F478442

General Info

Members Datasets Scaffolds Average Seq Length
739 433 1478 141

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_101912113|Ga0070689_1019121131
Length 135
Sequence MITTRYLPFVGRLMIGLPFAMSGLGKLGTYGATTAMIGAAGLPLPPLAYAELGGGLLLVAGYRVRLVAVALAVFTLAAAISFHGNFADQNQMIHFLKNVMMAGGLLQIAAFGAGALSLDHRRSNGQLTPSPTVAA

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
111 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
112 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
113 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
114 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
115 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
197 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
211 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
231 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
232 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
349 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
354 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
355 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
356 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
357 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
358 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
363 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
364 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
368 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
369 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
372 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
373 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
374 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
378 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
379 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
380 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
381 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
382 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
383 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
384 2643221557 Ensifer sp. Root558 Isolate Unclassified
385 2643221668 Ensifer sp. Root423 Isolate Unclassified
386 2643221723 Ensifer sp. Root278 Isolate Unclassified
387 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
388 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
389 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
390 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
391 2922368715
392 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
393 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
394 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
395 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
396 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
397 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
398 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
399 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
400 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
401 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
402 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
403 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
404 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
405 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
406 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
407 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
408 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
409 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
410 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
411 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
412 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
413 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
414 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
415 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
416 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
417 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
418 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
419 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
420 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
421 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
422 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
423 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
424 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
425 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
426 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
427 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
428 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
429 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
430 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
431 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
432 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
433 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.14
Metatranscriptomes 0.14
Isolates 7.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 6.36
Rhizoplane 7.98
Rhizosphere 67.52
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_101912113 3300005340 Bacteria 542
2 JGI24736J21556_1029064 3300001904 Bacteria 855
3 JGI24739J22299_10159857 3300001989 Bacteria 665
4 JGI25162J39368_1001596 3300002737 Bacteria 11415
5 JGI25159J45721_1000015 3300002987 Bacteria 142431
6 JGI25165J46597_1000280 3300003214 Bacteria 65126
7 JGI25160J50197_1000003 3300003354 Bacteria 482719
8 JGI25161J50226_1002742 3300003374 Bacteria 4345
9 Ga0055526_1007083 3300003771 Bacteria 5923
10 Ga0055524_1041650 3300003775 Bacteria 1154
11 Ga0055536_1001123 3300003781 Bacteria 16800
12 Ga0055536_1041459 3300003781 Bacteria 1086
13 Ga0055530_10004321 3300003791 Bacteria 7390
14 Ga0055530_10023186 3300003791 Bacteria 1789
15 Ga0055540_1041907 3300003792 Bacteria 984
16 Ga0055531_10000697 3300003794 Bacteria 28671
17 Ga0055531_10044523 3300003794 Bacteria 1243
18 Ga0055543_1000034 3300004625 Bacteria 128668
19 Ga0065165_1000025 3300005262 Bacteria 246909
20 Ga0070690_100645102 3300005330 Bacteria 808
21 Ga0070670_100331594 3300005331 Bacteria 1334
22 Ga0070677_10476250 3300005333 Bacteria 672
23 Ga0070666_10031914 3300005335 Bacteria 3479
24 Ga0070666_10162265 3300005335 Bacteria 1562
25 Ga0070680_100541876 3300005336 Bacteria 997
26 Ga0070682_100033993 3300005337 Bacteria 3101
27 Ga0068868_100336151 3300005338 Bacteria 1290
28 Ga0068868_100420909 3300005338 Bacteria 1156
29 Ga0070689_100461258 3300005340 Bacteria 1082
30 Ga0070691_10333830 3300005341 Bacteria 837
31 Ga0070687_100100429 3300005343 Bacteria 1619
32 Ga0070661_100049498 3300005344 Bacteria 3076
33 Ga0070668_100036882 3300005347 Bacteria 3731
34 Ga0070669_100000438 3300005353 Bacteria 31742
35 Ga0070669_100691660 3300005353 Bacteria 860
36 Ga0070675_100415925 3300005354 Bacteria 1202
37 Ga0070675_101883211 3300005354 Bacteria 552
38 Ga0070671_100059070 3300005355 Bacteria 3191
39 Ga0070671_100144711 3300005355 Bacteria 2006
40 Ga0070674_100152366 3300005356 Bacteria 1746
41 Ga0070673_100023208 3300005364 Bacteria 4530
42 Ga0070673_101626359 3300005364 Bacteria 611
43 Ga0070688_100640354 3300005365 Bacteria 818
44 Ga0070667_100066963 3300005367 Bacteria 3052
45 Ga0070709_10006594 3300005434 Bacteria 6332
46 Ga0070709_10256865 3300005434 Bacteria 1261
47 Ga0070714_100024651 3300005435 Bacteria 4956
48 Ga0070714_100050162 3300005435 Bacteria 3554
49 Ga0070714_100120710 3300005435 Bacteria 2331
50 Ga0070714_100900473 3300005435 Bacteria 859
51 Ga0070713_100013850 3300005436 Bacteria 5968
52 Ga0070713_100022038 3300005436 Bacteria 4915
53 Ga0070713_100115085 3300005436 Bacteria 2350
54 Ga0070713_100216049 3300005436 Bacteria 1738
55 Ga0070713_100254892 3300005436 Bacteria 1602
56 Ga0070710_10006716 3300005437 Bacteria 5545
57 Ga0070710_10383336 3300005437 Bacteria 938
58 Ga0070710_10753845 3300005437 Bacteria 692
59 Ga0070711_100011825 3300005439 Bacteria 5431
60 Ga0070711_100074143 3300005439 Bacteria 2406
61 Ga0070711_100138930 3300005439 Bacteria 1819
62 Ga0070711_100544071 3300005439 Bacteria 962
63 Ga0070711_100630139 3300005439 Bacteria 897
64 Ga0070711_101216695 3300005439 Bacteria 652
65 Ga0070663_100058160 3300005455 Bacteria 2775
66 Ga0070663_100214577 3300005455 Bacteria 1508
67 Ga0070678_100041051 3300005456 Bacteria 3277
68 Ga0070681_10296286 3300005458 Bacteria 1527
69 Ga0070685_10033295 3300005466 Bacteria 2894
70 Ga0070706_100265211 3300005467 Bacteria 1603
71 Ga0070706_100564086 3300005467 Bacteria 1059
72 Ga0070706_100929972 3300005467 Bacteria 803
73 Ga0070706_101064456 3300005467 Bacteria 745
74 Ga0070707_100773233 3300005468 Bacteria 924
75 Ga0070698_100352319 3300005471 Bacteria 1404
76 Ga0070698_100588372 3300005471 Bacteria 1053
77 Ga0070698_100746413 3300005471 Bacteria 922
78 Ga0070699_100682520 3300005518 Bacteria 938
79 Ga0070699_101431738 3300005518 Bacteria 634
80 Ga0070679_100044161 3300005530 Bacteria 4440
81 Ga0070684_100250152 3300005535 Bacteria 1620
82 Ga0070684_100250578 3300005535 Bacteria 1618
83 Ga0070684_100280207 3300005535 Bacteria 1527
84 Ga0070697_101163105 3300005536 Bacteria 687
85 Ga0070697_101407977 3300005536 Bacteria 623
86 Ga0070697_102092728 3300005536 Bacteria 507
87 Ga0068853_100209856 3300005539 Bacteria 1775
88 Ga0070672_100249124 3300005543 Bacteria 1496
89 Ga0070686_100028574 3300005544 Bacteria 3383
90 Ga0070696_100694322 3300005546 Bacteria 829
91 Ga0070693_100394740 3300005547 Bacteria 958
92 Ga0070665_100128511 3300005548 Bacteria 2537
93 Ga0070665_100504232 3300005548 Bacteria 1221
94 Ga0070664_100252839 3300005564 Bacteria 1584
95 Ga0070664_100508563 3300005564 Bacteria 1111
96 Ga0068857_100202889 3300005577 Bacteria 1808
97 Ga0068857_100230824 3300005577 Bacteria 1693
98 Ga0068857_100562902 3300005577 Bacteria 1075
99 Ga0068856_100081658 3300005614 Bacteria 3207
100 Ga0068856_101457596 3300005614 Bacteria 699
101 Ga0068856_102235263 3300005614 Bacteria 556
102 Ga0070702_100164382 3300005615 Bacteria 1437
103 Ga0068852_100822318 3300005616 Bacteria 944
104 Ga0068859_100212221 3300005617 Bacteria 2022
105 Ga0068864_100072302 3300005618 Bacteria 3005
106 Ga0068861_101273324 3300005719 Bacteria 714
107 Ga0068851_10359222 3300005834 Bacteria 849
108 Ga0068863_100190180 3300005841 Bacteria 1972
109 Ga0068863_100234561 3300005841 Bacteria 1770
110 Ga0068863_100311724 3300005841 Bacteria 1527
111 Ga0068863_102418364 3300005841 Bacteria 535
112 Ga0068858_100167886 3300005842 Bacteria 2068
113 Ga0068858_100546155 3300005842 Bacteria 1122
114 Ga0068858_100825267 3300005842 Bacteria 905
115 Ga0068860_100340567 3300005843 Bacteria 1474
116 Ga0068862_100580020 3300005844 Bacteria 1074
117 Ga0081538_10036483 3300005981 Bacteria 3206
118 Ga0070717_10002063 3300006028 Bacteria 14061
119 Ga0070717_10007835 3300006028 Bacteria 7949
120 Ga0070717_10014255 3300006028 Bacteria 6113
121 Ga0070717_10063991 3300006028 Bacteria 3054
122 Ga0070717_10167061 3300006028 Bacteria 1912
123 Ga0070717_10260551 3300006028 Bacteria 1534
124 Ga0070717_10524093 3300006028 Bacteria 1072
125 Ga0070717_10605578 3300006028 Bacteria 994
126 Ga0075365_10024860 3300006038 Bacteria 3785
127 Ga0075363_100196048 3300006048 Bacteria 1153
128 Ga0075364_10090133 3300006051 Bacteria 2034
129 Ga0070715_10004890 3300006163 Bacteria 4439
130 Ga0070715_10034619 3300006163 Bacteria 2072
131 Ga0070716_100003451 3300006173 Bacteria 7443
132 Ga0070716_100007047 3300006173 Bacteria 5516
133 Ga0070716_100780373 3300006173 Bacteria 738
134 Ga0070712_100267905 3300006175 Bacteria 1371
135 Ga0070712_100321967 3300006175 Bacteria 1257
136 Ga0070712_100442663 3300006175 Bacteria 1081
137 Ga0070712_100594498 3300006175 Bacteria 936
138 Ga0070712_100749308 3300006175 Bacteria 836
139 Ga0075362_10143408 3300006177 Bacteria 1142
140 Ga0075367_10240951 3300006178 Bacteria 1133
141 Ga0075367_10316159 3300006178 Bacteria 984
142 Ga0075367_10712549 3300006178 Bacteria 638
143 Ga0075369_10131074 3300006186 Bacteria 1139
144 Ga0075369_10441910 3300006186 Bacteria 615
145 Ga0075366_10012033 3300006195 Bacteria 4901
146 Ga0097621_100024299 3300006237 Unclassified 4731
147 Ga0097621_100102101 3300006237 Bacteria 2414
148 Ga0075370_10083286 3300006353 Bacteria 1840
149 Ga0068871_100053351 3300006358 Bacteria 3276
150 Ga0068871_100066751 3300006358 Bacteria 2949
151 Ga0068871_100144834 3300006358 Bacteria 2022
152 Ga0075428_100194112 3300006844 Bacteria 2196
153 Ga0075430_100456992 3300006846 Bacteria 1054
154 Ga0075431_100700520 3300006847 Bacteria 990
155 Ga0075433_10090020 3300006852 Bacteria 2712
156 Ga0075433_10313534 3300006852 Bacteria 1388
157 Ga0068865_100065878 3300006881 Bacteria 2554
158 Ga0068865_100738678 3300006881 Bacteria 844
159 Ga0075436_100392603 3300006914 Bacteria 1004
160 Ga0097620_100212229 3300006931 Bacteria 2022
161 Ga0075435_100009745 3300007076 Bacteria 6983
162 Ga0075435_100391737 3300007076 Bacteria 1194
163 Ga0075435_100570558 3300007076 Bacteria 980
164 Ga0099795_10023932 3300007788 Bacteria 2031
165 Ga0099795_10048771 3300007788 Bacteria 1535
166 Ga0099795_10094602 3300007788 Bacteria 1163
167 Ga0105251_10029408 3300009011 Bacteria 2768
168 Ga0105250_10224504 3300009092 Bacteria 797
169 Ga0105240_11079200 3300009093 Unclassified 855
170 Ga0111539_10090477 3300009094 Bacteria 3596
171 Ga0111539_10843425 3300009094 Bacteria 1066
172 Ga0105245_10321862 3300009098 Bacteria 1524
173 Ga0105245_11141935 3300009098 Bacteria 826
174 Ga0105247_10165485 3300009101 Bacteria 1467
175 Ga0105247_10273143 3300009101 Bacteria 1163
176 Ga0105247_11261842 3300009101 Bacteria 591
177 Ga0114129_10079908 3300009147 Bacteria 4546
178 Ga0105243_10069112 3300009148 Bacteria 2848
179 Ga0105243_10798501 3300009148 Bacteria 930
180 Ga0105243_12295722 3300009148 Bacteria 577
181 Ga0105241_10132181 3300009174 Bacteria 2022
182 Ga0105242_10150596 3300009176 Bacteria 2028
183 Ga0105248_10048981 3300009177 Bacteria 4739
184 Ga0105248_10096567 3300009177 Bacteria 3329
185 Ga0105248_10290835 3300009177 Bacteria 1840
186 Ga0105248_10293218 3300009177 Bacteria 1832
187 Ga0105237_10065253 3300009545 Bacteria 3637
188 Ga0105237_10071604 3300009545 Bacteria 3461
189 Ga0105237_10497877 3300009545 Bacteria 1225
190 Ga0105238_10087189 3300009551 Bacteria 3108
191 Ga0105238_10571889 3300009551 Bacteria 1136
192 Ga0105238_10816175 3300009551 Bacteria 949
193 Ga0105238_10860645 3300009551 Bacteria 924
194 Ga0099796_10074170 3300010159 Bacteria 1235
195 Ga0099796_10194774 3300010159 Bacteria 820
196 Ga0099796_10227893 3300010159 Bacteria 766
197 Ga0105239_10435458 3300010375 Bacteria 1486
198 Ga0105239_10695543 3300010375 Bacteria 1162
199 Ga0105246_10142512 3300011119 Bacteria 1804
200 Ga0157346_1003875 3300012480 Bacteria 858
201 Ga0157321_1006128 3300012487 Bacteria 810
202 Ga0157341_1002933 3300012494 Bacteria 1162
203 Ga0157324_1031631 3300012506 Bacteria 603
204 Ga0157342_1006762 3300012507 Bacteria 1096
205 Ga0157327_1020250 3300012512 Bacteria 744
206 Ga0157369_10050653 3300013105 Bacteria 4496
207 Ga0157369_10414934 3300013105 Bacteria 1396
208 Ga0157374_10364707 3300013296 Bacteria 1437
209 Ga0157378_10078599 3300013297 Bacteria 2977
210 Ga0157378_11173336 3300013297 Bacteria 807
211 Ga0163162_10241776 3300013306 Bacteria 1936
212 Ga0163162_10476677 3300013306 Bacteria 1379
213 Ga0163162_10810763 3300013306 Bacteria 1053
214 Ga0157375_10505267 3300013308 Bacteria 1373
215 Ga0157375_11503301 3300013308 Bacteria 795
216 Ga0157375_12519970 3300013308 Bacteria 614
217 Ga0163163_10182975 3300014325 Bacteria 2143
218 Ga0163163_10646726 3300014325 Bacteria 1121
219 Ga0163163_10870736 3300014325 Bacteria 964
220 Ga0163163_11575952 3300014325 Bacteria 718
221 Ga0157377_10466010 3300014745 Bacteria 876
222 Ga0157377_11064020 3300014745 Bacteria 617
223 Ga0157379_10182921 3300014968 Bacteria 1893
224 Ga0157376_10103099 3300014969 Bacteria 2497
225 Ga0163161_10660159 3300017792 Bacteria 867
226 Ga0209436_100130 3300025208 Bacteria 37375
227 Ga0209437_100281 3300025233 Bacteria 74945
228 Ga0207425_1011713 3300025245 Bacteria 2079
229 Ga0209646_1004247 3300025246 Bacteria 2639
230 Ga0209233_1000267 3300025261 Bacteria 74945
231 Ga0209130_1000005 3300025284 Bacteria 599620
232 Ga0209676_1001348 3300025292 Bacteria 24430
233 Ga0209676_1001927 3300025292 Bacteria 16772
234 Ga0209025_1000105 3300025294 Bacteria 224157
235 Ga0209564_1000113 3300025295 Bacteria 211564
236 Ga0209758_1030383 3300025297 Bacteria 2239
237 Ga0209050_1000644 3300025298 Bacteria 54118
238 Ga0209050_1001277 3300025298 Bacteria 28847
239 Ga0209050_1005247 3300025298 Bacteria 8259
240 Ga0209256_1002435 3300025299 Bacteria 15208
241 Ga0209256_1044068 3300025299 Bacteria 1116
242 Ga0207426_1000015 3300025302 Bacteria 599316
243 Ga0209051_1001056 3300025303 Bacteria 25758
244 Ga0209051_1013495 3300025303 Bacteria 3886
245 Ga0209257_1001078 3300025304 Bacteria 35791
246 Ga0209257_1001948 3300025304 Bacteria 22281
247 Ga0209257_1016366 3300025304 Bacteria 3004
248 Ga0207656_10369960 3300025321 Bacteria 717
249 Ga0207713_1029276 3300025735 Bacteria 2469
250 Ga0207692_10007178 3300025898 Bacteria 4553
251 Ga0207692_10015010 3300025898 Bacteria 3399
252 Ga0207692_10308877 3300025898 Bacteria 965
253 Ga0207710_10025982 3300025900 Bacteria 2529
254 Ga0207710_10169683 3300025900 Bacteria 1066
255 Ga0207710_10601175 3300025900 Bacteria 575
256 Ga0207680_10133162 3300025903 Bacteria 1640
257 Ga0207647_10114051 3300025904 Bacteria 1597
258 Ga0207647_10535633 3300025904 Bacteria 651
259 Ga0207685_10034813 3300025905 Bacteria 1833
260 Ga0207699_10001770 3300025906 Bacteria 10191
261 Ga0207699_10004550 3300025906 Bacteria 6625
262 Ga0207645_10227402 3300025907 Bacteria 1231
263 Ga0207684_10775129 3300025910 Bacteria 812
264 Ga0207707_10226485 3300025912 Bacteria 1627
265 Ga0207671_10190002 3300025914 Bacteria 1601
266 Ga0207671_10351449 3300025914 Bacteria 1169
267 Ga0207693_10001772 3300025915 Bacteria 18926
268 Ga0207693_10110901 3300025915 Bacteria 2151
269 Ga0207693_10238157 3300025915 Bacteria 1429
270 Ga0207693_10432850 3300025915 Bacteria 1028
271 Ga0207663_10008912 3300025916 Bacteria 5276
272 Ga0207663_10052746 3300025916 Bacteria 2538
273 Ga0207663_10070638 3300025916 Bacteria 2250
274 Ga0207663_10407751 3300025916 Bacteria 1041
275 Ga0207663_10949536 3300025916 Bacteria 689
276 Ga0207657_10272274 3300025919 Bacteria 1346
277 Ga0207657_10330779 3300025919 Bacteria 1203
278 Ga0207649_11024230 3300025920 Bacteria 650
279 Ga0207652_10010590 3300025921 Bacteria 7422
280 Ga0207646_10631306 3300025922 Bacteria 960
281 Ga0207681_10000037 3300025923 Bacteria 154417
282 Ga0207694_10427688 3300025924 Bacteria 1104
283 Ga0207650_10083520 3300025925 Bacteria 2426
284 Ga0207650_10266822 3300025925 Bacteria 1390
285 Ga0207687_10012794 3300025927 Bacteria 5483
286 Ga0207687_10912353 3300025927 Bacteria 752
287 Ga0207700_10004844 3300025928 Bacteria 7991
288 Ga0207700_10010379 3300025928 Bacteria 5873
289 Ga0207700_10400548 3300025928 Bacteria 1203
290 Ga0207700_10539799 3300025928 Bacteria 1034
291 Ga0207700_10597867 3300025928 Bacteria 982
292 Ga0207700_10625256 3300025928 Bacteria 959
293 Ga0207664_10007907 3300025929 Bacteria 7387
294 Ga0207664_10763708 3300025929 Bacteria 869
295 Ga0207644_10041350 3300025931 Bacteria 3260
296 Ga0207644_10114805 3300025931 Bacteria 2041
297 Ga0207644_10143676 3300025931 Bacteria 1840
298 Ga0207690_10148701 3300025932 Bacteria 1734
299 Ga0207690_10361681 3300025932 Bacteria 1150
300 Ga0207706_10053868 3300025933 Bacteria 3551
301 Ga0207706_10551467 3300025933 Bacteria 992
302 Ga0207686_10034580 3300025934 Bacteria 3026
303 Ga0207709_10164742 3300025935 Bacteria 1550
304 Ga0207709_11356654 3300025935 Bacteria 588
305 Ga0207704_10195864 3300025938 Bacteria 1474
306 Ga0207665_10001072 3300025939 Bacteria 18388
307 Ga0207665_10004233 3300025939 Bacteria 9549
308 Ga0207665_10026869 3300025939 Bacteria 3801
309 Ga0207665_10037803 3300025939 Bacteria 3213
310 Ga0207665_10458333 3300025939 Bacteria 979
311 Ga0207665_10567784 3300025939 Bacteria 883
312 Ga0207691_10046346 3300025940 Bacteria 3995
313 Ga0207711_10025595 3300025941 Bacteria 4949
314 Ga0207711_10033852 3300025941 Bacteria 4325
315 Ga0207711_10434829 3300025941 Bacteria 1221
316 Ga0207661_10111892 3300025944 Bacteria 2310
317 Ga0207661_10178685 3300025944 Bacteria 1852
318 Ga0207679_10084323 3300025945 Bacteria 2438
319 Ga0207667_10230320 3300025949 Bacteria 1897
320 Ga0207651_10294295 3300025960 Bacteria 1347
321 Ga0207668_10140262 3300025972 Bacteria 1858
322 Ga0207668_10157418 3300025972 Bacteria 1766
323 Ga0207668_10688752 3300025972 Unclassified 897
324 Ga0207668_10979739 3300025972 Bacteria 755
325 Ga0207658_10129624 3300025986 Bacteria 2024
326 Ga0207677_10141054 3300026023 Bacteria 1845
327 Ga0207703_10101418 3300026035 Bacteria 2440
328 Ga0207703_10279671 3300026035 Bacteria 1515
329 Ga0207703_10482658 3300026035 Bacteria 1161
330 Ga0207639_10514690 3300026041 Bacteria 1095
331 Ga0207678_10090345 3300026067 Bacteria 2618
332 Ga0207678_10146846 3300026067 Bacteria 2013
333 Ga0207678_10189873 3300026067 Bacteria 1755
334 Ga0207708_10073466 3300026075 Bacteria 2621
335 Ga0207702_10299535 3300026078 Bacteria 1526
336 Ga0207702_10585597 3300026078 Bacteria 1094
337 Ga0207641_10177653 3300026088 Bacteria 1947
338 Ga0207641_10545956 3300026088 Bacteria 1130
339 Ga0207648_10174815 3300026089 Bacteria 1899
340 Ga0207676_10284533 3300026095 Bacteria 1502
341 Ga0207676_10321976 3300026095 Bacteria 1420
342 Ga0207674_10086582 3300026116 Bacteria 3128
343 Ga0207674_10288352 3300026116 Bacteria 1590
344 Ga0207675_101888401 3300026118 Bacteria 616
345 Ga0207683_10017427 3300026121 Bacteria 6122
346 Ga0207683_10266726 3300026121 Bacteria 1564
347 Ga0207698_10237013 3300026142 Bacteria 1660
348 Ga0209179_1054300 3300027512 Bacteria 863
349 Ga0209588_1016132 3300027671 Bacteria 2303
350 Ga0209588_1190935 3300027671 Bacteria 640
351 Ga0207428_10086181 3300027907 Bacteria 2445
352 Ga0207428_10424925 3300027907 Bacteria 971
353 Ga0207428_11316093 3300027907 Bacteria 500
354 Ga0265354_1004635 3300028016 Bacteria 1431
355 Ga0265355_1011388 3300028036 Bacteria 731
356 Ga0268266_10033064 3300028379 Bacteria 4397
357 Ga0268265_10030300 3300028380 Bacteria 3895
358 Ga0268264_10101786 3300028381 Bacteria 2498
359 Ga0307517_10285537 3300028786 Bacteria 937
360 Ga0307515_10058325 3300028794 Bacteria 5562
361 Ga0307515_10420527 3300028794 Bacteria 957
362 Ga0307511_10022068 3300030521 Bacteria 5975
363 Ga0307511_10063150 3300030521 Bacteria 2801
364 Ga0265770_1000015 3300030878 Bacteria 17088
365 Ga0307509_10139206 3300031507 Bacteria 2366
366 Ga0307508_10033908 3300031616 Bacteria 4604
367 Ga0307508_10305488 3300031616 Bacteria 1183
368 Ga0307516_10000276 3300031730 Bacteria 66471
369 Ga0307507_10069784 3300033179 Bacteria 3194
370 Ga0307510_10008458 3300033180 Bacteria 12263
371 Ga0307510_10134756 3300033180 Bacteria 2131
372 Ga0307510_10157839 3300033180 Bacteria 1872
373 Ga0307510_10177098 3300033180 Bacteria 1702
374 Ga0316215_1029823 3300033544 Bacteria 565
375 Ga0373930_0023479 3300034816 Bacteria 1226
376 Ga0373951_0075716 3300035091 Bacteria 864
377 Ga0373952_0019801 3300035092 Bacteria 1405
378 Ga0373939_0403998 3300035114 Bacteria 566
379 Ga0373941_0187392 3300035115 Bacteria 780
380 Ga0373945_0043635 3300035116 Bacteria 1628
381 Ga0373954_0181451 3300035118 Bacteria 1032
382 Ga0373960_0201203 3300035121 Bacteria 704
383 Ga0373943_0039152 3300035170 Bacteria 2283
384 Ga0373946_0026637 3300035171 Bacteria 2282
385 Ga0373946_0414032 3300035171 Bacteria 682
386 Ga0373955_0549519 3300035172 Bacteria 706
387 Ga0373961_0012586 3300035241 Bacteria 2121
388 Ga0373931_0129183 3300035691 Bacteria 1452
389 Ga0373927_0007027 3300035695 Bacteria 7641
390 Ga0373927_0387816 3300035695 Bacteria 921
391 Ga0373933_0471483 3300035724 Bacteria 822
392 Ga0373947_0001566 3300035725 Bacteria 14014
393 Ga0373947_0028793 3300035725 Bacteria 3258
394 Ga0373925_0013517 3300037068 Bacteria 5909
395 Ga0373925_0086217 3300037068 Bacteria 2395
396 Ga0395905_0139986 3300037471 Bacteria 2277
397 Ga0451807_2026923 3300041486 Bacteria 581
398 Ga0451835_0153052 3300041492 Bacteria 1030
399 Ga0451837_0595071 3300041494 Bacteria 948
400 Ga0451851_0227276 3300041507 Bacteria 3868
401 Ga0451853_1297410 3300041512 Bacteria 1105
402 Ga0466969_0167388 3300044656 Bacteria 1008
403 Ga0466966_0539586 3300044684 Bacteria 702
404 Ga0466970_0164137 3300044765 Bacteria 1229
405 Ga0466959_0003549 3300045049 Bacteria 10253
406 Ga0495603_0004010 3300046455 Bacteria 8765
407 Ga0495590_0018331 3300046457 Bacteria 2506
408 Ga0495629_0001306 3300046459 Bacteria 19602
409 Ga0495629_0007863 3300046459 Bacteria 7846
410 Ga0495638_0004919 3300046460 Bacteria 10042
411 Ga0495638_0006659 3300046460 Bacteria 8384
412 Ga0495641_0031370 3300046461 Bacteria 2540
413 Ga0495641_0263431 3300046461 Bacteria 776
414 Ga0495651_0691382 3300046462 Bacteria 636
415 Ga0495653_0015161 3300046463 Bacteria 6283
416 Ga0495653_0033105 3300046463 Bacteria 4097
417 Ga0495650_0005382 3300046471 Bacteria 8328
418 Ga0495580_0000405 3300046472 Bacteria 35466
419 Ga0495580_0005620 3300046472 Bacteria 10326
420 Ga0495582_0001069 3300046473 Bacteria 15376
421 Ga0495582_0002617 3300046473 Bacteria 10021
422 Ga0495582_0127007 3300046473 Bacteria 1439
423 Ga0495605_0013142 3300046474 Bacteria 4574
424 Ga0495605_0054123 3300046474 Bacteria 1945
425 Ga0495605_0074470 3300046474 Bacteria 1598
426 Ga0495662_0043219 3300046476 Bacteria 2175
427 Ga0495662_0125321 3300046476 Bacteria 1262
428 Ga0495664_0000547 3300046477 Bacteria 18910
429 Ga0495664_0171034 3300046477 Bacteria 1318
430 Ga0495584_0000002 3300046491 Bacteria 512179
431 Ga0495585_0463162 3300046492 Bacteria 605
432 Ga0495594_0005370 3300046499 Bacteria 6585
433 Ga0495594_0127978 3300046499 Bacteria 1437
434 Ga0495596_0057473 3300046500 Bacteria 1518
435 Ga0495583_0002869 3300046506 Bacteria 14011
436 Ga0495583_0262027 3300046506 Bacteria 691
437 Ga0495606_0038857 3300046507 Bacteria 3215
438 Ga0495606_0044716 3300046507 Bacteria 2942
439 Ga0495606_0050123 3300046507 Bacteria 2733
440 Ga0495606_0344983 3300046507 Bacteria 792
441 Ga0495606_0533824 3300046507 Bacteria 586
442 Ga0495610_0091732 3300046512 Bacteria 1376
443 Ga0495610_0257871 3300046512 Bacteria 688
444 Ga0495610_0274314 3300046512 Bacteria 659
445 Ga0495618_0010352 3300046514 Bacteria 5643
446 Ga0495618_0501904 3300046514 Bacteria 731
447 Ga0495620_0035667 3300046515 Bacteria 2233
448 Ga0495628_0009095 3300046516 Bacteria 8497
449 Ga0495628_0052696 3300046516 Bacteria 3213
450 Ga0495630_0012823 3300046517 Bacteria 6091
451 Ga0495630_0051802 3300046517 Bacteria 3072
452 Ga0495630_0405450 3300046517 Bacteria 1045
453 Ga0495632_0038567 3300046519 Bacteria 2418
454 Ga0495648_0002183 3300046524 Bacteria 18357
455 Ga0495648_0026751 3300046524 Bacteria 3877
456 Ga0495648_0048786 3300046524 Bacteria 2603
457 Ga0495648_0049569 3300046524 Bacteria 2573
458 Ga0495648_0072410 3300046524 Bacteria 1994
459 Ga0495648_0075425 3300046524 Bacteria 1940
460 Ga0495648_0116631 3300046524 Bacteria 1442
461 Ga0495648_0155447 3300046524 Bacteria 1188
462 Ga0495648_0383124 3300046524 Bacteria 633
463 Ga0495666_0001085 3300046526 Bacteria 12965
464 Ga0495652_0017711 3300046529 Bacteria 6357
465 Ga0495654_0152506 3300046530 Bacteria 1021
466 Ga0495665_0009393 3300046531 Bacteria 5294
467 Ga0495665_0083475 3300046531 Bacteria 1680
468 Ga0495640_0007678 3300046533 Bacteria 8481
469 Ga0495640_0595823 3300046533 Bacteria 668
470 Ga0495586_0009947 3300046535 Bacteria 5065
471 Ga0495587_0003216 3300046536 Bacteria 10921
472 Ga0495609_0060084 3300046538 Bacteria 1681
473 Ga0495609_0204290 3300046538 Bacteria 825
474 Ga0495597_0059674 3300046542 Bacteria 1665
475 Ga0495645_0004363 3300046543 Bacteria 9663
476 Ga0495622_0102961 3300046557 Bacteria 1308
477 Ga0495622_0110318 3300046557 Bacteria 1260
478 Ga0495622_0122110 3300046557 Bacteria 1189
479 Ga0495668_0087653 3300046616 Bacteria 1707
480 Ga0495668_0150115 3300046616 Bacteria 1276
481 Ga0495634_0000661 3300046642 Bacteria 33530
482 Ga0495634_0183924 3300046642 Bacteria 1307
483 Ga0495634_0280449 3300046642 Bacteria 1012
484 Ga0495611_0019704 3300046648 Bacteria 2899
485 Ga0495611_0059673 3300046648 Bacteria 1732
486 Ga0495625_0209923 3300046660 Bacteria 1280
487 Ga0495625_0223929 3300046660 Bacteria 1231
488 Ga0495625_0263961 3300046660 Bacteria 1113
489 Ga0495625_0515761 3300046660 Bacteria 729
490 Ga0495635_0006091 3300046663 Bacteria 8410
491 Ga0495661_0004172 3300046665 Bacteria 10507
492 Ga0495588_0138758 3300046674 Bacteria 1284
493 Ga0495599_0018634 3300046678 Bacteria 4324
494 Ga0495623_0098957 3300046679 Bacteria 1779
495 Ga0495646_0003715 3300046680 Bacteria 9533
496 Ga0495646_0005124 3300046680 Bacteria 8266
497 Ga0495647_0026122 3300046681 Bacteria 2137
498 Ga0495658_0000967 3300046683 Bacteria 15275
499 Ga0495613_0002330 3300046689 Bacteria 14375
500 Ga0495613_0101505 3300046689 Bacteria 2078
501 Ga0495624_0006209 3300046690 Bacteria 8493
502 Ga0495624_0022858 3300046690 Bacteria 4127
503 Ga0495624_0079432 3300046690 Bacteria 2034
504 Ga0495624_0691588 3300046690 Bacteria 606
505 Ga0495671_0126295 3300046692 Bacteria 1247
506 Ga0495671_0197755 3300046692 Bacteria 975
507 Ga0495649_0507251 3300046694 Bacteria 599
508 Ga0495649_0557779 3300046694 Bacteria 567
509 Ga0495600_0176771 3300046809 Bacteria 1376
510 Ga0495581_0002154 3300047315 Bacteria 11113
511 Ga0495604_0002039 3300047317 Bacteria 16326
512 Ga0495674_0005169 3300047319 Bacteria 12533
513 Ga0495674_0043489 3300047319 Bacteria 3997
514 Ga0495674_0354487 3300047319 Bacteria 1190
515 Ga0495676_0010864 3300047321 Bacteria 8236
516 Ga0495676_0022259 3300047321 Bacteria 5518
517 Ga0495680_0002175 3300047322 Bacteria 20282
518 Ga0495683_0090983 3300047323 Bacteria 1478
519 Ga0495683_0109450 3300047323 Bacteria 1320
520 Ga0495683_0343601 3300047323 Bacteria 631
521 Ga0495687_161356 3300047443 Bacteria 753
522 Ga0495679_000009 3300047446 Bacteria 343637
523 Ga0495679_000748 3300047446 Bacteria 20826
524 Ga0495673_0055630 3300047469 Bacteria 1715
525 Ga0495673_0085907 3300047469 Bacteria 1294
526 Ga0495673_0097803 3300047469 Bacteria 1191
527 Ga0495673_0104426 3300047469 Bacteria 1141
528 Ga0495673_0217300 3300047469 Bacteria 709
529 Ga0495673_0244169 3300047469 Bacteria 657
530 Ga0495673_0335510 3300047469 Bacteria 536
531 Ga0495684_0081956 3300047471 Bacteria 2448
532 Ga0495686_0313072 3300047472 Bacteria 863
533 Ga0495593_0001822 3300047673 Bacteria 12674
534 Ga0495593_0004348 3300047673 Bacteria 8431
535 Ga0495593_0415253 3300047673 Bacteria 673
536 Ga0495602_0006795 3300048088 Bacteria 12010
537 Ga0495602_0621950 3300048088 Bacteria 740
538 Ga0495614_0002666 3300048089 Bacteria 7938
539 Ga0495614_0060933 3300048089 Bacteria 1621
540 Ga0495626_0040568 3300048091 Bacteria 2198
541 Ga0496100_0038877 3300048903 Bacteria 3017
542 Ga0496100_0236171 3300048903 Bacteria 1347
543 Ga0496101_0004589 3300048904 Bacteria 8726
544 Ga0496101_0023487 3300048904 Bacteria 4261
545 Ga0496101_0164972 3300048904 Bacteria 1700
546 Ga0496101_1286975 3300048904 Bacteria 572
547 Ga0496102_0011208 3300048905 Bacteria 7722
548 Ga0496102_0093381 3300048905 Bacteria 2787
549 Ga0496102_0126223 3300048905 Bacteria 2392
550 Ga0496102_0290004 3300048905 Bacteria 1542
551 Ga0496103_0015983 3300048906 Bacteria 4476
552 Ga0496103_0188362 3300048906 Bacteria 1326
553 Ga0496104_0049184 3300048907 Bacteria 3976
554 Ga0496104_0181876 3300048907 Bacteria 2012
555 Ga0496104_0217293 3300048907 Bacteria 1823
556 Ga0496104_0291448 3300048907 Bacteria 1544
557 Ga0496105_0010764 3300048908 Bacteria 7201
558 Ga0496105_0043497 3300048908 Bacteria 3704
559 Ga0496105_0075306 3300048908 Bacteria 2787
560 Ga0496105_0151854 3300048908 Bacteria 1903
561 Ga0496105_0484640 3300048908 Bacteria 972
562 Ga0496105_0603594 3300048908 Bacteria 851
563 Ga0496105_1293804 3300048908 Bacteria 533
564 Ga0496106_0033052 3300048909 Bacteria 3858
565 Ga0496106_0124532 3300048909 Bacteria 2017
566 Ga0496106_0271628 3300048909 Bacteria 1357
567 Ga0496107_0056643 3300048910 Bacteria 2832
568 Ga0496107_0070722 3300048910 Bacteria 2534
569 Ga0496107_0576935 3300048910 Bacteria 832
570 Ga0496108_0012633 3300048911 Bacteria 6880
571 Ga0496108_0238582 3300048911 Bacteria 1581
572 Ga0496108_0326690 3300048911 Bacteria 1337
573 Ga0496109_0036006 3300048912 Bacteria 4467
574 Ga0496109_0206453 3300048912 Bacteria 1847
575 Ga0496109_0315724 3300048912 Bacteria 1474
576 Ga0496109_0379127 3300048912 Bacteria 1336
577 Ga0496110_0022139 3300048913 Bacteria 5392
578 Ga0496110_0042236 3300048913 Bacteria 3980
579 Ga0496110_0072136 3300048913 Bacteria 3063
580 Ga0496110_0888016 3300048913 Bacteria 797
581 Ga0496111_0007468 3300048914 Bacteria 7169
582 Ga0496111_0183651 3300048914 Bacteria 1555
583 Ga0496112_0032895 3300048915 Bacteria 5036
584 Ga0496112_0075775 3300048915 Bacteria 3326
585 Ga0496112_0212718 3300048915 Bacteria 1890
586 Ga0496112_0525721 3300048915 Bacteria 1117
587 Ga0496113_0110546 3300048916 Bacteria 2139
588 Ga0496113_0114845 3300048916 Bacteria 2100
589 Ga0496113_0205460 3300048916 Bacteria 1566
590 Ga0496113_0430942 3300048916 Bacteria 1059
591 Ga0496114_0009386 3300048917 Bacteria 7768
592 Ga0496114_0075322 3300048917 Bacteria 2842
593 Ga0496114_0628331 3300048917 Bacteria 946
594 Ga0496115_0083872 3300048918 Bacteria 2597
595 Ga0496115_0233276 3300048918 Bacteria 1517
596 Ga0496115_0762794 3300048918 Bacteria 755
597 Ga0496115_1014940 3300048918 Bacteria 633
598 Ga0496116_0047230 3300048919 Bacteria 2899
599 Ga0496116_0275111 3300048919 Bacteria 819
600 Ga0496117_0099668 3300048920 Bacteria 1842
601 Ga0496117_0228904 3300048920 Bacteria 1029
602 Ga0496118_0024558 3300048921 Bacteria 5197
603 Ga0496118_0060180 3300048921 Bacteria 2822
604 Ga0496119_0122871 3300048922 Bacteria 1425
605 Ga0496120_0214489 3300048923 Bacteria 924
606 Ga0496121_0046077 3300048924 Bacteria 3736
607 Ga0496122_0318247 3300048925 Bacteria 829
608 Ga0496124_0384566 3300048927 Bacteria 980
609 Ga0496125_0164900 3300048928 Bacteria 1499
610 Ga0496125_0179400 3300048928 Bacteria 1413
611 Ga0496126_0096161 3300048929 Bacteria 2597
612 Ga0496126_0101996 3300048929 Bacteria 2509
613 Ga0496126_0250191 3300048929 Bacteria 1477
614 Ga0495682_0014807 3300049460 Bacteria 2956
615 Ga0495682_0049600 3300049460 Bacteria 1529
616 Ga0495682_0083048 3300049460 Bacteria 1152
617 Ga0495682_0122959 3300049460 Bacteria 929
618 Ga0495682_0123722 3300049460 Bacteria 926
619 Ga0495682_0207770 3300049460 Bacteria 694
620 nmdc:mga03n38_511818_c1 3300050490 Bacteria 675
621 nmdc:mga0yw44_1061758_c1 3300050492 Bacteria 548
622 nmdc:mga0yw44_57930_c1 3300050492 Bacteria 2365
623 nmdc:mga0yw44_99120_c1 3300050492 Bacteria 1854
624 nmdc:mga0k408_125429_c1 3300050493 Bacteria 1523
625 nmdc:mga06z11_119875_c1 3300050494 Bacteria 1467
626 nmdc:mga05p37_60503_c1 3300050507 Bacteria 4663
627 nmdc:mga09592_241064_c1 3300050508 Bacteria 1567
628 nmdc:mga0qj67_105304_c1 3300050509 Unclassified 2276
629 nmdc:mga06r32_119839_c1 3300050510 Bacteria 2595
630 nmdc:mga06r32_54616_c1 3300050510 Bacteria 3831
631 nmdc:mga08y16_108791_c1 3300050511 Bacteria 2886
632 nmdc:mga08y16_391967_c1 3300050511 Bacteria 1423
633 nmdc:mga08y16_83147_c1 3300050511 Bacteria 3337
634 nmdc:mga0n895_137295_c1 3300050512 Bacteria 2472
635 nmdc:mga0n895_253520_c1 3300050512 Bacteria 1786
636 nmdc:mga0n895_351632_c1 3300050512 Bacteria 1493
637 nmdc:mga0n895_371392_c1 3300050512 Bacteria 1448
638 nmdc:mga0n895_851638_c1 3300050512 Unclassified 899
639 nmdc:mga0rr50_886470_c1 3300050513 Bacteria 761
640 nmdc:mga08x19_603155_c1 3300050514 Bacteria 778
641 nmdc:mga0a205_253321_c1 3300050515 Bacteria 1639
642 nmdc:mga0a205_573520_c1 3300050515 Bacteria 983
643 nmdc:mga0sz30_194346_c1 3300050516 Bacteria 901
644 nmdc:mga0sz30_92231_c1 3300050516 Bacteria 1319
645 Ga0500635_0008832 3300053080 Bacteria 2776
646 Ga0495655_0091952 3300053083 Bacteria 885
647 Ga0495655_0372034 3300053083 Bacteria 503
648 Ga0495619_0000197 3300053085 Bacteria 44259
649 Ga0500578_0111265 3300053086 Bacteria 1726
650 Ga0500643_050489 3300053087 Bacteria 1190
651 Ga0500647_0162140 3300053091 Bacteria 1037
652 Ga0500583_0021076 3300053092 Bacteria 2704
653 Ga0500651_0038651 3300053093 Bacteria 3006
654 Ga0500651_0094984 3300053093 Bacteria 1833
655 Ga0500641_0078346 3300053096 Bacteria 1400
656 Ga0500555_003590 3300053103 Bacteria 4420
657 Ga0500556_0003155 3300053104 Bacteria 4910
658 Ga0500556_0301841 3300053104 Bacteria 626
659 Ga0500562_006055 3300053108 Bacteria 3045
660 Ga0500569_000906 3300053109 Bacteria 5312
661 Ga0500595_007843 3300053119 Bacteria 4398
662 Ga0500614_049860 3300053123 Bacteria 1095
663 Ga0500642_0090055 3300053130 Bacteria 1417
664 Ga0500655_048735 3300053133 Bacteria 841
665 Ga0500658_0153128 3300053134 Bacteria 1040
666 Ga0500568_0019594 3300053139 Bacteria 2937
667 Ga0500568_0079662 3300053139 Bacteria 1245
668 Ga0500577_0066161 3300053142 Bacteria 1405
669 Ga0500588_0030651 3300053146 Bacteria 1545
670 Ga0500604_0029865 3300053151 Bacteria 1591
671 Ga0500622_0361311 3300053156 Bacteria 599
672 Ga0500627_0321952 3300053158 Bacteria 671
673 Ga0500633_0020658 3300053160 Bacteria 1990
674 Ga0500638_115711 3300053162 Bacteria 1233
675 Ga0500639_145842 3300053163 Bacteria 1099
676 Ga0500636_0117585 3300053177 Bacteria 1494
677 Ga0500636_0164511 3300053177 Bacteria 1206
678 Ga0500645_039681 3300053730 Bacteria 1394
679 Ga0500645_051857 3300053730 Bacteria 1196
680 Ga0500599_000400 3300053736 Bacteria 4398
681 Ga0500661_006184 3300055283 Bacteria 2232
682 2501078034 2501025502 Bacteria 9641094
683 2511092005 2510917013 Bacteria 9951648
684 2524538495 2524023228 Bacteria 10118060
685 2600197568 2599185352 Bacteria 7228948
686 2617384125 2617270742 Bacteria 6808054
687 2643807702 2643221557 Bacteria 7184309
688 2644379190 2643221668 Bacteria 7306521
689 2644671557 2643221723 Bacteria 7095460
690 2746086288 2744054900 Bacteria 8399525
691 2746096959 2744054901 Bacteria 8397047
692 2824668780 2824661429 Bacteria 9877870
693 2879100676 2879099564 Bacteria 10442239
694 2922373279
695 2929615692 2929615660 Bacteria 9193770
696 2929630307 2929624759 Bacteria 9339455
697 2932791866 2932784394 Bacteria 9704911
698 2932796334 2932794094 Bacteria 7915132
699 2932797077 2932794094 Bacteria 7915132
700 2932804360 2932801729 Bacteria 7987968
701 2932807426 2932801729 Bacteria 7987968
702 2932815607 2932809354 Bacteria 9135765
703 2932819320 2932818245 Bacteria 9955613
704 2933579021 2933577622 Bacteria 9116884
705 2935624268 2935616580 Bacteria 9032984
706 2935647760 2935638405 Bacteria 10015038
707 2935674783 2935665750 Bacteria 9571747
708 2935678344 2935675223 Bacteria 9928132
709 2935688230 2935684952 Bacteria 9590419
710 2935698894 2935694250 Bacteria 9291695
711 2935708513 2935703347 Bacteria 10242284
712 2935715249 2935713505 Bacteria 9608509
713 2935726186 2935722832 Bacteria 9608746
714 2935734068 2935732158 Bacteria 9706831
715 2935743447 2935741537 Bacteria 9707219
716 2935754515 2935750917 Bacteria 9590372
717 2935768285 2935760218 Bacteria 9817913
718 2935819439 2935810662 Bacteria 9401221
719 2935837244 2935827899 Bacteria 10038562
720 2935846502 2935837841 Bacteria 9454360
721 2935862698 2935855204 Bacteria 9035059
722 2935871704 2935864058 Bacteria 9784707
723 2935881929 2935873716 Bacteria 9632195
724 2935888771 2935883170 Bacteria 7964738
725 2935961642 2935959822 Bacteria 7869783
726 2935963916 2935959822 Bacteria 7869783
727 2935998802 2935992306 Bacteria 9802711
728 2936007358 2936002035 Bacteria 9362176
729 2936046284 2936037263 Bacteria 9446081
730 2940560108 2940556831 Bacteria 9590747
731 2941546921 2941538514 Bacteria 9402094
732 3005714002 3005710791 Bacteria 7622528
733 8019556762 8019555841 Bacteria 9642137
734 8019568544 8019565922 Bacteria 9639779
735 8019581506 8019576017 Bacteria 10049540
736 8019589134 8019586578 Bacteria 10212056
737 8019602097 8019597564 Bacteria 10041141
738 8019616457 8019608314 Bacteria 10042931
739 8055747340 8055742211 Bacteria 9226248
740 Ga0070689_101912113
741 JGI24736J21556_1029064
742 JGI24739J22299_10159857
743 JGI25162J39368_1001596
744 JGI25159J45721_1000015
745 JGI25165J46597_1000280
746 JGI25160J50197_1000003
747 JGI25161J50226_1002742
748 Ga0055526_1007083
749 Ga0055524_1041650
750 Ga0055536_1001123
751 Ga0055536_1041459
752 Ga0055530_10004321
753 Ga0055530_10023186
754 Ga0055540_1041907
755 Ga0055531_10000697
756 Ga0055531_10044523
757 Ga0055543_1000034
758 Ga0065165_1000025
759 Ga0070690_100645102
760 Ga0070670_100331594
761 Ga0070677_10476250
762 Ga0070666_10031914
763 Ga0070666_10162265
764 Ga0070680_100541876
765 Ga0070682_100033993
766 Ga0068868_100336151
767 Ga0068868_100420909
768 Ga0070689_100461258
769 Ga0070691_10333830
770 Ga0070687_100100429
771 Ga0070661_100049498
772 Ga0070668_100036882
773 Ga0070669_100000438
774 Ga0070669_100691660
775 Ga0070675_100415925
776 Ga0070675_101883211
777 Ga0070671_100059070
778 Ga0070671_100144711
779 Ga0070674_100152366
780 Ga0070673_100023208
781 Ga0070673_101626359
782 Ga0070688_100640354
783 Ga0070667_100066963
784 Ga0070709_10006594
785 Ga0070709_10256865
786 Ga0070714_100024651
787 Ga0070714_100050162
788 Ga0070714_100120710
789 Ga0070714_100900473
790 Ga0070713_100013850
791 Ga0070713_100022038
792 Ga0070713_100115085
793 Ga0070713_100216049
794 Ga0070713_100254892
795 Ga0070710_10006716
796 Ga0070710_10383336
797 Ga0070710_10753845
798 Ga0070711_100011825
799 Ga0070711_100074143
800 Ga0070711_100138930
801 Ga0070711_100544071
802 Ga0070711_100630139
803 Ga0070711_101216695
804 Ga0070663_100058160
805 Ga0070663_100214577
806 Ga0070678_100041051
807 Ga0070681_10296286
808 Ga0070685_10033295
809 Ga0070706_100265211
810 Ga0070706_100564086
811 Ga0070706_100929972
812 Ga0070706_101064456
813 Ga0070707_100773233
814 Ga0070698_100352319
815 Ga0070698_100588372
816 Ga0070698_100746413
817 Ga0070699_100682520
818 Ga0070699_101431738
819 Ga0070679_100044161
820 Ga0070684_100250152
821 Ga0070684_100250578
822 Ga0070684_100280207
823 Ga0070697_101163105
824 Ga0070697_101407977
825 Ga0070697_102092728
826 Ga0068853_100209856
827 Ga0070672_100249124
828 Ga0070686_100028574
829 Ga0070696_100694322
830 Ga0070693_100394740
831 Ga0070665_100128511
832 Ga0070665_100504232
833 Ga0070664_100252839
834 Ga0070664_100508563
835 Ga0068857_100202889
836 Ga0068857_100230824
837 Ga0068857_100562902
838 Ga0068856_100081658
839 Ga0068856_101457596
840 Ga0068856_102235263
841 Ga0070702_100164382
842 Ga0068852_100822318
843 Ga0068859_100212221
844 Ga0068864_100072302
845 Ga0068861_101273324
846 Ga0068851_10359222
847 Ga0068863_100190180
848 Ga0068863_100234561
849 Ga0068863_100311724
850 Ga0068863_102418364
851 Ga0068858_100167886
852 Ga0068858_100546155
853 Ga0068858_100825267
854 Ga0068860_100340567
855 Ga0068862_100580020
856 Ga0081538_10036483
857 Ga0070717_10002063
858 Ga0070717_10007835
859 Ga0070717_10014255
860 Ga0070717_10063991
861 Ga0070717_10167061
862 Ga0070717_10260551
863 Ga0070717_10524093
864 Ga0070717_10605578
865 Ga0075365_10024860
866 Ga0075363_100196048
867 Ga0075364_10090133
868 Ga0070715_10004890
869 Ga0070715_10034619
870 Ga0070716_100003451
871 Ga0070716_100007047
872 Ga0070716_100780373
873 Ga0070712_100267905
874 Ga0070712_100321967
875 Ga0070712_100442663
876 Ga0070712_100594498
877 Ga0070712_100749308
878 Ga0075362_10143408
879 Ga0075367_10240951
880 Ga0075367_10316159
881 Ga0075367_10712549
882 Ga0075369_10131074
883 Ga0075369_10441910
884 Ga0075366_10012033
885 Ga0097621_100024299
886 Ga0097621_100102101
887 Ga0075370_10083286
888 Ga0068871_100053351
889 Ga0068871_100066751
890 Ga0068871_100144834
891 Ga0075428_100194112
892 Ga0075430_100456992
893 Ga0075431_100700520
894 Ga0075433_10090020
895 Ga0075433_10313534
896 Ga0068865_100065878
897 Ga0068865_100738678
898 Ga0075436_100392603
899 Ga0097620_100212229
900 Ga0075435_100009745
901 Ga0075435_100391737
902 Ga0075435_100570558
903 Ga0099795_10023932
904 Ga0099795_10048771
905 Ga0099795_10094602
906 Ga0105251_10029408
907 Ga0105250_10224504
908 Ga0105240_11079200
909 Ga0111539_10090477
910 Ga0111539_10843425
911 Ga0105245_10321862
912 Ga0105245_11141935
913 Ga0105247_10165485
914 Ga0105247_10273143
915 Ga0105247_11261842
916 Ga0114129_10079908
917 Ga0105243_10069112
918 Ga0105243_10798501
919 Ga0105243_12295722
920 Ga0105241_10132181
921 Ga0105242_10150596
922 Ga0105248_10048981
923 Ga0105248_10096567
924 Ga0105248_10290835
925 Ga0105248_10293218
926 Ga0105237_10065253
927 Ga0105237_10071604
928 Ga0105237_10497877
929 Ga0105238_10087189
930 Ga0105238_10571889
931 Ga0105238_10816175
932 Ga0105238_10860645
933 Ga0099796_10074170
934 Ga0099796_10194774
935 Ga0099796_10227893
936 Ga0105239_10435458
937 Ga0105239_10695543
938 Ga0105246_10142512
939 Ga0157346_1003875
940 Ga0157321_1006128
941 Ga0157341_1002933
942 Ga0157324_1031631
943 Ga0157342_1006762
944 Ga0157327_1020250
945 Ga0157369_10050653
946 Ga0157369_10414934
947 Ga0157374_10364707
948 Ga0157378_10078599
949 Ga0157378_11173336
950 Ga0163162_10241776
951 Ga0163162_10476677
952 Ga0163162_10810763
953 Ga0157375_10505267
954 Ga0157375_11503301
955 Ga0157375_12519970
956 Ga0163163_10182975
957 Ga0163163_10646726
958 Ga0163163_10870736
959 Ga0163163_11575952
960 Ga0157377_10466010
961 Ga0157377_11064020
962 Ga0157379_10182921
963 Ga0157376_10103099
964 Ga0163161_10660159
965 Ga0209436_100130
966 Ga0209437_100281
967 Ga0207425_1011713
968 Ga0209646_1004247
969 Ga0209233_1000267
970 Ga0209130_1000005
971 Ga0209676_1001348
972 Ga0209676_1001927
973 Ga0209025_1000105
974 Ga0209564_1000113
975 Ga0209758_1030383
976 Ga0209050_1000644
977 Ga0209050_1001277
978 Ga0209050_1005247
979 Ga0209256_1002435
980 Ga0209256_1044068
981 Ga0207426_1000015
982 Ga0209051_1001056
983 Ga0209051_1013495
984 Ga0209257_1001078
985 Ga0209257_1001948
986 Ga0209257_1016366
987 Ga0207656_10369960
988 Ga0207713_1029276
989 Ga0207692_10007178
990 Ga0207692_10015010
991 Ga0207692_10308877
992 Ga0207710_10025982
993 Ga0207710_10169683
994 Ga0207710_10601175
995 Ga0207680_10133162
996 Ga0207647_10114051
997 Ga0207647_10535633
998 Ga0207685_10034813
999 Ga0207699_10001770
1000 Ga0207699_10004550
1001 Ga0207645_10227402
1002 Ga0207684_10775129
1003 Ga0207707_10226485
1004 Ga0207671_10190002
1005 Ga0207671_10351449
1006 Ga0207693_10001772
1007 Ga0207693_10110901
1008 Ga0207693_10238157
1009 Ga0207693_10432850
1010 Ga0207663_10008912
1011 Ga0207663_10052746
1012 Ga0207663_10070638
1013 Ga0207663_10407751
1014 Ga0207663_10949536
1015 Ga0207657_10272274
1016 Ga0207657_10330779
1017 Ga0207649_11024230
1018 Ga0207652_10010590
1019 Ga0207646_10631306
1020 Ga0207681_10000037
1021 Ga0207694_10427688
1022 Ga0207650_10083520
1023 Ga0207650_10266822
1024 Ga0207687_10012794
1025 Ga0207687_10912353
1026 Ga0207700_10004844
1027 Ga0207700_10010379
1028 Ga0207700_10400548
1029 Ga0207700_10539799
1030 Ga0207700_10597867
1031 Ga0207700_10625256
1032 Ga0207664_10007907
1033 Ga0207664_10763708
1034 Ga0207644_10041350
1035 Ga0207644_10114805
1036 Ga0207644_10143676
1037 Ga0207690_10148701
1038 Ga0207690_10361681
1039 Ga0207706_10053868
1040 Ga0207706_10551467
1041 Ga0207686_10034580
1042 Ga0207709_10164742
1043 Ga0207709_11356654
1044 Ga0207704_10195864
1045 Ga0207665_10001072
1046 Ga0207665_10004233
1047 Ga0207665_10026869
1048 Ga0207665_10037803
1049 Ga0207665_10458333
1050 Ga0207665_10567784
1051 Ga0207691_10046346
1052 Ga0207711_10025595
1053 Ga0207711_10033852
1054 Ga0207711_10434829
1055 Ga0207661_10111892
1056 Ga0207661_10178685
1057 Ga0207679_10084323
1058 Ga0207667_10230320
1059 Ga0207651_10294295
1060 Ga0207668_10140262
1061 Ga0207668_10157418
1062 Ga0207668_10688752
1063 Ga0207668_10979739
1064 Ga0207658_10129624
1065 Ga0207677_10141054
1066 Ga0207703_10101418
1067 Ga0207703_10279671
1068 Ga0207703_10482658
1069 Ga0207639_10514690
1070 Ga0207678_10090345
1071 Ga0207678_10146846
1072 Ga0207678_10189873
1073 Ga0207708_10073466
1074 Ga0207702_10299535
1075 Ga0207702_10585597
1076 Ga0207641_10177653
1077 Ga0207641_10545956
1078 Ga0207648_10174815
1079 Ga0207676_10284533
1080 Ga0207676_10321976
1081 Ga0207674_10086582
1082 Ga0207674_10288352
1083 Ga0207675_101888401
1084 Ga0207683_10017427
1085 Ga0207683_10266726
1086 Ga0207698_10237013
1087 Ga0209179_1054300
1088 Ga0209588_1016132
1089 Ga0209588_1190935
1090 Ga0207428_10086181
1091 Ga0207428_10424925
1092 Ga0207428_11316093
1093 Ga0265354_1004635
1094 Ga0265355_1011388
1095 Ga0268266_10033064
1096 Ga0268265_10030300
1097 Ga0268264_10101786
1098 Ga0307517_10285537
1099 Ga0307515_10058325
1100 Ga0307515_10420527
1101 Ga0307511_10022068
1102 Ga0307511_10063150
1103 Ga0265770_1000015
1104 Ga0307509_10139206
1105 Ga0307508_10033908
1106 Ga0307508_10305488
1107 Ga0307516_10000276
1108 Ga0307507_10069784
1109 Ga0307510_10008458
1110 Ga0307510_10134756
1111 Ga0307510_10157839
1112 Ga0307510_10177098
1113 Ga0316215_1029823
1114 Ga0373930_0023479
1115 Ga0373951_0075716
1116 Ga0373952_0019801
1117 Ga0373939_0403998
1118 Ga0373941_0187392
1119 Ga0373945_0043635
1120 Ga0373954_0181451
1121 Ga0373960_0201203
1122 Ga0373943_0039152
1123 Ga0373946_0026637
1124 Ga0373946_0414032
1125 Ga0373955_0549519
1126 Ga0373961_0012586
1127 Ga0373931_0129183
1128 Ga0373927_0007027
1129 Ga0373927_0387816
1130 Ga0373933_0471483
1131 Ga0373947_0001566
1132 Ga0373947_0028793
1133 Ga0373925_0013517
1134 Ga0373925_0086217
1135 Ga0395905_0139986
1136 Ga0451807_2026923
1137 Ga0451835_0153052
1138 Ga0451837_0595071
1139 Ga0451851_0227276
1140 Ga0451853_1297410
1141 Ga0466969_0167388
1142 Ga0466966_0539586
1143 Ga0466970_0164137
1144 Ga0466959_0003549
1145 Ga0495603_0004010
1146 Ga0495590_0018331
1147 Ga0495629_0001306
1148 Ga0495629_0007863
1149 Ga0495638_0004919
1150 Ga0495638_0006659
1151 Ga0495641_0031370
1152 Ga0495641_0263431
1153 Ga0495651_0691382
1154 Ga0495653_0015161
1155 Ga0495653_0033105
1156 Ga0495650_0005382
1157 Ga0495580_0000405
1158 Ga0495580_0005620
1159 Ga0495582_0001069
1160 Ga0495582_0002617
1161 Ga0495582_0127007
1162 Ga0495605_0013142
1163 Ga0495605_0054123
1164 Ga0495605_0074470
1165 Ga0495662_0043219
1166 Ga0495662_0125321
1167 Ga0495664_0000547
1168 Ga0495664_0171034
1169 Ga0495584_0000002
1170 Ga0495585_0463162
1171 Ga0495594_0005370
1172 Ga0495594_0127978
1173 Ga0495596_0057473
1174 Ga0495583_0002869
1175 Ga0495583_0262027
1176 Ga0495606_0038857
1177 Ga0495606_0044716
1178 Ga0495606_0050123
1179 Ga0495606_0344983
1180 Ga0495606_0533824
1181 Ga0495610_0091732
1182 Ga0495610_0257871
1183 Ga0495610_0274314
1184 Ga0495618_0010352
1185 Ga0495618_0501904
1186 Ga0495620_0035667
1187 Ga0495628_0009095
1188 Ga0495628_0052696
1189 Ga0495630_0012823
1190 Ga0495630_0051802
1191 Ga0495630_0405450
1192 Ga0495632_0038567
1193 Ga0495648_0002183
1194 Ga0495648_0026751
1195 Ga0495648_0048786
1196 Ga0495648_0049569
1197 Ga0495648_0072410
1198 Ga0495648_0075425
1199 Ga0495648_0116631
1200 Ga0495648_0155447
1201 Ga0495648_0383124
1202 Ga0495666_0001085
1203 Ga0495652_0017711
1204 Ga0495654_0152506
1205 Ga0495665_0009393
1206 Ga0495665_0083475
1207 Ga0495640_0007678
1208 Ga0495640_0595823
1209 Ga0495586_0009947
1210 Ga0495587_0003216
1211 Ga0495609_0060084
1212 Ga0495609_0204290
1213 Ga0495597_0059674
1214 Ga0495645_0004363
1215 Ga0495622_0102961
1216 Ga0495622_0110318
1217 Ga0495622_0122110
1218 Ga0495668_0087653
1219 Ga0495668_0150115
1220 Ga0495634_0000661
1221 Ga0495634_0183924
1222 Ga0495634_0280449
1223 Ga0495611_0019704
1224 Ga0495611_0059673
1225 Ga0495625_0209923
1226 Ga0495625_0223929
1227 Ga0495625_0263961
1228 Ga0495625_0515761
1229 Ga0495635_0006091
1230 Ga0495661_0004172
1231 Ga0495588_0138758
1232 Ga0495599_0018634
1233 Ga0495623_0098957
1234 Ga0495646_0003715
1235 Ga0495646_0005124
1236 Ga0495647_0026122
1237 Ga0495658_0000967
1238 Ga0495613_0002330
1239 Ga0495613_0101505
1240 Ga0495624_0006209
1241 Ga0495624_0022858
1242 Ga0495624_0079432
1243 Ga0495624_0691588
1244 Ga0495671_0126295
1245 Ga0495671_0197755
1246 Ga0495649_0507251
1247 Ga0495649_0557779
1248 Ga0495600_0176771
1249 Ga0495581_0002154
1250 Ga0495604_0002039
1251 Ga0495674_0005169
1252 Ga0495674_0043489
1253 Ga0495674_0354487
1254 Ga0495676_0010864
1255 Ga0495676_0022259
1256 Ga0495680_0002175
1257 Ga0495683_0090983
1258 Ga0495683_0109450
1259 Ga0495683_0343601
1260 Ga0495687_161356
1261 Ga0495679_000009
1262 Ga0495679_000748
1263 Ga0495673_0055630
1264 Ga0495673_0085907
1265 Ga0495673_0097803
1266 Ga0495673_0104426
1267 Ga0495673_0217300
1268 Ga0495673_0244169
1269 Ga0495673_0335510
1270 Ga0495684_0081956
1271 Ga0495686_0313072
1272 Ga0495593_0001822
1273 Ga0495593_0004348
1274 Ga0495593_0415253
1275 Ga0495602_0006795
1276 Ga0495602_0621950
1277 Ga0495614_0002666
1278 Ga0495614_0060933
1279 Ga0495626_0040568
1280 Ga0496100_0038877
1281 Ga0496100_0236171
1282 Ga0496101_0004589
1283 Ga0496101_0023487
1284 Ga0496101_0164972
1285 Ga0496101_1286975
1286 Ga0496102_0011208
1287 Ga0496102_0093381
1288 Ga0496102_0126223
1289 Ga0496102_0290004
1290 Ga0496103_0015983
1291 Ga0496103_0188362
1292 Ga0496104_0049184
1293 Ga0496104_0181876
1294 Ga0496104_0217293
1295 Ga0496104_0291448
1296 Ga0496105_0010764
1297 Ga0496105_0043497
1298 Ga0496105_0075306
1299 Ga0496105_0151854
1300 Ga0496105_0484640
1301 Ga0496105_0603594
1302 Ga0496105_1293804
1303 Ga0496106_0033052
1304 Ga0496106_0124532
1305 Ga0496106_0271628
1306 Ga0496107_0056643
1307 Ga0496107_0070722
1308 Ga0496107_0576935
1309 Ga0496108_0012633
1310 Ga0496108_0238582
1311 Ga0496108_0326690
1312 Ga0496109_0036006
1313 Ga0496109_0206453
1314 Ga0496109_0315724
1315 Ga0496109_0379127
1316 Ga0496110_0022139
1317 Ga0496110_0042236
1318 Ga0496110_0072136
1319 Ga0496110_0888016
1320 Ga0496111_0007468
1321 Ga0496111_0183651
1322 Ga0496112_0032895
1323 Ga0496112_0075775
1324 Ga0496112_0212718
1325 Ga0496112_0525721
1326 Ga0496113_0110546
1327 Ga0496113_0114845
1328 Ga0496113_0205460
1329 Ga0496113_0430942
1330 Ga0496114_0009386
1331 Ga0496114_0075322
1332 Ga0496114_0628331
1333 Ga0496115_0083872
1334 Ga0496115_0233276
1335 Ga0496115_0762794
1336 Ga0496115_1014940
1337 Ga0496116_0047230
1338 Ga0496116_0275111
1339 Ga0496117_0099668
1340 Ga0496117_0228904
1341 Ga0496118_0024558
1342 Ga0496118_0060180
1343 Ga0496119_0122871
1344 Ga0496120_0214489
1345 Ga0496121_0046077
1346 Ga0496122_0318247
1347 Ga0496124_0384566
1348 Ga0496125_0164900
1349 Ga0496125_0179400
1350 Ga0496126_0096161
1351 Ga0496126_0101996
1352 Ga0496126_0250191
1353 Ga0495682_0014807
1354 Ga0495682_0049600
1355 Ga0495682_0083048
1356 Ga0495682_0122959
1357 Ga0495682_0123722
1358 Ga0495682_0207770
1359 nmdc:mga03n38_511818_c1
1360 nmdc:mga0yw44_1061758_c1
1361 nmdc:mga0yw44_57930_c1
1362 nmdc:mga0yw44_99120_c1
1363 nmdc:mga0k408_125429_c1
1364 nmdc:mga06z11_119875_c1
1365 nmdc:mga05p37_60503_c1
1366 nmdc:mga09592_241064_c1
1367 nmdc:mga0qj67_105304_c1
1368 nmdc:mga06r32_119839_c1
1369 nmdc:mga06r32_54616_c1
1370 nmdc:mga08y16_108791_c1
1371 nmdc:mga08y16_391967_c1
1372 nmdc:mga08y16_83147_c1
1373 nmdc:mga0n895_137295_c1
1374 nmdc:mga0n895_253520_c1
1375 nmdc:mga0n895_351632_c1
1376 nmdc:mga0n895_371392_c1
1377 nmdc:mga0n895_851638_c1
1378 nmdc:mga0rr50_886470_c1
1379 nmdc:mga08x19_603155_c1
1380 nmdc:mga0a205_253321_c1
1381 nmdc:mga0a205_573520_c1
1382 nmdc:mga0sz30_194346_c1
1383 nmdc:mga0sz30_92231_c1
1384 Ga0500635_0008832
1385 Ga0495655_0091952
1386 Ga0495655_0372034
1387 Ga0495619_0000197
1388 Ga0500578_0111265
1389 Ga0500643_050489
1390 Ga0500647_0162140
1391 Ga0500583_0021076
1392 Ga0500651_0038651
1393 Ga0500651_0094984
1394 Ga0500641_0078346
1395 Ga0500555_003590
1396 Ga0500556_0003155
1397 Ga0500556_0301841
1398 Ga0500562_006055
1399 Ga0500569_000906
1400 Ga0500595_007843
1401 Ga0500614_049860
1402 Ga0500642_0090055
1403 Ga0500655_048735
1404 Ga0500658_0153128
1405 Ga0500568_0019594
1406 Ga0500568_0079662
1407 Ga0500577_0066161
1408 Ga0500588_0030651
1409 Ga0500604_0029865
1410 Ga0500622_0361311
1411 Ga0500627_0321952
1412 Ga0500633_0020658
1413 Ga0500638_115711
1414 Ga0500639_145842
1415 Ga0500636_0117585
1416 Ga0500636_0164511
1417 Ga0500645_039681
1418 Ga0500645_051857
1419 Ga0500599_000400
1420 Ga0500661_006184
1421 2501078034
1422 2511092005
1423 2524538495
1424 2600197568
1425 2617384125
1426 2643807702
1427 2644379190
1428 2644671557
1429 2746086288
1430 2746096959
1431 2824668780
1432 2879100676
1433 2922373279
1434 2929615692
1435 2929630307
1436 2932791866
1437 2932796334
1438 2932797077
1439 2932804360
1440 2932807426
1441 2932815607
1442 2932819320
1443 2933579021
1444 2935624268
1445 2935647760
1446 2935674783
1447 2935678344
1448 2935688230
1449 2935698894
1450 2935708513
1451 2935715249
1452 2935726186
1453 2935734068
1454 2935743447
1455 2935754515
1456 2935768285
1457 2935819439
1458 2935837244
1459 2935846502
1460 2935862698
1461 2935871704
1462 2935881929
1463 2935888771
1464 2935961642
1465 2935963916
1466 2935998802
1467 2936007358
1468 2936046284
1469 2940560108
1470 2941546921
1471 3005714002
1472 8019556762
1473 8019568544
1474 8019581506
1475 8019589134
1476 8019602097
1477 8019616457
1478 8055747340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

7

84

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c1r-assembly1.cif.gz_E resting state homomeric glua2 f231a mutant ampa receptor in complex with tarp gamma-2 0.649 53 115
6q6b-assembly1.cif.gz_A structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents 0.4789 7 115
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.4781 2 115
5arm-assembly1.cif.gz_A apo-csp3 (copper storage protein 3) from methylosinus 0.4687 7 114
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.459 2 115
ID Description Score Start End Superfamily
af_Q9LSW5_1_134_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.814 1 116 1.20.120.550
af_Q7TP91_4_196_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.773 3 115 1.20.120.550
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7594 11 108 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.745 6 115 1.10.10.1740
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7422 3 136 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A3D5CZY7-F1-model_v4 DoxX family protein 0.9957 5 126 GO:0005886
AF-A0A6A7YDW1-F1-model_v4 DoxX family membrane protein 0.9938 3 126 GO:0005886
AF-A0A6I3T101-F1-model_v4 DoxX family membrane protein 0.9935 4 137 GO:0005886
AF-A0A840YS47-F1-model_v4 Putative oxidoreductase 0.9929 7 126 GO:0005886
AF-A0A1G8DHB0-F1-model_v4 deleted 0.9928 3 129

Map