 | 3300025928 | Ga0207700_10147114 | Ga0207700_101471143 | 247 |
| 475 | 3300025928 | Ga0207700_10203610 | Ga0207700_102036102 | 247 |
| 476 | 3300025929 | Ga0207664_10011058 | Ga0207664_100110587 | 247 |
| 477 | 3300025929 | Ga0207664_10124402 | Ga0207664_101244023 | 247 |
| 478 | 3300025929 | Ga0207664_10746112 | Ga0207664_107461121 | 247 |
| 479 | 3300025939 | Ga0207665_10067636 | Ga0207665_100676364 | 247 |
| 480 | 3300025939 | Ga0207665_10203739 | Ga0207665_102037392 | 247 |
| 481 | 3300025945 | Ga0207679_10455080 | Ga0207679_104550801 | 247 |
| 482 | 3300031235 | Ga0265330_10009079 | Ga0265330_100090792 | 247 |
| 483 | 3300031247 | Ga0265340_10037738 | Ga0265340_100377383 | 247 |
| 484 | 3300031249 | Ga0265339_10079860 | Ga0265339_100798602 | 247 |
| 485 | 3300035725 | Ga0373947_0271652 | Ga0373947_0271652_232_1035 | 247 |
| 486 | 3300036401 | Ga0373937_0018912 | Ga0373937_0018912_746_1549 | 247 |
| 487 | 3300039437 | Ga0436365_0913571 | Ga0436365_0913571_335_1138 | 247 |
| 488 | 3300039450 | Ga0436363_0108166 | Ga0436363_0108166_175_978 | 247 |
| 489 | 3300039450 | Ga0436363_0644861 | Ga0436363_0644861_139_942 | 247 |
| 490 | 3300039450 | Ga0436363_1342541 | Ga0436363_1342541_835_1638 | 247 |
| 491 | 3300046472 | Ga0495580_0004470 | Ga0495580_0004470_1418_2224 | 247 |
| 492 | 3300046472 | Ga0495580_0042668 | Ga0495580_0042668_931_1737 | 247 |
| 493 | 3300046472 | Ga0495580_0096651 | Ga0495580_0096651_1187_1990 | 247 |
| 494 | 3300046531 | Ga0495665_0018105 | Ga0495665_0018105_194_1000 | 247 |
| 495 | 3300047315 | Ga0495581_0122147 | Ga0495581_0122147_467_1273 | 247 |
| 496 | 3300048904 | Ga0496101_0127407 | Ga0496101_0127407_425_1228 | 247 |
| 497 | 3300048905 | Ga0496102_0008569 | Ga0496102_0008569_1085_1888 | 247 |
| 498 | 3300048905 | Ga0496102_0013555 | Ga0496102_0013555_477_1277 | 247 |
| 499 | 3300048906 | Ga0496103_0022061 | Ga0496103_0022061_1641_2444 | 247 |
| 500 | 3300048907 | Ga0496104_0206179 | Ga0496104_0206179_182_985 | 247 |
| 501 | 3300050512 | nmdc:mga0n895_1448_c1 | nmdc:mga0n895_1448_c1_4048_4851 | 247 |
| 502 | 3300050514 | nmdc:mga08x19_18672_c1 | nmdc:mga08x19_18672_c1_2637_3440 | 247 |
| 503 | 3300050514 | nmdc:mga08x19_2129_c2 | nmdc:mga08x19_2129_c2_1446_2264 | 247 |
| 504 | 3300005290 | Ga0065712_10246933 | Ga0065712_102469331 | 248 |
| 505 | 3300005293 | Ga0065715_10145026 | Ga0065715_101450261 | 248 |
| 506 | 3300005293 | Ga0065715_10407363 | Ga0065715_104073631 | 248 |
| 507 | 3300005329 | Ga0070683_100100788 | Ga0070683_1001007882 | 248 |
| 508 | 3300005330 | Ga0070690_100130224 | Ga0070690_1001302242 | 248 |
| 509 | 3300005334 | Ga0068869_100006311 | Ga0068869_1000063118 | 248 |
| 510 | 3300005334 | Ga0068869_100401888 | Ga0068869_1004018882 | 248 |
| 511 | 3300005335 | Ga0070666_10034392 | Ga0070666_100343923 | 248 |
| 512 | 3300005336 | Ga0070680_100023130 | Ga0070680_1000231306 | 248 |
| 513 | 3300005337 | Ga0070682_100002535 | Ga0070682_1000025355 | 248 |
| 514 | 3300005339 | Ga0070660_100043786 | Ga0070660_1000437863 | 248 |
| 515 | 3300005340 | Ga0070689_100028593 | Ga0070689_1000285932 | 248 |
| 516 | 3300005343 | Ga0070687_100331765 | Ga0070687_1003317652 | 248 |
| 517 | 3300005344 | Ga0070661_100019010 | Ga0070661_1000190105 | 248 |
| 518 | 3300005347 | Ga0070668_100008093 | Ga0070668_1000080936 | 248 |
| 519 | 3300005353 | Ga0070669_100177950 | Ga0070669_1001779502 | 248 |
| 520 | 3300005354 | Ga0070675_100342055 | Ga0070675_1003420552 | 248 |
| 521 | 3300005366 | Ga0070659_100015849 | Ga0070659_1000158496 | 248 |
| 522 | 3300005367 | Ga0070667_100012738 | Ga0070667_1000127386 | 248 |
| 523 | 3300005434 | Ga0070709_10357201 | Ga0070709_103572012 | 248 |
| 524 | 3300005435 | Ga0070714_100081406 | Ga0070714_1000814062 | 248 |
| 525 | 3300005436 | Ga0070713_100076581 | Ga0070713_1000765812 | 248 |
| 526 | 3300005437 | Ga0070710_10022575 | Ga0070710_100225752 | 248 |
| 527 | 3300005444 | Ga0070694_100075969 | Ga0070694_1000759691 | 248 |
| 528 | 3300005455 | Ga0070663_100016064 | Ga0070663_1000160642 | 248 |
| 529 | 3300005457 | Ga0070662_100002565 | Ga0070662_1000025659 | 248 |
| 530 | 3300005459 | Ga0068867_100016423 | Ga0068867_1000164234 | 248 |
| 531 | 3300005459 | Ga0068867_100232568 | Ga0068867_1002325681 | 248 |
| 532 | 3300005466 | Ga0070685_10093357 | Ga0070685_100933572 | 248 |
| 533 | 3300005467 | Ga0070706_100000499 | Ga0070706_10000049938 | 248 |
| 534 | 3300005467 | Ga0070706_100109918 | Ga0070706_1001099183 | 248 |
| 535 | 3300005518 | Ga0070699_100387798 | Ga0070699_1003877982 | 248 |
| 536 | 3300005518 | Ga0070699_100489442 | Ga0070699_1004894422 | 248 |
| 537 | 3300005535 | Ga0070684_100015349 | Ga0070684_1000153493 | 248 |
| 538 | 3300005539 | Ga0068853_100018379 | Ga0068853_1000183797 | 248 |
| 539 | 3300005539 | Ga0068853_100157381 | Ga0068853_1001573812 | 248 |
| 540 | 3300005545 | Ga0070695_100015812 | Ga0070695_1000158125 | 248 |
| 541 | 3300005546 | Ga0070696_100141341 | Ga0070696_1001413411 | 248 |
| 542 | 3300005548 | Ga0070665_100008351 | Ga0070665_1000083518 | 248 |
| 543 | 3300005548 | Ga0070665_100124026 | Ga0070665_1001240263 | 248 |
| 544 | 3300005548 | Ga0070665_100815155 | Ga0070665_1008151551 | 248 |
| 545 | 3300005563 | Ga0068855_100119682 | Ga0068855_1001196823 | 248 |
| 546 | 3300005563 | Ga0068855_100133493 | Ga0068855_1001334933 | 248 |
| 547 | 3300005564 | Ga0070664_100054375 | Ga0070664_1000543752 | 248 |
| 548 | 3300005578 | Ga0068854_100022674 | Ga0068854_1000226742 | 248 |
| 549 | 3300005614 | Ga0068856_100045755 | Ga0068856_1000457552 | 248 |
| 550 | 3300005616 | Ga0068852_100008868 | Ga0068852_1000088685 | 248 |
| 551 | 3300005617 | Ga0068859_100029696 | Ga0068859_1000296965 | 248 |
| 552 | 3300005617 | Ga0068859_100107366 | Ga0068859_1001073663 | 248 |
| 553 | 3300005718 | Ga0068866_10109412 | Ga0068866_101094123 | 248 |
| 554 | 3300005719 | Ga0068861_100058819 | Ga0068861_1000588192 | 248 |
| 555 | 3300005719 | Ga0068861_100068073 | Ga0068861_1000680732 | 248 |
| 556 | 3300005840 | Ga0068870_10034485 | Ga0068870_100344853 | 248 |
| 557 | 3300005841 | Ga0068863_100027936 | Ga0068863_1000279365 | 248 |
| 558 | 3300005841 | Ga0068863_100169603 | Ga0068863_1001696033 | 248 |
| 559 | 3300005841 | Ga0068863_100278670 | Ga0068863_1002786701 | 248 |
| 560 | 3300005842 | Ga0068858_100008051 | Ga0068858_10000805111 | 248 |
| 561 | 3300005842 | Ga0068858_100400035 | Ga0068858_1004000352 | 248 |
| 562 | 3300005843 | Ga0068860_100011415 | Ga0068860_1000114154 | 248 |
| 563 | 3300005843 | Ga0068860_100017651 | Ga0068860_1000176514 | 248 |
| 564 | 3300005844 | Ga0068862_100039922 | Ga0068862_1000399222 | 248 |
| 565 | 3300005844 | Ga0068862_100048021 | Ga0068862_1000480211 | 248 |
| 566 | 3300006028 | Ga0070717_10009320 | Ga0070717_100093207 | 248 |
| 567 | 3300006028 | Ga0070717_10223765 | Ga0070717_102237651 | 248 |
| 568 | 3300006173 | Ga0070716_100017261 | Ga0070716_1000172613 | 248 |
| 569 | 3300006175 | Ga0070712_100028835 | Ga0070712_1000288353 | 248 |
| 570 | 3300006237 | Ga0097621_100083976 | Ga0097621_1000839763 | 248 |
| 571 | 3300006237 | Ga0097621_100666514 | Ga0097621_1006665141 | 248 |
| 572 | 3300006358 | Ga0068871_100017378 | Ga0068871_1000173787 | 248 |
| 573 | 3300006871 | Ga0075434_100138002 | Ga0075434_1001380023 | 248 |
| 574 | 3300006871 | Ga0075434_100273872 | Ga0075434_1002738722 | 248 |
| 575 | 3300006881 | Ga0068865_100046813 | Ga0068865_1000468132 | 248 |
| 576 | 3300006881 | Ga0068865_100085305 | Ga0068865_1000853052 | 248 |
| 577 | 3300006914 | Ga0075436_100006016 | Ga0075436_10000601611 | 248 |
| 578 | 3300006931 | Ga0097620_100029691 | Ga0097620_1000296915 | 248 |
| 579 | 3300006931 | Ga0097620_100107371 | Ga0097620_1001073713 | 248 |
| 580 | 3300007076 | Ga0075435_100108003 | Ga0075435_1001080033 | 248 |
| 581 | 3300007076 | Ga0075435_100159998 | Ga0075435_1001599983 | 248 |
| 582 | 3300009092 | Ga0105250_10059427 | Ga0105250_100594272 | 248 |
| 583 | 3300009098 | Ga0105245_10021687 | Ga0105245_100216877 | 248 |
| 584 | 3300009098 | Ga0105245_10134582 | Ga0105245_101345823 | 248 |
| 585 | 3300009098 | Ga0105245_10318767 | Ga0105245_103187672 | 248 |
| 586 | 3300009101 | Ga0105247_10170366 | Ga0105247_101703662 | 248 |
| 587 | 3300009148 | Ga0105243_10065709 | Ga0105243_100657092 | 248 |
| 588 | 3300009174 | Ga0105241_10021553 | Ga0105241_100215533 | 248 |
| 589 | 3300009177 | Ga0105248_10097481 | Ga0105248_100974813 | 248 |
| 590 | 3300009545 | Ga0105237_10090403 | Ga0105237_100904032 | 248 |
| 591 | 3300009545 | Ga0105237_10127258 | Ga0105237_101272583 | 248 |
| 592 | 3300009545 | Ga0105237_10129749 | Ga0105237_101297492 | 248 |
| 593 | 3300009551 | Ga0105238_10011948 | Ga0105238_100119485 | 248 |
| 594 | 3300009553 | Ga0105249_10010877 | Ga0105249_100108778 | 248 |
| 595 | 3300010375 | Ga0105239_10066265 | Ga0105239_100662654 | 248 |
| 596 | 3300011119 | Ga0105246_10130306 | Ga0105246_101303061 | 248 |
| 597 | 3300013102 | Ga0157371_10011620 | Ga0157371_100116202 | 248 |
| 598 | 3300013105 | Ga0157369_10014078 | Ga0157369_100140787 | 248 |
| 599 | 3300013105 | Ga0157369_10406164 | Ga0157369_104061641 | 248 |
| 600 | 3300013296 | Ga0157374_10003563 | Ga0157374_1000356313 | 248 |
| 601 | 3300013296 | Ga0157374_10069754 | Ga0157374_100697542 | 248 |
| 602 | 3300013296 | Ga0157374_10093357 | Ga0157374_100933573 | 248 |
| 603 | 3300013297 | Ga0157378_10014035 | Ga0157378_100140353 | 248 |
| 604 | 3300013297 | Ga0157378_10314628 | Ga0157378_103146282 | 248 |
| 605 | 3300013306 | Ga0163162_10013577 | Ga0163162_100135778 | 248 |
| 606 | 3300013306 | Ga0163162_10477484 | Ga0163162_104774841 | 248 |
| 607 | 3300013307 | Ga0157372_10070788 | Ga0157372_100707884 | 248 |
| 608 | 3300013308 | Ga0157375_10335189 | Ga0157375_103351891 | 248 |
| 609 | 3300014325 | Ga0163163_10082546 | Ga0163163_100825462 | 248 |
| 610 | 3300014968 | Ga0157379_10041098 | Ga0157379_100410984 | 248 |
| 611 | 3300014968 | Ga0157379_10329788 | Ga0157379_103297882 | 248 |
| 612 | 3300014969 | Ga0157376_10120856 | Ga0157376_101208563 | 248 |
| 613 | 3300014969 | Ga0157376_10150939 | Ga0157376_101509391 | 248 |
| 614 | 3300025321 | Ga0207656_10072464 | Ga0207656_100724642 | 248 |
| 615 | 3300025898 | Ga0207692_10049371 | Ga0207692_100493711 | 248 |
| 616 | 3300025899 | Ga0207642_10049092 | Ga0207642_100490922 | 248 |
| 617 | 3300025899 | Ga0207642_10167243 | Ga0207642_101672431 | 248 |
| 618 | 3300025903 | Ga0207680_10067798 | Ga0207680_100677982 | 248 |
| 619 | 3300025904 | Ga0207647_10005883 | Ga0207647_100058834 | 248 |
| 620 | 3300025906 | Ga0207699_10358348 | Ga0207699_103583482 | 248 |
| 621 | 3300025907 | Ga0207645_10004243 | Ga0207645_100042434 | 248 |
| 622 | 3300025910 | Ga0207684_10016288 | Ga0207684_100162886 | 248 |
| 623 | 3300025910 | Ga0207684_10077797 | Ga0207684_100777973 | 248 |
| 624 | 3300025913 | Ga0207695_10016407 | Ga0207695_100164077 | 248 |
| 625 | 3300025913 | Ga0207695_10440108 | Ga0207695_104401082 | 248 |
| 626 | 3300025914 | Ga0207671_10009068 | Ga0207671_100090686 | 248 |
| 627 | 3300025914 | Ga0207671_10131643 | Ga0207671_101316431 | 248 |
| 628 | 3300025915 | Ga0207693_10010388 | Ga0207693_100103884 | 248 |
| 629 | 3300025916 | Ga0207663_10217699 | Ga0207663_102176991 | 248 |
| 630 | 3300025918 | Ga0207662_10314459 | Ga0207662_103144591 | 248 |
| 631 | 3300025919 | Ga0207657_10009009 | Ga0207657_100090098 | 248 |
| 632 | 3300025920 | Ga0207649_10127147 | Ga0207649_101271472 | 248 |
| 633 | 3300025923 | Ga0207681_10184901 | Ga0207681_101849012 | 248 |
| 634 | 3300025925 | Ga0207650_10257958 | Ga0207650_102579582 | 248 |
| 635 | 3300025927 | Ga0207687_10114864 | Ga0207687_101148642 | 248 |
| 636 | 3300025928 | Ga0207700_10026354 | Ga0207700_100263544 | 248 |
| 637 | 3300025928 | Ga0207700_10217446 | Ga0207700_102174462 | 248 |
| 638 | 3300025933 | Ga0207706_10003060 | Ga0207706_100030601 | 248 |
| 639 | 3300025934 | Ga0207686_10147256 | Ga0207686_101472562 | 248 |
| 640 | 3300025935 | Ga0207709_10050443 | Ga0207709_100504431 | 248 |
| 641 | 3300025936 | Ga0207670_10186756 | Ga0207670_101867562 | 248 |
| 642 | 3300025939 | Ga0207665_10004259 | Ga0207665_100042597 | 248 |
| 643 | 3300025939 | Ga0207665_10060541 | Ga0207665_100605413 | 248 |
| 644 | 3300025939 | Ga0207665_10272350 | Ga0207665_102723502 | 248 |
| 645 | 3300025941 | Ga0207711_10118544 | Ga0207711_101185441 | 248 |
| 646 | 3300025942 | Ga0207689_10009031 | Ga0207689_100090312 | 248 |
| 647 | 3300025942 | Ga0207689_10018148 | Ga0207689_100181483 | 248 |
| 648 | 3300025944 | Ga0207661_10125130 | Ga0207661_101251303 | 248 |
| 649 | 3300025949 | Ga0207667_10047229 | Ga0207667_100472295 | 248 |
| 650 | 3300025961 | Ga0207712_10011555 | Ga0207712_100115557 | 248 |
| 651 | 3300025972 | Ga0207668_10017040 | Ga0207668_100170402 | 248 |
| 652 | 3300025981 | Ga0207640_10156562 | Ga0207640_101565622 | 248 |
| 653 | 3300025981 | Ga0207640_10302945 | Ga0207640_103029452 | 248 |
| 654 | 3300026035 | Ga0207703_10003528 | Ga0207703_1000352811 | 248 |
| 655 | 3300026035 | Ga0207703_10039474 | Ga0207703_100394743 | 248 |
| 656 | 3300026041 | Ga0207639_10131743 | Ga0207639_101317432 | 248 |
| 657 | 3300026067 | Ga0207678_10001488 | Ga0207678_100014888 | 248 |
| 658 | 3300026088 | Ga0207641_10070055 | Ga0207641_100700552 | 248 |
| 659 | 3300026088 | Ga0207641_10102549 | Ga0207641_101025492 | 248 |
| 660 | 3300026089 | Ga0207648_10006630 | Ga0207648_100066309 | 248 |
| 661 | 3300026089 | Ga0207648_10030195 | Ga0207648_100301954 | 248 |
| 662 | 3300026116 | Ga0207674_10022219 | Ga0207674_100222193 | 248 |
| 663 | 3300026118 | Ga0207675_100099837 | Ga0207675_1000998373 | 248 |
| 664 | 3300028017 | Ga0265356_1012459 | Ga0265356_10124591 | 248 |
| 665 | 3300028379 | Ga0268266_10016584 | Ga0268266_100165843 | 248 |
| 666 | 3300028379 | Ga0268266_10433877 | Ga0268266_104338771 | 248 |
| 667 | 3300028380 | Ga0268265_10082287 | Ga0268265_100822871 | 248 |
| 668 | 3300028381 | Ga0268264_10044109 | Ga0268264_100441094 | 248 |
| 669 | 3300031018 | Ga0265773_1005274 | Ga0265773_10052741 | 248 |
| 670 | 3300031090 | Ga0265760_10003748 | Ga0265760_100037485 | 248 |
| 671 | 3300031344 | Ga0265316_10006906 | Ga0265316_100069064 | 248 |
| 672 | 3300031711 | Ga0265314_10004769 | Ga0265314_100047697 | 248 |
| 673 | 3300035089 | Ga0373944_0015522 | Ga0373944_0015522_718_1521 | 248 |
| 674 | 3300035113 | Ga0373936_0029250 | Ga0373936_0029250_181_993 | 248 |
| 675 | 3300035691 | Ga0373931_0025139 | Ga0373931_0025139_1499_2302 | 248 |
| 676 | 3300035692 | Ga0373935_0157587 | Ga0373935_0157587_109_918 | 248 |
| 677 | 3300035695 | Ga0373927_0012227 | Ga0373927_0012227_2216_3028 | 248 |
| 678 | 3300037068 | Ga0373925_0004417 | Ga0373925_0004417_3404_4216 | 248 |
| 679 | 3300037068 | Ga0373925_0017930 | Ga0373925_0017930_2947_3756 | 248 |
| 680 | 3300045051 | Ga0451576_0221217 | Ga0451576_0221217_488_1291 | 248 |
| 681 | 3300046472 | Ga0495580_0002108 | Ga0495580_0002108_13295_14107 | 248 |
| 682 | 3300046472 | Ga0495580_0002538 | Ga0495580_0002538_4030_4833 | 248 |
| 683 | 3300046472 | Ga0495580_0009075 | Ga0495580_0009075_1224_2033 | 248 |
| 684 | 3300046473 | Ga0495582_0000074 | Ga0495582_0000074_13535_14347 | 248 |
| 685 | 3300046531 | Ga0495665_0000640 | Ga0495665_0000640_5565_6377 | 248 |
| 686 | 3300047315 | Ga0495581_0026361 | Ga0495581_0026361_1922_2734 | 248 |
| 687 | 3300048903 | Ga0496100_0106014 | Ga0496100_0106014_143_946 | 248 |
| 688 | 3300048905 | Ga0496102_0327715 | Ga0496102_0327715_49_852 | 248 |
| 689 | 3300048908 | Ga0496105_0575347 | Ga0496105_0575347_10_813 | 248 |
| 690 | 3300048909 | Ga0496106_0110030 | Ga0496106_0110030_338_1141 | 248 |
| 691 | 3300048910 | Ga0496107_0070997 | Ga0496107_0070997_739_1542 | 248 |
| 692 | 3300048912 | Ga0496109_0075326 | Ga0496109_0075326_333_1136 | 248 |
| 693 | 3300048915 | Ga0496112_0046418 | Ga0496112_0046418_511_1314 | 248 |
| 694 | 3300048915 | Ga0496112_0073440 | Ga0496112_0073440_2300_3103 | 248 |
| 695 | 3300048915 | Ga0496112_0645398 | Ga0496112_0645398_146_949 | 248 |
| 696 | 3300050512 | nmdc:mga0n895_46359_c2 | nmdc:mga0n895_46359_c2_1179_1982 | 248 |
| 697 | 3300050514 | nmdc:mga08x19_6332_c1 | nmdc:mga08x19_6332_c1_1232_2044 | 248 |
| 698 | 2162886011 | MRS1b_contig_9212784 | MRS1b_0256.00001640 | 249 |
| 699 | 3300005290 | Ga0065712_10117566 | Ga0065712_101175662 | 249 |
| 700 | 3300005328 | Ga0070676_10170230 | Ga0070676_101702302 | 249 |
| 701 | 3300005329 | Ga0070683_100200734 | Ga0070683_1002007342 | 249 |
| 702 | 3300005331 | Ga0070670_100186273 | Ga0070670_1001862732 | 249 |
| 703 | 3300005339 | Ga0070660_100032389 | Ga0070660_1000323892 | 249 |
| 704 | 3300005344 | Ga0070661_100034867 | Ga0070661_1000348672 | 249 |
| 705 | 3300005457 | Ga0070662_100068638 | Ga0070662_1000686381 | 249 |
| 706 | 3300005458 | Ga0070681_10206078 | Ga0070681_102060781 | 249 |
| 707 | 3300005547 | Ga0070693_100113701 | Ga0070693_1001137013 | 249 |
| 708 | 3300005563 | Ga0068855_100033223 | Ga0068855_1000332236 | 249 |
| 709 | 3300005564 | Ga0070664_100020262 | Ga0070664_1000202624 | 249 |
| 710 | 3300005614 | Ga0068856_100013950 | Ga0068856_1000139506 | 249 |
| 711 | 3300005616 | Ga0068852_100237967 | Ga0068852_1002379672 | 249 |
| 712 | 3300009177 | Ga0105248_10057988 | Ga0105248_100579885 | 249 |
| 713 | 3300009545 | Ga0105237_10037740 | Ga0105237_100377406 | 249 |
| 714 | 3300010375 | Ga0105239_10133705 | Ga0105239_101337053 | 249 |
| 715 | 3300013105 | Ga0157369_10124427 | Ga0157369_101244272 | 249 |
| 716 | 3300013297 | Ga0157378_10017752 | Ga0157378_100177524 | 249 |
| 717 | 3300013306 | Ga0163162_10117086 | Ga0163162_101170863 | 249 |
| 718 | 3300014325 | Ga0163163_10466176 | Ga0163163_104661762 | 249 |
| 719 | 3300025321 | Ga0207656_10084586 | Ga0207656_100845862 | 249 |
| 720 | 3300025913 | Ga0207695_10577129 | Ga0207695_105771291 | 249 |
| 721 | 3300025919 | Ga0207657_10002740 | Ga0207657_1000274012 | 249 |
| 722 | 3300025920 | Ga0207649_10035538 | Ga0207649_100355383 | 249 |
| 723 | 3300025924 | Ga0207694_10020189 | Ga0207694_100201895 | 249 |
| 724 | 3300025931 | Ga0207644_10328554 | Ga0207644_103285541 | 249 |
| 725 | 3300025933 | Ga0207706_10037894 | Ga0207706_100378944 | 249 |
| 726 | 3300025941 | Ga0207711_10035712 | Ga0207711_100357122 | 249 |
| 727 | 3300025945 | Ga0207679_10251611 | Ga0207679_102516112 | 249 |
| 728 | 3300025949 | Ga0207667_10095084 | Ga0207667_100950843 | 249 |
| 729 | 3300026041 | Ga0207639_10089777 | Ga0207639_100897772 | 249 |
| 730 | 3300026078 | Ga0207702_10076023 | Ga0207702_100760233 | 249 |
| 731 | 3300026088 | Ga0207641_10626665 | Ga0207641_106266652 | 249 |
| 732 | 3300048907 | Ga0496104_0599097 | Ga0496104_0599097_122_928 | 249 |
| 733 | 3300048909 | Ga0496106_0077026 | Ga0496106_0077026_1098_1904 | 249 |
| 734 | 3300048911 | Ga0496108_0101207 | Ga0496108_0101207_1255_2061 | 249 |
| 735 | 3300048912 | Ga0496109_0148872 | Ga0496109_0148872_741_1547 | 249 |
| 736 | 3300048913 | Ga0496110_0053666 | Ga0496110_0053666_600_1406 | 249 |
| 737 | 3300048914 | Ga0496111_0017498 | Ga0496111_0017498_824_1630 | 249 |
| 738 | 3300048915 | Ga0496112_0422625 | Ga0496112_0422625_294_1100 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar