F478486

General Info

Members Datasets Scaffolds Average Seq Length
739 406 1478 341

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000748|Ga0496104_0000748_9863_10957
Length 364
Sequence VQHDEVWRTWQSGYEADMSPAPLIGAVQARLAARSRWHLLEIAFWLAALSTYYLLPGKHLILTEIAILALFALSLDLILGYAGIISLGHAAFFGFGAYAAGLLAKHEIINEPLLALLASGLAAMLLGFVTSFLVLRGSDLTRIMVTLGVALVLRELANRYGWLTGGADGLQGVEMKPLLGLFRFDMFGRTAYAYSLATLFVLFLLARRIVNSPFGLSLQSIKGNPLRAAAVGIPVNRRLIAVYTLAAGYAGIAGALLTQTTAFASLDVFAFDRSADLLLVLIIGGTGYLYGGLIGAVLFKLMQDYISGLTPQYWPFWIGLLLVVIVMVGRERITAWTAPFRALAGRFDWRAQRSPAPAASELRS

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
97 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
344 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
345 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
348 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
349 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
352 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
355 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
356 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
357 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
358 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
359 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
360 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
365 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
366 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
367 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
368 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
369 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
376 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
377 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
378 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
379 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
380 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
381 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
382 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
383 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
384 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
385 2643221651 Afipia sp. Root123D2 Isolate Unclassified
386 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
387 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
388 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
389 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
390 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
391 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
392 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
393 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
394 2906610324
395 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
396 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
397 2922425934
398 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
399 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
400 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
401 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
402 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
403 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
404 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
405 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
406 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.04
Nodule 1.62
Rhizoplane 4.33
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0000748 3300048907 Bacteria 27756
2 2214544908 2209111006 Bacteria 36473
3 2214544909 2209111006 Bacteria 30927
4 ARcpr5oldR_c000009 3300000041 Bacteria 39838
5 ARSoilYngRDRAFT_c00030 3300000042 Bacteria 22085
6 ARcpr5yngRDRAFT_c000008 3300000043 Bacteria 39878
7 ARSoilOldRDRAFT_c000009 3300000044 Bacteria 45329
8 ARCol0oldRDRAFT_c00052 3300000045 Bacteria 9238
9 ARCol0yngRDRAFT_1000008 3300000652 Bacteria 45358
10 Ga0065165_1025302 3300005262 Bacteria 1978
11 Ga0065704_10077879 3300005289 Bacteria 4591
12 Ga0065715_10102289 3300005293 Bacteria 3128
13 Ga0070658_10077583 3300005327 Bacteria 2725
14 Ga0070658_10148980 3300005327 Bacteria 1958
15 Ga0070690_100068821 3300005330 Bacteria 2296
16 Ga0070670_100117365 3300005331 Bacteria 2295
17 Ga0068869_100037562 3300005334 Bacteria 3444
18 Ga0068869_100038739 3300005334 Bacteria 3400
19 Ga0070680_100074519 3300005336 Bacteria 2793
20 Ga0070680_100080719 3300005336 Bacteria 2683
21 Ga0070660_100016759 3300005339 Bacteria 5328
22 Ga0070689_100132248 3300005340 Bacteria 2001
23 Ga0070692_10003707 3300005345 Bacteria 6265
24 Ga0070668_100050190 3300005347 Bacteria 3211
25 Ga0070668_100087608 3300005347 Bacteria 2450
26 Ga0070668_100315129 3300005347 Bacteria 1315
27 Ga0070669_100053696 3300005353 Bacteria 2950
28 Ga0070669_100174280 3300005353 Bacteria 1679
29 Ga0070675_100036113 3300005354 Bacteria 4019
30 Ga0070675_100159475 3300005354 Bacteria 1939
31 Ga0070671_100105257 3300005355 Bacteria 2368
32 Ga0070671_100119054 3300005355 Bacteria 2222
33 Ga0070674_100095308 3300005356 Bacteria 2157
34 Ga0070674_100153091 3300005356 Bacteria 1742
35 Ga0070673_100107317 3300005364 Bacteria 2309
36 Ga0070688_100021126 3300005365 Bacteria 3798
37 Ga0070659_100054193 3300005366 Bacteria 3158
38 Ga0070667_100314760 3300005367 Bacteria 1411
39 Ga0070714_100003590 3300005435 Bacteria 11606
40 Ga0070714_100062465 3300005435 Bacteria 3202
41 Ga0070714_100075862 3300005435 Bacteria 2917
42 Ga0070713_100005913 3300005436 Bacteria 8412
43 Ga0070713_100157130 3300005436 Bacteria 2027
44 Ga0070710_10005874 3300005437 Bacteria 5860
45 Ga0070710_10076968 3300005437 Bacteria 1937
46 Ga0070711_100009019 3300005439 Bacteria 6124
47 Ga0070711_100237416 3300005439 Bacteria 1424
48 Ga0070700_100045666 3300005441 Bacteria 2703
49 Ga0070700_100058485 3300005441 Bacteria 2422
50 Ga0070694_100003181 3300005444 Bacteria 9793
51 Ga0070694_100032721 3300005444 Bacteria 3416
52 Ga0070708_100002558 3300005445 Bacteria 14069
53 Ga0070663_100106582 3300005455 Bacteria 2099
54 Ga0070662_100041573 3300005457 Bacteria 3280
55 Ga0070681_10025982 3300005458 Bacteria 5887
56 Ga0070681_10240638 3300005458 Bacteria 1723
57 Ga0068867_100081431 3300005459 Bacteria 2440
58 Ga0070685_10017349 3300005466 Bacteria 3852
59 Ga0070706_100168008 3300005467 Bacteria 2048
60 Ga0070679_100031732 3300005530 Bacteria 5222
61 Ga0070679_100085038 3300005530 Bacteria 3150
62 Ga0070679_100387610 3300005530 Bacteria 1344
63 Ga0070684_100053743 3300005535 Bacteria 3508
64 Ga0070697_100000384 3300005536 Bacteria 34537
65 Ga0068853_100144851 3300005539 Bacteria 2134
66 Ga0068853_100173547 3300005539 Bacteria 1952
67 Ga0070695_100001249 3300005545 Bacteria 13980
68 Ga0070665_100196258 3300005548 Bacteria 2019
69 Ga0070665_100213889 3300005548 Bacteria 1929
70 Ga0070665_100215998 3300005548 Bacteria 1918
71 Ga0068855_100089047 3300005563 Bacteria 3564
72 Ga0068855_100350353 3300005563 Bacteria 1627
73 Ga0070664_100318917 3300005564 Bacteria 1408
74 Ga0068857_100003812 3300005577 Bacteria 12691
75 Ga0068856_100005654 3300005614 Bacteria 12307
76 Ga0068852_100006751 3300005616 Bacteria 8326
77 Ga0068852_100165816 3300005616 Bacteria 2067
78 Ga0068859_100164886 3300005617 Bacteria 2295
79 Ga0068864_100064561 3300005618 Bacteria 3175
80 Ga0068861_100072652 3300005719 Bacteria 2670
81 Ga0068861_100128237 3300005719 Bacteria 2056
82 Ga0068861_100138453 3300005719 Bacteria 1984
83 Ga0068861_100359754 3300005719 Bacteria 1279
84 Ga0068851_10025805 3300005834 Bacteria 2884
85 Ga0068870_10095941 3300005840 Bacteria 1667
86 Ga0068863_100030297 3300005841 Bacteria 5168
87 Ga0068863_100084686 3300005841 Bacteria 3004
88 Ga0068863_100185389 3300005841 Bacteria 1998
89 Ga0068858_100094323 3300005842 Bacteria 2787
90 Ga0068860_100058132 3300005843 Bacteria 3676
91 Ga0068860_100082888 3300005843 Bacteria 3049
92 Ga0068860_100169022 3300005843 Bacteria 2111
93 Ga0068860_100568333 3300005843 Bacteria 1137
94 Ga0068862_100012376 3300005844 Bacteria 7054
95 Ga0081455_10014413 3300005937 Bacteria 7752
96 Ga0081455_10067468 3300005937 Bacteria 2981
97 Ga0081455_10106504 3300005937 Bacteria 2237
98 Ga0081538_10019025 3300005981 Bacteria 5127
99 Ga0081540_1004461 3300005983 Bacteria 10658
100 Ga0081540_1011197 3300005983 Bacteria 6015
101 Ga0081540_1025111 3300005983 Bacteria 3440
102 Ga0081540_1032788 3300005983 Bacteria 2830
103 Ga0081540_1033273 3300005983 Bacteria 2802
104 Ga0081540_1038259 3300005983 Bacteria 2530
105 Ga0081540_1076542 3300005983 Bacteria 1524
106 Ga0081539_10001561 3300005985 Bacteria 38000
107 Ga0081539_10047770 3300005985 Bacteria 2441
108 Ga0070717_10304670 3300006028 Bacteria 1417
109 Ga0075365_10019754 3300006038 Bacteria 4165
110 Ga0075365_10077934 3300006038 Bacteria 2240
111 Ga0075365_10129686 3300006038 Bacteria 1744
112 Ga0075365_10213384 3300006038 Bacteria 1353
113 Ga0075368_10001490 3300006042 Bacteria 7498
114 Ga0075363_100034602 3300006048 Bacteria 2638
115 Ga0075363_100114424 3300006048 Bacteria 1502
116 Ga0075364_10076323 3300006051 Bacteria 2211
117 Ga0070712_100081356 3300006175 Bacteria 2347
118 Ga0070712_100161900 3300006175 Bacteria 1728
119 Ga0070712_100229890 3300006175 Bacteria 1472
120 Ga0070712_100245181 3300006175 Bacteria 1429
121 Ga0075367_10013781 3300006178 Bacteria 4359
122 Ga0075367_10057476 3300006178 Bacteria 2313
123 Ga0075367_10101957 3300006178 Bacteria 1755
124 Ga0075366_10133110 3300006195 Bacteria 1501
125 Ga0075370_10089458 3300006353 Bacteria 1775
126 Ga0068871_100102734 3300006358 Bacteria 2396
127 Ga0075428_100001309 3300006844 Bacteria 26388
128 Ga0075428_100121145 3300006844 Bacteria 2849
129 Ga0075428_100171330 3300006844 Bacteria 2352
130 Ga0075430_100069691 3300006846 Bacteria 2950
131 Ga0075431_100000481 3300006847 Bacteria 33062
132 Ga0075431_100126203 3300006847 Bacteria 2640
133 Ga0075433_10008551 3300006852 Bacteria 8165
134 Ga0075434_100003619 3300006871 Bacteria 13794
135 Ga0075434_100038004 3300006871 Bacteria 4768
136 Ga0075434_100156626 3300006871 Bacteria 2297
137 Ga0075429_100004654 3300006880 Bacteria 11805
138 Ga0068865_100060263 3300006881 Bacteria 2657
139 Ga0068865_100366309 3300006881 Bacteria 1171
140 Ga0097620_100164883 3300006931 Bacteria 2295
141 Ga0075435_100006201 3300007076 Bacteria 8435
142 Ga0075435_100019548 3300007076 Bacteria 5176
143 Ga0075435_100206610 3300007076 Bacteria 1665
144 Ga0075435_100245840 3300007076 Unclassified 1522
145 Ga0099794_10047974 3300007265 Bacteria 2049
146 Ga0105250_10064284 3300009092 Bacteria 1478
147 Ga0105240_10007705 3300009093 Bacteria 15579
148 Ga0105240_10106573 3300009093 Bacteria 3399
149 Ga0105240_10279122 3300009093 Bacteria 1920
150 Ga0111539_10000242 3300009094 Bacteria 65417
151 Ga0111539_10002444 3300009094 Bacteria 24696
152 Ga0111539_10004586 3300009094 Bacteria 18056
153 Ga0111539_10012307 3300009094 Bacteria 10722
154 Ga0111539_10142590 3300009094 Bacteria 2805
155 Ga0105247_10065163 3300009101 Bacteria 2265
156 Ga0114129_10001244 3300009147 Bacteria 33939
157 Ga0114129_10028194 3300009147 Bacteria 7956
158 Ga0114129_10217729 3300009147 Bacteria 2578
159 Ga0105243_10276681 3300009148 Bacteria 1510
160 Ga0105248_10300875 3300009177 Bacteria 1806
161 Ga0105237_10004743 3300009545 Bacteria 15634
162 Ga0105237_10011260 3300009545 Bacteria 9463
163 Ga0105237_10038763 3300009545 Bacteria 4812
164 Ga0105237_10192052 3300009545 Bacteria 2042
165 Ga0105237_10211918 3300009545 Bacteria 1937
166 Ga0105238_10012649 3300009551 Bacteria 8517
167 Ga0105238_10183037 3300009551 Bacteria 2072
168 Ga0105239_10002642 3300010375 Bacteria 22634
169 Ga0105239_10186975 3300010375 Bacteria 2318
170 Ga0105239_10266730 3300010375 Bacteria 1925
171 Ga0105239_10285591 3300010375 Bacteria 1858
172 Ga0105239_10462756 3300010375 Bacteria 1439
173 Ga0105239_10774080 3300010375 Bacteria 1099
174 Ga0157316_1000560 3300012510 Bacteria 1996
175 Ga0157338_1000401 3300012515 Bacteria 2472
176 Ga0157370_10116311 3300013104 Bacteria 2498
177 Ga0157369_10020586 3300013105 Bacteria 7375
178 Ga0163162_10009887 3300013306 Bacteria 9276
179 Ga0157372_10236176 3300013307 Bacteria 2120
180 Ga0157375_10193901 3300013308 Bacteria 2186
181 Ga0157375_10416097 3300013308 Bacteria 1510
182 Ga0157375_10626012 3300013308 Bacteria 1234
183 Ga0163163_10054542 3300014325 Bacteria 3949
184 Ga0157380_10233589 3300014326 Bacteria 1653
185 Ga0157380_10311481 3300014326 Bacteria 1455
186 Ga0157380_10463318 3300014326 Bacteria 1221
187 Ga0157376_10057486 3300014969 Bacteria 3254
188 Ga0213875_10001946 3300021388 Bacteria 12777
189 Ga0209148_1000680 3300025254 Bacteria 28419
190 Ga0209148_1011702 3300025254 Bacteria 1624
191 Ga0209233_1005353 3300025261 Bacteria 4265
192 Ga0209455_1001796 3300025272 Bacteria 9023
193 Ga0209455_1005908 3300025272 Bacteria 3696
194 Ga0209564_1001387 3300025295 Bacteria 25238
195 Ga0209758_1004012 3300025297 Bacteria 12721
196 Ga0207656_10070261 3300025321 Bacteria 1554
197 Ga0207692_10000740 3300025898 Bacteria 11521
198 Ga0207692_10028228 3300025898 Bacteria 2652
199 Ga0207710_10013885 3300025900 Bacteria 3392
200 Ga0207688_10067947 3300025901 Bacteria 2017
201 Ga0207688_10126002 3300025901 Bacteria 1498
202 Ga0207699_10001145 3300025906 Bacteria 12548
203 Ga0207699_10004649 3300025906 Bacteria 6568
204 Ga0207699_10013798 3300025906 Bacteria 4146
205 Ga0207705_10263015 3300025909 Bacteria 1318
206 Ga0207684_10120684 3300025910 Bacteria 2247
207 Ga0207654_10039189 3300025911 Bacteria 2663
208 Ga0207707_10007605 3300025912 Bacteria 9443
209 Ga0207707_10051295 3300025912 Bacteria 3593
210 Ga0207695_10000029 3300025913 Bacteria 548364
211 Ga0207671_10003843 3300025914 Bacteria 14693
212 Ga0207671_10051209 3300025914 Bacteria 3059
213 Ga0207671_10091093 3300025914 Bacteria 2297
214 Ga0207671_10158494 3300025914 Bacteria 1752
215 Ga0207693_10001764 3300025915 Bacteria 18977
216 Ga0207693_10005866 3300025915 Bacteria 10193
217 Ga0207693_10105130 3300025915 Bacteria 2214
218 Ga0207693_10169760 3300025915 Bacteria 1718
219 Ga0207663_10229730 3300025916 Bacteria 1355
220 Ga0207660_10012306 3300025917 Bacteria 5595
221 Ga0207660_10123842 3300025917 Bacteria 1961
222 Ga0207657_10006868 3300025919 Bacteria 11742
223 Ga0207657_10018426 3300025919 Bacteria 6664
224 Ga0207657_10058011 3300025919 Bacteria 3334
225 Ga0207652_10006786 3300025921 Bacteria 9230
226 Ga0207646_10298813 3300025922 Bacteria 1455
227 Ga0207681_10051683 3300025923 Bacteria 2785
228 Ga0207694_10068569 3300025924 Bacteria 2770
229 Ga0207650_10019751 3300025925 Bacteria 4739
230 Ga0207650_10139902 3300025925 Bacteria 1902
231 Ga0207650_10228447 3300025925 Bacteria 1500
232 Ga0207650_10277173 3300025925 Bacteria 1364
233 Ga0207687_10056048 3300025927 Bacteria 2763
234 Ga0207687_10134808 3300025927 Bacteria 1866
235 Ga0207700_10083109 3300025928 Bacteria 2506
236 Ga0207700_10091964 3300025928 Bacteria 2398
237 Ga0207644_10079033 3300025931 Bacteria 2426
238 Ga0207706_10294162 3300025933 Bacteria 1415
239 Ga0207709_10228124 3300025935 Bacteria 1347
240 Ga0207670_10115558 3300025936 Bacteria 1941
241 Ga0207670_10265612 3300025936 Bacteria 1332
242 Ga0207669_10119204 3300025937 Bacteria 1787
243 Ga0207704_10096636 3300025938 Bacteria 1957
244 Ga0207665_10004098 3300025939 Bacteria 9720
245 Ga0207665_10073413 3300025939 Bacteria 2339
246 Ga0207691_10100142 3300025940 Bacteria 2587
247 Ga0207691_10111202 3300025940 Bacteria 2436
248 Ga0207689_10147766 3300025942 Bacteria 1936
249 Ga0207661_10007779 3300025944 Bacteria 7633
250 Ga0207661_10202993 3300025944 Bacteria 1744
251 Ga0207667_10193228 3300025949 Bacteria 2088
252 Ga0207651_10047835 3300025960 Bacteria 2887
253 Ga0207668_10109135 3300025972 Bacteria 2072
254 Ga0207658_10377322 3300025986 Bacteria 1241
255 Ga0207639_10104022 3300026041 Bacteria 2301
256 Ga0207639_10177493 3300026041 Bacteria 1809
257 Ga0207678_10123456 3300026067 Bacteria 2210
258 Ga0207678_10130761 3300026067 Bacteria 2141
259 Ga0207678_10191373 3300026067 Bacteria 1748
260 Ga0207708_10027237 3300026075 Bacteria 4327
261 Ga0207708_10230913 3300026075 Bacteria 1485
262 Ga0207702_10000334 3300026078 Bacteria 54042
263 Ga0207641_10183711 3300026088 Bacteria 1917
264 Ga0207648_10230769 3300026089 Bacteria 1646
265 Ga0207676_10136721 3300026095 Bacteria 2092
266 Ga0207676_10158025 3300026095 Bacteria 1961
267 Ga0207676_10229729 3300026095 Bacteria 1658
268 Ga0207674_10007361 3300026116 Bacteria 12820
269 Ga0207674_10104306 3300026116 Bacteria 2814
270 Ga0207675_100066896 3300026118 Bacteria 3359
271 Ga0207675_100103300 3300026118 Bacteria 2686
272 Ga0207675_100331152 3300026118 Bacteria 1488
273 Ga0207683_10056801 3300026121 Bacteria 3435
274 Ga0207683_10099932 3300026121 Bacteria 2590
275 Ga0207683_10182858 3300026121 Bacteria 1901
276 Ga0207698_10031186 3300026142 Bacteria 3844
277 Ga0207698_10113888 3300026142 Bacteria 2274
278 Ga0207698_10221195 3300026142 Bacteria 1711
279 Ga0207698_10398334 3300026142 Bacteria 1315
280 Ga0209813_10006277 3300027866 Bacteria 2932
281 Ga0209813_10037282 3300027866 Bacteria 1464
282 Ga0207428_10000666 3300027907 Bacteria 40250
283 Ga0207428_10006807 3300027907 Bacteria 10483
284 Ga0268266_10092507 3300028379 Bacteria 2653
285 Ga0268266_10312024 3300028379 Bacteria 1470
286 Ga0268265_10035005 3300028380 Bacteria 3665
287 Ga0268265_10070488 3300028380 Bacteria 2719
288 Ga0268264_10050111 3300028381 Bacteria 3476
289 Ga0268264_10146067 3300028381 Bacteria 2115
290 Ga0268264_10520398 3300028381 Bacteria 1163
291 Ga0265337_1008837 3300028556 Bacteria 3631
292 Ga0265326_10003930 3300028558 Bacteria 4822
293 Ga0265319_1004925 3300028563 Bacteria 6523
294 Ga0265334_10003506 3300028573 Bacteria 7112
295 Ga0265334_10043443 3300028573 Bacteria 1749
296 Ga0265318_10009701 3300028577 Bacteria 4222
297 Ga0265323_10001786 3300028653 Bacteria 10211
298 Ga0265336_10001310 3300028666 Bacteria 11611
299 Ga0307517_10000315 3300028786 Bacteria 84020
300 Ga0307515_10073332 3300028794 Bacteria 4602
301 Ga0307515_10178407 3300028794 Bacteria 2085
302 Ga0265338_10000013 3300028800 Bacteria 379065
303 Ga0265324_10006344 3300029957 Bacteria 4947
304 Ga0265330_10025004 3300031235 Bacteria 2708
305 Ga0265332_10061795 3300031238 Bacteria 1601
306 Ga0265328_10056929 3300031239 Bacteria 1435
307 Ga0265320_10018789 3300031240 Bacteria 3797
308 Ga0265325_10124477 3300031241 Bacteria 1240
309 Ga0265340_10006370 3300031247 Bacteria 6505
310 Ga0265340_10053192 3300031247 Bacteria 1955
311 Ga0307513_10138370 3300031456 Bacteria 2366
312 Ga0307513_10149521 3300031456 Bacteria 2247
313 Ga0307408_100334312 3300031548 Bacteria 1280
314 Ga0307508_10000419 3300031616 Bacteria 50420
315 Ga0307508_10145599 3300031616 Bacteria 1973
316 Ga0265314_10003890 3300031711 Bacteria 14201
317 Ga0265314_10011565 3300031711 Bacteria 7272
318 Ga0265314_10013863 3300031711 Bacteria 6487
319 Ga0265314_10094661 3300031711 Bacteria 1936
320 Ga0307516_10292556 3300031730 Bacteria 1307
321 Ga0307412_10179995 3300031911 Bacteria 1589
322 Ga0307416_100045120 3300032002 Bacteria 3468
323 Ga0307411_10176387 3300032005 Bacteria 1617
324 Ga0307415_100037417 3300032126 Bacteria 3189
325 Ga0307507_10083746 3300033179 Bacteria 2786
326 Ga0307510_10061243 3300033180 Bacteria 3861
327 Ga0373948_0000293 3300034817 Bacteria 6049
328 Ga0373950_0003832 3300034818 Bacteria 2180
329 Ga0373958_0000031 3300034819 Bacteria 14995
330 Ga0373938_0000049 3300034957 Bacteria 15338
331 Ga0373928_0000190 3300035084 Bacteria 11780
332 Ga0373929_0000140 3300035085 Bacteria 12362
333 Ga0373934_0000167 3300035086 Bacteria 23997
334 Ga0373934_0011751 3300035086 Bacteria 3298
335 Ga0373934_0030528 3300035086 Bacteria 2108
336 Ga0373940_0000013 3300035088 Bacteria 23710
337 Ga0373940_0045861 3300035088 Bacteria 1215
338 Ga0373949_0000214 3300035090 Bacteria 21912
339 Ga0373951_0001211 3300035091 Bacteria 6814
340 Ga0373952_0000349 3300035092 Bacteria 7787
341 Ga0373923_0101720 3300035111 Bacteria 1268
342 Ga0373923_0103354 3300035111 Bacteria 1259
343 Ga0373932_0000018 3300035112 Bacteria 53356
344 Ga0373936_0152623 3300035113 Bacteria 1002
345 Ga0373939_0006979 3300035114 Bacteria 2733
346 Ga0373939_0008368 3300035114 Bacteria 2535
347 Ga0373941_0000150 3300035115 Bacteria 12466
348 Ga0373953_0031220 3300035117 Bacteria 2071
349 Ga0373953_0037169 3300035117 Bacteria 1920
350 Ga0373954_0003678 3300035118 Bacteria 6531
351 Ga0373954_0031123 3300035118 Bacteria 2462
352 Ga0373954_0042470 3300035118 Bacteria 2120
353 Ga0373954_0055662 3300035118 Bacteria 1861
354 Ga0373954_0101043 3300035118 Bacteria 1391
355 Ga0373954_0123725 3300035118 Bacteria 1257
356 Ga0373956_0000005 3300035119 Bacteria 69067
357 Ga0373956_0006620 3300035119 Bacteria 4646
358 Ga0373957_0001547 3300035120 Bacteria 6270
359 Ga0373957_0067190 3300035120 Bacteria 1397
360 Ga0373957_0092503 3300035120 Bacteria 1203
361 Ga0373960_0000903 3300035121 Bacteria 6311
362 Ga0373943_0041548 3300035170 Bacteria 2224
363 Ga0373955_0001424 3300035172 Bacteria 10177
364 Ga0373955_0002275 3300035172 Bacteria 8339
365 Ga0373955_0021411 3300035172 Bacteria 3263
366 Ga0373955_0071714 3300035172 Bacteria 1938
367 Ga0373942_0021462 3300035207 Bacteria 1629
368 Ga0373961_0000824 3300035241 Bacteria 10539
369 Ga0373962_0000024 3300035242 Bacteria 39974
370 Ga0373962_0009867 3300035242 Bacteria 2372
371 Ga0373931_0000562 3300035691 Bacteria 15314
372 Ga0373931_0004504 3300035691 Bacteria 6370
373 Ga0373931_0005979 3300035691 Bacteria 5659
374 Ga0373931_0078422 3300035691 Bacteria 1817
375 Ga0373935_0100799 3300035692 Bacteria 1903
376 Ga0373935_0104823 3300035692 Bacteria 1869
377 Ga0373935_0165204 3300035692 Bacteria 1511
378 Ga0373927_0036155 3300035695 Bacteria 3212
379 Ga0373927_0041103 3300035695 Bacteria 2999
380 Ga0373927_0043981 3300035695 Bacteria 2890
381 Ga0373927_0045775 3300035695 Bacteria 2830
382 Ga0373933_0000447 3300035724 Bacteria 25787
383 Ga0373933_0000883 3300035724 Bacteria 18320
384 Ga0373933_0003022 3300035724 Bacteria 9384
385 Ga0373933_0111955 3300035724 Bacteria 1703
386 Ga0373947_0003071 3300035725 Bacteria 9940
387 Ga0373937_0000912 3300036401 Bacteria 25128
388 Ga0373937_0009273 3300036401 Bacteria 8543
389 Ga0373937_0033182 3300036401 Bacteria 4687
390 Ga0373937_0048714 3300036401 Bacteria 3879
391 Ga0373937_0085716 3300036401 Bacteria 2915
392 Ga0373937_0224272 3300036401 Bacteria 1769
393 Ga0373925_0005375 3300037068 Bacteria 9548
394 Ga0373925_0027216 3300037068 Bacteria 4187
395 Ga0373925_0063127 3300037068 Bacteria 2787
396 Ga0373925_0152117 3300037068 Bacteria 1818
397 Ga0373925_0152833 3300037068 Bacteria 1813
398 Ga0395900_0373119 3300037418 Bacteria 1396
399 Ga0395898_0037448 3300037466 Bacteria 4812
400 Ga0436364_0745728 3300037853 Bacteria 2696
401 Ga0436364_1405230 3300037853 Bacteria 14749
402 Ga0395901_0115780 3300038443 Bacteria 2816
403 Ga0436363_1563864 3300039450 Bacteria 1692
404 Ga0451577_0032136 3300042876 Bacteria 4730
405 Ga0466957_0061122 3300044842 Bacteria 2311
406 Ga0451576_0056628 3300045051 Bacteria 4099
407 Ga0495592_0002231 3300046454 Bacteria 13664
408 Ga0495603_0006560 3300046455 Bacteria 6983
409 Ga0495629_0016538 3300046459 Bacteria 5295
410 Ga0495629_0052697 3300046459 Bacteria 2847
411 Ga0495629_0187906 3300046459 Bacteria 1430
412 Ga0495638_0130778 3300046460 Bacteria 1474
413 Ga0495651_0000479 3300046462 Bacteria 30785
414 Ga0495651_0000878 3300046462 Bacteria 23362
415 Ga0495651_0050923 3300046462 Bacteria 3194
416 Ga0495651_0159960 3300046462 Bacteria 1614
417 Ga0495653_0000553 3300046463 Bacteria 28588
418 Ga0495653_0059837 3300046463 Bacteria 2888
419 Ga0495653_0099389 3300046463 Bacteria 2111
420 Ga0495582_0004249 3300046473 Bacteria 8054
421 Ga0495582_0037901 3300046473 Bacteria 2652
422 Ga0495582_0120779 3300046473 Bacteria 1476
423 Ga0495639_0001631 3300046475 Bacteria 10005
424 Ga0495664_0026645 3300046477 Bacteria 3367
425 Ga0495664_0032952 3300046477 Bacteria 3043
426 Ga0495664_0052678 3300046477 Bacteria 2419
427 Ga0495594_0001269 3300046499 Bacteria 13192
428 Ga0495594_0196110 3300046499 Bacteria 1151
429 Ga0495606_0001096 3300046507 Bacteria 38817
430 Ga0495608_0000376 3300046511 Bacteria 31189
431 Ga0495608_0033566 3300046511 Bacteria 3466
432 Ga0495628_0025647 3300046516 Bacteria 4815
433 Ga0495628_0066180 3300046516 Bacteria 2825
434 Ga0495628_0099405 3300046516 Bacteria 2247
435 Ga0495630_0035102 3300046517 Bacteria 3747
436 Ga0495631_0067290 3300046518 Bacteria 1550
437 Ga0495632_0112626 3300046519 Bacteria 1276
438 Ga0495648_0008150 3300046524 Bacteria 8272
439 Ga0495648_0008195 3300046524 Bacteria 8245
440 Ga0495666_0138835 3300046526 Bacteria 1134
441 Ga0495652_0006143 3300046529 Bacteria 11225
442 Ga0495652_0175332 3300046529 Bacteria 1651
443 Ga0495665_0001884 3300046531 Bacteria 11332
444 Ga0495640_0005971 3300046533 Bacteria 9656
445 Ga0495640_0016106 3300046533 Bacteria 5599
446 Ga0495587_0001125 3300046536 Bacteria 17493
447 Ga0495587_0010826 3300046536 Bacteria 5790
448 Ga0495587_0051041 3300046536 Bacteria 2447
449 Ga0495587_0101588 3300046536 Bacteria 1656
450 Ga0495645_0032323 3300046543 Bacteria 3816
451 Ga0495622_0025751 3300046557 Bacteria 2747
452 Ga0495667_0000294 3300046559 Bacteria 32145
453 Ga0495667_0037649 3300046559 Bacteria 3223
454 Ga0495668_0119443 3300046616 Bacteria 1442
455 Ga0495668_0125161 3300046616 Bacteria 1407
456 Ga0495625_0215253 3300046660 Bacteria 1261
457 Ga0495625_0222374 3300046660 Bacteria 1236
458 Ga0495635_0000880 3300046663 Bacteria 19715
459 Ga0495635_0011308 3300046663 Bacteria 6260
460 Ga0495635_0068116 3300046663 Bacteria 2441
461 Ga0495635_0102163 3300046663 Bacteria 1959
462 Ga0495588_0044701 3300046674 Bacteria 2269
463 Ga0495657_0021192 3300046675 Bacteria 4665
464 Ga0495657_0022609 3300046675 Bacteria 4501
465 Ga0495657_0064942 3300046675 Bacteria 2401
466 Ga0495657_0140439 3300046675 Bacteria 1506
467 Ga0495657_0185607 3300046675 Bacteria 1273
468 Ga0495599_0115695 3300046678 Bacteria 1668
469 Ga0495623_0001907 3300046679 Bacteria 13995
470 Ga0495623_0069237 3300046679 Bacteria 2199
471 Ga0495646_0010397 3300046680 Bacteria 5918
472 Ga0495646_0186549 3300046680 Bacteria 1135
473 Ga0495658_0023050 3300046683 Bacteria 3301
474 Ga0495658_0063701 3300046683 Bacteria 2122
475 Ga0495613_0009118 3300046689 Bacteria 7356
476 Ga0495613_0056174 3300046689 Bacteria 2891
477 Ga0495624_0008474 3300046690 Bacteria 7166
478 Ga0495600_0003489 3300046809 Bacteria 9244
479 Ga0495600_0047122 3300046809 Bacteria 2811
480 Ga0495604_0000972 3300047317 Bacteria 23909
481 Ga0495604_0078226 3300047317 Bacteria 2483
482 Ga0495674_0003482 3300047319 Bacteria 15299
483 Ga0495674_0009055 3300047319 Bacteria 9455
484 Ga0495672_0012238 3300047320 Bacteria 5999
485 Ga0495676_0158887 3300047321 Bacteria 1601
486 Ga0495680_0003955 3300047322 Bacteria 14330
487 Ga0495680_0048502 3300047322 Bacteria 3334
488 Ga0495680_0097745 3300047322 Bacteria 2191
489 Ga0495675_0009564 3300047444 Bacteria 6037
490 Ga0495675_0019173 3300047444 Bacteria 4346
491 Ga0495675_0020724 3300047444 Bacteria 4183
492 Ga0495675_0215880 3300047444 Bacteria 1162
493 Ga0495677_0077301 3300047445 Bacteria 1245
494 Ga0495673_0014034 3300047469 Bacteria 4181
495 Ga0495684_0002466 3300047471 Bacteria 14757
496 Ga0495684_0060773 3300047471 Bacteria 2875
497 Ga0495593_0004676 3300047673 Bacteria 8141
498 Ga0495593_0019912 3300047673 Bacteria 3759
499 Ga0495602_0014347 3300048088 Bacteria 8047
500 Ga0495602_0146810 3300048088 Bacteria 1859
501 Ga0495602_0287484 3300048088 Bacteria 1208
502 Ga0496100_0061031 3300048903 Bacteria 2483
503 Ga0496101_0140613 3300048904 Bacteria 1839
504 Ga0496104_0044789 3300048907 Bacteria 4158
505 Ga0496105_0006671 3300048908 Bacteria 8886
506 Ga0496105_0052151 3300048908 Bacteria 3378
507 Ga0496105_0155806 3300048908 Bacteria 1876
508 Ga0496106_0000790 3300048909 Bacteria 22889
509 Ga0496106_0090294 3300048909 Bacteria 2364
510 Ga0496107_0056657 3300048910 Bacteria 2832
511 Ga0496107_0093836 3300048910 Bacteria 2195
512 Ga0496107_0229504 3300048910 Bacteria 1381
513 Ga0496108_0016631 3300048911 Bacteria 6008
514 Ga0496108_0105858 3300048911 Bacteria 2402
515 Ga0496109_0006272 3300048912 Bacteria 10004
516 Ga0496110_0025413 3300048913 Bacteria 5060
517 Ga0496110_0170502 3300048913 Bacteria 1974
518 Ga0496111_0003062 3300048914 Bacteria 10268
519 Ga0496111_0067418 3300048914 Bacteria 2600
520 Ga0496112_0000008 3300048915 Bacteria 310323
521 Ga0496112_0032218 3300048915 Bacteria 5088
522 Ga0496112_0086433 3300048915 Bacteria 3102
523 Ga0496112_0111269 3300048915 Bacteria 2708
524 Ga0496112_0243193 3300048915 Bacteria 1752
525 Ga0496113_0001051 3300048916 Bacteria 14906
526 Ga0496113_0209552 3300048916 Bacteria 1551
527 Ga0496114_0028954 3300048917 Bacteria 4550
528 Ga0496114_0322048 3300048917 Bacteria 1366
529 Ga0496115_0168870 3300048918 Bacteria 1809
530 Ga0496115_0217378 3300048918 Bacteria 1577
531 Ga0496115_0249709 3300048918 Bacteria 1461
532 Ga0496116_0144569 3300048919 Bacteria 1331
533 Ga0496117_0069881 3300048920 Bacteria 2362
534 Ga0496118_0011291 3300048921 Bacteria 8736
535 Ga0496118_0058776 3300048921 Bacteria 2869
536 Ga0496118_0069037 3300048921 Bacteria 2562
537 Ga0496118_0132724 3300048921 Bacteria 1595
538 Ga0496118_0213140 3300048921 Bacteria 1132
539 Ga0496119_0030064 3300048922 Bacteria 3669
540 Ga0496119_0031085 3300048922 Bacteria 3588
541 Ga0496119_0133316 3300048922 Bacteria 1351
542 Ga0496121_0000774 3300048924 Bacteria 58528
543 Ga0496121_0001681 3300048924 Bacteria 36391
544 Ga0496121_0003198 3300048924 Bacteria 23590
545 Ga0496121_0006839 3300048924 Bacteria 13949
546 Ga0496121_0023712 3300048924 Bacteria 5898
547 Ga0496121_0077477 3300048924 Bacteria 2647
548 Ga0496121_0087647 3300048924 Bacteria 2443
549 Ga0496121_0167255 3300048924 Bacteria 1601
550 Ga0496122_0027723 3300048925 Bacteria 4833
551 Ga0496122_0061840 3300048925 Bacteria 2745
552 Ga0496122_0124663 3300048925 Bacteria 1652
553 Ga0496123_0059238 3300048926 Bacteria 2477
554 Ga0496123_0088824 3300048926 Bacteria 1843
555 Ga0496124_0002423 3300048927 Bacteria 24474
556 Ga0496124_0035095 3300048927 Bacteria 4391
557 Ga0496124_0083476 3300048927 Bacteria 2621
558 Ga0496124_0268346 3300048927 Bacteria 1251
559 Ga0496124_0292460 3300048927 Bacteria 1181
560 Ga0496125_0000063 3300048928 Bacteria 250260
561 Ga0496125_0003190 3300048928 Bacteria 20279
562 Ga0496125_0016567 3300048928 Bacteria 7069
563 Ga0496125_0037765 3300048928 Bacteria 4194
564 Ga0496126_0023541 3300048929 Bacteria 5967
565 Ga0496126_0055308 3300048929 Bacteria 3591
566 Ga0496126_0084560 3300048929 Bacteria 2798
567 Ga0496126_0118200 3300048929 Bacteria 2302
568 Ga0496126_0214738 3300048929 Bacteria 1618
569 Ga0496126_0361529 3300048929 Bacteria 1185
570 Ga0496126_0405484 3300048929 Bacteria 1105
571 Ga0501032_0000683 3300049569 Bacteria 27581
572 Ga0501032_0119505 3300049569 Bacteria 1743
573 Ga0501033_0000645 3300049570 Bacteria 32274
574 Ga0501033_0253104 3300049570 Bacteria 1248
575 Ga0501034_0004310 3300049571 Bacteria 15861
576 Ga0501034_0018499 3300049571 Bacteria 7143
577 Ga0501036_0002022 3300049572 Bacteria 15776
578 Ga0501037_0000484 3300049573 Bacteria 32262
579 Ga0501039_0001484 3300049575 Bacteria 17245
580 Ga0501043_0000593 3300049579 Bacteria 32115
581 Ga0501046_0000499 3300049580 Bacteria 39177
582 Ga0501046_0085355 3300049580 Bacteria 2434
583 Ga0501047_0001042 3300049581 Bacteria 27709
584 Ga0501048_0001414 3300049582 Bacteria 18146
585 Ga0501067_0016992 3300049583 Bacteria 4020
586 Ga0501067_0048934 3300049583 Bacteria 2343
587 Ga0501068_0004322 3300049584 Bacteria 7720
588 Ga0501069_0002891 3300049585 Bacteria 8818
589 Ga0501070_0000773 3300049586 Bacteria 29138
590 Ga0501070_0048155 3300049586 Bacteria 3541
591 Ga0501070_0406205 3300049586 Bacteria 1101
592 Ga0501071_0061701 3300049587 Bacteria 2715
593 Ga0501073_0003354 3300049589 Bacteria 12036
594 Ga0501073_0020292 3300049589 Bacteria 4794
595 Ga0501073_0174080 3300049589 Bacteria 1490
596 Ga0501074_0015366 3300049590 Bacteria 5565
597 Ga0501074_0105194 3300049590 Bacteria 2020
598 Ga0501079_0023534 3300049741 Bacteria 4727
599 Ga0501080_0000326 3300049742 Bacteria 36467
600 Ga0501080_0049000 3300049742 Bacteria 3931
601 Ga0501080_0378091 3300049742 Bacteria 1276
602 Ga0501083_0020993 3300049744 Bacteria 4539
603 Ga0501035_0009126 3300049822 Bacteria 9221
604 Ga0501035_0115922 3300049822 Bacteria 2345
605 Ga0501035_0129358 3300049822 Bacteria 2202
606 Ga0501035_0243728 3300049822 Bacteria 1528
607 Ga0501044_0003564 3300049823 Bacteria 17514
608 Ga0501044_0097832 3300049823 Bacteria 2955
609 Ga0501045_0047286 3300049824 Bacteria 3134
610 nmdc:mga03n38_1395_c1 3300050490 Bacteria 6872
611 nmdc:mga00v17_122225_c1 3300050491 Bacteria 1659
612 nmdc:mga00v17_139644_c1 3300050491 Bacteria 1553
613 nmdc:mga00v17_20779_c1 3300050491 Bacteria 3765
614 nmdc:mga00v17_2979_c1 3300050491 Bacteria 8690
615 nmdc:mga0yw44_132865_c1 3300050492 Bacteria 1613
616 nmdc:mga0yw44_35735_c1 3300050492 Bacteria 2922
617 nmdc:mga06z11_119462_c1 3300050494 Bacteria 1469
618 nmdc:mga06z11_476_c1 3300050494 Bacteria 14825
619 nmdc:mga04h51_2266_c1 3300050495 Bacteria 4536
620 nmdc:mga04h51_44465_c1 3300050495 Bacteria 1464
621 nmdc:mga05p37_216242_c1 3300050507 Bacteria 2315
622 nmdc:mga05p37_236359_c1 3300050507 Bacteria 2199
623 nmdc:mga05p37_242152_c1 3300050507 Bacteria 2168
624 nmdc:mga05p37_28962_c1 3300050507 Bacteria 6757
625 nmdc:mga05p37_528_c1 3300050507 Bacteria 42336
626 nmdc:mga05p37_72508_c1 3300050507 Bacteria 4237
627 nmdc:mga09592_406593_c1 3300050508 Bacteria 1176
628 nmdc:mga09592_704_c1 3300050508 Bacteria 25621
629 nmdc:mga0qj67_101221_c1 3300050509 Bacteria 2323
630 nmdc:mga06r32_241_c1 3300050510 Bacteria 44852
631 nmdc:mga08y16_23292_c1 3300050511 Bacteria 6540
632 nmdc:mga08y16_388769_c1 3300050511 Bacteria 1429
633 nmdc:mga08y16_427_c1 3300050511 Bacteria 38825
634 nmdc:mga08y16_83275_c1 3300050511 Bacteria 3334
635 nmdc:mga0n895_12352_c1 3300050512 Bacteria 7657
636 nmdc:mga0n895_327770_c1 3300050512 Bacteria 1551
637 nmdc:mga0n895_373096_c1 3300050512 Bacteria 1444
638 nmdc:mga0n895_56607_c1 3300050512 Bacteria 3863
639 nmdc:mga0rr50_103088_c1 3300050513 Bacteria 2245
640 nmdc:mga0rr50_201349_c1 3300050513 Unclassified 1636
641 nmdc:mga0rr50_219554_c1 3300050513 Bacteria 1569
642 nmdc:mga0rr50_497178_c1 3300050513 Bacteria 1037
643 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
644 nmdc:mga0a205_18414_c2 3300050515 Bacteria 4436
645 nmdc:mga0a205_5012_c1 3300050515 Bacteria 11924
646 nmdc:mga0sz30_3240_c1 3300050516 Bacteria 1522
647 Ga0495601_0001493 3300053077 Bacteria 12895
648 Ga0495601_0010297 3300053077 Bacteria 5560
649 Ga0495601_0015849 3300053077 Bacteria 4561
650 Ga0495601_0234933 3300053077 Bacteria 1197
651 Ga0495612_0009950 3300053078 Bacteria 3850
652 Ga0495612_0017571 3300053078 Bacteria 2863
653 Ga0500635_0021832 3300053080 Bacteria 1977
654 Ga0495595_0133833 3300053084 Bacteria 1213
655 Ga0495619_0000426 3300053085 Bacteria 28605
656 Ga0495619_0002191 3300053085 Bacteria 12937
657 Ga0495619_0035938 3300053085 Bacteria 3224
658 Ga0495619_0071870 3300053085 Bacteria 2316
659 Ga0495619_0078164 3300053085 Bacteria 2224
660 Ga0500644_0042976 3300053088 Bacteria 1509
661 Ga0500651_0020333 3300053093 Bacteria 4131
662 Ga0500566_0018920 3300053094 Bacteria 4043
663 Ga0500566_0075127 3300053094 Bacteria 1891
664 Ga0500566_0115554 3300053094 Bacteria 1453
665 Ga0500641_0020369 3300053096 Bacteria 2517
666 Ga0500650_0025868 3300053098 Bacteria 2627
667 Ga0500554_023530 3300053102 Bacteria 1734
668 Ga0500554_048783 3300053102 Bacteria 1326
669 Ga0500556_0000002 3300053104 Bacteria 773626
670 Ga0500569_002951 3300053109 Bacteria 3414
671 Ga0500572_019881 3300053111 Bacteria 1759
672 Ga0500592_001197 3300053116 Bacteria 4227
673 Ga0500595_000067 3300053119 Bacteria 73964
674 Ga0500595_000921 3300053119 Bacteria 16701
675 Ga0500595_003248 3300053119 Bacteria 7674
676 Ga0500595_005375 3300053119 Bacteria 5602
677 Ga0500618_026989 3300053125 Bacteria 1368
678 Ga0500642_0000026 3300053130 Bacteria 127731
679 Ga0500655_006783 3300053133 Bacteria 2061
680 Ga0500559_0033992 3300053136 Bacteria 2197
681 Ga0500564_033008 3300053138 Bacteria 2388
682 Ga0500568_0000922 3300053139 Bacteria 20296
683 Ga0500568_0008666 3300053139 Bacteria 4882
684 Ga0500568_0030756 3300053139 Bacteria 2221
685 Ga0500573_0107245 3300053140 Bacteria 1566
686 Ga0500577_0002345 3300053142 Bacteria 4826
687 Ga0500586_003261 3300053145 Bacteria 3816
688 Ga0500590_062189 3300053148 Bacteria 1874
689 Ga0500603_014408 3300053150 Bacteria 1847
690 Ga0500604_0007958 3300053151 Bacteria 2811
691 Ga0500616_0000031 3300053153 Bacteria 415013
692 Ga0500616_0063063 3300053153 Bacteria 1912
693 Ga0500620_002066 3300053155 Bacteria 3924
694 Ga0500622_0007393 3300053156 Bacteria 6243
695 Ga0500622_0035149 3300053156 Bacteria 2623
696 Ga0500638_005687 3300053162 Bacteria 5006
697 Ga0500638_035422 3300053162 Bacteria 2418
698 Ga0500638_037363 3300053162 Bacteria 2357
699 Ga0500636_0001005 3300053177 Bacteria 15085
700 Ga0500636_0031405 3300053177 Bacteria 3144
701 Ga0500636_0043882 3300053177 Bacteria 2639
702 Ga0500636_0073965 3300053177 Bacteria 1972
703 Ga0500637_0000035 3300053178 Bacteria 51004
704 Ga0500637_0005303 3300053178 Bacteria 6230
705 Ga0500637_0127943 3300053178 Bacteria 1473
706 Ga0500609_010330 3300053731 Bacteria 1258
707 Ga0500596_001218 3300053735 Bacteria 5202
708 Ga0500596_006564 3300053735 Bacteria 1959
709 Ga0500601_000645 3300053737 Bacteria 4804
710 Ga0500661_000283 3300055283 Bacteria 9215
711 Ga0500661_002522 3300055283 Bacteria 3456
712 Ga0500661_013042 3300055283 Bacteria 1498
713 2513640324 2513237094 Bacteria 8789602
714 2513674780 2513237098 Bacteria 9902361
715 2513698046 2513237101 Bacteria 7952346
716 2524466052 2524023210 Bacteria 9029266
717 2603861342 2602042107 Bacteria 6226103
718 2644287527 2643221651 Bacteria 4798932
719 2793071458 2791355197 Bacteria 8420563
720 2844317451 2844315083 Bacteria 8138177
721 2857530108 2857524615 Bacteria 6615449
722 2885385804 2885383462 Bacteria 9473874
723 2893071708 2893066018 Bacteria 6158120
724 2903733167 2903727486 Bacteria 8281579
725 2903772802 2903768456 Bacteria 9749579
726 2906604012 2906602504 Bacteria 8295279
727 2906611024
728 2908744540 2908739725 Bacteria 8628932
729 2919076884 2919073203 Bacteria 6531949
730 2922428288
731 3005713206 3005710791 Bacteria 7622528
732 8006932604 8006926726 Bacteria 6749210
733 8006942941 8006933436 Bacteria 10410654
734 8006982661 8006973647 Bacteria 10679141
735 8007001895 8006994254 Bacteria 8309700
736 8019558732 8019555841 Bacteria 9642137
737 8019566575 8019565922 Bacteria 9639779
738 8056681141 8056673599 Bacteria 7871253
739 8056969025 8056967851 Bacteria 9038162
740 Ga0496104_0000748
741 2214544908
742 2214544909
743 ARcpr5oldR_c000009
744 ARSoilYngRDRAFT_c00030
745 ARcpr5yngRDRAFT_c000008
746 ARSoilOldRDRAFT_c000009
747 ARCol0oldRDRAFT_c00052
748 ARCol0yngRDRAFT_1000008
749 Ga0065165_1025302
750 Ga0065704_10077879
751 Ga0065715_10102289
752 Ga0070658_10077583
753 Ga0070658_10148980
754 Ga0070690_100068821
755 Ga0070670_100117365
756 Ga0068869_100037562
757 Ga0068869_100038739
758 Ga0070680_100074519
759 Ga0070680_100080719
760 Ga0070660_100016759
761 Ga0070689_100132248
762 Ga0070692_10003707
763 Ga0070668_100050190
764 Ga0070668_100087608
765 Ga0070668_100315129
766 Ga0070669_100053696
767 Ga0070669_100174280
768 Ga0070675_100036113
769 Ga0070675_100159475
770 Ga0070671_100105257
771 Ga0070671_100119054
772 Ga0070674_100095308
773 Ga0070674_100153091
774 Ga0070673_100107317
775 Ga0070688_100021126
776 Ga0070659_100054193
777 Ga0070667_100314760
778 Ga0070714_100003590
779 Ga0070714_100062465
780 Ga0070714_100075862
781 Ga0070713_100005913
782 Ga0070713_100157130
783 Ga0070710_10005874
784 Ga0070710_10076968
785 Ga0070711_100009019
786 Ga0070711_100237416
787 Ga0070700_100045666
788 Ga0070700_100058485
789 Ga0070694_100003181
790 Ga0070694_100032721
791 Ga0070708_100002558
792 Ga0070663_100106582
793 Ga0070662_100041573
794 Ga0070681_10025982
795 Ga0070681_10240638
796 Ga0068867_100081431
797 Ga0070685_10017349
798 Ga0070706_100168008
799 Ga0070679_100031732
800 Ga0070679_100085038
801 Ga0070679_100387610
802 Ga0070684_100053743
803 Ga0070697_100000384
804 Ga0068853_100144851
805 Ga0068853_100173547
806 Ga0070695_100001249
807 Ga0070665_100196258
808 Ga0070665_100213889
809 Ga0070665_100215998
810 Ga0068855_100089047
811 Ga0068855_100350353
812 Ga0070664_100318917
813 Ga0068857_100003812
814 Ga0068856_100005654
815 Ga0068852_100006751
816 Ga0068852_100165816
817 Ga0068859_100164886
818 Ga0068864_100064561
819 Ga0068861_100072652
820 Ga0068861_100128237
821 Ga0068861_100138453
822 Ga0068861_100359754
823 Ga0068851_10025805
824 Ga0068870_10095941
825 Ga0068863_100030297
826 Ga0068863_100084686
827 Ga0068863_100185389
828 Ga0068858_100094323
829 Ga0068860_100058132
830 Ga0068860_100082888
831 Ga0068860_100169022
832 Ga0068860_100568333
833 Ga0068862_100012376
834 Ga0081455_10014413
835 Ga0081455_10067468
836 Ga0081455_10106504
837 Ga0081538_10019025
838 Ga0081540_1004461
839 Ga0081540_1011197
840 Ga0081540_1025111
841 Ga0081540_1032788
842 Ga0081540_1033273
843 Ga0081540_1038259
844 Ga0081540_1076542
845 Ga0081539_10001561
846 Ga0081539_10047770
847 Ga0070717_10304670
848 Ga0075365_10019754
849 Ga0075365_10077934
850 Ga0075365_10129686
851 Ga0075365_10213384
852 Ga0075368_10001490
853 Ga0075363_100034602
854 Ga0075363_100114424
855 Ga0075364_10076323
856 Ga0070712_100081356
857 Ga0070712_100161900
858 Ga0070712_100229890
859 Ga0070712_100245181
860 Ga0075367_10013781
861 Ga0075367_10057476
862 Ga0075367_10101957
863 Ga0075366_10133110
864 Ga0075370_10089458
865 Ga0068871_100102734
866 Ga0075428_100001309
867 Ga0075428_100121145
868 Ga0075428_100171330
869 Ga0075430_100069691
870 Ga0075431_100000481
871 Ga0075431_100126203
872 Ga0075433_10008551
873 Ga0075434_100003619
874 Ga0075434_100038004
875 Ga0075434_100156626
876 Ga0075429_100004654
877 Ga0068865_100060263
878 Ga0068865_100366309
879 Ga0097620_100164883
880 Ga0075435_100006201
881 Ga0075435_100019548
882 Ga0075435_100206610
883 Ga0075435_100245840
884 Ga0099794_10047974
885 Ga0105250_10064284
886 Ga0105240_10007705
887 Ga0105240_10106573
888 Ga0105240_10279122
889 Ga0111539_10000242
890 Ga0111539_10002444
891 Ga0111539_10004586
892 Ga0111539_10012307
893 Ga0111539_10142590
894 Ga0105247_10065163
895 Ga0114129_10001244
896 Ga0114129_10028194
897 Ga0114129_10217729
898 Ga0105243_10276681
899 Ga0105248_10300875
900 Ga0105237_10004743
901 Ga0105237_10011260
902 Ga0105237_10038763
903 Ga0105237_10192052
904 Ga0105237_10211918
905 Ga0105238_10012649
906 Ga0105238_10183037
907 Ga0105239_10002642
908 Ga0105239_10186975
909 Ga0105239_10266730
910 Ga0105239_10285591
911 Ga0105239_10462756
912 Ga0105239_10774080
913 Ga0157316_1000560
914 Ga0157338_1000401
915 Ga0157370_10116311
916 Ga0157369_10020586
917 Ga0163162_10009887
918 Ga0157372_10236176
919 Ga0157375_10193901
920 Ga0157375_10416097
921 Ga0157375_10626012
922 Ga0163163_10054542
923 Ga0157380_10233589
924 Ga0157380_10311481
925 Ga0157380_10463318
926 Ga0157376_10057486
927 Ga0213875_10001946
928 Ga0209148_1000680
929 Ga0209148_1011702
930 Ga0209233_1005353
931 Ga0209455_1001796
932 Ga0209455_1005908
933 Ga0209564_1001387
934 Ga0209758_1004012
935 Ga0207656_10070261
936 Ga0207692_10000740
937 Ga0207692_10028228
938 Ga0207710_10013885
939 Ga0207688_10067947
940 Ga0207688_10126002
941 Ga0207699_10001145
942 Ga0207699_10004649
943 Ga0207699_10013798
944 Ga0207705_10263015
945 Ga0207684_10120684
946 Ga0207654_10039189
947 Ga0207707_10007605
948 Ga0207707_10051295
949 Ga0207695_10000029
950 Ga0207671_10003843
951 Ga0207671_10051209
952 Ga0207671_10091093
953 Ga0207671_10158494
954 Ga0207693_10001764
955 Ga0207693_10005866
956 Ga0207693_10105130
957 Ga0207693_10169760
958 Ga0207663_10229730
959 Ga0207660_10012306
960 Ga0207660_10123842
961 Ga0207657_10006868
962 Ga0207657_10018426
963 Ga0207657_10058011
964 Ga0207652_10006786
965 Ga0207646_10298813
966 Ga0207681_10051683
967 Ga0207694_10068569
968 Ga0207650_10019751
969 Ga0207650_10139902
970 Ga0207650_10228447
971 Ga0207650_10277173
972 Ga0207687_10056048
973 Ga0207687_10134808
974 Ga0207700_10083109
975 Ga0207700_10091964
976 Ga0207644_10079033
977 Ga0207706_10294162
978 Ga0207709_10228124
979 Ga0207670_10115558
980 Ga0207670_10265612
981 Ga0207669_10119204
982 Ga0207704_10096636
983 Ga0207665_10004098
984 Ga0207665_10073413
985 Ga0207691_10100142
986 Ga0207691_10111202
987 Ga0207689_10147766
988 Ga0207661_10007779
989 Ga0207661_10202993
990 Ga0207667_10193228
991 Ga0207651_10047835
992 Ga0207668_10109135
993 Ga0207658_10377322
994 Ga0207639_10104022
995 Ga0207639_10177493
996 Ga0207678_10123456
997 Ga0207678_10130761
998 Ga0207678_10191373
999 Ga0207708_10027237
1000 Ga0207708_10230913
1001 Ga0207702_10000334
1002 Ga0207641_10183711
1003 Ga0207648_10230769
1004 Ga0207676_10136721
1005 Ga0207676_10158025
1006 Ga0207676_10229729
1007 Ga0207674_10007361
1008 Ga0207674_10104306
1009 Ga0207675_100066896
1010 Ga0207675_100103300
1011 Ga0207675_100331152
1012 Ga0207683_10056801
1013 Ga0207683_10099932
1014 Ga0207683_10182858
1015 Ga0207698_10031186
1016 Ga0207698_10113888
1017 Ga0207698_10221195
1018 Ga0207698_10398334
1019 Ga0209813_10006277
1020 Ga0209813_10037282
1021 Ga0207428_10000666
1022 Ga0207428_10006807
1023 Ga0268266_10092507
1024 Ga0268266_10312024
1025 Ga0268265_10035005
1026 Ga0268265_10070488
1027 Ga0268264_10050111
1028 Ga0268264_10146067
1029 Ga0268264_10520398
1030 Ga0265337_1008837
1031 Ga0265326_10003930
1032 Ga0265319_1004925
1033 Ga0265334_10003506
1034 Ga0265334_10043443
1035 Ga0265318_10009701
1036 Ga0265323_10001786
1037 Ga0265336_10001310
1038 Ga0307517_10000315
1039 Ga0307515_10073332
1040 Ga0307515_10178407
1041 Ga0265338_10000013
1042 Ga0265324_10006344
1043 Ga0265330_10025004
1044 Ga0265332_10061795
1045 Ga0265328_10056929
1046 Ga0265320_10018789
1047 Ga0265325_10124477
1048 Ga0265340_10006370
1049 Ga0265340_10053192
1050 Ga0307513_10138370
1051 Ga0307513_10149521
1052 Ga0307408_100334312
1053 Ga0307508_10000419
1054 Ga0307508_10145599
1055 Ga0265314_10003890
1056 Ga0265314_10011565
1057 Ga0265314_10013863
1058 Ga0265314_10094661
1059 Ga0307516_10292556
1060 Ga0307412_10179995
1061 Ga0307416_100045120
1062 Ga0307411_10176387
1063 Ga0307415_100037417
1064 Ga0307507_10083746
1065 Ga0307510_10061243
1066 Ga0373948_0000293
1067 Ga0373950_0003832
1068 Ga0373958_0000031
1069 Ga0373938_0000049
1070 Ga0373928_0000190
1071 Ga0373929_0000140
1072 Ga0373934_0000167
1073 Ga0373934_0011751
1074 Ga0373934_0030528
1075 Ga0373940_0000013
1076 Ga0373940_0045861
1077 Ga0373949_0000214
1078 Ga0373951_0001211
1079 Ga0373952_0000349
1080 Ga0373923_0101720
1081 Ga0373923_0103354
1082 Ga0373932_0000018
1083 Ga0373936_0152623
1084 Ga0373939_0006979
1085 Ga0373939_0008368
1086 Ga0373941_0000150
1087 Ga0373953_0031220
1088 Ga0373953_0037169
1089 Ga0373954_0003678
1090 Ga0373954_0031123
1091 Ga0373954_0042470
1092 Ga0373954_0055662
1093 Ga0373954_0101043
1094 Ga0373954_0123725
1095 Ga0373956_0000005
1096 Ga0373956_0006620
1097 Ga0373957_0001547
1098 Ga0373957_0067190
1099 Ga0373957_0092503
1100 Ga0373960_0000903
1101 Ga0373943_0041548
1102 Ga0373955_0001424
1103 Ga0373955_0002275
1104 Ga0373955_0021411
1105 Ga0373955_0071714
1106 Ga0373942_0021462
1107 Ga0373961_0000824
1108 Ga0373962_0000024
1109 Ga0373962_0009867
1110 Ga0373931_0000562
1111 Ga0373931_0004504
1112 Ga0373931_0005979
1113 Ga0373931_0078422
1114 Ga0373935_0100799
1115 Ga0373935_0104823
1116 Ga0373935_0165204
1117 Ga0373927_0036155
1118 Ga0373927_0041103
1119 Ga0373927_0043981
1120 Ga0373927_0045775
1121 Ga0373933_0000447
1122 Ga0373933_0000883
1123 Ga0373933_0003022
1124 Ga0373933_0111955
1125 Ga0373947_0003071
1126 Ga0373937_0000912
1127 Ga0373937_0009273
1128 Ga0373937_0033182
1129 Ga0373937_0048714
1130 Ga0373937_0085716
1131 Ga0373937_0224272
1132 Ga0373925_0005375
1133 Ga0373925_0027216
1134 Ga0373925_0063127
1135 Ga0373925_0152117
1136 Ga0373925_0152833
1137 Ga0395900_0373119
1138 Ga0395898_0037448
1139 Ga0436364_0745728
1140 Ga0436364_1405230
1141 Ga0395901_0115780
1142 Ga0436363_1563864
1143 Ga0451577_0032136
1144 Ga0466957_0061122
1145 Ga0451576_0056628
1146 Ga0495592_0002231
1147 Ga0495603_0006560
1148 Ga0495629_0016538
1149 Ga0495629_0052697
1150 Ga0495629_0187906
1151 Ga0495638_0130778
1152 Ga0495651_0000479
1153 Ga0495651_0000878
1154 Ga0495651_0050923
1155 Ga0495651_0159960
1156 Ga0495653_0000553
1157 Ga0495653_0059837
1158 Ga0495653_0099389
1159 Ga0495582_0004249
1160 Ga0495582_0037901
1161 Ga0495582_0120779
1162 Ga0495639_0001631
1163 Ga0495664_0026645
1164 Ga0495664_0032952
1165 Ga0495664_0052678
1166 Ga0495594_0001269
1167 Ga0495594_0196110
1168 Ga0495606_0001096
1169 Ga0495608_0000376
1170 Ga0495608_0033566
1171 Ga0495628_0025647
1172 Ga0495628_0066180
1173 Ga0495628_0099405
1174 Ga0495630_0035102
1175 Ga0495631_0067290
1176 Ga0495632_0112626
1177 Ga0495648_0008150
1178 Ga0495648_0008195
1179 Ga0495666_0138835
1180 Ga0495652_0006143
1181 Ga0495652_0175332
1182 Ga0495665_0001884
1183 Ga0495640_0005971
1184 Ga0495640_0016106
1185 Ga0495587_0001125
1186 Ga0495587_0010826
1187 Ga0495587_0051041
1188 Ga0495587_0101588
1189 Ga0495645_0032323
1190 Ga0495622_0025751
1191 Ga0495667_0000294
1192 Ga0495667_0037649
1193 Ga0495668_0119443
1194 Ga0495668_0125161
1195 Ga0495625_0215253
1196 Ga0495625_0222374
1197 Ga0495635_0000880
1198 Ga0495635_0011308
1199 Ga0495635_0068116
1200 Ga0495635_0102163
1201 Ga0495588_0044701
1202 Ga0495657_0021192
1203 Ga0495657_0022609
1204 Ga0495657_0064942
1205 Ga0495657_0140439
1206 Ga0495657_0185607
1207 Ga0495599_0115695
1208 Ga0495623_0001907
1209 Ga0495623_0069237
1210 Ga0495646_0010397
1211 Ga0495646_0186549
1212 Ga0495658_0023050
1213 Ga0495658_0063701
1214 Ga0495613_0009118
1215 Ga0495613_0056174
1216 Ga0495624_0008474
1217 Ga0495600_0003489
1218 Ga0495600_0047122
1219 Ga0495604_0000972
1220 Ga0495604_0078226
1221 Ga0495674_0003482
1222 Ga0495674_0009055
1223 Ga0495672_0012238
1224 Ga0495676_0158887
1225 Ga0495680_0003955
1226 Ga0495680_0048502
1227 Ga0495680_0097745
1228 Ga0495675_0009564
1229 Ga0495675_0019173
1230 Ga0495675_0020724
1231 Ga0495675_0215880
1232 Ga0495677_0077301
1233 Ga0495673_0014034
1234 Ga0495684_0002466
1235 Ga0495684_0060773
1236 Ga0495593_0004676
1237 Ga0495593_0019912
1238 Ga0495602_0014347
1239 Ga0495602_0146810
1240 Ga0495602_0287484
1241 Ga0496100_0061031
1242 Ga0496101_0140613
1243 Ga0496104_0044789
1244 Ga0496105_0006671
1245 Ga0496105_0052151
1246 Ga0496105_0155806
1247 Ga0496106_0000790
1248 Ga0496106_0090294
1249 Ga0496107_0056657
1250 Ga0496107_0093836
1251 Ga0496107_0229504
1252 Ga0496108_0016631
1253 Ga0496108_0105858
1254 Ga0496109_0006272
1255 Ga0496110_0025413
1256 Ga0496110_0170502
1257 Ga0496111_0003062
1258 Ga0496111_0067418
1259 Ga0496112_0000008
1260 Ga0496112_0032218
1261 Ga0496112_0086433
1262 Ga0496112_0111269
1263 Ga0496112_0243193
1264 Ga0496113_0001051
1265 Ga0496113_0209552
1266 Ga0496114_0028954
1267 Ga0496114_0322048
1268 Ga0496115_0168870
1269 Ga0496115_0217378
1270 Ga0496115_0249709
1271 Ga0496116_0144569
1272 Ga0496117_0069881
1273 Ga0496118_0011291
1274 Ga0496118_0058776
1275 Ga0496118_0069037
1276 Ga0496118_0132724
1277 Ga0496118_0213140
1278 Ga0496119_0030064
1279 Ga0496119_0031085
1280 Ga0496119_0133316
1281 Ga0496121_0000774
1282 Ga0496121_0001681
1283 Ga0496121_0003198
1284 Ga0496121_0006839
1285 Ga0496121_0023712
1286 Ga0496121_0077477
1287 Ga0496121_0087647
1288 Ga0496121_0167255
1289 Ga0496122_0027723
1290 Ga0496122_0061840
1291 Ga0496122_0124663
1292 Ga0496123_0059238
1293 Ga0496123_0088824
1294 Ga0496124_0002423
1295 Ga0496124_0035095
1296 Ga0496124_0083476
1297 Ga0496124_0268346
1298 Ga0496124_0292460
1299 Ga0496125_0000063
1300 Ga0496125_0003190
1301 Ga0496125_0016567
1302 Ga0496125_0037765
1303 Ga0496126_0023541
1304 Ga0496126_0055308
1305 Ga0496126_0084560
1306 Ga0496126_0118200
1307 Ga0496126_0214738
1308 Ga0496126_0361529
1309 Ga0496126_0405484
1310 Ga0501032_0000683
1311 Ga0501032_0119505
1312 Ga0501033_0000645
1313 Ga0501033_0253104
1314 Ga0501034_0004310
1315 Ga0501034_0018499
1316 Ga0501036_0002022
1317 Ga0501037_0000484
1318 Ga0501039_0001484
1319 Ga0501043_0000593
1320 Ga0501046_0000499
1321 Ga0501046_0085355
1322 Ga0501047_0001042
1323 Ga0501048_0001414
1324 Ga0501067_0016992
1325 Ga0501067_0048934
1326 Ga0501068_0004322
1327 Ga0501069_0002891
1328 Ga0501070_0000773
1329 Ga0501070_0048155
1330 Ga0501070_0406205
1331 Ga0501071_0061701
1332 Ga0501073_0003354
1333 Ga0501073_0020292
1334 Ga0501073_0174080
1335 Ga0501074_0015366
1336 Ga0501074_0105194
1337 Ga0501079_0023534
1338 Ga0501080_0000326
1339 Ga0501080_0049000
1340 Ga0501080_0378091
1341 Ga0501083_0020993
1342 Ga0501035_0009126
1343 Ga0501035_0115922
1344 Ga0501035_0129358
1345 Ga0501035_0243728
1346 Ga0501044_0003564
1347 Ga0501044_0097832
1348 Ga0501045_0047286
1349 nmdc:mga03n38_1395_c1
1350 nmdc:mga00v17_122225_c1
1351 nmdc:mga00v17_139644_c1
1352 nmdc:mga00v17_20779_c1
1353 nmdc:mga00v17_2979_c1
1354 nmdc:mga0yw44_132865_c1
1355 nmdc:mga0yw44_35735_c1
1356 nmdc:mga06z11_119462_c1
1357 nmdc:mga06z11_476_c1
1358 nmdc:mga04h51_2266_c1
1359 nmdc:mga04h51_44465_c1
1360 nmdc:mga05p37_216242_c1
1361 nmdc:mga05p37_236359_c1
1362 nmdc:mga05p37_242152_c1
1363 nmdc:mga05p37_28962_c1
1364 nmdc:mga05p37_528_c1
1365 nmdc:mga05p37_72508_c1
1366 nmdc:mga09592_406593_c1
1367 nmdc:mga09592_704_c1
1368 nmdc:mga0qj67_101221_c1
1369 nmdc:mga06r32_241_c1
1370 nmdc:mga08y16_23292_c1
1371 nmdc:mga08y16_388769_c1
1372 nmdc:mga08y16_427_c1
1373 nmdc:mga08y16_83275_c1
1374 nmdc:mga0n895_12352_c1
1375 nmdc:mga0n895_327770_c1
1376 nmdc:mga0n895_373096_c1
1377 nmdc:mga0n895_56607_c1
1378 nmdc:mga0rr50_103088_c1
1379 nmdc:mga0rr50_201349_c1
1380 nmdc:mga0rr50_219554_c1
1381 nmdc:mga0rr50_497178_c1
1382 nmdc:mga08x19_6_c1
1383 nmdc:mga0a205_18414_c2
1384 nmdc:mga0a205_5012_c1
1385 nmdc:mga0sz30_3240_c1
1386 Ga0495601_0001493
1387 Ga0495601_0010297
1388 Ga0495601_0015849
1389 Ga0495601_0234933
1390 Ga0495612_0009950
1391 Ga0495612_0017571
1392 Ga0500635_0021832
1393 Ga0495595_0133833
1394 Ga0495619_0000426
1395 Ga0495619_0002191
1396 Ga0495619_0035938
1397 Ga0495619_0071870
1398 Ga0495619_0078164
1399 Ga0500644_0042976
1400 Ga0500651_0020333
1401 Ga0500566_0018920
1402 Ga0500566_0075127
1403 Ga0500566_0115554
1404 Ga0500641_0020369
1405 Ga0500650_0025868
1406 Ga0500554_023530
1407 Ga0500554_048783
1408 Ga0500556_0000002
1409 Ga0500569_002951
1410 Ga0500572_019881
1411 Ga0500592_001197
1412 Ga0500595_000067
1413 Ga0500595_000921
1414 Ga0500595_003248
1415 Ga0500595_005375
1416 Ga0500618_026989
1417 Ga0500642_0000026
1418 Ga0500655_006783
1419 Ga0500559_0033992
1420 Ga0500564_033008
1421 Ga0500568_0000922
1422 Ga0500568_0008666
1423 Ga0500568_0030756
1424 Ga0500573_0107245
1425 Ga0500577_0002345
1426 Ga0500586_003261
1427 Ga0500590_062189
1428 Ga0500603_014408
1429 Ga0500604_0007958
1430 Ga0500616_0000031
1431 Ga0500616_0063063
1432 Ga0500620_002066
1433 Ga0500622_0007393
1434 Ga0500622_0035149
1435 Ga0500638_005687
1436 Ga0500638_035422
1437 Ga0500638_037363
1438 Ga0500636_0001005
1439 Ga0500636_0031405
1440 Ga0500636_0043882
1441 Ga0500636_0073965
1442 Ga0500637_0000035
1443 Ga0500637_0005303
1444 Ga0500637_0127943
1445 Ga0500609_010330
1446 Ga0500596_001218
1447 Ga0500596_006564
1448 Ga0500601_000645
1449 Ga0500661_000283
1450 Ga0500661_002522
1451 Ga0500661_013042
1452 2513640324
1453 2513674780
1454 2513698046
1455 2524466052
1456 2603861342
1457 2644287527
1458 2793071458
1459 2844317451
1460 2857530108
1461 2885385804
1462 2893071708
1463 2903733167
1464 2903772802
1465 2906604012
1466 2906611024
1467 2908744540
1468 2919076884
1469 2922428288
1470 3005713206
1471 8006932604
1472 8006942941
1473 8006982661
1474 8007001895
1475 8019558732
1476 8019566575
1477 8056681141
1478 8056969025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

59

328

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5001 4 295
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4956 45 313
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4683 4 295
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4413 45 313
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.4219 9 292
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8367 43 310 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7958 43 308 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7771 43 308 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7727 45 308 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7639 43 308 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A4U6ACY6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9564 6 322 GO:0005886
GO:0015658
AF-A0A1S1TCX6-F1-model_v4 ABC transporter permease 0.9562 20 322 GO:0005886
GO:0015658
AF-A0A536T171-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9552 19 284 GO:0005886
GO:0015658
AF-A0A4R5UBA5-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9549 6 322 GO:0005886
GO:0015658
AF-A0A0Q7AE76-F1-model_v4 ABC transporter permease 0.9529 11 318 GO:0005886
GO:0015658

Map