F478443

General Info

Members Datasets Scaffolds Average Seq Length
739 224 1478 133

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100468768|Ga0070714_1004687682
Length 146
Sequence VLDFALLERNSDDVPKLHLTKVAFACRDVDSLTQRIANRAFGGEVRVATRMRPKRSAELIGGNLYWIVKHRLVAGLEILRFEDREDGRLDIVCSAELVVVSPRPRRAHQGWRYLEEADAPSAGDDGTGLGALPPILYGKLASLALV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.84
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 5.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100468768 3300005435 Bacteria 1198
2 MBSR1b_contig_5802081 2162886012 Unclassified 1259
3 JGI24752J21851_1042724 3300001976 Unclassified 609
4 JGI24740J21852_10001279 3300001979 Bacteria 11425
5 JGI24740J21852_10124572 3300001979 Bacteria 644
6 JGI24739J22299_10000632 3300001989 Bacteria 12645
7 JGI24739J22299_10008617 3300001989 Bacteria 3805
8 JGI24737J22298_10000103 3300001990 Bacteria 25390
9 JGI24737J22298_10017157 3300001990 Bacteria 2334
10 JGI24735J21928_10019965 3300002067 Bacteria 2056
11 JGI24738J21930_10000018 3300002075 Bacteria 30549
12 JGI24738J21930_10008304 3300002075 Bacteria 2364
13 Ga0065712_10040760 3300005290 Bacteria 1206
14 Ga0065715_10340560 3300005293 Bacteria 963
15 Ga0065715_10584272 3300005293 Bacteria 718
16 Ga0070658_10000107 3300005327 Bacteria 73895
17 Ga0070658_10009613 3300005327 Bacteria 7761
18 Ga0070658_10019253 3300005327 Bacteria 5468
19 Ga0070658_10019568 3300005327 Bacteria 5420
20 Ga0070658_10033380 3300005327 Bacteria 4140
21 Ga0070658_10060655 3300005327 Bacteria 3081
22 Ga0070658_10076497 3300005327 Bacteria 2745
23 Ga0070658_10398910 3300005327 Bacteria 1181
24 Ga0070658_11268895 3300005327 Unclassified 640
25 Ga0070676_10002531 3300005328 Bacteria 9389
26 Ga0070676_10027239 3300005328 Bacteria 3240
27 Ga0070676_10036742 3300005328 Bacteria 2823
28 Ga0070676_10908951 3300005328 Bacteria 656
29 Ga0070683_100001635 3300005329 Bacteria 17347
30 Ga0070683_100006411 3300005329 Bacteria 9866
31 Ga0070683_100028335 3300005329 Bacteria 5061
32 Ga0070683_100062139 3300005329 Bacteria 3472
33 Ga0070683_100062612 3300005329 Bacteria 3459
34 Ga0070683_100131879 3300005329 Bacteria 2365
35 Ga0070683_100301837 3300005329 Bacteria 1523
36 Ga0070683_100514835 3300005329 Bacteria 1143
37 Ga0070683_100870353 3300005329 Unclassified 864
38 Ga0070690_100026541 3300005330 Bacteria 3574
39 Ga0070690_100902800 3300005330 Bacteria 691
40 Ga0070670_100014652 3300005331 Bacteria 6731
41 Ga0070670_100266583 3300005331 Bacteria 1494
42 Ga0070670_101822775 3300005331 Bacteria 560
43 Ga0070677_10405993 3300005333 Unclassified 719
44 Ga0068869_100003378 3300005334 Bacteria 9741
45 Ga0068869_100667997 3300005334 Bacteria 883
46 Ga0070666_10001184 3300005335 Bacteria 15784
47 Ga0070666_10713713 3300005335 Unclassified 736
48 Ga0070680_100000477 3300005336 Bacteria 27458
49 Ga0070680_100002652 3300005336 Bacteria 13265
50 Ga0070680_100004694 3300005336 Bacteria 10278
51 Ga0070680_100006732 3300005336 Bacteria 8753
52 Ga0070680_100008676 3300005336 Bacteria 7792
53 Ga0070680_100048693 3300005336 Bacteria 3454
54 Ga0070680_100132389 3300005336 Bacteria 2087
55 Ga0070680_100589438 3300005336 Bacteria 954
56 Ga0070680_100711197 3300005336 Bacteria 864
57 Ga0070682_100006724 3300005337 Bacteria 6449
58 Ga0070682_100192650 3300005337 Bacteria 1432
59 Ga0070682_100382896 3300005337 Bacteria 1058
60 Ga0068868_100000972 3300005338 Bacteria 19505
61 Ga0068868_100343657 3300005338 Bacteria 1276
62 Ga0070660_100000861 3300005339 Bacteria 20243
63 Ga0070660_100003065 3300005339 Bacteria 11487
64 Ga0070660_100003086 3300005339 Bacteria 11449
65 Ga0070660_100011318 3300005339 Bacteria 6332
66 Ga0070660_100025166 3300005339 Bacteria 4422
67 Ga0070660_100033421 3300005339 Bacteria 3877
68 Ga0070660_100034397 3300005339 Bacteria 3828
69 Ga0070660_100034860 3300005339 Bacteria 3806
70 Ga0070660_100748122 3300005339 Bacteria 821
71 Ga0070660_100786605 3300005339 Bacteria 800
72 Ga0070689_100017523 3300005340 Bacteria 5263
73 Ga0070691_10256308 3300005341 Bacteria 940
74 Ga0070687_100037451 3300005343 Bacteria 2425
75 Ga0070661_100000101 3300005344 Bacteria 70279
76 Ga0070661_100004927 3300005344 Bacteria 9192
77 Ga0070661_100005038 3300005344 Bacteria 9110
78 Ga0070661_100055931 3300005344 Bacteria 2889
79 Ga0070661_100131409 3300005344 Bacteria 1881
80 Ga0070661_100187165 3300005344 Bacteria 1578
81 Ga0070661_100232893 3300005344 Bacteria 1416
82 Ga0070661_100612791 3300005344 Bacteria 881
83 Ga0070692_10003217 3300005345 Bacteria 6575
84 Ga0070692_10016353 3300005345 Bacteria 3528
85 Ga0070692_10082450 3300005345 Bacteria 1734
86 Ga0070692_10083589 3300005345 Bacteria 1724
87 Ga0070692_10130734 3300005345 Bacteria 1411
88 Ga0070668_100008284 3300005347 Bacteria 7716
89 Ga0070668_100038015 3300005347 Bacteria 3677
90 Ga0070668_101253443 3300005347 Bacteria 673
91 Ga0070669_100000613 3300005353 Bacteria 26394
92 Ga0070669_100016981 3300005353 Bacteria 5197
93 Ga0070669_100084035 3300005353 Bacteria 2374
94 Ga0070669_100653472 3300005353 Bacteria 885
95 Ga0070669_101138821 3300005353 Unclassified 673
96 Ga0070675_100073493 3300005354 Bacteria 2839
97 Ga0070675_100360257 3300005354 Bacteria 1291
98 Ga0070671_100000533 3300005355 Bacteria 26740
99 Ga0070671_100014143 3300005355 Bacteria 6445
100 Ga0070671_100030078 3300005355 Bacteria 4482
101 Ga0070671_101046362 3300005355 Unclassified 716
102 Ga0070674_101294478 3300005356 Bacteria 650
103 Ga0070673_100003805 3300005364 Bacteria 9466
104 Ga0070673_100057067 3300005364 Bacteria 3084
105 Ga0070673_100308646 3300005364 Bacteria 1395
106 Ga0070659_100000045 3300005366 Bacteria 101520
107 Ga0070659_100016514 3300005366 Bacteria 5542
108 Ga0070659_100057730 3300005366 Bacteria 3061
109 Ga0070659_100059707 3300005366 Bacteria 3011
110 Ga0070659_100154086 3300005366 Bacteria 1876
111 Ga0070659_100202596 3300005366 Bacteria 1634
112 Ga0070659_100219296 3300005366 Bacteria 1569
113 Ga0070659_100259405 3300005366 Bacteria 1442
114 Ga0070659_100702014 3300005366 Unclassified 875
115 Ga0070659_100989752 3300005366 Bacteria 738
116 Ga0070659_101062650 3300005366 Bacteria 712
117 Ga0070667_100001174 3300005367 Bacteria 23830
118 Ga0070667_100079689 3300005367 Bacteria 2800
119 Ga0070667_100413617 3300005367 Bacteria 1229
120 Ga0070667_100601984 3300005367 Bacteria 1013
121 Ga0070714_100172953 3300005435 Bacteria 1961
122 Ga0070714_101059704 3300005435 Bacteria 790
123 Ga0070713_101767878 3300005436 Unclassified 600
124 Ga0070694_100005710 3300005444 Bacteria 7546
125 Ga0070694_101381431 3300005444 Unclassified 594
126 Ga0070663_100000549 3300005455 Bacteria 19942
127 Ga0070663_100047213 3300005455 Bacteria 3050
128 Ga0070663_100180609 3300005455 Bacteria 1637
129 Ga0070663_100322178 3300005455 Bacteria 1243
130 Ga0070663_100456936 3300005455 Bacteria 1054
131 Ga0070662_100000036 3300005457 Bacteria 77190
132 Ga0070662_100015155 3300005457 Bacteria 5158
133 Ga0070662_100026980 3300005457 Bacteria 3982
134 Ga0070662_100068699 3300005457 Bacteria 2606
135 Ga0070662_100283452 3300005457 Bacteria 1341
136 Ga0070662_101925569 3300005457 Unclassified 511
137 Ga0070681_10004074 3300005458 Bacteria 13800
138 Ga0070681_10023867 3300005458 Bacteria 6157
139 Ga0070681_10081032 3300005458 Bacteria 3201
140 Ga0070681_10165930 3300005458 Bacteria 2131
141 Ga0070681_10338619 3300005458 Bacteria 1414
142 Ga0070681_10705275 3300005458 Bacteria 925
143 Ga0070681_11014010 3300005458 Bacteria 750
144 Ga0070681_11538171 3300005458 Bacteria 590
145 Ga0068867_100001501 3300005459 Bacteria 16154
146 Ga0068867_101293752 3300005459 Bacteria 673
147 Ga0070685_10016844 3300005466 Bacteria 3901
148 Ga0070679_100066466 3300005530 Bacteria 3594
149 Ga0070679_100106227 3300005530 Bacteria 2793
150 Ga0070679_100181881 3300005530 Bacteria 2074
151 Ga0070679_100189064 3300005530 Bacteria 2029
152 Ga0070679_100472562 3300005530 Bacteria 1198
153 Ga0070684_100027913 3300005535 Bacteria 4769
154 Ga0070684_100305960 3300005535 Bacteria 1459
155 Ga0070684_100347638 3300005535 Bacteria 1364
156 Ga0070684_100510099 3300005535 Bacteria 1114
157 Ga0068853_100000059 3300005539 Bacteria 78301
158 Ga0068853_100000570 3300005539 Bacteria 25231
159 Ga0068853_100032863 3300005539 Bacteria 4398
160 Ga0068853_100089942 3300005539 Bacteria 2697
161 Ga0068853_100447637 3300005539 Bacteria 1214
162 Ga0068853_100638202 3300005539 Bacteria 1013
163 Ga0070672_100000866 3300005543 Bacteria 18097
164 Ga0070672_100120352 3300005543 Bacteria 2148
165 Ga0070686_100772757 3300005544 Unclassified 772
166 Ga0070696_100042737 3300005546 Bacteria 3133
167 Ga0070693_100000361 3300005547 Bacteria 20637
168 Ga0070693_100092887 3300005547 Bacteria 1823
169 Ga0070665_100004200 3300005548 Bacteria 15157
170 Ga0070665_100062768 3300005548 Bacteria 3725
171 Ga0070665_100795186 3300005548 Bacteria 959
172 Ga0068855_100003767 3300005563 Bacteria 18537
173 Ga0068855_100010268 3300005563 Bacteria 11292
174 Ga0068855_100021027 3300005563 Bacteria 7824
175 Ga0068855_100058235 3300005563 Bacteria 4526
176 Ga0068855_100210192 3300005563 Bacteria 2187
177 Ga0068855_100988817 3300005563 Bacteria 884
178 Ga0070664_100000027 3300005564 Bacteria 90881
179 Ga0070664_100007309 3300005564 Bacteria 8904
180 Ga0070664_100014989 3300005564 Bacteria 6326
181 Ga0070664_100184030 3300005564 Bacteria 1858
182 Ga0070664_100191805 3300005564 Bacteria 1821
183 Ga0070664_100379554 3300005564 Bacteria 1290
184 Ga0070664_101123983 3300005564 Bacteria 740
185 Ga0068857_100006503 3300005577 Bacteria 10025
186 Ga0068857_100027425 3300005577 Bacteria 5024
187 Ga0068857_100031864 3300005577 Bacteria 4658
188 Ga0068857_100158885 3300005577 Bacteria 2050
189 Ga0068857_100209968 3300005577 Bacteria 1776
190 Ga0068857_101898123 3300005577 Bacteria 583
191 Ga0068854_100014971 3300005578 Bacteria 5125
192 Ga0068854_100031718 3300005578 Bacteria 3673
193 Ga0068854_100049234 3300005578 Bacteria 3009
194 Ga0068854_100064635 3300005578 Bacteria 2659
195 Ga0068854_100077907 3300005578 Bacteria 2440
196 Ga0068854_100173258 3300005578 Bacteria 1680
197 Ga0068854_100189781 3300005578 Bacteria 1610
198 Ga0068854_100248935 3300005578 Bacteria 1418
199 Ga0068856_100000705 3300005614 Bacteria 36291
200 Ga0068856_100112245 3300005614 Bacteria 2723
201 Ga0068856_100177026 3300005614 Bacteria 2146
202 Ga0068856_100844405 3300005614 Unclassified 935
203 Ga0068856_100961209 3300005614 Bacteria 873
204 Ga0068856_101446059 3300005614 Bacteria 702
205 Ga0068856_102281372 3300005614 Bacteria 549
206 Ga0068856_102461425 3300005614 Bacteria 527
207 Ga0068852_100000433 3300005616 Bacteria 27783
208 Ga0068852_100002112 3300005616 Bacteria 13601
209 Ga0068852_100004730 3300005616 Bacteria 9661
210 Ga0068852_100005166 3300005616 Bacteria 9308
211 Ga0068852_100009994 3300005616 Bacteria 7060
212 Ga0068852_100012833 3300005616 Bacteria 6385
213 Ga0068852_100021917 3300005616 Bacteria 5112
214 Ga0068852_100028840 3300005616 Bacteria 4548
215 Ga0068852_100038267 3300005616 Bacteria 4030
216 Ga0068852_100199101 3300005616 Bacteria 1895
217 Ga0068852_100293902 3300005616 Bacteria 1570
218 Ga0068852_100449243 3300005616 Bacteria 1276
219 Ga0068852_101047860 3300005616 Bacteria 835
220 Ga0068859_100001592 3300005617 Bacteria 23154
221 Ga0068859_100004210 3300005617 Bacteria 14679
222 Ga0068859_100186961 3300005617 Bacteria 2155
223 Ga0068859_100505209 3300005617 Bacteria 1304
224 Ga0068864_100000247 3300005618 Bacteria 48323
225 Ga0068864_100008545 3300005618 Bacteria 8451
226 Ga0068864_100018914 3300005618 Bacteria 5760
227 Ga0068864_100081590 3300005618 Bacteria 2835
228 Ga0068866_10126483 3300005718 Bacteria 1447
229 Ga0068866_10525938 3300005718 Bacteria 787
230 Ga0068861_100180793 3300005719 Bacteria 1755
231 Ga0068861_100355085 3300005719 Bacteria 1287
232 Ga0068851_10020047 3300005834 Bacteria 3234
233 Ga0068851_10062018 3300005834 Bacteria 1917
234 Ga0068870_10010268 3300005840 Bacteria 4294
235 Ga0068870_10988314 3300005840 Bacteria 599
236 Ga0068863_100001653 3300005841 Bacteria 22048
237 Ga0068863_100069143 3300005841 Bacteria 3339
238 Ga0068863_100234963 3300005841 Bacteria 1769
239 Ga0068858_100006759 3300005842 Bacteria 11161
240 Ga0068858_100017221 3300005842 Bacteria 6781
241 Ga0068858_100022399 3300005842 Bacteria 5897
242 Ga0068860_100021537 3300005843 Bacteria 6241
243 Ga0068860_100027958 3300005843 Bacteria 5430
244 Ga0068860_101165869 3300005843 Bacteria 790
245 Ga0068862_100006024 3300005844 Bacteria 10096
246 Ga0068862_100254750 3300005844 Bacteria 1600
247 Ga0068862_101192545 3300005844 Bacteria 759
248 Ga0097621_100026649 3300006237 Bacteria 4537
249 Ga0097621_100219024 3300006237 Bacteria 1658
250 Ga0097621_101420964 3300006237 Unclassified 657
251 Ga0068871_100070496 3300006358 Bacteria 2873
252 Ga0097620_100001592 3300006931 Bacteria 23154
253 Ga0097620_100004210 3300006931 Bacteria 14679
254 Ga0097620_100186953 3300006931 Bacteria 2155
255 Ga0097620_100505223 3300006931 Bacteria 1304
256 Ga0105240_10027015 3300009093 Bacteria 7524
257 Ga0105240_10126852 3300009093 Bacteria 3065
258 Ga0105240_10379048 3300009093 Bacteria 1598
259 Ga0105245_10000128 3300009098 Bacteria 72249
260 Ga0105245_10276026 3300009098 Bacteria 1641
261 Ga0114129_10896631 3300009147 Bacteria 1124
262 Ga0105243_10064347 3300009148 Bacteria 2943
263 Ga0105243_10105180 3300009148 Bacteria 2351
264 Ga0105243_10759863 3300009148 Bacteria 951
265 Ga0105243_10817439 3300009148 Bacteria 920
266 Ga0105241_10032667 3300009174 Bacteria 3903
267 Ga0105241_10057413 3300009174 Bacteria 2986
268 Ga0105241_10108525 3300009174 Bacteria 2219
269 Ga0105241_10211699 3300009174 Unclassified 1624
270 Ga0105242_10912682 3300009176 Bacteria 879
271 Ga0105248_10001451 3300009177 Bacteria 26388
272 Ga0105248_10005525 3300009177 Bacteria 13885
273 Ga0105248_10018193 3300009177 Bacteria 7761
274 Ga0105248_11168005 3300009177 Bacteria 870
275 Ga0105237_10010769 3300009545 Bacteria 9706
276 Ga0105238_10014228 3300009551 Bacteria 8046
277 Ga0105238_10033353 3300009551 Bacteria 5241
278 Ga0105238_10122248 3300009551 Bacteria 2583
279 Ga0105238_10143149 3300009551 Bacteria 2367
280 Ga0105249_10031339 3300009553 Bacteria 4809
281 Ga0105249_10065744 3300009553 Bacteria 3337
282 Ga0105249_11185354 3300009553 Bacteria 835
283 Ga0105239_10118334 3300010375 Bacteria 2940
284 Ga0105239_10218160 3300010375 Bacteria 2139
285 Ga0105239_10263900 3300010375 Bacteria 1936
286 Ga0105246_10007663 3300011119 Bacteria 6626
287 Ga0105246_10011642 3300011119 Bacteria 5463
288 Ga0105246_11300917 3300011119 Bacteria 674
289 Ga0157373_10001921 3300013100 Bacteria 15792
290 Ga0157373_10011033 3300013100 Bacteria 6655
291 Ga0157373_10017730 3300013100 Bacteria 5183
292 Ga0157373_10026865 3300013100 Bacteria 4155
293 Ga0157373_10043735 3300013100 Bacteria 3199
294 Ga0157373_10056049 3300013100 Bacteria 2799
295 Ga0157373_10060140 3300013100 Bacteria 2692
296 Ga0157373_10069117 3300013100 Bacteria 2497
297 Ga0157373_10072216 3300013100 Bacteria 2436
298 Ga0157373_10229162 3300013100 Bacteria 1312
299 Ga0157373_10258216 3300013100 Bacteria 1233
300 Ga0157373_10306653 3300013100 Bacteria 1128
301 Ga0157373_10328756 3300013100 Bacteria 1088
302 Ga0157373_10384756 3300013100 Bacteria 1004
303 Ga0157373_10906988 3300013100 Bacteria 654
304 Ga0157371_10001392 3300013102 Bacteria 25245
305 Ga0157371_10002958 3300013102 Bacteria 15800
306 Ga0157371_10014993 3300013102 Bacteria 5828
307 Ga0157371_10055697 3300013102 Bacteria 2806
308 Ga0157371_10058590 3300013102 Bacteria 2731
309 Ga0157371_10070710 3300013102 Bacteria 2471
310 Ga0157371_10112985 3300013102 Bacteria 1928
311 Ga0157371_10140542 3300013102 Bacteria 1720
312 Ga0157371_10140622 3300013102 Bacteria 1719
313 Ga0157371_10255184 3300013102 Unclassified 1263
314 Ga0157371_10308430 3300013102 Bacteria 1147
315 Ga0157371_10416876 3300013102 Unclassified 984
316 Ga0157371_10483958 3300013102 Bacteria 912
317 Ga0157370_10000686 3300013104 Bacteria 42199
318 Ga0157370_10011108 3300013104 Bacteria 9441
319 Ga0157370_10047926 3300013104 Bacteria 4094
320 Ga0157370_10060505 3300013104 Bacteria 3596
321 Ga0157370_10093074 3300013104 Bacteria 2829
322 Ga0157370_10141565 3300013104 Bacteria 2241
323 Ga0157370_10212917 3300013104 Bacteria 1791
324 Ga0157370_10286151 3300013104 Bacteria 1523
325 Ga0157370_11887769 3300013104 Unclassified 536
326 Ga0157369_10008678 3300013105 Bacteria 11651
327 Ga0157369_10039739 3300013105 Bacteria 5140
328 Ga0157369_10059618 3300013105 Bacteria 4115
329 Ga0157369_10069335 3300013105 Bacteria 3788
330 Ga0157369_10115743 3300013105 Bacteria 2847
331 Ga0157369_10309826 3300013105 Bacteria 1642
332 Ga0157369_10556221 3300013105 Bacteria 1186
333 Ga0157369_10612319 3300013105 Bacteria 1124
334 Ga0157369_12011390 3300013105 Unclassified 586
335 Ga0157369_12247206 3300013105 Bacteria 553
336 Ga0157374_10031240 3300013296 Bacteria 4840
337 Ga0157378_10000396 3300013297 Bacteria 42907
338 Ga0163162_10068534 3300013306 Bacteria 3600
339 Ga0163162_10264490 3300013306 Bacteria 1851
340 Ga0163162_10471362 3300013306 Bacteria 1387
341 Ga0157372_10038042 3300013307 Bacteria 5309
342 Ga0157372_10070283 3300013307 Bacteria 3938
343 Ga0157372_10097641 3300013307 Bacteria 3350
344 Ga0157372_10459311 3300013307 Bacteria 1484
345 Ga0157372_11243324 3300013307 Bacteria 860
346 Ga0157372_11540970 3300013307 Bacteria 765
347 Ga0157375_10591103 3300013308 Bacteria 1270
348 Ga0157375_10644106 3300013308 Bacteria 1216
349 Ga0163163_10000187 3300014325 Bacteria 63661
350 Ga0157380_11723141 3300014326 Bacteria 684
351 Ga0157377_11115750 3300014745 Bacteria 605
352 Ga0157379_10182906 3300014968 Bacteria 1893
353 Ga0157379_10681921 3300014968 Bacteria 964
354 Ga0197907_10087473 3300020069 Bacteria 2393
355 Ga0206356_11579705 3300020070 Bacteria 558
356 Ga0206354_10755474 3300020081 Unclassified 646
357 Ga0206354_11422423 3300020081 Bacteria 958
358 Ga0206353_10818459 3300020082 Bacteria 3127
359 Ga0206353_11188791 3300020082 Unclassified 817
360 Ga0207697_10000059 3300025315 Bacteria 45306
361 Ga0207656_10040854 3300025321 Bacteria 1968
362 Ga0207656_10357895 3300025321 Bacteria 729
363 Ga0207682_10197253 3300025893 Bacteria 924
364 Ga0207642_10117116 3300025899 Bacteria 1367
365 Ga0207688_10000721 3300025901 Bacteria 16387
366 Ga0207680_10004748 3300025903 Bacteria 6467
367 Ga0207680_10138471 3300025903 Bacteria 1611
368 Ga0207647_10000968 3300025904 Bacteria 22267
369 Ga0207647_10001381 3300025904 Bacteria 18648
370 Ga0207647_10014849 3300025904 Bacteria 5356
371 Ga0207647_10051788 3300025904 Archaea 2536
372 Ga0207645_10002144 3300025907 Bacteria 15772
373 Ga0207645_10016875 3300025907 Bacteria 4824
374 Ga0207645_10078345 3300025907 Bacteria 2118
375 Ga0207643_10258584 3300025908 Bacteria 1074
376 Ga0207705_10000086 3300025909 Bacteria 116132
377 Ga0207705_10004131 3300025909 Bacteria 11008
378 Ga0207705_10012975 3300025909 Bacteria 6014
379 Ga0207705_10018733 3300025909 Bacteria 4953
380 Ga0207705_10019330 3300025909 Bacteria 4871
381 Ga0207705_10023122 3300025909 Bacteria 4433
382 Ga0207705_10102751 3300025909 Bacteria 2104
383 Ga0207705_10374960 3300025909 Bacteria 1099
384 Ga0207705_10804549 3300025909 Bacteria 729
385 Ga0207654_10096895 3300025911 Bacteria 1810
386 Ga0207654_10116145 3300025911 Unclassified 1673
387 Ga0207654_10238303 3300025911 Bacteria 1215
388 Ga0207654_10325720 3300025911 Bacteria 1051
389 Ga0207707_10086364 3300025912 Bacteria 2742
390 Ga0207707_10096969 3300025912 Bacteria 2576
391 Ga0207707_10238320 3300025912 Bacteria 1582
392 Ga0207707_11096466 3300025912 Bacteria 649
393 Ga0207695_10019721 3300025913 Bacteria 7753
394 Ga0207695_10057499 3300025913 Bacteria 4040
395 Ga0207671_10068265 3300025914 Bacteria 2648
396 Ga0207671_11104349 3300025914 Bacteria 623
397 Ga0207660_10000711 3300025917 Bacteria 22172
398 Ga0207660_10002701 3300025917 Bacteria 11629
399 Ga0207660_10005238 3300025917 Bacteria 8424
400 Ga0207660_10156919 3300025917 Bacteria 1752
401 Ga0207660_10159858 3300025917 Bacteria 1737
402 Ga0207660_10367846 3300025917 Bacteria 1154
403 Ga0207660_10509129 3300025917 Bacteria 977
404 Ga0207657_10000133 3300025919 Bacteria 75282
405 Ga0207657_10000267 3300025919 Bacteria 55426
406 Ga0207657_10005242 3300025919 Bacteria 13581
407 Ga0207657_10005850 3300025919 Bacteria 12810
408 Ga0207657_10008846 3300025919 Bacteria 10185
409 Ga0207657_10054657 3300025919 Bacteria 3452
410 Ga0207657_10092503 3300025919 Bacteria 2520
411 Ga0207657_10124942 3300025919 Bacteria 2114
412 Ga0207657_10294401 3300025919 Bacteria 1287
413 Ga0207649_10000378 3300025920 Bacteria 33311
414 Ga0207649_10031381 3300025920 Bacteria 3157
415 Ga0207649_10191138 3300025920 Bacteria 1440
416 Ga0207649_10252189 3300025920 Bacteria 1271
417 Ga0207649_10352801 3300025920 Bacteria 1089
418 Ga0207649_10442940 3300025920 Bacteria 979
419 Ga0207649_10465146 3300025920 Unclassified 957
420 Ga0207649_10487309 3300025920 Bacteria 936
421 Ga0207649_10523691 3300025920 Bacteria 904
422 Ga0207652_10041849 3300025921 Bacteria 3897
423 Ga0207652_10066873 3300025921 Bacteria 3115
424 Ga0207652_10723332 3300025921 Bacteria 887
425 Ga0207652_10760263 3300025921 Bacteria 862
426 Ga0207652_10788659 3300025921 Unclassified 844
427 Ga0207681_10012674 3300025923 Bacteria 5205
428 Ga0207681_10042342 3300025923 Bacteria 3042
429 Ga0207694_10001964 3300025924 Bacteria 17016
430 Ga0207694_10061732 3300025924 Bacteria 2917
431 Ga0207694_10137561 3300025924 Bacteria 1963
432 Ga0207694_10165810 3300025924 Bacteria 1787
433 Ga0207650_10010511 3300025925 Bacteria 6348
434 Ga0207650_10207863 3300025925 Bacteria 1571
435 Ga0207659_10051002 3300025926 Bacteria 2941
436 Ga0207687_10000688 3300025927 Bacteria 22793
437 Ga0207687_10147036 3300025927 Bacteria 1794
438 Ga0207664_10442792 3300025929 Bacteria 1159
439 Ga0207664_10509144 3300025929 Bacteria 1078
440 Ga0207644_10015617 3300025931 Bacteria 5100
441 Ga0207644_10079499 3300025931 Bacteria 2419
442 Ga0207644_10089244 3300025931 Bacteria 2294
443 Ga0207690_10000080 3300025932 Bacteria 82082
444 Ga0207690_10001597 3300025932 Bacteria 14142
445 Ga0207690_10004642 3300025932 Bacteria 8126
446 Ga0207690_10007944 3300025932 Bacteria 6299
447 Ga0207690_10045680 3300025932 Bacteria 2895
448 Ga0207690_10095329 3300025932 Bacteria 2113
449 Ga0207690_10193393 3300025932 Bacteria 1540
450 Ga0207690_10207875 3300025932 Bacteria 1491
451 Ga0207690_10340231 3300025932 Bacteria 1184
452 Ga0207690_10805864 3300025932 Bacteria 776
453 Ga0207706_10000159 3300025933 Bacteria 75284
454 Ga0207706_10000426 3300025933 Bacteria 45291
455 Ga0207706_10001767 3300025933 Bacteria 21221
456 Ga0207706_10003045 3300025933 Bacteria 16158
457 Ga0207706_10040717 3300025933 Bacteria 4119
458 Ga0207706_10051732 3300025933 Bacteria 3627
459 Ga0207686_10539801 3300025934 Bacteria 910
460 Ga0207709_10193898 3300025935 Bacteria 1445
461 Ga0207709_10336057 3300025935 Bacteria 1135
462 Ga0207670_11292471 3300025936 Bacteria 618
463 Ga0207669_10005541 3300025937 Bacteria 5675
464 Ga0207669_11768220 3300025937 Bacteria 528
465 Ga0207691_10013333 3300025940 Bacteria 7872
466 Ga0207691_10113343 3300025940 Bacteria 2409
467 Ga0207711_10000744 3300025941 Bacteria 31965
468 Ga0207711_10002355 3300025941 Bacteria 16937
469 Ga0207711_10003526 3300025941 Bacteria 13544
470 Ga0207711_10562316 3300025941 Bacteria 1064
471 Ga0207689_10000128 3300025942 Bacteria 64122
472 Ga0207689_10050102 3300025942 Bacteria 3444
473 Ga0207689_10070985 3300025942 Bacteria 2861
474 Ga0207661_10001549 3300025944 Bacteria 15638
475 Ga0207661_10036102 3300025944 Bacteria 3856
476 Ga0207661_10058294 3300025944 Bacteria 3107
477 Ga0207661_10088312 3300025944 Bacteria 2577
478 Ga0207661_10094886 3300025944 Bacteria 2493
479 Ga0207661_10458338 3300025944 Bacteria 1162
480 Ga0207661_10908919 3300025944 Bacteria 811
481 Ga0207679_10000155 3300025945 Bacteria 56504
482 Ga0207679_10021030 3300025945 Bacteria 4414
483 Ga0207679_10023302 3300025945 Bacteria 4231
484 Ga0207679_10212489 3300025945 Unclassified 1623
485 Ga0207679_10431160 3300025945 Bacteria 1165
486 Ga0207679_10979224 3300025945 Bacteria 775
487 Ga0207667_10017533 3300025949 Bacteria 8054
488 Ga0207667_10018898 3300025949 Bacteria 7709
489 Ga0207667_10037566 3300025949 Bacteria 5176
490 Ga0207667_10042322 3300025949 Bacteria 4842
491 Ga0207667_10053023 3300025949 Bacteria 4268
492 Ga0207667_10055114 3300025949 Bacteria 4180
493 Ga0207667_10118071 3300025949 Bacteria 2734
494 Ga0207667_10153295 3300025949 Bacteria 2371
495 Ga0207667_12109732 3300025949 Bacteria 522
496 Ga0207651_10001297 3300025960 Bacteria 11254
497 Ga0207651_10669219 3300025960 Bacteria 912
498 Ga0207651_11023569 3300025960 Bacteria 739
499 Ga0207712_10934758 3300025961 Bacteria 768
500 Ga0207668_10270781 3300025972 Bacteria 1388
501 Ga0207668_10547427 3300025972 Bacteria 1002
502 Ga0207668_10718534 3300025972 Bacteria 879
503 Ga0207640_10005165 3300025981 Bacteria 7099
504 Ga0207640_10037349 3300025981 Bacteria 3055
505 Ga0207640_10063004 3300025981 Bacteria 2462
506 Ga0207640_10067160 3300025981 Bacteria 2398
507 Ga0207640_10177192 3300025981 Bacteria 1595
508 Ga0207640_10314352 3300025981 Bacteria 1244
509 Ga0207640_10337021 3300025981 Bacteria 1207
510 Ga0207658_10012354 3300025986 Bacteria 5830
511 Ga0207658_10054963 3300025986 Bacteria 2948
512 Ga0207658_10218426 3300025986 Bacteria 1602
513 Ga0207677_10006405 3300026023 Bacteria 6455
514 Ga0207677_10635950 3300026023 Bacteria 940
515 Ga0207703_10003199 3300026035 Bacteria 13789
516 Ga0207703_10030128 3300026035 Bacteria 4286
517 Ga0207703_10030986 3300026035 Bacteria 4228
518 Ga0207639_10000137 3300026041 Bacteria 54378
519 Ga0207639_10001284 3300026041 Bacteria 16946
520 Ga0207639_10004961 3300026041 Bacteria 8966
521 Ga0207639_10048237 3300026041 Bacteria 3222
522 Ga0207639_10112034 3300026041 Bacteria 2226
523 Ga0207639_10653102 3300026041 Bacteria 973
524 Ga0207639_10722671 3300026041 Bacteria 925
525 Ga0207678_10000973 3300026067 Bacteria 26103
526 Ga0207678_10002271 3300026067 Bacteria 17395
527 Ga0207678_10004199 3300026067 Bacteria 12929
528 Ga0207678_10084825 3300026067 Bacteria 2709
529 Ga0207678_10155934 3300026067 Bacteria 1949
530 Ga0207678_10375665 3300026067 Bacteria 1228
531 Ga0207678_10543744 3300026067 Bacteria 1015
532 Ga0207702_10000246 3300026078 Bacteria 63201
533 Ga0207702_10196423 3300026078 Bacteria 1868
534 Ga0207702_10386791 3300026078 Bacteria 1346
535 Ga0207702_10552615 3300026078 Bacteria 1126
536 Ga0207702_10580725 3300026078 Bacteria 1098
537 Ga0207702_10874550 3300026078 Bacteria 890
538 Ga0207702_11263430 3300026078 Bacteria 732
539 Ga0207702_11419196 3300026078 Unclassified 688
540 Ga0207702_11755914 3300026078 Bacteria 613
541 Ga0207641_10001758 3300026088 Bacteria 20880
542 Ga0207641_10061282 3300026088 Bacteria 3208
543 Ga0207641_10063990 3300026088 Bacteria 3143
544 Ga0207648_10003309 3300026089 Bacteria 16928
545 Ga0207648_10239230 3300026089 Bacteria 1616
546 Ga0207676_10000220 3300026095 Bacteria 49329
547 Ga0207676_10005619 3300026095 Bacteria 8874
548 Ga0207676_10009270 3300026095 Bacteria 7002
549 Ga0207676_10015190 3300026095 Bacteria 5554
550 Ga0207674_10000827 3300026116 Bacteria 40278
551 Ga0207674_10004899 3300026116 Bacteria 16018
552 Ga0207674_10012242 3300026116 Bacteria 9595
553 Ga0207674_10017536 3300026116 Bacteria 7811
554 Ga0207675_100055033 3300026118 Bacteria 3712
555 Ga0207675_100437483 3300026118 Bacteria 1294
556 Ga0207683_11250536 3300026121 Bacteria 688
557 Ga0207698_10000421 3300026142 Bacteria 24394
558 Ga0207698_10001565 3300026142 Bacteria 13341
559 Ga0207698_10001619 3300026142 Bacteria 13098
560 Ga0207698_10006275 3300026142 Bacteria 7398
561 Ga0207698_10008966 3300026142 Bacteria 6348
562 Ga0207698_10013342 3300026142 Bacteria 5417
563 Ga0207698_10059370 3300026142 Bacteria 2970
564 Ga0207698_10067580 3300026142 Bacteria 2819
565 Ga0207698_10072205 3300026142 Bacteria 2743
566 Ga0207698_10083651 3300026142 Bacteria 2583
567 Ga0207698_10148606 3300026142 Bacteria 2030
568 Ga0207698_10211701 3300026142 Bacteria 1744
569 Ga0207698_10506316 3300026142 Bacteria 1176
570 Ga0207698_11039440 3300026142 Bacteria 831
571 Ga0209983_1029422 3300027665 Bacteria 1168
572 Ga0209974_10052186 3300027876 Bacteria 1376
573 Ga0209974_10132559 3300027876 Bacteria 889
574 Ga0268266_10044669 3300028379 Bacteria 3787
575 Ga0268266_10044928 3300028379 Bacteria 3777
576 Ga0268266_11561860 3300028379 Unclassified 635
577 Ga0268265_10022231 3300028380 Bacteria 4453
578 Ga0268265_10054802 3300028380 Bacteria 3027
579 Ga0268265_10091343 3300028380 Bacteria 2435
580 Ga0268264_10006398 3300028381 Bacteria 9922
581 Ga0268264_10097034 3300028381 Bacteria 2554
582 Ga0268264_10563890 3300028381 Unclassified 1118
583 Ga0268264_10588828 3300028381 Bacteria 1095
584 Ga0307408_100080001 3300031548 Bacteria 2440
585 Ga0307408_100292496 3300031548 Bacteria 1361
586 Ga0307405_11919848 3300031731 Bacteria 528
587 Ga0307413_10335602 3300031824 Bacteria 1160
588 Ga0307413_12152347 3300031824 Unclassified 505
589 Ga0307410_10091123 3300031852 Bacteria 2164
590 Ga0307406_10057541 3300031901 Bacteria 2494
591 Ga0307407_10424373 3300031903 Bacteria 959
592 Ga0307409_100110175 3300031995 Bacteria 2307
593 Ga0307409_100363706 3300031995 Bacteria 1369
594 Ga0307409_101885542 3300031995 Bacteria 627
595 Ga0307409_101932378 3300031995 Bacteria 620
596 Ga0307416_100200678 3300032002 Bacteria 1892
597 Ga0307416_100343055 3300032002 Bacteria 1508
598 Ga0307414_11035571 3300032004 Bacteria 756
599 Ga0307414_11188522 3300032004 Bacteria 706
600 Ga0307411_10079042 3300032005 Bacteria 2257
601 Ga0307415_100099528 3300032126 Bacteria 2128
602 Ga0307415_100616182 3300032126 Bacteria 968
603 Ga0373928_0171963 3300035084 Unclassified 611
604 Ga0373951_0008212 3300035091 Bacteria 2364
605 Ga0373923_0047268 3300035111 Bacteria 1793
606 Ga0373954_0085213 3300035118 Bacteria 1513
607 Ga0373956_0156274 3300035119 Bacteria 1074
608 Ga0373960_0161607 3300035121 Unclassified 771
609 Ga0373955_1028398 3300035172 Bacteria 507
610 Ga0373962_0121808 3300035242 Bacteria 832
611 Ga0373931_0028286 3300035691 Bacteria 2868
612 Ga0373935_0309818 3300035692 Bacteria 1118
613 Ga0373937_0008086 3300036401 Bacteria 9130
614 Ga0395899_0001906 3300037312 Bacteria 17205
615 Ga0395899_0015290 3300037312 Bacteria 5848
616 Ga0395899_0033784 3300037312 Bacteria 3841
617 Ga0395899_0041859 3300037312 Bacteria 3421
618 Ga0395899_0099675 3300037312 Bacteria 2098
619 Ga0395899_0103209 3300037312 Bacteria 2057
620 Ga0395899_0106354 3300037312 Bacteria 2020
621 Ga0395899_0149902 3300037312 Bacteria 1653
622 Ga0395899_0270210 3300037312 Bacteria 1160
623 Ga0395899_0362165 3300037312 Bacteria 967
624 Ga0395899_0442582 3300037312 Bacteria 852
625 Ga0395899_0498246 3300037312 Unclassified 790
626 Ga0395899_0824625 3300037312 Bacteria 571
627 Ga0395900_0000447 3300037418 Bacteria 59069
628 Ga0395900_0055653 3300037418 Bacteria 4073
629 Ga0395900_0070117 3300037418 Bacteria 3603
630 Ga0395900_0079680 3300037418 Bacteria 3365
631 Ga0395900_0173564 3300037418 Bacteria 2193
632 Ga0395900_0239111 3300037418 Bacteria 1822
633 Ga0395900_0253231 3300037418 Bacteria 1761
634 Ga0395900_0315078 3300037418 Bacteria 1546
635 Ga0395900_0412256 3300037418 Bacteria 1313
636 Ga0395900_0442238 3300037418 Bacteria 1257
637 Ga0395900_0526478 3300037418 Bacteria 1129
638 Ga0395900_0544897 3300037418 Bacteria 1105
639 Ga0395900_0833937 3300037418 Bacteria 848
640 Ga0395900_0899189 3300037418 Unclassified 809
641 Ga0395900_1033061 3300037418 Bacteria 741
642 Ga0395898_0011697 3300037466 Bacteria 9100
643 Ga0395898_0083259 3300037466 Bacteria 3083
644 Ga0395898_0088326 3300037466 Bacteria 2984
645 Ga0395898_0110666 3300037466 Bacteria 2632
646 Ga0395898_0111874 3300037466 Bacteria 2617
647 Ga0395898_0180232 3300037466 Bacteria 2019
648 Ga0395898_0629625 3300037466 Unclassified 1015
649 Ga0395898_0720986 3300037466 Bacteria 939
650 Ga0395898_1740063 3300037466 Bacteria 545
651 Ga0395905_0000187 3300037471 Bacteria 98895
652 Ga0395905_0004624 3300037471 Bacteria 14237
653 Ga0395905_0019955 3300037471 Bacteria 6351
654 Ga0395905_0078505 3300037471 Bacteria 3093
655 Ga0395905_0084520 3300037471 Bacteria 2973
656 Ga0395905_0226697 3300037471 Bacteria 1748
657 Ga0395905_0246156 3300037471 Bacteria 1670
658 Ga0395905_0340970 3300037471 Bacteria 1390
659 Ga0395905_0377867 3300037471 Bacteria 1310
660 Ga0395905_0403715 3300037471 Bacteria 1262
661 Ga0395905_1004132 3300037471 Bacteria 737
662 Ga0395905_1006643 3300037471 Bacteria 736
663 Ga0395905_1111291 3300037471 Bacteria 694
664 Ga0395905_1329505 3300037471 Unclassified 622
665 Ga0395905_1769107 3300037471 Bacteria 523
666 Ga0395901_0000324 3300038443 Bacteria 59134
667 Ga0395901_0032370 3300038443 Bacteria 5395
668 Ga0395901_0043378 3300038443 Bacteria 4666
669 Ga0395901_0056287 3300038443 Bacteria 4090
670 Ga0395901_0115251 3300038443 Bacteria 2823
671 Ga0395901_0378893 3300038443 Bacteria 1456
672 Ga0395901_0726547 3300038443 Bacteria 988
673 Ga0395901_1274975 3300038443 Bacteria 697
674 Ga0395901_1502295 3300038443 Bacteria 629
675 Ga0466966_0196540 3300044684 Bacteria 1221
676 Ga0466961_0065766 3300044693 Bacteria 2304
677 Ga0466963_0004598 3300044694 Bacteria 8035
678 Ga0466963_0005117 3300044694 Bacteria 7660
679 Ga0466963_0039353 3300044694 Bacteria 3096
680 Ga0466963_0124686 3300044694 Bacteria 1775
681 Ga0466963_0242665 3300044694 Bacteria 1264
682 Ga0466964_0022607 3300044706 Bacteria 2442
683 Ga0453684_0360581 3300044712 Bacteria 1637
684 Ga0466971_0062393 3300044719 Bacteria 1686
685 Ga0466971_0400063 3300044719 Bacteria 669
686 Ga0466970_0105760 3300044765 Unclassified 1535
687 Ga0466957_0009743 3300044842 Bacteria 5487
688 Ga0466957_0095693 3300044842 Bacteria 1865
689 Ga0466957_0143882 3300044842 Bacteria 1538
690 Ga0466959_0030022 3300045049 Bacteria 4027
691 Ga0466959_0267248 3300045049 Bacteria 1176
692 Ga0466958_0001186 3300045836 Bacteria 12153
693 Ga0466958_0013790 3300045836 Bacteria 4608
694 Ga0466958_0118416 3300045836 Bacteria 1657
695 Ga0466967_0014760 3300045976 Bacteria 6103
696 Ga0466967_0016917 3300045976 Bacteria 5767
697 Ga0466967_0041146 3300045976 Bacteria 3982
698 Ga0466967_0043652 3300045976 Bacteria 3883
699 Ga0466967_0075882 3300045976 Bacteria 3022
700 Ga0466967_0098890 3300045976 Bacteria 2664
701 Ga0466967_0117896 3300045976 Bacteria 2448
702 Ga0466967_1286798 3300045976 Bacteria 728
703 Ga0495584_0345244 3300046491 Bacteria 756
704 Ga0495668_0273738 3300046616 Bacteria 925
705 Ga0495623_0155323 3300046679 Bacteria 1349
706 Ga0495669_0067032 3300046684 Bacteria 1631
707 Ga0496100_0177685 3300048903 Bacteria 1538
708 Ga0496101_0012991 3300048904 Bacteria 5570
709 Ga0496102_0134653 3300048905 Bacteria 2315
710 Ga0496103_0067103 3300048906 Bacteria 2240
711 Ga0496103_0421365 3300048906 Bacteria 857
712 Ga0496105_0371655 3300048908 Bacteria 1139
713 Ga0496106_0022698 3300048909 Bacteria 4663
714 Ga0496106_0229494 3300048909 Bacteria 1482
715 Ga0496107_0004256 3300048910 Bacteria 9679
716 Ga0496107_0346012 3300048910 Bacteria 1106
717 Ga0496108_0025939 3300048911 Bacteria 4833
718 Ga0496108_0897410 3300048911 Bacteria 761
719 Ga0496109_0017833 3300048912 Bacteria 6228
720 Ga0496109_0269210 3300048912 Bacteria 1605
721 Ga0496109_0432629 3300048912 Bacteria 1243
722 Ga0496110_0005528 3300048913 Bacteria 9921
723 Ga0496110_0543461 3300048913 Bacteria 1056
724 Ga0496111_0021519 3300048914 Bacteria 4505
725 Ga0496111_0546362 3300048914 Bacteria 851
726 Ga0496112_0006261 3300048915 Bacteria 10431
727 Ga0496113_0423362 3300048916 Bacteria 1069
728 Ga0501067_0031805 3300049583 Bacteria 2928
729 Ga0501070_0446862 3300049586 Bacteria 1042
730 Ga0501074_0187914 3300049590 Bacteria 1473
731 Ga0501233_025411 3300049668 Unclassified 1302
732 Ga0501080_0094630 3300049742 Bacteria 2774
733 Ga0501270_050416 3300049767 Bacteria 753
734 nmdc:mga0rr50_510936_c1 3300050513 Bacteria 1022
735 nmdc:mga08x19_559351_c1 3300050514 Bacteria 809
736 Ga0587088_093176 3300059508 Unclassified 663
737 Ga0587067_091100 3300059640 Unclassified 691
738 Ga0466962_0024643 3300061719 Bacteria 2889
739 Ga0530510_0772873 3300061734 Unclassified 733
740 Ga0070714_100468768
741 MBSR1b_contig_5802081
742 JGI24752J21851_1042724
743 JGI24740J21852_10001279
744 JGI24740J21852_10124572
745 JGI24739J22299_10000632
746 JGI24739J22299_10008617
747 JGI24737J22298_10000103
748 JGI24737J22298_10017157
749 JGI24735J21928_10019965
750 JGI24738J21930_10000018
751 JGI24738J21930_10008304
752 Ga0065712_10040760
753 Ga0065715_10340560
754 Ga0065715_10584272
755 Ga0070658_10000107
756 Ga0070658_10009613
757 Ga0070658_10019253
758 Ga0070658_10019568
759 Ga0070658_10033380
760 Ga0070658_10060655
761 Ga0070658_10076497
762 Ga0070658_10398910
763 Ga0070658_11268895
764 Ga0070676_10002531
765 Ga0070676_10027239
766 Ga0070676_10036742
767 Ga0070676_10908951
768 Ga0070683_100001635
769 Ga0070683_100006411
770 Ga0070683_100028335
771 Ga0070683_100062139
772 Ga0070683_100062612
773 Ga0070683_100131879
774 Ga0070683_100301837
775 Ga0070683_100514835
776 Ga0070683_100870353
777 Ga0070690_100026541
778 Ga0070690_100902800
779 Ga0070670_100014652
780 Ga0070670_100266583
781 Ga0070670_101822775
782 Ga0070677_10405993
783 Ga0068869_100003378
784 Ga0068869_100667997
785 Ga0070666_10001184
786 Ga0070666_10713713
787 Ga0070680_100000477
788 Ga0070680_100002652
789 Ga0070680_100004694
790 Ga0070680_100006732
791 Ga0070680_100008676
792 Ga0070680_100048693
793 Ga0070680_100132389
794 Ga0070680_100589438
795 Ga0070680_100711197
796 Ga0070682_100006724
797 Ga0070682_100192650
798 Ga0070682_100382896
799 Ga0068868_100000972
800 Ga0068868_100343657
801 Ga0070660_100000861
802 Ga0070660_100003065
803 Ga0070660_100003086
804 Ga0070660_100011318
805 Ga0070660_100025166
806 Ga0070660_100033421
807 Ga0070660_100034397
808 Ga0070660_100034860
809 Ga0070660_100748122
810 Ga0070660_100786605
811 Ga0070689_100017523
812 Ga0070691_10256308
813 Ga0070687_100037451
814 Ga0070661_100000101
815 Ga0070661_100004927
816 Ga0070661_100005038
817 Ga0070661_100055931
818 Ga0070661_100131409
819 Ga0070661_100187165
820 Ga0070661_100232893
821 Ga0070661_100612791
822 Ga0070692_10003217
823 Ga0070692_10016353
824 Ga0070692_10082450
825 Ga0070692_10083589
826 Ga0070692_10130734
827 Ga0070668_100008284
828 Ga0070668_100038015
829 Ga0070668_101253443
830 Ga0070669_100000613
831 Ga0070669_100016981
832 Ga0070669_100084035
833 Ga0070669_100653472
834 Ga0070669_101138821
835 Ga0070675_100073493
836 Ga0070675_100360257
837 Ga0070671_100000533
838 Ga0070671_100014143
839 Ga0070671_100030078
840 Ga0070671_101046362
841 Ga0070674_101294478
842 Ga0070673_100003805
843 Ga0070673_100057067
844 Ga0070673_100308646
845 Ga0070659_100000045
846 Ga0070659_100016514
847 Ga0070659_100057730
848 Ga0070659_100059707
849 Ga0070659_100154086
850 Ga0070659_100202596
851 Ga0070659_100219296
852 Ga0070659_100259405
853 Ga0070659_100702014
854 Ga0070659_100989752
855 Ga0070659_101062650
856 Ga0070667_100001174
857 Ga0070667_100079689
858 Ga0070667_100413617
859 Ga0070667_100601984
860 Ga0070714_100172953
861 Ga0070714_101059704
862 Ga0070713_101767878
863 Ga0070694_100005710
864 Ga0070694_101381431
865 Ga0070663_100000549
866 Ga0070663_100047213
867 Ga0070663_100180609
868 Ga0070663_100322178
869 Ga0070663_100456936
870 Ga0070662_100000036
871 Ga0070662_100015155
872 Ga0070662_100026980
873 Ga0070662_100068699
874 Ga0070662_100283452
875 Ga0070662_101925569
876 Ga0070681_10004074
877 Ga0070681_10023867
878 Ga0070681_10081032
879 Ga0070681_10165930
880 Ga0070681_10338619
881 Ga0070681_10705275
882 Ga0070681_11014010
883 Ga0070681_11538171
884 Ga0068867_100001501
885 Ga0068867_101293752
886 Ga0070685_10016844
887 Ga0070679_100066466
888 Ga0070679_100106227
889 Ga0070679_100181881
890 Ga0070679_100189064
891 Ga0070679_100472562
892 Ga0070684_100027913
893 Ga0070684_100305960
894 Ga0070684_100347638
895 Ga0070684_100510099
896 Ga0068853_100000059
897 Ga0068853_100000570
898 Ga0068853_100032863
899 Ga0068853_100089942
900 Ga0068853_100447637
901 Ga0068853_100638202
902 Ga0070672_100000866
903 Ga0070672_100120352
904 Ga0070686_100772757
905 Ga0070696_100042737
906 Ga0070693_100000361
907 Ga0070693_100092887
908 Ga0070665_100004200
909 Ga0070665_100062768
910 Ga0070665_100795186
911 Ga0068855_100003767
912 Ga0068855_100010268
913 Ga0068855_100021027
914 Ga0068855_100058235
915 Ga0068855_100210192
916 Ga0068855_100988817
917 Ga0070664_100000027
918 Ga0070664_100007309
919 Ga0070664_100014989
920 Ga0070664_100184030
921 Ga0070664_100191805
922 Ga0070664_100379554
923 Ga0070664_101123983
924 Ga0068857_100006503
925 Ga0068857_100027425
926 Ga0068857_100031864
927 Ga0068857_100158885
928 Ga0068857_100209968
929 Ga0068857_101898123
930 Ga0068854_100014971
931 Ga0068854_100031718
932 Ga0068854_100049234
933 Ga0068854_100064635
934 Ga0068854_100077907
935 Ga0068854_100173258
936 Ga0068854_100189781
937 Ga0068854_100248935
938 Ga0068856_100000705
939 Ga0068856_100112245
940 Ga0068856_100177026
941 Ga0068856_100844405
942 Ga0068856_100961209
943 Ga0068856_101446059
944 Ga0068856_102281372
945 Ga0068856_102461425
946 Ga0068852_100000433
947 Ga0068852_100002112
948 Ga0068852_100004730
949 Ga0068852_100005166
950 Ga0068852_100009994
951 Ga0068852_100012833
952 Ga0068852_100021917
953 Ga0068852_100028840
954 Ga0068852_100038267
955 Ga0068852_100199101
956 Ga0068852_100293902
957 Ga0068852_100449243
958 Ga0068852_101047860
959 Ga0068859_100001592
960 Ga0068859_100004210
961 Ga0068859_100186961
962 Ga0068859_100505209
963 Ga0068864_100000247
964 Ga0068864_100008545
965 Ga0068864_100018914
966 Ga0068864_100081590
967 Ga0068866_10126483
968 Ga0068866_10525938
969 Ga0068861_100180793
970 Ga0068861_100355085
971 Ga0068851_10020047
972 Ga0068851_10062018
973 Ga0068870_10010268
974 Ga0068870_10988314
975 Ga0068863_100001653
976 Ga0068863_100069143
977 Ga0068863_100234963
978 Ga0068858_100006759
979 Ga0068858_100017221
980 Ga0068858_100022399
981 Ga0068860_100021537
982 Ga0068860_100027958
983 Ga0068860_101165869
984 Ga0068862_100006024
985 Ga0068862_100254750
986 Ga0068862_101192545
987 Ga0097621_100026649
988 Ga0097621_100219024
989 Ga0097621_101420964
990 Ga0068871_100070496
991 Ga0097620_100001592
992 Ga0097620_100004210
993 Ga0097620_100186953
994 Ga0097620_100505223
995 Ga0105240_10027015
996 Ga0105240_10126852
997 Ga0105240_10379048
998 Ga0105245_10000128
999 Ga0105245_10276026
1000 Ga0114129_10896631
1001 Ga0105243_10064347
1002 Ga0105243_10105180
1003 Ga0105243_10759863
1004 Ga0105243_10817439
1005 Ga0105241_10032667
1006 Ga0105241_10057413
1007 Ga0105241_10108525
1008 Ga0105241_10211699
1009 Ga0105242_10912682
1010 Ga0105248_10001451
1011 Ga0105248_10005525
1012 Ga0105248_10018193
1013 Ga0105248_11168005
1014 Ga0105237_10010769
1015 Ga0105238_10014228
1016 Ga0105238_10033353
1017 Ga0105238_10122248
1018 Ga0105238_10143149
1019 Ga0105249_10031339
1020 Ga0105249_10065744
1021 Ga0105249_11185354
1022 Ga0105239_10118334
1023 Ga0105239_10218160
1024 Ga0105239_10263900
1025 Ga0105246_10007663
1026 Ga0105246_10011642
1027 Ga0105246_11300917
1028 Ga0157373_10001921
1029 Ga0157373_10011033
1030 Ga0157373_10017730
1031 Ga0157373_10026865
1032 Ga0157373_10043735
1033 Ga0157373_10056049
1034 Ga0157373_10060140
1035 Ga0157373_10069117
1036 Ga0157373_10072216
1037 Ga0157373_10229162
1038 Ga0157373_10258216
1039 Ga0157373_10306653
1040 Ga0157373_10328756
1041 Ga0157373_10384756
1042 Ga0157373_10906988
1043 Ga0157371_10001392
1044 Ga0157371_10002958
1045 Ga0157371_10014993
1046 Ga0157371_10055697
1047 Ga0157371_10058590
1048 Ga0157371_10070710
1049 Ga0157371_10112985
1050 Ga0157371_10140542
1051 Ga0157371_10140622
1052 Ga0157371_10255184
1053 Ga0157371_10308430
1054 Ga0157371_10416876
1055 Ga0157371_10483958
1056 Ga0157370_10000686
1057 Ga0157370_10011108
1058 Ga0157370_10047926
1059 Ga0157370_10060505
1060 Ga0157370_10093074
1061 Ga0157370_10141565
1062 Ga0157370_10212917
1063 Ga0157370_10286151
1064 Ga0157370_11887769
1065 Ga0157369_10008678
1066 Ga0157369_10039739
1067 Ga0157369_10059618
1068 Ga0157369_10069335
1069 Ga0157369_10115743
1070 Ga0157369_10309826
1071 Ga0157369_10556221
1072 Ga0157369_10612319
1073 Ga0157369_12011390
1074 Ga0157369_12247206
1075 Ga0157374_10031240
1076 Ga0157378_10000396
1077 Ga0163162_10068534
1078 Ga0163162_10264490
1079 Ga0163162_10471362
1080 Ga0157372_10038042
1081 Ga0157372_10070283
1082 Ga0157372_10097641
1083 Ga0157372_10459311
1084 Ga0157372_11243324
1085 Ga0157372_11540970
1086 Ga0157375_10591103
1087 Ga0157375_10644106
1088 Ga0163163_10000187
1089 Ga0157380_11723141
1090 Ga0157377_11115750
1091 Ga0157379_10182906
1092 Ga0157379_10681921
1093 Ga0197907_10087473
1094 Ga0206356_11579705
1095 Ga0206354_10755474
1096 Ga0206354_11422423
1097 Ga0206353_10818459
1098 Ga0206353_11188791
1099 Ga0207697_10000059
1100 Ga0207656_10040854
1101 Ga0207656_10357895
1102 Ga0207682_10197253
1103 Ga0207642_10117116
1104 Ga0207688_10000721
1105 Ga0207680_10004748
1106 Ga0207680_10138471
1107 Ga0207647_10000968
1108 Ga0207647_10001381
1109 Ga0207647_10014849
1110 Ga0207647_10051788
1111 Ga0207645_10002144
1112 Ga0207645_10016875
1113 Ga0207645_10078345
1114 Ga0207643_10258584
1115 Ga0207705_10000086
1116 Ga0207705_10004131
1117 Ga0207705_10012975
1118 Ga0207705_10018733
1119 Ga0207705_10019330
1120 Ga0207705_10023122
1121 Ga0207705_10102751
1122 Ga0207705_10374960
1123 Ga0207705_10804549
1124 Ga0207654_10096895
1125 Ga0207654_10116145
1126 Ga0207654_10238303
1127 Ga0207654_10325720
1128 Ga0207707_10086364
1129 Ga0207707_10096969
1130 Ga0207707_10238320
1131 Ga0207707_11096466
1132 Ga0207695_10019721
1133 Ga0207695_10057499
1134 Ga0207671_10068265
1135 Ga0207671_11104349
1136 Ga0207660_10000711
1137 Ga0207660_10002701
1138 Ga0207660_10005238
1139 Ga0207660_10156919
1140 Ga0207660_10159858
1141 Ga0207660_10367846
1142 Ga0207660_10509129
1143 Ga0207657_10000133
1144 Ga0207657_10000267
1145 Ga0207657_10005242
1146 Ga0207657_10005850
1147 Ga0207657_10008846
1148 Ga0207657_10054657
1149 Ga0207657_10092503
1150 Ga0207657_10124942
1151 Ga0207657_10294401
1152 Ga0207649_10000378
1153 Ga0207649_10031381
1154 Ga0207649_10191138
1155 Ga0207649_10252189
1156 Ga0207649_10352801
1157 Ga0207649_10442940
1158 Ga0207649_10465146
1159 Ga0207649_10487309
1160 Ga0207649_10523691
1161 Ga0207652_10041849
1162 Ga0207652_10066873
1163 Ga0207652_10723332
1164 Ga0207652_10760263
1165 Ga0207652_10788659
1166 Ga0207681_10012674
1167 Ga0207681_10042342
1168 Ga0207694_10001964
1169 Ga0207694_10061732
1170 Ga0207694_10137561
1171 Ga0207694_10165810
1172 Ga0207650_10010511
1173 Ga0207650_10207863
1174 Ga0207659_10051002
1175 Ga0207687_10000688
1176 Ga0207687_10147036
1177 Ga0207664_10442792
1178 Ga0207664_10509144
1179 Ga0207644_10015617
1180 Ga0207644_10079499
1181 Ga0207644_10089244
1182 Ga0207690_10000080
1183 Ga0207690_10001597
1184 Ga0207690_10004642
1185 Ga0207690_10007944
1186 Ga0207690_10045680
1187 Ga0207690_10095329
1188 Ga0207690_10193393
1189 Ga0207690_10207875
1190 Ga0207690_10340231
1191 Ga0207690_10805864
1192 Ga0207706_10000159
1193 Ga0207706_10000426
1194 Ga0207706_10001767
1195 Ga0207706_10003045
1196 Ga0207706_10040717
1197 Ga0207706_10051732
1198 Ga0207686_10539801
1199 Ga0207709_10193898
1200 Ga0207709_10336057
1201 Ga0207670_11292471
1202 Ga0207669_10005541
1203 Ga0207669_11768220
1204 Ga0207691_10013333
1205 Ga0207691_10113343
1206 Ga0207711_10000744
1207 Ga0207711_10002355
1208 Ga0207711_10003526
1209 Ga0207711_10562316
1210 Ga0207689_10000128
1211 Ga0207689_10050102
1212 Ga0207689_10070985
1213 Ga0207661_10001549
1214 Ga0207661_10036102
1215 Ga0207661_10058294
1216 Ga0207661_10088312
1217 Ga0207661_10094886
1218 Ga0207661_10458338
1219 Ga0207661_10908919
1220 Ga0207679_10000155
1221 Ga0207679_10021030
1222 Ga0207679_10023302
1223 Ga0207679_10212489
1224 Ga0207679_10431160
1225 Ga0207679_10979224
1226 Ga0207667_10017533
1227 Ga0207667_10018898
1228 Ga0207667_10037566
1229 Ga0207667_10042322
1230 Ga0207667_10053023
1231 Ga0207667_10055114
1232 Ga0207667_10118071
1233 Ga0207667_10153295
1234 Ga0207667_12109732
1235 Ga0207651_10001297
1236 Ga0207651_10669219
1237 Ga0207651_11023569
1238 Ga0207712_10934758
1239 Ga0207668_10270781
1240 Ga0207668_10547427
1241 Ga0207668_10718534
1242 Ga0207640_10005165
1243 Ga0207640_10037349
1244 Ga0207640_10063004
1245 Ga0207640_10067160
1246 Ga0207640_10177192
1247 Ga0207640_10314352
1248 Ga0207640_10337021
1249 Ga0207658_10012354
1250 Ga0207658_10054963
1251 Ga0207658_10218426
1252 Ga0207677_10006405
1253 Ga0207677_10635950
1254 Ga0207703_10003199
1255 Ga0207703_10030128
1256 Ga0207703_10030986
1257 Ga0207639_10000137
1258 Ga0207639_10001284
1259 Ga0207639_10004961
1260 Ga0207639_10048237
1261 Ga0207639_10112034
1262 Ga0207639_10653102
1263 Ga0207639_10722671
1264 Ga0207678_10000973
1265 Ga0207678_10002271
1266 Ga0207678_10004199
1267 Ga0207678_10084825
1268 Ga0207678_10155934
1269 Ga0207678_10375665
1270 Ga0207678_10543744
1271 Ga0207702_10000246
1272 Ga0207702_10196423
1273 Ga0207702_10386791
1274 Ga0207702_10552615
1275 Ga0207702_10580725
1276 Ga0207702_10874550
1277 Ga0207702_11263430
1278 Ga0207702_11419196
1279 Ga0207702_11755914
1280 Ga0207641_10001758
1281 Ga0207641_10061282
1282 Ga0207641_10063990
1283 Ga0207648_10003309
1284 Ga0207648_10239230
1285 Ga0207676_10000220
1286 Ga0207676_10005619
1287 Ga0207676_10009270
1288 Ga0207676_10015190
1289 Ga0207674_10000827
1290 Ga0207674_10004899
1291 Ga0207674_10012242
1292 Ga0207674_10017536
1293 Ga0207675_100055033
1294 Ga0207675_100437483
1295 Ga0207683_11250536
1296 Ga0207698_10000421
1297 Ga0207698_10001565
1298 Ga0207698_10001619
1299 Ga0207698_10006275
1300 Ga0207698_10008966
1301 Ga0207698_10013342
1302 Ga0207698_10059370
1303 Ga0207698_10067580
1304 Ga0207698_10072205
1305 Ga0207698_10083651
1306 Ga0207698_10148606
1307 Ga0207698_10211701
1308 Ga0207698_10506316
1309 Ga0207698_11039440
1310 Ga0209983_1029422
1311 Ga0209974_10052186
1312 Ga0209974_10132559
1313 Ga0268266_10044669
1314 Ga0268266_10044928
1315 Ga0268266_11561860
1316 Ga0268265_10022231
1317 Ga0268265_10054802
1318 Ga0268265_10091343
1319 Ga0268264_10006398
1320 Ga0268264_10097034
1321 Ga0268264_10563890
1322 Ga0268264_10588828
1323 Ga0307408_100080001
1324 Ga0307408_100292496
1325 Ga0307405_11919848
1326 Ga0307413_10335602
1327 Ga0307413_12152347
1328 Ga0307410_10091123
1329 Ga0307406_10057541
1330 Ga0307407_10424373
1331 Ga0307409_100110175
1332 Ga0307409_100363706
1333 Ga0307409_101885542
1334 Ga0307409_101932378
1335 Ga0307416_100200678
1336 Ga0307416_100343055
1337 Ga0307414_11035571
1338 Ga0307414_11188522
1339 Ga0307411_10079042
1340 Ga0307415_100099528
1341 Ga0307415_100616182
1342 Ga0373928_0171963
1343 Ga0373951_0008212
1344 Ga0373923_0047268
1345 Ga0373954_0085213
1346 Ga0373956_0156274
1347 Ga0373960_0161607
1348 Ga0373955_1028398
1349 Ga0373962_0121808
1350 Ga0373931_0028286
1351 Ga0373935_0309818
1352 Ga0373937_0008086
1353 Ga0395899_0001906
1354 Ga0395899_0015290
1355 Ga0395899_0033784
1356 Ga0395899_0041859
1357 Ga0395899_0099675
1358 Ga0395899_0103209
1359 Ga0395899_0106354
1360 Ga0395899_0149902
1361 Ga0395899_0270210
1362 Ga0395899_0362165
1363 Ga0395899_0442582
1364 Ga0395899_0498246
1365 Ga0395899_0824625
1366 Ga0395900_0000447
1367 Ga0395900_0055653
1368 Ga0395900_0070117
1369 Ga0395900_0079680
1370 Ga0395900_0173564
1371 Ga0395900_0239111
1372 Ga0395900_0253231
1373 Ga0395900_0315078
1374 Ga0395900_0412256
1375 Ga0395900_0442238
1376 Ga0395900_0526478
1377 Ga0395900_0544897
1378 Ga0395900_0833937
1379 Ga0395900_0899189
1380 Ga0395900_1033061
1381 Ga0395898_0011697
1382 Ga0395898_0083259
1383 Ga0395898_0088326
1384 Ga0395898_0110666
1385 Ga0395898_0111874
1386 Ga0395898_0180232
1387 Ga0395898_0629625
1388 Ga0395898_0720986
1389 Ga0395898_1740063
1390 Ga0395905_0000187
1391 Ga0395905_0004624
1392 Ga0395905_0019955
1393 Ga0395905_0078505
1394 Ga0395905_0084520
1395 Ga0395905_0226697
1396 Ga0395905_0246156
1397 Ga0395905_0340970
1398 Ga0395905_0377867
1399 Ga0395905_0403715
1400 Ga0395905_1004132
1401 Ga0395905_1006643
1402 Ga0395905_1111291
1403 Ga0395905_1329505
1404 Ga0395905_1769107
1405 Ga0395901_0000324
1406 Ga0395901_0032370
1407 Ga0395901_0043378
1408 Ga0395901_0056287
1409 Ga0395901_0115251
1410 Ga0395901_0378893
1411 Ga0395901_0726547
1412 Ga0395901_1274975
1413 Ga0395901_1502295
1414 Ga0466966_0196540
1415 Ga0466961_0065766
1416 Ga0466963_0004598
1417 Ga0466963_0005117
1418 Ga0466963_0039353
1419 Ga0466963_0124686
1420 Ga0466963_0242665
1421 Ga0466964_0022607
1422 Ga0453684_0360581
1423 Ga0466971_0062393
1424 Ga0466971_0400063
1425 Ga0466970_0105760
1426 Ga0466957_0009743
1427 Ga0466957_0095693
1428 Ga0466957_0143882
1429 Ga0466959_0030022
1430 Ga0466959_0267248
1431 Ga0466958_0001186
1432 Ga0466958_0013790
1433 Ga0466958_0118416
1434 Ga0466967_0014760
1435 Ga0466967_0016917
1436 Ga0466967_0041146
1437 Ga0466967_0043652
1438 Ga0466967_0075882
1439 Ga0466967_0098890
1440 Ga0466967_0117896
1441 Ga0466967_1286798
1442 Ga0495584_0345244
1443 Ga0495668_0273738
1444 Ga0495623_0155323
1445 Ga0495669_0067032
1446 Ga0496100_0177685
1447 Ga0496101_0012991
1448 Ga0496102_0134653
1449 Ga0496103_0067103
1450 Ga0496103_0421365
1451 Ga0496105_0371655
1452 Ga0496106_0022698
1453 Ga0496106_0229494
1454 Ga0496107_0004256
1455 Ga0496107_0346012
1456 Ga0496108_0025939
1457 Ga0496108_0897410
1458 Ga0496109_0017833
1459 Ga0496109_0269210
1460 Ga0496109_0432629
1461 Ga0496110_0005528
1462 Ga0496110_0543461
1463 Ga0496111_0021519
1464 Ga0496111_0546362
1465 Ga0496112_0006261
1466 Ga0496113_0423362
1467 Ga0501067_0031805
1468 Ga0501070_0446862
1469 Ga0501074_0187914
1470 Ga0501233_025411
1471 Ga0501080_0094630
1472 Ga0501270_050416
1473 nmdc:mga0rr50_510936_c1
1474 nmdc:mga08x19_559351_c1
1475 Ga0587088_093176
1476 Ga0587067_091100
1477 Ga0466962_0024643
1478 Ga0530510_0772873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07370

DUF1489

Protein of unknown function (DUF1489)

19

146

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v47-assembly1.cif.gz_A crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.6371 33 93
7b8w-assembly1.cif.gz_A structure of limk1 kinase domain with allosteric inhibitor th-470 0.6314 64 82
2gks-assembly1.cif.gz_B crystal structure of the bi-functional atp sulfurylase-aps kinase from aquifex aeolicus, a chemolithotrophic thermophile 0.6008 33 88
1wjx-assembly1.cif.gz_A crystal sturucture of tt0801 from thermus thermophilus 0.5956 62 93
5y6c-assembly2.cif.gz_B crystal structure of zmasch s128a mutant protein from zymomonas mobilis 0.5683 5 106
ID Description Score Start End Superfamily
af_I6X7G8_41_118_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6915 32 84 2.40.50.140
af_Q9VRJ1_539_644_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.6666 63 82 2.40.30.130
af_A0A1D6KPV4_2_110_3.40.395.10 Alpha Beta;3-Layer(aba) Sandwich;Adenoviral Proteinase; Chain;Adenoviral Proteinase; Chain A 0.6649 111 132 3.40.395.10
af_A0A2R8QQC0_103_236_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.657 29 82 2.40.10.10
af_I6YC99_39_118_2.40.30.170 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain 0.6329 32 84 2.40.30.170
ID Description Score Start End GO Terms
AF-A0A2W5APN5-F1-model_v4 DUF1489 domain-containing protein 0.9696 1 88
AF-A0A2W5APN5-F1-model_v4 DUF1489 domain-containing protein 0.9588 1 88
AF-A0A2R7IW93-F1-model_v4 DUF1489 domain-containing protein 0.9273 3 109
AF-A0A6A4U4Y7-F1-model_v4 DUF1489 domain-containing protein 0.9265 1 108
AF-A0A520HM13-F1-model_v4 DUF1489 family protein 0.922 4 109

Map