F478498
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 497 | 534 | 542 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2876808645|2876812901 |
| Length | 632 |
| Sequence | LTPPDISELKPRITVFGVGGAGGNAVNNMITAGLQGVDFVVANTDAQALTMSKAQRIVQMGTQVTQGLGAGSQPDVGAAAAQEVIDELRDHLSGANMVFVTAGMGGGTGTGAAPVIAKTAREMGILTVGVVTKPFHFEGMRRMRTAESGIAELHKVVDTLLIIPNQNLFRVANEKTTFADAFAMADQVLYSGVACITDLMVKEGLINLDFADVRAVMKEMGKAMMGTGEATGEKRALTAAEAAIANPLIDDSSMKGARGLLISITGGKDLTLFEVDEAATRIREEVDQDANIIVGATFDETLDGIIRVSVVATGIEQAQIARNAAAAPAAATTATAGATSSPDNRLAELTARLRADNARLAERAQKLEPAPAQQAIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARIEPEQPATPETFIPQAAERAPARSPRMPKFEDLPMPAQAEIRQARGEAEEEHPQKSKLSLLQRLPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPAPPVRRWRRCRRCPIASRSGPSPSKWRRITSRYQSTQNARRRKVWTSMAAQRLLPRRHRATTILISRPSSDARPTELL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 33 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 34 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 35 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 36 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 37 | 2791355199 | |||
| 38 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 39 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 40 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 41 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 42 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 43 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 44 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 45 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 46 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 47 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 48 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 49 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 50 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 51 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 52 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 53 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 54 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 55 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 56 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 57 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 58 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 59 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 60 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 61 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 62 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 63 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 64 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 65 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 66 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 67 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 70 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 71 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 72 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 73 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 74 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 75 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 76 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 77 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 78 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 79 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 80 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 81 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 82 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 83 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 84 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 85 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 86 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 87 | 2904699407 | |||
| 88 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 89 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 90 | 2906610324 | |||
| 91 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 92 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 93 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 94 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 95 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 96 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 97 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 98 | 2922368715 | |||
| 99 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 100 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 101 | 2922425934 | |||
| 102 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 103 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 104 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 105 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 106 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 107 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 108 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 109 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 110 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 111 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 112 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 113 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 114 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 115 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 116 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 117 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 118 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 119 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 120 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 121 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 122 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 123 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 124 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 125 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 126 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 127 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 128 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 129 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 130 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 131 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 132 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 133 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 134 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 135 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 136 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 137 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 138 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 139 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 140 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 141 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 142 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 143 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 144 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 145 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 146 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 147 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 148 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 149 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 150 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 151 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 152 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 153 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 154 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 155 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 156 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 157 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 158 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 159 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 160 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 161 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 162 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 163 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 164 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 165 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 166 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 167 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 168 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 169 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 170 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 171 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 172 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 173 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 174 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 175 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 179 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 180 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 188 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 189 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 190 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 191 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 192 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 193 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 194 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 195 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 196 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 197 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 198 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 199 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 200 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 202 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 203 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 204 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 205 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 206 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 207 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 208 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 209 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 210 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 211 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 212 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 213 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 214 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 215 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 228 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 229 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 265 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 266 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 268 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 271 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 273 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 275 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 276 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 277 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 278 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 279 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 280 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 281 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 282 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 283 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 284 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 285 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 286 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 287 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 297 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 299 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 300 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 303 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 304 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 308 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 311 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 312 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 313 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 314 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 315 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 387 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 388 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 389 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 390 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 391 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 392 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 393 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 394 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 395 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 396 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 397 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 398 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 399 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 400 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 430 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 440 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 441 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 442 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 444 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 445 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 446 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 448 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 449 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 450 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 451 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 452 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 453 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 454 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 455 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 456 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 457 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 458 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 459 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 460 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 461 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 462 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 464 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 465 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 466 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 467 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 468 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 469 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 470 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 471 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 472 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 473 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 474 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 475 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 476 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 477 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 478 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 479 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 480 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 481 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 482 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 483 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 484 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 485 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 486 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 487 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 488 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 489 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 490 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 491 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 492 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 493 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 494 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 495 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 496 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 497 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.75 |
| Metatranscriptomes | 0 |
| Isolates | 27.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.14 |
| Nodule | 22.06 |
| Rhizoplane | 3.38 |
| Rhizosphere | 58.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10001955 | 3300001990 | Bacteria | 7373 |
| 2 | JGI24742J22300_10002888 | 3300002244 | Bacteria | 2778 |
| 3 | JGI25406J46586_10000580 | 3300003203 | Bacteria | 17278 |
| 4 | Ga0070658_10054743 | 3300005327 | Bacteria | 3239 |
| 5 | Ga0070676_10056615 | 3300005328 | Bacteria | 2317 |
| 6 | Ga0070683_100005294 | 3300005329 | Bacteria | 10748 |
| 7 | Ga0070683_100005592 | 3300005329 | Bacteria | 10498 |
| 8 | Ga0068869_100036616 | 3300005334 | Bacteria | 3484 |
| 9 | Ga0070680_100010654 | 3300005336 | Bacteria | 7093 |
| 10 | Ga0070680_100024434 | 3300005336 | Bacteria | 4827 |
| 11 | Ga0070660_100002003 | 3300005339 | Bacteria | 14053 |
| 12 | Ga0070660_100080940 | 3300005339 | Bacteria | 2549 |
| 13 | Ga0070674_100017753 | 3300005356 | Bacteria | 4483 |
| 14 | Ga0070674_100063129 | 3300005356 | Bacteria | 2591 |
| 15 | Ga0070714_100000678 | 3300005435 | Bacteria | 24075 |
| 16 | Ga0070713_100006575 | 3300005436 | Bacteria | 8077 |
| 17 | Ga0070713_100030732 | 3300005436 | Bacteria | 4269 |
| 18 | Ga0070713_100061543 | 3300005436 | Bacteria | 3141 |
| 19 | Ga0070710_10002407 | 3300005437 | Bacteria | 8862 |
| 20 | Ga0070710_10014311 | 3300005437 | Bacteria | 3991 |
| 21 | Ga0070711_100002216 | 3300005439 | Bacteria | 11029 |
| 22 | Ga0070711_100037147 | 3300005439 | Bacteria | 3266 |
| 23 | Ga0070662_100121640 | 3300005457 | Bacteria | 2001 |
| 24 | Ga0070681_10058601 | 3300005458 | Bacteria | 3830 |
| 25 | Ga0070681_10112003 | 3300005458 | Bacteria | 2668 |
| 26 | Ga0070684_100007625 | 3300005535 | Bacteria | 8437 |
| 27 | Ga0070684_100013985 | 3300005535 | Bacteria | 6488 |
| 28 | Ga0068853_100024007 | 3300005539 | Bacteria | 5110 |
| 29 | Ga0068853_100098898 | 3300005539 | Bacteria | 2576 |
| 30 | Ga0068855_100061972 | 3300005563 | Bacteria | 4368 |
| 31 | Ga0068855_100070295 | 3300005563 | Bacteria | 4073 |
| 32 | Ga0068855_100157838 | 3300005563 | Bacteria | 2576 |
| 33 | Ga0068857_100061834 | 3300005577 | Bacteria | 3327 |
| 34 | Ga0068856_100000091 | 3300005614 | Bacteria | 85048 |
| 35 | Ga0068852_100103362 | 3300005616 | Bacteria | 2576 |
| 36 | Ga0068861_100109804 | 3300005719 | Bacteria | 2208 |
| 37 | Ga0068851_10001608 | 3300005834 | Bacteria | 9920 |
| 38 | Ga0068851_10031958 | 3300005834 | Bacteria | 2617 |
| 39 | Ga0081455_10006756 | 3300005937 | Bacteria | 12243 |
| 40 | Ga0081538_10035991 | 3300005981 | Bacteria | 3240 |
| 41 | Ga0081540_1000414 | 3300005983 | Bacteria | 42174 |
| 42 | Ga0081540_1001143 | 3300005983 | Bacteria | 23424 |
| 43 | Ga0081540_1002660 | 3300005983 | Bacteria | 14529 |
| 44 | Ga0081540_1007581 | 3300005983 | Bacteria | 7710 |
| 45 | Ga0081540_1029895 | 3300005983 | Bacteria | 3027 |
| 46 | Ga0081539_10000321 | 3300005985 | Bacteria | 106887 |
| 47 | Ga0070717_10000355 | 3300006028 | Bacteria | 29408 |
| 48 | Ga0070717_10155182 | 3300006028 | Bacteria | 1983 |
| 49 | Ga0075368_10016141 | 3300006042 | Bacteria | 2780 |
| 50 | Ga0070715_10000078 | 3300006163 | Bacteria | 27243 |
| 51 | Ga0070716_100003281 | 3300006173 | Bacteria | 7598 |
| 52 | Ga0070712_100003019 | 3300006175 | Bacteria | 10414 |
| 53 | Ga0070712_100115234 | 3300006175 | Bacteria | 2013 |
| 54 | Ga0075367_10013285 | 3300006178 | Bacteria | 4422 |
| 55 | Ga0075369_10002656 | 3300006186 | Bacteria | 6399 |
| 56 | Ga0075366_10017608 | 3300006195 | Bacteria | 4115 |
| 57 | Ga0075428_100007340 | 3300006844 | Bacteria | 12217 |
| 58 | Ga0075428_100108453 | 3300006844 | Bacteria | 3026 |
| 59 | Ga0075430_100002116 | 3300006846 | Bacteria | 16412 |
| 60 | Ga0075431_100000266 | 3300006847 | Bacteria | 40349 |
| 61 | Ga0068865_100062481 | 3300006881 | Bacteria | 2614 |
| 62 | Ga0099824_1031088 | 3300006942 | Bacteria | 2066 |
| 63 | Ga0099822_1000022 | 3300006943 | Bacteria | 64942 |
| 64 | Ga0099794_10013213 | 3300007265 | Bacteria | 3588 |
| 65 | Ga0105240_10076691 | 3300009093 | Bacteria | 4121 |
| 66 | Ga0111539_10000429 | 3300009094 | Bacteria | 52811 |
| 67 | Ga0114129_10000640 | 3300009147 | Bacteria | 43706 |
| 68 | Ga0105243_10013160 | 3300009148 | Bacteria | 6254 |
| 69 | Ga0105241_10000538 | 3300009174 | Bacteria | 28546 |
| 70 | Ga0105237_10013047 | 3300009545 | Bacteria | 8725 |
| 71 | Ga0105237_10068348 | 3300009545 | Bacteria | 3546 |
| 72 | Ga0105237_10174055 | 3300009545 | Bacteria | 2153 |
| 73 | Ga0105238_10007630 | 3300009551 | Bacteria | 10837 |
| 74 | Ga0105238_10020275 | 3300009551 | Bacteria | 6768 |
| 75 | Ga0105238_10020868 | 3300009551 | Bacteria | 6674 |
| 76 | Ga0105239_10009371 | 3300010375 | Bacteria | 11048 |
| 77 | Ga0105239_10227715 | 3300010375 | Bacteria | 2091 |
| 78 | Ga0157374_10047518 | 3300013296 | Bacteria | 3980 |
| 79 | Ga0157374_10095016 | 3300013296 | Bacteria | 2850 |
| 80 | Ga0157378_10030086 | 3300013297 | Bacteria | 4797 |
| 81 | Ga0163163_10035104 | 3300014325 | Bacteria | 4862 |
| 82 | Ga0157379_10064358 | 3300014968 | Bacteria | 3277 |
| 83 | Ga0213874_10003592 | 3300021377 | Bacteria | 3461 |
| 84 | Ga0213876_10002118 | 3300021384 | Bacteria | 11744 |
| 85 | Ga0209677_104584 | 3300025253 | Bacteria | 3924 |
| 86 | Ga0209233_1001414 | 3300025261 | Bacteria | 9463 |
| 87 | Ga0209233_1001581 | 3300025261 | Bacteria | 8917 |
| 88 | Ga0209564_1000485 | 3300025295 | Bacteria | 66032 |
| 89 | Ga0207656_10008718 | 3300025321 | Bacteria | 3745 |
| 90 | Ga0207692_10002540 | 3300025898 | Bacteria | 7010 |
| 91 | Ga0207688_10050812 | 3300025901 | Bacteria | 2322 |
| 92 | Ga0207647_10001688 | 3300025904 | Bacteria | 17020 |
| 93 | Ga0207647_10039223 | 3300025904 | Bacteria | 2990 |
| 94 | Ga0207685_10002560 | 3300025905 | Bacteria | 4196 |
| 95 | Ga0207699_10035125 | 3300025906 | Bacteria | 2850 |
| 96 | Ga0207654_10000323 | 3300025911 | Bacteria | 28628 |
| 97 | Ga0207707_10003524 | 3300025912 | Bacteria | 13859 |
| 98 | Ga0207707_10014163 | 3300025912 | Bacteria | 6949 |
| 99 | Ga0207707_10015945 | 3300025912 | Bacteria | 6553 |
| 100 | Ga0207695_10000497 | 3300025913 | Bacteria | 83894 |
| 101 | Ga0207695_10018045 | 3300025913 | Bacteria | 8170 |
| 102 | Ga0207695_10054932 | 3300025913 | Bacteria | 4154 |
| 103 | Ga0207695_10122303 | 3300025913 | Bacteria | 2569 |
| 104 | Ga0207671_10062614 | 3300025914 | Bacteria | 2763 |
| 105 | Ga0207671_10120386 | 3300025914 | Bacteria | 2006 |
| 106 | Ga0207693_10003503 | 3300025915 | Bacteria | 13399 |
| 107 | Ga0207693_10010489 | 3300025915 | Bacteria | 7519 |
| 108 | Ga0207693_10045520 | 3300025915 | Bacteria | 3448 |
| 109 | Ga0207663_10002914 | 3300025916 | Bacteria | 8272 |
| 110 | Ga0207663_10024493 | 3300025916 | Bacteria | 3476 |
| 111 | Ga0207663_10066360 | 3300025916 | Bacteria | 2310 |
| 112 | Ga0207660_10002555 | 3300025917 | Bacteria | 11965 |
| 113 | Ga0207660_10060552 | 3300025917 | Bacteria | 2722 |
| 114 | Ga0207662_10022522 | 3300025918 | Bacteria | 3613 |
| 115 | Ga0207657_10002910 | 3300025919 | Bacteria | 18383 |
| 116 | Ga0207657_10008531 | 3300025919 | Bacteria | 10390 |
| 117 | Ga0207657_10057823 | 3300025919 | Bacteria | 3340 |
| 118 | Ga0207652_10008399 | 3300025921 | Bacteria | 8309 |
| 119 | Ga0207652_10018037 | 3300025921 | Bacteria | 5785 |
| 120 | Ga0207652_10018744 | 3300025921 | Bacteria | 5680 |
| 121 | Ga0207694_10000212 | 3300025924 | Bacteria | 56506 |
| 122 | Ga0207694_10009680 | 3300025924 | Bacteria | 7266 |
| 123 | Ga0207694_10074599 | 3300025924 | Bacteria | 2655 |
| 124 | Ga0207687_10047616 | 3300025927 | Bacteria | 2973 |
| 125 | Ga0207687_10088865 | 3300025927 | Bacteria | 2249 |
| 126 | Ga0207700_10025237 | 3300025928 | Bacteria | 4125 |
| 127 | Ga0207700_10048143 | 3300025928 | Bacteria | 3164 |
| 128 | Ga0207700_10118988 | 3300025928 | Bacteria | 2139 |
| 129 | Ga0207644_10034045 | 3300025931 | Bacteria | 3565 |
| 130 | Ga0207690_10085552 | 3300025932 | Bacteria | 2214 |
| 131 | Ga0207709_10024068 | 3300025935 | Bacteria | 3473 |
| 132 | Ga0207709_10051550 | 3300025935 | Bacteria | 2523 |
| 133 | Ga0207665_10000361 | 3300025939 | Bacteria | 31561 |
| 134 | Ga0207691_10008900 | 3300025940 | Bacteria | 9639 |
| 135 | Ga0207661_10004270 | 3300025944 | Bacteria | 10004 |
| 136 | Ga0207667_10007538 | 3300025949 | Bacteria | 13058 |
| 137 | Ga0207667_10010126 | 3300025949 | Bacteria | 11041 |
| 138 | Ga0207667_10041779 | 3300025949 | Bacteria | 4876 |
| 139 | Ga0207640_10011719 | 3300025981 | Bacteria | 4971 |
| 140 | Ga0207639_10068006 | 3300026041 | Bacteria | 2774 |
| 141 | Ga0207639_10082674 | 3300026041 | Bacteria | 2546 |
| 142 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 143 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 144 | Ga0207702_10007932 | 3300026078 | Bacteria | 8996 |
| 145 | Ga0207674_10069601 | 3300026116 | Bacteria | 3539 |
| 146 | Ga0207674_10069718 | 3300026116 | Bacteria | 3536 |
| 147 | Ga0207683_10000639 | 3300026121 | Bacteria | 32031 |
| 148 | Ga0207698_10042373 | 3300026142 | Bacteria | 3400 |
| 149 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 150 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 151 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 152 | Ga0207428_10028479 | 3300027907 | Bacteria | 4642 |
| 153 | Ga0268266_10085788 | 3300028379 | Bacteria | 2751 |
| 154 | Ga0268264_10099651 | 3300028381 | Bacteria | 2522 |
| 155 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 156 | Ga0265338_10000328 | 3300028800 | Bacteria | 86546 |
| 157 | Ga0265338_10048157 | 3300028800 | Bacteria | 3881 |
| 158 | Ga0265330_10006196 | 3300031235 | Bacteria | 5920 |
| 159 | Ga0265332_10015786 | 3300031238 | Bacteria | 3333 |
| 160 | Ga0265328_10000656 | 3300031239 | Bacteria | 16072 |
| 161 | Ga0265325_10004970 | 3300031241 | Bacteria | 8285 |
| 162 | Ga0265325_10009754 | 3300031241 | Bacteria | 5595 |
| 163 | Ga0265325_10030977 | 3300031241 | Bacteria | 2866 |
| 164 | Ga0265339_10000296 | 3300031249 | Bacteria | 40500 |
| 165 | Ga0265316_10020836 | 3300031344 | Bacteria | 5568 |
| 166 | Ga0307513_10112096 | 3300031456 | Bacteria | 2719 |
| 167 | Ga0265313_10000242 | 3300031595 | Bacteria | 59524 |
| 168 | Ga0307508_10014686 | 3300031616 | Bacteria | 7144 |
| 169 | Ga0265314_10027164 | 3300031711 | Bacteria | 4289 |
| 170 | Ga0265314_10057208 | 3300031711 | Bacteria | 2680 |
| 171 | Ga0265342_10001688 | 3300031712 | Bacteria | 20283 |
| 172 | Ga0316578_10035596 | 3300031728 | Bacteria | 2863 |
| 173 | Ga0307411_10092328 | 3300032005 | Bacteria | 2117 |
| 174 | Ga0307510_10004348 | 3300033180 | Bacteria | 16677 |
| 175 | Ga0307510_10047949 | 3300033180 | Bacteria | 4565 |
| 176 | Ga0307510_10114972 | 3300033180 | Bacteria | 2417 |
| 177 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 178 | Ga0373934_0008722 | 3300035086 | Bacteria | 3784 |
| 179 | Ga0373934_0021845 | 3300035086 | Bacteria | 2467 |
| 180 | Ga0373944_0001292 | 3300035089 | Bacteria | 6297 |
| 181 | Ga0373923_0003228 | 3300035111 | Bacteria | 5188 |
| 182 | Ga0373923_0016815 | 3300035111 | Bacteria | 2787 |
| 183 | Ga0373936_0003430 | 3300035113 | Bacteria | 5942 |
| 184 | Ga0373936_0004950 | 3300035113 | Bacteria | 5017 |
| 185 | Ga0373936_0005197 | 3300035113 | Bacteria | 4896 |
| 186 | Ga0373945_0001879 | 3300035116 | Bacteria | 6511 |
| 187 | Ga0373954_0003807 | 3300035118 | Bacteria | 6444 |
| 188 | Ga0373954_0008528 | 3300035118 | Bacteria | 4501 |
| 189 | Ga0373943_0003574 | 3300035170 | Bacteria | 7074 |
| 190 | Ga0373943_0003740 | 3300035170 | Bacteria | 6921 |
| 191 | Ga0373943_0014816 | 3300035170 | Bacteria | 3537 |
| 192 | Ga0373943_0025435 | 3300035170 | Bacteria | 2767 |
| 193 | Ga0373946_0000911 | 3300035171 | Bacteria | 10159 |
| 194 | Ga0373946_0006180 | 3300035171 | Bacteria | 4337 |
| 195 | Ga0373955_0000880 | 3300035172 | Bacteria | 12889 |
| 196 | Ga0373955_0001476 | 3300035172 | Bacteria | 9994 |
| 197 | Ga0373924_0015299 | 3300035410 | Bacteria | 2915 |
| 198 | Ga0373935_0000185 | 3300035692 | Bacteria | 29355 |
| 199 | Ga0373935_0000259 | 3300035692 | Bacteria | 26229 |
| 200 | Ga0373935_0005095 | 3300035692 | Bacteria | 7744 |
| 201 | Ga0373935_0018143 | 3300035692 | Bacteria | 4277 |
| 202 | Ga0373927_0000339 | 3300035695 | Bacteria | 36731 |
| 203 | Ga0373927_0005659 | 3300035695 | Bacteria | 8590 |
| 204 | Ga0373927_0015251 | 3300035695 | Bacteria | 5076 |
| 205 | Ga0373933_0010044 | 3300035724 | Bacteria | 5182 |
| 206 | Ga0373933_0012994 | 3300035724 | Bacteria | 4606 |
| 207 | Ga0373947_0000217 | 3300035725 | Bacteria | 32254 |
| 208 | Ga0373947_0001402 | 3300035725 | Bacteria | 14825 |
| 209 | Ga0373947_0022620 | 3300035725 | Bacteria | 3647 |
| 210 | Ga0373947_0023418 | 3300035725 | Bacteria | 3591 |
| 211 | Ga0373947_0026840 | 3300035725 | Bacteria | 3368 |
| 212 | Ga0373947_0033394 | 3300035725 | Bacteria | 3037 |
| 213 | Ga0373947_0062544 | 3300035725 | Bacteria | 2265 |
| 214 | Ga0373937_0000068 | 3300036401 | Bacteria | 94138 |
| 215 | Ga0373937_0164886 | 3300036401 | Bacteria | 2077 |
| 216 | Ga0316582_0014115 | 3300036647 | Bacteria | 4523 |
| 217 | Ga0316584_0000295 | 3300036712 | Bacteria | 25457 |
| 218 | Ga0373925_0002364 | 3300037068 | Bacteria | 15132 |
| 219 | Ga0373925_0017146 | 3300037068 | Bacteria | 5243 |
| 220 | Ga0373925_0027338 | 3300037068 | Bacteria | 4175 |
| 221 | Ga0373925_0029284 | 3300037068 | Bacteria | 4039 |
| 222 | Ga0395900_0001924 | 3300037418 | Bacteria | 23564 |
| 223 | Ga0436364_0564128 | 3300037853 | Bacteria | 4775 |
| 224 | Ga0436365_0028690 | 3300039437 | Bacteria | 17107 |
| 225 | Ga0436365_0396709 | 3300039437 | Bacteria | 84982 |
| 226 | Ga0436365_1783153 | 3300039437 | Bacteria | 7662 |
| 227 | Ga0436361_0201292 | 3300039447 | Bacteria | 5043 |
| 228 | Ga0436363_0979840 | 3300039450 | Bacteria | 10570 |
| 229 | Ga0436363_1183593 | 3300039450 | Bacteria | 5753 |
| 230 | Ga0436362_0087827 | 3300039453 | Bacteria | 3696 |
| 231 | Ga0466972_0009157 | 3300044658 | Bacteria | 4973 |
| 232 | Ga0466972_0033035 | 3300044658 | Bacteria | 2538 |
| 233 | Ga0466966_0005226 | 3300044684 | Bacteria | 8533 |
| 234 | Ga0466966_0071655 | 3300044684 | Bacteria | 2171 |
| 235 | Ga0466961_0000149 | 3300044693 | Bacteria | 47561 |
| 236 | Ga0466960_0003292 | 3300044901 | Bacteria | 6199 |
| 237 | Ga0466959_0016807 | 3300045049 | Bacteria | 5354 |
| 238 | Ga0466967_0155660 | 3300045976 | Bacteria | 2140 |
| 239 | Ga0495592_0004767 | 3300046454 | Bacteria | 9955 |
| 240 | Ga0495592_0031316 | 3300046454 | Bacteria | 4020 |
| 241 | Ga0495603_0000352 | 3300046455 | Bacteria | 24722 |
| 242 | Ga0495603_0011088 | 3300046455 | Bacteria | 5464 |
| 243 | Ga0495603_0033308 | 3300046455 | Bacteria | 3100 |
| 244 | Ga0495629_0003719 | 3300046459 | Bacteria | 11498 |
| 245 | Ga0495629_0005407 | 3300046459 | Bacteria | 9524 |
| 246 | Ga0495629_0006765 | 3300046459 | Bacteria | 8473 |
| 247 | Ga0495629_0033983 | 3300046459 | Bacteria | 3606 |
| 248 | Ga0495638_0002610 | 3300046460 | Bacteria | 14544 |
| 249 | Ga0495641_0029668 | 3300046461 | Bacteria | 2633 |
| 250 | Ga0495651_0065336 | 3300046462 | Bacteria | 2778 |
| 251 | Ga0495651_0087461 | 3300046462 | Bacteria | 2343 |
| 252 | Ga0495653_0002829 | 3300046463 | Bacteria | 13841 |
| 253 | Ga0495653_0005358 | 3300046463 | Bacteria | 10437 |
| 254 | Ga0495653_0013792 | 3300046463 | Bacteria | 6586 |
| 255 | Ga0495653_0020335 | 3300046463 | Bacteria | 5382 |
| 256 | Ga0495653_0052870 | 3300046463 | Bacteria | 3111 |
| 257 | Ga0495580_0010063 | 3300046472 | Bacteria | 7391 |
| 258 | Ga0495580_0049877 | 3300046472 | Bacteria | 2960 |
| 259 | Ga0495580_0116984 | 3300046472 | Bacteria | 1852 |
| 260 | Ga0495582_0038387 | 3300046473 | Bacteria | 2635 |
| 261 | Ga0495639_0001973 | 3300046475 | Bacteria | 9084 |
| 262 | Ga0495662_0000872 | 3300046476 | Bacteria | 14723 |
| 263 | Ga0495662_0002537 | 3300046476 | Bacteria | 9212 |
| 264 | Ga0495662_0003626 | 3300046476 | Bacteria | 7784 |
| 265 | Ga0495662_0039364 | 3300046476 | Bacteria | 2284 |
| 266 | Ga0495664_0000105 | 3300046477 | Bacteria | 41914 |
| 267 | Ga0495664_0001875 | 3300046477 | Bacteria | 11171 |
| 268 | Ga0495664_0002434 | 3300046477 | Bacteria | 10005 |
| 269 | Ga0495664_0010696 | 3300046477 | Bacteria | 5154 |
| 270 | Ga0495664_0013349 | 3300046477 | Bacteria | 4658 |
| 271 | Ga0495584_0054511 | 3300046491 | Bacteria | 2012 |
| 272 | Ga0495585_0011553 | 3300046492 | Bacteria | 5225 |
| 273 | Ga0495594_0001257 | 3300046499 | Bacteria | 13294 |
| 274 | Ga0495594_0005909 | 3300046499 | Bacteria | 6288 |
| 275 | Ga0495607_0038390 | 3300046501 | Bacteria | 2869 |
| 276 | Ga0495607_0065170 | 3300046501 | Bacteria | 2055 |
| 277 | Ga0495606_0066113 | 3300046507 | Bacteria | 2294 |
| 278 | Ga0495608_0000020 | 3300046511 | Bacteria | 169036 |
| 279 | Ga0495608_0026634 | 3300046511 | Bacteria | 3940 |
| 280 | Ga0495608_0045021 | 3300046511 | Bacteria | 2943 |
| 281 | Ga0495618_0001074 | 3300046514 | Bacteria | 18661 |
| 282 | Ga0495618_0001471 | 3300046514 | Bacteria | 15799 |
| 283 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 284 | Ga0495628_0030101 | 3300046516 | Bacteria | 4397 |
| 285 | Ga0495628_0079520 | 3300046516 | Bacteria | 2549 |
| 286 | Ga0495630_0001784 | 3300046517 | Bacteria | 15054 |
| 287 | Ga0495630_0016855 | 3300046517 | Bacteria | 5345 |
| 288 | Ga0495630_0022789 | 3300046517 | Bacteria | 4626 |
| 289 | Ga0495630_0134092 | 3300046517 | Bacteria | 1881 |
| 290 | Ga0495643_0020957 | 3300046522 | Bacteria | 3759 |
| 291 | Ga0495644_0003488 | 3300046523 | Bacteria | 6222 |
| 292 | Ga0495648_0001680 | 3300046524 | Bacteria | 21407 |
| 293 | Ga0495648_0002765 | 3300046524 | Bacteria | 15842 |
| 294 | Ga0495648_0042142 | 3300046524 | Bacteria | 2874 |
| 295 | Ga0495666_0012289 | 3300046526 | Bacteria | 4269 |
| 296 | Ga0495666_0014789 | 3300046526 | Bacteria | 3884 |
| 297 | Ga0495666_0015097 | 3300046526 | Bacteria | 3844 |
| 298 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 299 | Ga0495652_0005722 | 3300046529 | Bacteria | 11643 |
| 300 | Ga0495652_0045811 | 3300046529 | Bacteria | 3758 |
| 301 | Ga0495665_0000361 | 3300046531 | Bacteria | 22971 |
| 302 | Ga0495665_0004993 | 3300046531 | Bacteria | 7151 |
| 303 | Ga0495640_0000027 | 3300046533 | Bacteria | 90638 |
| 304 | Ga0495640_0003002 | 3300046533 | Bacteria | 13580 |
| 305 | Ga0495640_0010171 | 3300046533 | Bacteria | 7284 |
| 306 | Ga0495587_0000017 | 3300046536 | Bacteria | 172923 |
| 307 | Ga0495587_0019103 | 3300046536 | Bacteria | 4245 |
| 308 | Ga0495645_0000212 | 3300046543 | Bacteria | 41774 |
| 309 | Ga0495645_0006115 | 3300046543 | Bacteria | 8329 |
| 310 | Ga0495645_0013655 | 3300046543 | Bacteria | 5753 |
| 311 | Ga0495645_0015805 | 3300046543 | Bacteria | 5374 |
| 312 | Ga0495622_0028261 | 3300046557 | Bacteria | 2618 |
| 313 | Ga0495622_0043128 | 3300046557 | Bacteria | 2097 |
| 314 | Ga0495667_0000031 | 3300046559 | Bacteria | 147377 |
| 315 | Ga0495667_0010860 | 3300046559 | Bacteria | 6156 |
| 316 | Ga0495667_0018667 | 3300046559 | Bacteria | 4683 |
| 317 | Ga0495667_0102038 | 3300046559 | Bacteria | 1856 |
| 318 | Ga0495667_0119568 | 3300046559 | Bacteria | 1701 |
| 319 | Ga0495634_0000006 | 3300046642 | Bacteria | 172775 |
| 320 | Ga0495634_0000249 | 3300046642 | Bacteria | 50835 |
| 321 | Ga0495634_0039660 | 3300046642 | Bacteria | 3206 |
| 322 | Ga0495634_0045962 | 3300046642 | Bacteria | 2948 |
| 323 | Ga0495611_0008507 | 3300046648 | Bacteria | 4339 |
| 324 | Ga0495625_0021332 | 3300046660 | Bacteria | 4990 |
| 325 | Ga0495635_0000154 | 3300046663 | Bacteria | 41886 |
| 326 | Ga0495635_0002882 | 3300046663 | Bacteria | 11809 |
| 327 | Ga0495635_0011527 | 3300046663 | Bacteria | 6197 |
| 328 | Ga0495659_0003707 | 3300046664 | Bacteria | 4856 |
| 329 | Ga0495588_0016229 | 3300046674 | Bacteria | 3597 |
| 330 | Ga0495657_0000828 | 3300046675 | Bacteria | 27353 |
| 331 | Ga0495657_0037997 | 3300046675 | Bacteria | 3314 |
| 332 | Ga0495599_0000051 | 3300046678 | Bacteria | 81853 |
| 333 | Ga0495599_0001556 | 3300046678 | Bacteria | 13209 |
| 334 | Ga0495599_0015398 | 3300046678 | Bacteria | 4745 |
| 335 | Ga0495623_0001078 | 3300046679 | Bacteria | 18463 |
| 336 | Ga0495623_0015085 | 3300046679 | Bacteria | 4996 |
| 337 | Ga0495646_0000102 | 3300046680 | Bacteria | 41798 |
| 338 | Ga0495646_0038456 | 3300046680 | Bacteria | 2954 |
| 339 | Ga0495658_0001058 | 3300046683 | Bacteria | 14532 |
| 340 | Ga0495613_0000929 | 3300046689 | Bacteria | 22466 |
| 341 | Ga0495624_0000865 | 3300046690 | Bacteria | 24061 |
| 342 | Ga0495624_0019259 | 3300046690 | Bacteria | 4559 |
| 343 | Ga0495670_0002486 | 3300046691 | Bacteria | 9106 |
| 344 | Ga0495649_0013626 | 3300046694 | Bacteria | 4687 |
| 345 | Ga0495600_0000069 | 3300046809 | Bacteria | 58754 |
| 346 | Ga0495600_0019691 | 3300046809 | Bacteria | 4312 |
| 347 | Ga0495660_0026239 | 3300046810 | Bacteria | 3304 |
| 348 | Ga0495581_0003094 | 3300047315 | Bacteria | 9519 |
| 349 | Ga0495581_0006025 | 3300047315 | Bacteria | 7027 |
| 350 | Ga0495581_0012170 | 3300047315 | Bacteria | 4980 |
| 351 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 352 | Ga0495604_0017303 | 3300047317 | Bacteria | 5769 |
| 353 | Ga0495604_0030600 | 3300047317 | Bacteria | 4274 |
| 354 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 355 | Ga0495674_0001854 | 3300047319 | Bacteria | 20818 |
| 356 | Ga0495674_0004728 | 3300047319 | Bacteria | 13095 |
| 357 | Ga0495674_0007497 | 3300047319 | Bacteria | 10418 |
| 358 | Ga0495674_0042508 | 3300047319 | Bacteria | 4053 |
| 359 | Ga0495674_0086896 | 3300047319 | Bacteria | 2677 |
| 360 | Ga0495672_0020995 | 3300047320 | Bacteria | 4266 |
| 361 | Ga0495676_0085600 | 3300047321 | Bacteria | 2374 |
| 362 | Ga0495680_0002632 | 3300047322 | Bacteria | 18223 |
| 363 | Ga0495680_0005755 | 3300047322 | Bacteria | 11605 |
| 364 | Ga0495680_0126186 | 3300047322 | Bacteria | 1884 |
| 365 | Ga0495675_0000216 | 3300047444 | Bacteria | 41783 |
| 366 | Ga0495675_0002807 | 3300047444 | Bacteria | 10441 |
| 367 | Ga0495675_0003321 | 3300047444 | Bacteria | 9678 |
| 368 | Ga0495684_0000009 | 3300047471 | Bacteria | 199436 |
| 369 | Ga0495684_0000893 | 3300047471 | Bacteria | 24119 |
| 370 | Ga0495684_0009436 | 3300047471 | Bacteria | 7533 |
| 371 | Ga0495684_0010049 | 3300047471 | Bacteria | 7315 |
| 372 | Ga0495686_0007020 | 3300047472 | Bacteria | 8508 |
| 373 | Ga0495686_0038224 | 3300047472 | Bacteria | 3071 |
| 374 | Ga0495686_0078047 | 3300047472 | Bacteria | 2027 |
| 375 | Ga0495593_0000034 | 3300047673 | Bacteria | 57993 |
| 376 | Ga0495593_0003510 | 3300047673 | Bacteria | 9379 |
| 377 | Ga0495593_0012736 | 3300047673 | Bacteria | 4801 |
| 378 | Ga0495593_0017351 | 3300047673 | Bacteria | 4052 |
| 379 | Ga0495602_0000373 | 3300048088 | Bacteria | 41729 |
| 380 | Ga0495602_0075882 | 3300048088 | Bacteria | 2851 |
| 381 | Ga0495602_0089934 | 3300048088 | Bacteria | 2552 |
| 382 | Ga0495602_0135050 | 3300048088 | Bacteria | 1961 |
| 383 | Ga0496101_0029634 | 3300048904 | Bacteria | 3828 |
| 384 | Ga0496102_0112526 | 3300048905 | Bacteria | 2539 |
| 385 | Ga0496103_0005710 | 3300048906 | Bacteria | 7435 |
| 386 | Ga0496103_0012907 | 3300048906 | Bacteria | 4954 |
| 387 | Ga0496104_0010270 | 3300048907 | Bacteria | 8364 |
| 388 | Ga0496104_0038208 | 3300048907 | Bacteria | 4491 |
| 389 | Ga0496104_0116570 | 3300048907 | Bacteria | 2563 |
| 390 | Ga0496105_0016293 | 3300048908 | Bacteria | 5932 |
| 391 | Ga0496105_0021511 | 3300048908 | Bacteria | 5219 |
| 392 | Ga0496106_0001165 | 3300048909 | Bacteria | 19535 |
| 393 | Ga0496106_0048853 | 3300048909 | Bacteria | 3187 |
| 394 | Ga0496106_0133210 | 3300048909 | Bacteria | 1950 |
| 395 | Ga0496108_0003943 | 3300048911 | Bacteria | 11912 |
| 396 | Ga0496109_0001766 | 3300048912 | Bacteria | 17962 |
| 397 | Ga0496110_0016568 | 3300048913 | Bacteria | 6155 |
| 398 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 399 | Ga0496112_0079529 | 3300048915 | Bacteria | 3243 |
| 400 | Ga0496112_0125924 | 3300048915 | Bacteria | 2533 |
| 401 | Ga0496112_0129586 | 3300048915 | Bacteria | 2493 |
| 402 | Ga0496114_0007505 | 3300048917 | Bacteria | 8623 |
| 403 | Ga0496114_0064612 | 3300048917 | Bacteria | 3065 |
| 404 | Ga0496115_0039632 | 3300048918 | Bacteria | 3742 |
| 405 | Ga0496115_0098202 | 3300048918 | Bacteria | 2398 |
| 406 | Ga0496116_0003364 | 3300048919 | Bacteria | 15879 |
| 407 | Ga0496117_0054433 | 3300048920 | Bacteria | 2803 |
| 408 | Ga0496118_0017089 | 3300048921 | Bacteria | 6622 |
| 409 | Ga0496119_0006190 | 3300048922 | Bacteria | 11190 |
| 410 | Ga0496119_0011151 | 3300048922 | Bacteria | 7485 |
| 411 | Ga0496120_0017714 | 3300048923 | Bacteria | 4606 |
| 412 | Ga0496121_0001497 | 3300048924 | Bacteria | 39336 |
| 413 | Ga0496121_0001742 | 3300048924 | Bacteria | 35564 |
| 414 | Ga0496121_0008145 | 3300048924 | Bacteria | 12448 |
| 415 | Ga0496121_0019504 | 3300048924 | Bacteria | 6776 |
| 416 | Ga0496121_0030095 | 3300048924 | Bacteria | 4996 |
| 417 | Ga0496121_0045511 | 3300048924 | Bacteria | 3769 |
| 418 | Ga0496122_0004307 | 3300048925 | Bacteria | 17825 |
| 419 | Ga0496123_0001264 | 3300048926 | Bacteria | 36241 |
| 420 | Ga0496124_0014417 | 3300048927 | Bacteria | 7643 |
| 421 | Ga0496124_0061827 | 3300048927 | Bacteria | 3137 |
| 422 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 423 | Ga0496125_0038467 | 3300048928 | Bacteria | 4139 |
| 424 | Ga0496125_0056102 | 3300048928 | Bacteria | 3202 |
| 425 | Ga0496126_0006113 | 3300048929 | Bacteria | 13500 |
| 426 | Ga0496126_0010521 | 3300048929 | Bacteria | 9686 |
| 427 | Ga0496126_0042173 | 3300048929 | Bacteria | 4215 |
| 428 | Ga0496126_0076252 | 3300048929 | Bacteria | 2974 |
| 429 | Ga0501031_0044273 | 3300049568 | Bacteria | 2904 |
| 430 | Ga0501032_0002005 | 3300049569 | Bacteria | 16045 |
| 431 | Ga0501033_0000249 | 3300049570 | Bacteria | 52045 |
| 432 | Ga0501033_0020597 | 3300049570 | Bacteria | 4983 |
| 433 | Ga0501034_0001247 | 3300049571 | Bacteria | 34598 |
| 434 | Ga0501034_0008453 | 3300049571 | Bacteria | 10873 |
| 435 | Ga0501036_0056173 | 3300049572 | Bacteria | 3335 |
| 436 | Ga0501036_0079526 | 3300049572 | Bacteria | 2772 |
| 437 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 438 | Ga0501038_0000160 | 3300049574 | Bacteria | 57443 |
| 439 | Ga0501038_0101953 | 3300049574 | Bacteria | 2389 |
| 440 | Ga0501041_0095311 | 3300049577 | Bacteria | 1839 |
| 441 | Ga0501043_0000278 | 3300049579 | Bacteria | 46214 |
| 442 | Ga0501043_0006651 | 3300049579 | Bacteria | 9249 |
| 443 | Ga0501046_0000937 | 3300049580 | Bacteria | 28581 |
| 444 | Ga0501046_0002541 | 3300049580 | Bacteria | 17058 |
| 445 | Ga0501047_0000275 | 3300049581 | Bacteria | 59536 |
| 446 | Ga0501047_0000688 | 3300049581 | Bacteria | 35266 |
| 447 | Ga0501047_0007951 | 3300049581 | Bacteria | 9999 |
| 448 | Ga0501047_0024669 | 3300049581 | Bacteria | 5773 |
| 449 | Ga0501047_0032791 | 3300049581 | Bacteria | 5014 |
| 450 | Ga0501048_0001248 | 3300049582 | Bacteria | 19253 |
| 451 | Ga0501048_0001846 | 3300049582 | Bacteria | 16054 |
| 452 | Ga0501067_0000258 | 3300049583 | Bacteria | 28937 |
| 453 | Ga0501069_0002032 | 3300049585 | Bacteria | 10137 |
| 454 | Ga0501070_0002548 | 3300049586 | Bacteria | 15964 |
| 455 | Ga0501070_0002926 | 3300049586 | Bacteria | 14858 |
| 456 | Ga0501070_0013913 | 3300049586 | Bacteria | 6774 |
| 457 | Ga0501072_0005621 | 3300049588 | Bacteria | 9541 |
| 458 | Ga0501072_0006863 | 3300049588 | Bacteria | 8639 |
| 459 | Ga0501072_0008585 | 3300049588 | Bacteria | 7753 |
| 460 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 461 | Ga0501073_0017405 | 3300049589 | Bacteria | 5206 |
| 462 | Ga0501074_0000203 | 3300049590 | Bacteria | 32417 |
| 463 | Ga0501074_0001612 | 3300049590 | Bacteria | 15274 |
| 464 | Ga0501074_0089424 | 3300049590 | Bacteria | 2205 |
| 465 | Ga0501075_0032818 | 3300049591 | Bacteria | 3860 |
| 466 | Ga0501076_0017661 | 3300049592 | Bacteria | 5423 |
| 467 | Ga0501076_0018366 | 3300049592 | Bacteria | 5330 |
| 468 | Ga0501076_0104906 | 3300049592 | Bacteria | 2281 |
| 469 | Ga0501077_0003492 | 3300049593 | Bacteria | 9437 |
| 470 | Ga0501079_0000451 | 3300049741 | Bacteria | 26871 |
| 471 | Ga0501079_0013641 | 3300049741 | Bacteria | 6196 |
| 472 | Ga0501080_0000082 | 3300049742 | Bacteria | 63972 |
| 473 | Ga0501080_0033711 | 3300049742 | Bacteria | 4780 |
| 474 | Ga0501080_0037908 | 3300049742 | Bacteria | 4501 |
| 475 | Ga0501081_0000145 | 3300049743 | Bacteria | 32074 |
| 476 | Ga0501083_0001798 | 3300049744 | Bacteria | 14667 |
| 477 | Ga0501035_0000766 | 3300049822 | Bacteria | 34513 |
| 478 | Ga0501035_0015153 | 3300049822 | Bacteria | 7115 |
| 479 | Ga0501035_0029377 | 3300049822 | Bacteria | 5013 |
| 480 | Ga0501044_0042166 | 3300049823 | Bacteria | 4749 |
| 481 | Ga0501044_0089629 | 3300049823 | Bacteria | 3104 |
| 482 | Ga0501045_0018377 | 3300049824 | Bacteria | 4973 |
| 483 | nmdc:mga06z11_23611_c1 | 3300050494 | Bacteria | 2892 |
| 484 | nmdc:mga07m45_19822_c1 | 3300050496 | Bacteria | 3647 |
| 485 | nmdc:mga05p37_33991_c1 | 3300050507 | Bacteria | 6246 |
| 486 | nmdc:mga0qj67_101_c1 | 3300050509 | Bacteria | 57355 |
| 487 | nmdc:mga06r32_64_c1 | 3300050510 | Bacteria | 67984 |
| 488 | nmdc:mga08y16_5017_c1 | 3300050511 | Bacteria | 13840 |
| 489 | nmdc:mga0n895_149168_c1 | 3300050512 | Bacteria | 2368 |
| 490 | Ga0495601_0000020 | 3300053077 | Bacteria | 160011 |
| 491 | Ga0495601_0003525 | 3300053077 | Bacteria | 8997 |
| 492 | Ga0495601_0003562 | 3300053077 | Bacteria | 8954 |
| 493 | Ga0495601_0023795 | 3300053077 | Bacteria | 3766 |
| 494 | Ga0495601_0030733 | 3300053077 | Bacteria | 3336 |
| 495 | Ga0495612_0000030 | 3300053078 | Bacteria | 81917 |
| 496 | Ga0495612_0001208 | 3300053078 | Bacteria | 10642 |
| 497 | Ga0495612_0003728 | 3300053078 | Bacteria | 6331 |
| 498 | Ga0495612_0009929 | 3300053078 | Bacteria | 3854 |
| 499 | Ga0495595_0000125 | 3300053084 | Bacteria | 33101 |
| 500 | Ga0495595_0020921 | 3300053084 | Bacteria | 2852 |
| 501 | Ga0495619_0000216 | 3300053085 | Bacteria | 41892 |
| 502 | Ga0495619_0009736 | 3300053085 | Bacteria | 6058 |
| 503 | Ga0495619_0016867 | 3300053085 | Bacteria | 4625 |
| 504 | Ga0495619_0051124 | 3300053085 | Bacteria | 2730 |
| 505 | Ga0500643_000267 | 3300053087 | Bacteria | 46005 |
| 506 | Ga0500583_0005389 | 3300053092 | Bacteria | 4283 |
| 507 | Ga0500651_0053755 | 3300053093 | Bacteria | 2525 |
| 508 | Ga0500566_0000185 | 3300053094 | Bacteria | 32171 |
| 509 | Ga0500641_0017847 | 3300053096 | Bacteria | 2661 |
| 510 | Ga0500556_0000202 | 3300053104 | Bacteria | 48694 |
| 511 | Ga0500556_0000561 | 3300053104 | Bacteria | 24816 |
| 512 | Ga0500557_000041 | 3300053105 | Bacteria | 64885 |
| 513 | Ga0500572_000384 | 3300053111 | Bacteria | 15705 |
| 514 | Ga0500592_000548 | 3300053116 | Bacteria | 6204 |
| 515 | Ga0500593_001184 | 3300053117 | Bacteria | 9405 |
| 516 | Ga0500595_001914 | 3300053119 | Bacteria | 10728 |
| 517 | Ga0500595_011523 | 3300053119 | Bacteria | 3458 |
| 518 | Ga0500608_000908 | 3300053122 | Bacteria | 10662 |
| 519 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 520 | Ga0500642_0000140 | 3300053130 | Bacteria | 32282 |
| 521 | Ga0500652_001843 | 3300053131 | Bacteria | 6407 |
| 522 | Ga0500559_0000863 | 3300053136 | Bacteria | 19480 |
| 523 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 524 | Ga0500577_0000127 | 3300053142 | Bacteria | 18475 |
| 525 | Ga0500604_0009955 | 3300053151 | Bacteria | 2537 |
| 526 | Ga0500616_0000166 | 3300053153 | Bacteria | 110141 |
| 527 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 528 | Ga0500636_0005367 | 3300053177 | Bacteria | 7311 |
| 529 | Ga0500637_0000121 | 3300053178 | Bacteria | 28204 |
| 530 | Ga0500637_0005097 | 3300053178 | Bacteria | 6327 |
| 531 | Ga0500625_020365 | 3300053729 | Bacteria | 3120 |
| 532 | Ga0500599_000209 | 3300053736 | Bacteria | 5475 |
| 533 | Ga0501082_0013621 | 3300060353 | Bacteria | 6989 |
| 534 | Ga0466962_0024652 | 3300061719 | Bacteria | 2888 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053077 | Ga0495601_0030733 | Ga0495601_0030733_29_1438 | 393 |
| 2 | 3300005439 | Ga0070711_100037147 | Ga0070711_1000371475 | 401 |
| 3 | 3300025916 | Ga0207663_10066360 | Ga0207663_100663603 | 401 |
| 4 | 3300050512 | nmdc:mga0n895_149168_c1 | nmdc:mga0n895_149168_c1_135_1397 | 401 |
| 5 | 3300053729 | Ga0500625_020365 | Ga0500625_020365_540_2003 | 417 |
| 6 | 3300046559 | Ga0495667_0119568 | Ga0495667_0119568_12_1514 | 418 |
| 7 | 3300047472 | Ga0495686_0078047 | Ga0495686_0078047_340_1875 | 419 |
| 8 | 3300006028 | Ga0070717_10155182 | Ga0070717_101551822 | 420 |
| 9 | 3300032005 | Ga0307411_10092328 | Ga0307411_100923282 | 420 |
| 10 | 3300046472 | Ga0495580_0116984 | Ga0495580_0116984_321_1832 | 423 |
| 11 | 3300048913 | Ga0496110_0016568 | Ga0496110_0016568_1087_2880 | 449 |
| 12 | 3300048907 | Ga0496104_0038208 | Ga0496104_0038208_1431_3224 | 451 |
| 13 | 3300048917 | Ga0496114_0064612 | Ga0496114_0064612_54_1847 | 451 |
| 14 | 3300061719 | Ga0466962_0024652 | Ga0466962_0024652_40_1635 | 452 |
| 15 | 3300048915 | Ga0496112_0125924 | Ga0496112_0125924_360_2069 | 454 |
| 16 | 3300048905 | Ga0496102_0112526 | Ga0496102_0112526_37_1746 | 455 |
| 17 | 3300035725 | Ga0373947_0022620 | Ga0373947_0022620_1012_2724 | 457 |
| 18 | 3300046517 | Ga0495630_0022789 | Ga0495630_0022789_276_1988 | 457 |
| 19 | 3300047319 | Ga0495674_0042508 | Ga0495674_0042508_2267_3979 | 457 |
| 20 | 3300053077 | Ga0495601_0003525 | Ga0495601_0003525_4735_6447 | 457 |
| 21 | 3300049588 | Ga0501072_0005621 | Ga0501072_0005621_124_1935 | 458 |
| 22 | 3300049571 | Ga0501034_0001247 | Ga0501034_0001247_575_2251 | 459 |
| 23 | 3300049581 | Ga0501047_0000688 | Ga0501047_0000688_33484_35160 | 459 |
| 24 | 3300049582 | Ga0501048_0001846 | Ga0501048_0001846_1292_2968 | 459 |
| 25 | 3300049744 | Ga0501083_0001798 | Ga0501083_0001798_58_1734 | 459 |
| 26 | 3300046501 | Ga0495607_0038390 | Ga0495607_0038390_543_2357 | 461 |
| 27 | 3300035170 | Ga0373943_0003574 | Ga0373943_0003574_2087_3901 | 463 |
| 28 | 3300035692 | Ga0373935_0018143 | Ga0373935_0018143_87_1901 | 463 |
| 29 | 3300037068 | Ga0373925_0017146 | Ga0373925_0017146_989_2803 | 463 |
| 30 | 3300046526 | Ga0495666_0012289 | Ga0495666_0012289_2237_4102 | 463 |
| 31 | 3300035725 | Ga0373947_0033394 | Ga0373947_0033394_756_2576 | 464 |
| 32 | 3300005458 | Ga0070681_10112003 | Ga0070681_101120032 | 466 |
| 33 | 3300025912 | Ga0207707_10015945 | Ga0207707_100159453 | 466 |
| 34 | 3300025919 | Ga0207657_10057823 | Ga0207657_100578231 | 466 |
| 35 | 3300025921 | Ga0207652_10018744 | Ga0207652_100187444 | 466 |
| 36 | 3300026041 | Ga0207639_10068006 | Ga0207639_100680062 | 466 |
| 37 | 3300026142 | Ga0207698_10042373 | Ga0207698_100423732 | 466 |
| 38 | 3300031712 | Ga0265342_10001688 | Ga0265342_1000168821 | 466 |
| 39 | 3300049823 | Ga0501044_0042166 | Ga0501044_0042166_2329_4038 | 466 |
| 40 | 3300039437 | Ga0436365_0396709 | Ga0436365_0396709_44672_46342 | 468 |
| 41 | 3300049574 | Ga0501038_0101953 | Ga0501038_0101953_282_1982 | 468 |
| 42 | 3300049581 | Ga0501047_0024669 | Ga0501047_0024669_2674_4374 | 468 |
| 43 | 3300049586 | Ga0501070_0002926 | Ga0501070_0002926_1413_3113 | 468 |
| 44 | 3300049742 | Ga0501080_0037908 | Ga0501080_0037908_2587_4287 | 468 |
| 45 | 3300049822 | Ga0501035_0029377 | Ga0501035_0029377_17_1717 | 468 |
| 46 | 3300006846 | Ga0075430_100002116 | Ga0075430_1000021165 | 469 |
| 47 | 3300050509 | nmdc:mga0qj67_101_c1 | nmdc:mga0qj67_101_c1_29781_31589 | 469 |
| 48 | 3300006178 | Ga0075367_10013285 | Ga0075367_100132854 | 470 |
| 49 | 3300050494 | nmdc:mga06z11_23611_c1 | nmdc:mga06z11_23611_c1_34_1728 | 470 |
| 50 | 3300006175 | Ga0070712_100115234 | Ga0070712_1001152341 | 471 |
| 51 | 3300009545 | Ga0105237_10068348 | Ga0105237_100683481 | 471 |
| 52 | 3300010375 | Ga0105239_10227715 | Ga0105239_102277151 | 471 |
| 53 | 3300014968 | Ga0157379_10064358 | Ga0157379_100643582 | 471 |
| 54 | 3300025914 | Ga0207671_10120386 | Ga0207671_101203861 | 471 |
| 55 | 3300031238 | Ga0265332_10015786 | Ga0265332_100157862 | 471 |
| 56 | 3300031344 | Ga0265316_10020836 | Ga0265316_100208361 | 471 |
| 57 | 3300035089 | Ga0373944_0001292 | Ga0373944_0001292_1877_3541 | 471 |
| 58 | 3300035724 | Ga0373933_0012994 | Ga0373933_0012994_2871_4535 | 471 |
| 59 | 3300046463 | Ga0495653_0002829 | Ga0495653_0002829_1858_3522 | 471 |
| 60 | 3300046511 | Ga0495608_0026634 | Ga0495608_0026634_1870_3534 | 471 |
| 61 | 3300046516 | Ga0495628_0030101 | Ga0495628_0030101_1915_3579 | 471 |
| 62 | 3300046536 | Ga0495587_0019103 | Ga0495587_0019103_2071_3735 | 471 |
| 63 | 3300046559 | Ga0495667_0010860 | Ga0495667_0010860_1244_2908 | 471 |
| 64 | 3300046674 | Ga0495588_0016229 | Ga0495588_0016229_20_1684 | 471 |
| 65 | 3300047471 | Ga0495684_0010049 | Ga0495684_0010049_1070_2734 | 471 |
| 66 | 3300048906 | Ga0496103_0012907 | Ga0496103_0012907_2027_3703 | 471 |
| 67 | 3300049577 | Ga0501041_0095311 | Ga0501041_0095311_112_1767 | 471 |
| 68 | 3300053078 | Ga0495612_0003728 | Ga0495612_0003728_321_1985 | 471 |
| 69 | 3300053084 | Ga0495595_0020921 | Ga0495595_0020921_937_2601 | 471 |
| 70 | 3300005328 | Ga0070676_10056615 | Ga0070676_100566152 | 472 |
| 71 | 3300005983 | Ga0081540_1000414 | Ga0081540_100041415 | 472 |
| 72 | 3300009148 | Ga0105243_10013160 | Ga0105243_100131604 | 472 |
| 73 | 3300013296 | Ga0157374_10095016 | Ga0157374_100950162 | 472 |
| 74 | 3300013297 | Ga0157378_10030086 | Ga0157378_100300861 | 472 |
| 75 | 3300025935 | Ga0207709_10051550 | Ga0207709_100515502 | 472 |
| 76 | 3300028381 | Ga0268264_10099651 | Ga0268264_100996512 | 472 |
| 77 | 3300035111 | Ga0373923_0003228 | Ga0373923_0003228_2446_4119 | 472 |
| 78 | 3300035113 | Ga0373936_0003430 | Ga0373936_0003430_2354_4027 | 472 |
| 79 | 3300046454 | Ga0495592_0031316 | Ga0495592_0031316_2270_3943 | 472 |
| 80 | 3300046462 | Ga0495651_0087461 | Ga0495651_0087461_547_2211 | 472 |
| 81 | 3300046473 | Ga0495582_0038387 | Ga0495582_0038387_322_1995 | 472 |
| 82 | 3300046492 | Ga0495585_0011553 | Ga0495585_0011553_3193_4866 | 472 |
| 83 | 3300046526 | Ga0495666_0015097 | Ga0495666_0015097_1111_2784 | 472 |
| 84 | 3300046664 | Ga0495659_0003707 | Ga0495659_0003707_745_2418 | 472 |
| 85 | 3300047321 | Ga0495676_0085600 | Ga0495676_0085600_422_2095 | 472 |
| 86 | 3300048918 | Ga0496115_0039632 | Ga0496115_0039632_211_1887 | 472 |
| 87 | 3300048917 | Ga0496114_0007505 | Ga0496114_0007505_6594_8330 | 473 |
| 88 | 3300053085 | Ga0495619_0016867 | Ga0495619_0016867_2495_4228 | 473 |
| 89 | 3300005436 | Ga0070713_100061543 | Ga0070713_1000615432 | 474 |
| 90 | 3300025928 | Ga0207700_10048143 | Ga0207700_100481432 | 474 |
| 91 | 3300031239 | Ga0265328_10000656 | Ga0265328_100006561 | 474 |
| 92 | 3300047673 | Ga0495593_0017351 | Ga0495593_0017351_2100_3773 | 474 |
| 93 | 3300005339 | Ga0070660_100080940 | Ga0070660_1000809402 | 475 |
| 94 | 3300039437 | Ga0436365_1783153 | Ga0436365_1783153_5893_7602 | 475 |
| 95 | 3300005981 | Ga0081538_10035991 | Ga0081538_100359912 | 476 |
| 96 | 3300046691 | Ga0495670_0002486 | Ga0495670_0002486_778_2451 | 476 |
| 97 | 3300049590 | Ga0501074_0089424 | Ga0501074_0089424_66_1745 | 476 |
| 98 | 3300049591 | Ga0501075_0032818 | Ga0501075_0032818_1390_3069 | 476 |
| 99 | 3300049592 | Ga0501076_0017661 | Ga0501076_0017661_3001_4680 | 476 |
| 100 | 3300049593 | Ga0501077_0003492 | Ga0501077_0003492_1707_3386 | 476 |
| 101 | 3300049741 | Ga0501079_0013641 | Ga0501079_0013641_514_2193 | 476 |
| 102 | 3300049743 | Ga0501081_0000145 | Ga0501081_0000145_6488_8167 | 476 |
| 103 | 3300060353 | Ga0501082_0013621 | Ga0501082_0013621_4675_6354 | 476 |
| 104 | 3300035410 | Ga0373924_0015299 | Ga0373924_0015299_956_2629 | 477 |
| 105 | 3300036401 | Ga0373937_0164886 | Ga0373937_0164886_232_1905 | 477 |
| 106 | 3300046461 | Ga0495641_0029668 | Ga0495641_0029668_860_2533 | 477 |
| 107 | 3300046462 | Ga0495651_0065336 | Ga0495651_0065336_52_1842 | 477 |
| 108 | 3300046499 | Ga0495594_0005909 | Ga0495594_0005909_1387_3060 | 477 |
| 109 | 3300046511 | Ga0495608_0045021 | Ga0495608_0045021_1003_2793 | 477 |
| 110 | 3300046529 | Ga0495652_0005722 | Ga0495652_0005722_2949_4739 | 477 |
| 111 | 3300046557 | Ga0495622_0043128 | Ga0495622_0043128_193_1866 | 477 |
| 112 | 3300046559 | Ga0495667_0018667 | Ga0495667_0018667_2658_4448 | 477 |
| 113 | 3300046678 | Ga0495599_0015398 | Ga0495599_0015398_1082_2872 | 477 |
| 114 | 3300047317 | Ga0495604_0017303 | Ga0495604_0017303_1376_3166 | 477 |
| 115 | 3300047322 | Ga0495680_0002632 | Ga0495680_0002632_15532_17322 | 477 |
| 116 | 3300047444 | Ga0495675_0002807 | Ga0495675_0002807_4941_6731 | 477 |
| 117 | 3300048088 | Ga0495602_0075882 | Ga0495602_0075882_983_2773 | 477 |
| 118 | 3300048088 | Ga0495602_0089934 | Ga0495602_0089934_788_2461 | 477 |
| 119 | iso_pu_bacteria | 8016539877 | 8016541630 | 478 |
| 120 | 3300021384 | Ga0213876_10002118 | Ga0213876_100021185 | 479 |
| 121 | 3300039437 | Ga0436365_0028690 | Ga0436365_0028690_7129_8778 | 479 |
| 122 | 3300039453 | Ga0436362_0087827 | Ga0436362_0087827_1704_3353 | 479 |
| 123 | 3300035111 | Ga0373923_0016815 | Ga0373923_0016815_444_2168 | 480 |
| 124 | 3300035113 | Ga0373936_0005197 | Ga0373936_0005197_1503_3227 | 480 |
| 125 | 3300035116 | Ga0373945_0001879 | Ga0373945_0001879_4029_5753 | 480 |
| 126 | 3300035118 | Ga0373954_0003807 | Ga0373954_0003807_1890_3614 | 480 |
| 127 | 3300035170 | Ga0373943_0003740 | Ga0373943_0003740_4917_6641 | 480 |
| 128 | 3300035171 | Ga0373946_0000911 | Ga0373946_0000911_1692_3416 | 480 |
| 129 | 3300035172 | Ga0373955_0001476 | Ga0373955_0001476_1578_3302 | 480 |
| 130 | 3300035692 | Ga0373935_0000185 | Ga0373935_0000185_4411_6135 | 480 |
| 131 | 3300035695 | Ga0373927_0005659 | Ga0373927_0005659_4420_6144 | 480 |
| 132 | 3300035724 | Ga0373933_0010044 | Ga0373933_0010044_1553_3277 | 480 |
| 133 | 3300035725 | Ga0373947_0001402 | Ga0373947_0001402_2012_3736 | 480 |
| 134 | 3300036401 | Ga0373937_0000068 | Ga0373937_0000068_85638_87362 | 480 |
| 135 | 3300037068 | Ga0373925_0002364 | Ga0373925_0002364_6509_8233 | 480 |
| 136 | 3300046454 | Ga0495592_0004767 | Ga0495592_0004767_4887_6611 | 480 |
| 137 | 3300046459 | Ga0495629_0005407 | Ga0495629_0005407_4489_6213 | 480 |
| 138 | 3300046463 | Ga0495653_0005358 | Ga0495653_0005358_1777_3501 | 480 |
| 139 | 3300046477 | Ga0495664_0000105 | Ga0495664_0000105_6783_8507 | 480 |
| 140 | 3300046511 | Ga0495608_0000020 | Ga0495608_0000020_32272_33996 | 480 |
| 141 | 3300046514 | Ga0495618_0001074 | Ga0495618_0001074_10125_11849 | 480 |
| 142 | 3300046516 | Ga0495628_0000005 | Ga0495628_0000005_85468_87192 | 480 |
| 143 | 3300046517 | Ga0495630_0001784 | Ga0495630_0001784_8962_10686 | 480 |
| 144 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_991952_993676 | 480 |
| 145 | 3300046533 | Ga0495640_0000027 | Ga0495640_0000027_82210_83934 | 480 |
| 146 | 3300046536 | Ga0495587_0000017 | Ga0495587_0000017_34663_36387 | 480 |
| 147 | 3300046543 | Ga0495645_0000212 | Ga0495645_0000212_33332_35056 | 480 |
| 148 | 3300046559 | Ga0495667_0000031 | Ga0495667_0000031_112291_114015 | 480 |
| 149 | 3300046642 | Ga0495634_0000006 | Ga0495634_0000006_119744_121468 | 480 |
| 150 | 3300046663 | Ga0495635_0000154 | Ga0495635_0000154_6790_8514 | 480 |
| 151 | 3300046675 | Ga0495657_0000828 | Ga0495657_0000828_6658_8382 | 480 |
| 152 | 3300046678 | Ga0495599_0000051 | Ga0495599_0000051_6702_8426 | 480 |
| 153 | 3300046679 | Ga0495623_0001078 | Ga0495623_0001078_10000_11724 | 480 |
| 154 | 3300046680 | Ga0495646_0000102 | Ga0495646_0000102_6721_8445 | 480 |
| 155 | 3300046690 | Ga0495624_0019259 | Ga0495624_0019259_1636_3360 | 480 |
| 156 | 3300046809 | Ga0495600_0000069 | Ga0495600_0000069_50158_51882 | 480 |
| 157 | 3300047315 | Ga0495581_0012170 | Ga0495581_0012170_1853_3577 | 480 |
| 158 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_359086_360810 | 480 |
| 159 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_33372_35096 | 480 |
| 160 | 3300047322 | Ga0495680_0005755 | Ga0495680_0005755_4394_6118 | 480 |
| 161 | 3300047444 | Ga0495675_0000216 | Ga0495675_0000216_6658_8382 | 480 |
| 162 | 3300047471 | Ga0495684_0000009 | Ga0495684_0000009_51357_53081 | 480 |
| 163 | 3300047673 | Ga0495593_0003510 | Ga0495593_0003510_3187_4911 | 480 |
| 164 | 3300048088 | Ga0495602_0000373 | Ga0495602_0000373_6712_8436 | 480 |
| 165 | 3300053077 | Ga0495601_0000020 | Ga0495601_0000020_124929_126653 | 480 |
| 166 | 3300053078 | Ga0495612_0000030 | Ga0495612_0000030_73435_75159 | 480 |
| 167 | 3300053084 | Ga0495595_0000125 | Ga0495595_0000125_24586_26310 | 480 |
| 168 | 3300053085 | Ga0495619_0000216 | Ga0495619_0000216_33381_35105 | 480 |
| 169 | 3300031241 | Ga0265325_10030977 | Ga0265325_100309771 | 482 |
| 170 | 3300039447 | Ga0436361_0201292 | Ga0436361_0201292_1744_3426 | 482 |
| 171 | 3300039450 | Ga0436363_0979840 | Ga0436363_0979840_5278_6960 | 482 |
| 172 | 3300005436 | Ga0070713_100006575 | Ga0070713_1000065752 | 483 |
| 173 | 3300006028 | Ga0070717_10000355 | Ga0070717_100003557 | 483 |
| 174 | 3300031235 | Ga0265330_10006196 | Ga0265330_100061961 | 483 |
| 175 | 3300005563 | Ga0068855_100061972 | Ga0068855_1000619721 | 484 |
| 176 | 3300025949 | Ga0207667_10041779 | Ga0207667_100417794 | 484 |
| 177 | 3300046491 | Ga0495584_0054511 | Ga0495584_0054511_70_1743 | 484 |
| 178 | 3300046501 | Ga0495607_0065170 | Ga0495607_0065170_142_1815 | 484 |
| 179 | 3300046523 | Ga0495644_0003488 | Ga0495644_0003488_141_1814 | 484 |
| 180 | 3300046648 | Ga0495611_0008507 | Ga0495611_0008507_1071_2744 | 484 |
| 181 | 3300005356 | Ga0070674_100017753 | Ga0070674_1000177533 | 486 |
| 182 | 3300025940 | Ga0207691_10008900 | Ga0207691_100089004 | 486 |
| 183 | 3300026121 | Ga0207683_10000639 | Ga0207683_1000063926 | 486 |
| 184 | 3300049570 | Ga0501033_0020597 | Ga0501033_0020597_1864_3630 | 486 |
| 185 | 3300049572 | Ga0501036_0056173 | Ga0501036_0056173_269_2038 | 486 |
| 186 | 3300049581 | Ga0501047_0032791 | Ga0501047_0032791_1800_3569 | 486 |
| 187 | 3300049823 | Ga0501044_0089629 | Ga0501044_0089629_87_1856 | 486 |
| 188 | 3300025924 | Ga0207694_10074599 | Ga0207694_100745991 | 487 |
| 189 | 3300046463 | Ga0495653_0020335 | Ga0495653_0020335_12_1718 | 487 |
| 190 | 3300046680 | Ga0495646_0038456 | Ga0495646_0038456_1237_2943 | 487 |
| 191 | 3300047322 | Ga0495680_0126186 | Ga0495680_0126186_12_1718 | 487 |
| 192 | 3300049579 | Ga0501043_0006651 | Ga0501043_0006651_1328_3106 | 487 |
| 193 | 3300053117 | Ga0500593_001184 | Ga0500593_001184_247_2076 | 487 |
| 194 | 3300025932 | Ga0207690_10085552 | Ga0207690_100855521 | 488 |
| 195 | 3300028800 | Ga0265338_10000328 | Ga0265338_1000032830 | 488 |
| 196 | 3300053085 | Ga0495619_0051124 | Ga0495619_0051124_593_2302 | 489 |
| 197 | 3300053139 | Ga0500568_0000002 | Ga0500568_0000002_198749_200566 | 489 |
| 198 | 3300044684 | Ga0466966_0071655 | Ga0466966_0071655_43_1851 | 490 |
| 199 | 3300003203 | JGI25406J46586_10000580 | JGI25406J46586_100005806 | 491 |
| 200 | 3300005985 | Ga0081539_10000321 | Ga0081539_1000032199 | 491 |
| 201 | 3300048924 | Ga0496121_0001497 | Ga0496121_0001497_36167_37894 | 491 |
| 202 | 3300048929 | Ga0496126_0076252 | Ga0496126_0076252_1232_2959 | 491 |
| 203 | 3300005334 | Ga0068869_100036616 | Ga0068869_1000366162 | 493 |
| 204 | 3300044658 | Ga0466972_0009157 | Ga0466972_0009157_2521_4314 | 493 |
| 205 | 3300046526 | Ga0495666_0014789 | Ga0495666_0014789_1848_3653 | 493 |
| 206 | 3300046557 | Ga0495622_0028261 | Ga0495622_0028261_680_2473 | 494 |
| 207 | 3300048908 | Ga0496105_0021511 | Ga0496105_0021511_781_2574 | 494 |
| 208 | 3300049588 | Ga0501072_0008585 | Ga0501072_0008585_3578_5248 | 494 |
| 209 | 3300049592 | Ga0501076_0018366 | Ga0501076_0018366_1186_2856 | 494 |
| 210 | iso_pu_bacteria | 2738541281 | 2738744675 | 494 |
| 211 | iso_pu_bacteria | 2738543032 | 2739353905 | 494 |
| 212 | 3300035113 | Ga0373936_0004950 | Ga0373936_0004950_230_2035 | 495 |
| 213 | 3300035170 | Ga0373943_0014816 | Ga0373943_0014816_22_1830 | 495 |
| 214 | 3300035692 | Ga0373935_0005095 | Ga0373935_0005095_3091_4896 | 495 |
| 215 | 3300035725 | Ga0373947_0023418 | Ga0373947_0023418_280_2085 | 495 |
| 216 | 3300046459 | Ga0495629_0033983 | Ga0495629_0033983_1763_3568 | 495 |
| 217 | 3300046472 | Ga0495580_0049877 | Ga0495580_0049877_257_2062 | 495 |
| 218 | 3300046476 | Ga0495662_0003626 | Ga0495662_0003626_2788_4593 | 495 |
| 219 | 3300046477 | Ga0495664_0013349 | Ga0495664_0013349_1741_3546 | 495 |
| 220 | 3300046517 | Ga0495630_0016855 | Ga0495630_0016855_2408_4213 | 495 |
| 221 | 3300046531 | Ga0495665_0004993 | Ga0495665_0004993_987_2792 | 495 |
| 222 | 3300046533 | Ga0495640_0010171 | Ga0495640_0010171_2984_4789 | 495 |
| 223 | 3300046642 | Ga0495634_0039660 | Ga0495634_0039660_959_2764 | 495 |
| 224 | 3300047315 | Ga0495581_0003094 | Ga0495581_0003094_4912_6717 | 495 |
| 225 | 3300047319 | Ga0495674_0007497 | Ga0495674_0007497_5874_7679 | 495 |
| 226 | 3300047471 | Ga0495684_0009436 | Ga0495684_0009436_5110_6915 | 495 |
| 227 | 3300047673 | Ga0495593_0012736 | Ga0495593_0012736_2740_4545 | 495 |
| 228 | 3300049592 | Ga0501076_0104906 | Ga0501076_0104906_506_2191 | 495 |
| 229 | 3300053078 | Ga0495612_0009929 | Ga0495612_0009929_313_2118 | 495 |
| 230 | 3300053087 | Ga0500643_000267 | Ga0500643_000267_4559_6346 | 495 |
| 231 | 3300053092 | Ga0500583_0005389 | Ga0500583_0005389_1735_3522 | 495 |
| 232 | 3300033180 | Ga0307510_10114972 | Ga0307510_101149722 | 496 |
| 233 | 3300035086 | Ga0373934_0021845 | Ga0373934_0021845_21_1826 | 496 |
| 234 | 3300048922 | Ga0496119_0006190 | Ga0496119_0006190_4765_6519 | 497 |
| 235 | 3300048925 | Ga0496122_0004307 | Ga0496122_0004307_10360_12132 | 497 |
| 236 | 3300048926 | Ga0496123_0001264 | Ga0496123_0001264_4374_6146 | 497 |
| 237 | 3300053104 | Ga0500556_0000561 | Ga0500556_0000561_20729_22483 | 497 |
| 238 | iso_pu_bacteria | 2902330777 | 2902333024 | 497 |
| 239 | 3300006844 | Ga0075428_100007340 | Ga0075428_1000073403 | 499 |
| 240 | 3300006847 | Ga0075431_100000266 | Ga0075431_1000002663 | 499 |
| 241 | 3300009094 | Ga0111539_10000429 | Ga0111539_1000042930 | 499 |
| 242 | 3300009147 | Ga0114129_10000640 | Ga0114129_100006403 | 499 |
| 243 | 3300027907 | Ga0207428_10028479 | Ga0207428_100284793 | 499 |
| 244 | 3300028800 | Ga0265338_10048157 | Ga0265338_100481573 | 499 |
| 245 | 3300031241 | Ga0265325_10004970 | Ga0265325_100049702 | 499 |
| 246 | 3300031249 | Ga0265339_10000296 | Ga0265339_1000029634 | 499 |
| 247 | 3300031595 | Ga0265313_10000242 | Ga0265313_100002428 | 499 |
| 248 | 3300031728 | Ga0316578_10035596 | Ga0316578_100355961 | 499 |
| 249 | 3300036647 | Ga0316582_0014115 | Ga0316582_0014115_428_2209 | 499 |
| 250 | 3300036712 | Ga0316584_0000295 | Ga0316584_0000295_17787_19568 | 499 |
| 251 | 3300046460 | Ga0495638_0002610 | Ga0495638_0002610_8849_10636 | 499 |
| 252 | 3300048927 | Ga0496124_0061827 | Ga0496124_0061827_1277_3013 | 499 |
| 253 | 3300050507 | nmdc:mga05p37_33991_c1 | nmdc:mga05p37_33991_c1_2634_4334 | 499 |
| 254 | 3300050510 | nmdc:mga06r32_64_c1 | nmdc:mga06r32_64_c1_2460_4160 | 499 |
| 255 | 3300050511 | nmdc:mga08y16_5017_c1 | nmdc:mga08y16_5017_c1_1896_3596 | 499 |
| 256 | 3300053736 | Ga0500599_000209 | Ga0500599_000209_1349_3136 | 499 |
| 257 | iso_pu_bacteria | 2902405164 | 2902411935 | 500 |
| 258 | 3300006195 | Ga0075366_10017608 | Ga0075366_100176083 | 501 |
| 259 | 3300025904 | Ga0207647_10039223 | Ga0207647_100392231 | 501 |
| 260 | 3300048906 | Ga0496103_0005710 | Ga0496103_0005710_4882_6681 | 501 |
| 261 | 3300048907 | Ga0496104_0116570 | Ga0496104_0116570_608_2413 | 501 |
| 262 | 3300048928 | Ga0496125_0000154 | Ga0496125_0000154_34200_35996 | 501 |
| 263 | 3300048928 | Ga0496125_0038467 | Ga0496125_0038467_81_1886 | 501 |
| 264 | 3300050496 | nmdc:mga07m45_19822_c1 | nmdc:mga07m45_19822_c1_265_2070 | 501 |
| 265 | iso_pu_bacteria | 2879083081 | 2879086199 | 501 |
| 266 | 3300025918 | Ga0207662_10022522 | Ga0207662_100225222 | 502 |
| 267 | 3300044658 | Ga0466972_0033035 | Ga0466972_0033035_319_2100 | 502 |
| 268 | 3300044901 | Ga0466960_0003292 | Ga0466960_0003292_4392_6173 | 502 |
| 269 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_16022_17791 | 502 |
| 270 | iso_pu_bacteria | 2513237087 | 2513590310 | 502 |
| 271 | 3300037418 | Ga0395900_0001924 | Ga0395900_0001924_16522_18309 | 503 |
| 272 | 3300046516 | Ga0495628_0079520 | Ga0495628_0079520_709_2364 | 503 |
| 273 | iso_pu_bacteria | 2643221547 | 2643755179 | 503 |
| 274 | 3300005983 | Ga0081540_1007581 | Ga0081540_10075814 | 504 |
| 275 | 3300035171 | Ga0373946_0006180 | Ga0373946_0006180_2370_4037 | 504 |
| 276 | 3300035695 | Ga0373927_0015251 | Ga0373927_0015251_607_2274 | 504 |
| 277 | 3300037068 | Ga0373925_0027338 | Ga0373925_0027338_1829_3634 | 504 |
| 278 | 3300037068 | Ga0373925_0029284 | Ga0373925_0029284_2184_3851 | 504 |
| 279 | 3300046476 | Ga0495662_0002537 | Ga0495662_0002537_181_1848 | 504 |
| 280 | 3300046476 | Ga0495662_0039364 | Ga0495662_0039364_161_1870 | 504 |
| 281 | 3300046477 | Ga0495664_0001875 | Ga0495664_0001875_8792_10459 | 504 |
| 282 | 3300046514 | Ga0495618_0001471 | Ga0495618_0001471_13203_14870 | 504 |
| 283 | 3300046517 | Ga0495630_0134092 | Ga0495630_0134092_155_1822 | 504 |
| 284 | 3300046529 | Ga0495652_0045811 | Ga0495652_0045811_1073_2740 | 504 |
| 285 | 3300046543 | Ga0495645_0006115 | Ga0495645_0006115_6470_8137 | 504 |
| 286 | 3300046559 | Ga0495667_0102038 | Ga0495667_0102038_23_1693 | 504 |
| 287 | 3300046663 | Ga0495635_0002882 | Ga0495635_0002882_7667_9334 | 504 |
| 288 | 3300047319 | Ga0495674_0004728 | Ga0495674_0004728_11129_12796 | 504 |
| 289 | 3300053078 | Ga0495612_0001208 | Ga0495612_0001208_3070_4737 | 504 |
| 290 | 3300053085 | Ga0495619_0009736 | Ga0495619_0009736_713_2380 | 504 |
| 291 | 3300005983 | Ga0081540_1002660 | Ga0081540_10026604 | 505 |
| 292 | 3300035725 | Ga0373947_0026840 | Ga0373947_0026840_536_2248 | 505 |
| 293 | 3300035725 | Ga0373947_0062544 | Ga0373947_0062544_381_2048 | 505 |
| 294 | 3300046463 | Ga0495653_0013792 | Ga0495653_0013792_4721_6388 | 505 |
| 295 | 3300046522 | Ga0495643_0020957 | Ga0495643_0020957_1072_2841 | 505 |
| 296 | 3300046642 | Ga0495634_0045962 | Ga0495634_0045962_327_1994 | 505 |
| 297 | 3300046810 | Ga0495660_0026239 | Ga0495660_0026239_349_2118 | 505 |
| 298 | 3300048924 | Ga0496121_0001742 | Ga0496121_0001742_23608_25377 | 505 |
| 299 | 3300053077 | Ga0495601_0003562 | Ga0495601_0003562_5566_7233 | 505 |
| 300 | 3300053131 | Ga0500652_001843 | Ga0500652_001843_4423_6192 | 505 |
| 301 | 3300053151 | Ga0500604_0009955 | Ga0500604_0009955_279_2048 | 505 |
| 302 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_67390_69159 | 505 |
| 303 | 3300046524 | Ga0495648_0001680 | Ga0495648_0001680_18128_19924 | 506 |
| 304 | 3300048927 | Ga0496124_0014417 | Ga0496124_0014417_1249_3081 | 506 |
| 305 | 3300053153 | Ga0500616_0000166 | Ga0500616_0000166_73637_75379 | 507 |
| 306 | iso_pu_bacteria | 2841911363 | 2841912884 | 507 |
| 307 | iso_pu_bacteria | 2841917233 | 2841918631 | 507 |
| 308 | 3300044684 | Ga0466966_0005226 | Ga0466966_0005226_6198_7994 | 508 |
| 309 | 3300044693 | Ga0466961_0000149 | Ga0466961_0000149_38107_39903 | 508 |
| 310 | 3300047472 | Ga0495686_0007020 | Ga0495686_0007020_4131_5897 | 508 |
| 311 | 3300053177 | Ga0500636_0005367 | Ga0500636_0005367_170_1942 | 508 |
| 312 | iso_pu_bacteria | 2876808645 | 2876812901 | 508 |
| 313 | 3300005435 | Ga0070714_100000678 | Ga0070714_10000067815 | 509 |
| 314 | 3300006173 | Ga0070716_100003281 | Ga0070716_1000032812 | 509 |
| 315 | 3300006186 | Ga0075369_10002656 | Ga0075369_100026562 | 509 |
| 316 | 3300025916 | Ga0207663_10002914 | Ga0207663_100029142 | 509 |
| 317 | 3300025939 | Ga0207665_10000361 | Ga0207665_1000036117 | 509 |
| 318 | 3300046477 | Ga0495664_0010696 | Ga0495664_0010696_1133_2932 | 509 |
| 319 | 3300046543 | Ga0495645_0013655 | Ga0495645_0013655_2417_4216 | 509 |
| 320 | 3300048919 | Ga0496116_0003364 | Ga0496116_0003364_6657_8435 | 509 |
| 321 | 3300048920 | Ga0496117_0054433 | Ga0496117_0054433_99_1877 | 509 |
| 322 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_37127_38896 | 509 |
| 323 | 3300005329 | Ga0070683_100005592 | Ga0070683_1000055924 | 510 |
| 324 | 3300005436 | Ga0070713_100030732 | Ga0070713_1000307322 | 510 |
| 325 | 3300005437 | Ga0070710_10002407 | Ga0070710_100024072 | 510 |
| 326 | 3300005535 | Ga0070684_100013985 | Ga0070684_1000139853 | 510 |
| 327 | 3300006163 | Ga0070715_10000078 | Ga0070715_1000007820 | 510 |
| 328 | 3300025898 | Ga0207692_10002540 | Ga0207692_100025402 | 510 |
| 329 | 3300025905 | Ga0207685_10002560 | Ga0207685_100025603 | 510 |
| 330 | 3300025906 | Ga0207699_10035125 | Ga0207699_100351252 | 510 |
| 331 | 3300025915 | Ga0207693_10003503 | Ga0207693_100035033 | 510 |
| 332 | 3300025944 | Ga0207661_10004270 | Ga0207661_100042708 | 510 |
| 333 | 3300049568 | Ga0501031_0044273 | Ga0501031_0044273_853_2646 | 510 |
| 334 | 3300049569 | Ga0501032_0002005 | Ga0501032_0002005_3379_5172 | 510 |
| 335 | 3300049571 | Ga0501034_0008453 | Ga0501034_0008453_6243_8036 | 510 |
| 336 | 3300049572 | Ga0501036_0079526 | Ga0501036_0079526_707_2500 | 510 |
| 337 | 3300049580 | Ga0501046_0002541 | Ga0501046_0002541_10695_12488 | 510 |
| 338 | 3300049581 | Ga0501047_0007951 | Ga0501047_0007951_7504_9297 | 510 |
| 339 | 3300049586 | Ga0501070_0013913 | Ga0501070_0013913_2612_4405 | 510 |
| 340 | 3300049589 | Ga0501073_0017405 | Ga0501073_0017405_374_2167 | 510 |
| 341 | 3300049590 | Ga0501074_0001612 | Ga0501074_0001612_7046_8839 | 510 |
| 342 | 3300049742 | Ga0501080_0000082 | Ga0501080_0000082_11462_13255 | 510 |
| 343 | 3300049822 | Ga0501035_0015153 | Ga0501035_0015153_2612_4405 | 510 |
| 344 | 3300049824 | Ga0501045_0018377 | Ga0501045_0018377_124_1917 | 510 |
| 345 | 3300053104 | Ga0500556_0000202 | Ga0500556_0000202_3016_4785 | 510 |
| 346 | 3300053116 | Ga0500592_000548 | Ga0500592_000548_2274_4043 | 510 |
| 347 | 3300053122 | Ga0500608_000908 | Ga0500608_000908_7016_8788 | 510 |
| 348 | 3300006175 | Ga0070712_100003019 | Ga0070712_1000030195 | 511 |
| 349 | 3300025915 | Ga0207693_10010489 | Ga0207693_100104894 | 511 |
| 350 | 3300048924 | Ga0496121_0019504 | Ga0496121_0019504_34_1857 | 512 |
| 351 | 3300025913 | Ga0207695_10122303 | Ga0207695_101223032 | 513 |
| 352 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010170 | 513 |
| 353 | 3300048929 | Ga0496126_0042173 | Ga0496126_0042173_1948_3753 | 513 |
| 354 | 3300025915 | Ga0207693_10045520 | Ga0207693_100455202 | 514 |
| 355 | 3300037853 | Ga0436364_0564128 | Ga0436364_0564128_474_2285 | 514 |
| 356 | 3300048909 | Ga0496106_0001165 | Ga0496106_0001165_6758_8581 | 514 |
| 357 | 3300048911 | Ga0496108_0003943 | Ga0496108_0003943_6430_8253 | 514 |
| 358 | 3300048912 | Ga0496109_0001766 | Ga0496109_0001766_471_2294 | 514 |
| 359 | 3300014325 | Ga0163163_10035104 | Ga0163163_100351042 | 515 |
| 360 | 3300047472 | Ga0495686_0038224 | Ga0495686_0038224_1004_2764 | 515 |
| 361 | 3300053111 | Ga0500572_000384 | Ga0500572_000384_9061_10863 | 515 |
| 362 | 3300053136 | Ga0500559_0000863 | Ga0500559_0000863_6140_7942 | 515 |
| 363 | 3300009545 | Ga0105237_10174055 | Ga0105237_101740551 | 516 |
| 364 | 3300025261 | Ga0209233_1001414 | Ga0209233_10014145 | 516 |
| 365 | 3300025914 | Ga0207671_10062614 | Ga0207671_100626142 | 516 |
| 366 | 3300025927 | Ga0207687_10047616 | Ga0207687_100476162 | 516 |
| 367 | 3300053094 | Ga0500566_0000185 | Ga0500566_0000185_6503_8293 | 516 |
| 368 | 3300053142 | Ga0500577_0000127 | Ga0500577_0000127_12922_14691 | 516 |
| 369 | 3300005614 | Ga0068856_100000091 | Ga0068856_10000009156 | 518 |
| 370 | 3300025928 | Ga0207700_10118988 | Ga0207700_101189881 | 518 |
| 371 | 3300026078 | Ga0207702_10000041 | Ga0207702_1000004169 | 518 |
| 372 | 3300028379 | Ga0268266_10085788 | Ga0268266_100857882 | 518 |
| 373 | 3300035692 | Ga0373935_0000259 | Ga0373935_0000259_21103_22905 | 518 |
| 374 | 3300035695 | Ga0373927_0000339 | Ga0373927_0000339_29882_31684 | 518 |
| 375 | 3300035725 | Ga0373947_0000217 | Ga0373947_0000217_19069_20871 | 518 |
| 376 | 3300046455 | Ga0495603_0000352 | Ga0495603_0000352_2078_3880 | 518 |
| 377 | 3300046459 | Ga0495629_0003719 | Ga0495629_0003719_910_2712 | 518 |
| 378 | 3300046472 | Ga0495580_0010063 | Ga0495580_0010063_1471_3273 | 518 |
| 379 | 3300046475 | Ga0495639_0001973 | Ga0495639_0001973_5242_7044 | 518 |
| 380 | 3300046476 | Ga0495662_0000872 | Ga0495662_0000872_1787_3589 | 518 |
| 381 | 3300046477 | Ga0495664_0002434 | Ga0495664_0002434_3178_4980 | 518 |
| 382 | 3300046499 | Ga0495594_0001257 | Ga0495594_0001257_6312_8114 | 518 |
| 383 | 3300046531 | Ga0495665_0000361 | Ga0495665_0000361_10208_12010 | 518 |
| 384 | 3300046533 | Ga0495640_0003002 | Ga0495640_0003002_10207_12009 | 518 |
| 385 | 3300046642 | Ga0495634_0000249 | Ga0495634_0000249_1382_3184 | 518 |
| 386 | 3300046683 | Ga0495658_0001058 | Ga0495658_0001058_39_1841 | 518 |
| 387 | 3300046690 | Ga0495624_0000865 | Ga0495624_0000865_19624_21426 | 518 |
| 388 | 3300047315 | Ga0495581_0006025 | Ga0495581_0006025_3744_5546 | 518 |
| 389 | 3300047319 | Ga0495674_0001854 | Ga0495674_0001854_17179_18981 | 518 |
| 390 | 3300047673 | Ga0495593_0000034 | Ga0495593_0000034_55662_57464 | 518 |
| 391 | 3300005329 | Ga0070683_100005294 | Ga0070683_1000052945 | 519 |
| 392 | 3300005336 | Ga0070680_100024434 | Ga0070680_1000244342 | 519 |
| 393 | 3300025912 | Ga0207707_10014163 | Ga0207707_100141635 | 519 |
| 394 | 3300035118 | Ga0373954_0008528 | Ga0373954_0008528_1328_3130 | 519 |
| 395 | 3300035172 | Ga0373955_0000880 | Ga0373955_0000880_1328_3130 | 519 |
| 396 | 3300046459 | Ga0495629_0006765 | Ga0495629_0006765_6529_8331 | 519 |
| 397 | 3300046463 | Ga0495653_0052870 | Ga0495653_0052870_1018_2814 | 519 |
| 398 | 3300046543 | Ga0495645_0015805 | Ga0495645_0015805_1158_2960 | 519 |
| 399 | 3300046663 | Ga0495635_0011527 | Ga0495635_0011527_4353_6149 | 519 |
| 400 | 3300046675 | Ga0495657_0037997 | Ga0495657_0037997_261_2063 | 519 |
| 401 | 3300046678 | Ga0495599_0001556 | Ga0495599_0001556_10171_11973 | 519 |
| 402 | 3300046679 | Ga0495623_0015085 | Ga0495623_0015085_2153_3925 | 519 |
| 403 | 3300046809 | Ga0495600_0019691 | Ga0495600_0019691_261_2063 | 519 |
| 404 | 3300047317 | Ga0495604_0030600 | Ga0495604_0030600_826_2598 | 519 |
| 405 | 3300047444 | Ga0495675_0003321 | Ga0495675_0003321_1200_3002 | 519 |
| 406 | 3300047471 | Ga0495684_0000893 | Ga0495684_0000893_12809_14611 | 519 |
| 407 | 3300048088 | Ga0495602_0135050 | Ga0495602_0135050_143_1945 | 519 |
| 408 | 3300048907 | Ga0496104_0010270 | Ga0496104_0010270_2923_4719 | 519 |
| 409 | 3300048908 | Ga0496105_0016293 | Ga0496105_0016293_3621_5417 | 519 |
| 410 | 3300048909 | Ga0496106_0133210 | Ga0496106_0133210_74_1882 | 519 |
| 411 | 3300048921 | Ga0496118_0017089 | Ga0496118_0017089_4718_6526 | 519 |
| 412 | 3300048922 | Ga0496119_0011151 | Ga0496119_0011151_4076_5872 | 519 |
| 413 | 3300048923 | Ga0496120_0017714 | Ga0496120_0017714_476_2272 | 519 |
| 414 | 3300048924 | Ga0496121_0030095 | Ga0496121_0030095_2751_4559 | 519 |
| 415 | 3300048924 | Ga0496121_0045511 | Ga0496121_0045511_1976_3751 | 519 |
| 416 | 3300048928 | Ga0496125_0056102 | Ga0496125_0056102_1151_2947 | 519 |
| 417 | 3300048929 | Ga0496126_0010521 | Ga0496126_0010521_6116_7912 | 519 |
| 418 | 3300053077 | Ga0495601_0023795 | Ga0495601_0023795_594_2366 | 519 |
| 419 | 3300005439 | Ga0070711_100002216 | Ga0070711_1000022167 | 520 |
| 420 | 3300025253 | Ga0209677_104584 | Ga0209677_1045842 | 520 |
| 421 | 3300025921 | Ga0207652_10018037 | Ga0207652_100180373 | 520 |
| 422 | 3300045049 | Ga0466959_0016807 | Ga0466959_0016807_1795_3588 | 520 |
| 423 | 3300046507 | Ga0495606_0066113 | Ga0495606_0066113_294_2090 | 520 |
| 424 | 3300046524 | Ga0495648_0042142 | Ga0495648_0042142_875_2671 | 520 |
| 425 | 3300046660 | Ga0495625_0021332 | Ga0495625_0021332_272_2068 | 520 |
| 426 | 3300046694 | Ga0495649_0013626 | Ga0495649_0013626_2802_4598 | 520 |
| 427 | 3300048915 | Ga0496112_0129586 | Ga0496112_0129586_487_2289 | 520 |
| 428 | 3300049570 | Ga0501033_0000249 | Ga0501033_0000249_19972_21795 | 520 |
| 429 | 3300049573 | Ga0501037_0000112 | Ga0501037_0000112_21435_23258 | 520 |
| 430 | 3300049574 | Ga0501038_0000160 | Ga0501038_0000160_50491_52314 | 520 |
| 431 | 3300049579 | Ga0501043_0000278 | Ga0501043_0000278_33648_35471 | 520 |
| 432 | 3300049580 | Ga0501046_0000937 | Ga0501046_0000937_9156_10979 | 520 |
| 433 | 3300049581 | Ga0501047_0000275 | Ga0501047_0000275_44258_46081 | 520 |
| 434 | 3300049582 | Ga0501048_0001248 | Ga0501048_0001248_11755_13578 | 520 |
| 435 | 3300049583 | Ga0501067_0000258 | Ga0501067_0000258_5422_7245 | 520 |
| 436 | 3300049585 | Ga0501069_0002032 | Ga0501069_0002032_4481_6304 | 520 |
| 437 | 3300049586 | Ga0501070_0002548 | Ga0501070_0002548_11726_13549 | 520 |
| 438 | 3300049588 | Ga0501072_0006863 | Ga0501072_0006863_1874_3697 | 520 |
| 439 | 3300049589 | Ga0501073_0000103 | Ga0501073_0000103_24672_26495 | 520 |
| 440 | 3300049590 | Ga0501074_0000203 | Ga0501074_0000203_27596_29419 | 520 |
| 441 | 3300049741 | Ga0501079_0000451 | Ga0501079_0000451_19165_20988 | 520 |
| 442 | 3300049742 | Ga0501080_0033711 | Ga0501080_0033711_1191_3014 | 520 |
| 443 | 3300049822 | Ga0501035_0000766 | Ga0501035_0000766_24672_26495 | 520 |
| 444 | 3300005437 | Ga0070710_10014311 | Ga0070710_100143111 | 521 |
| 445 | 3300007265 | Ga0099794_10013213 | Ga0099794_100132132 | 521 |
| 446 | 3300025916 | Ga0207663_10024493 | Ga0207663_100244931 | 521 |
| 447 | 3300025928 | Ga0207700_10025237 | Ga0207700_100252371 | 521 |
| 448 | 3300048915 | Ga0496112_0079529 | Ga0496112_0079529_79_1866 | 521 |
| 449 | 3300048929 | Ga0496126_0006113 | Ga0496126_0006113_8765_10615 | 521 |
| 450 | 3300005327 | Ga0070658_10054743 | Ga0070658_100547432 | 522 |
| 451 | 3300005336 | Ga0070680_100010654 | Ga0070680_1000106543 | 522 |
| 452 | 3300005339 | Ga0070660_100002003 | Ga0070660_1000020034 | 522 |
| 453 | 3300005458 | Ga0070681_10058601 | Ga0070681_100586012 | 522 |
| 454 | 3300005535 | Ga0070684_100007625 | Ga0070684_1000076254 | 522 |
| 455 | 3300005563 | Ga0068855_100070295 | Ga0068855_1000702952 | 522 |
| 456 | 3300005834 | Ga0068851_10031958 | Ga0068851_100319581 | 522 |
| 457 | 3300009545 | Ga0105237_10013047 | Ga0105237_100130472 | 522 |
| 458 | 3300009551 | Ga0105238_10020868 | Ga0105238_100208683 | 522 |
| 459 | 3300010375 | Ga0105239_10009371 | Ga0105239_100093715 | 522 |
| 460 | 3300025321 | Ga0207656_10008718 | Ga0207656_100087181 | 522 |
| 461 | 3300025912 | Ga0207707_10003524 | Ga0207707_100035246 | 522 |
| 462 | 3300025917 | Ga0207660_10002555 | Ga0207660_100025554 | 522 |
| 463 | 3300025919 | Ga0207657_10002910 | Ga0207657_1000291012 | 522 |
| 464 | 3300025921 | Ga0207652_10008399 | Ga0207652_100083994 | 522 |
| 465 | 3300025949 | Ga0207667_10007538 | Ga0207667_100075382 | 522 |
| 466 | iso_pu_bacteria | 8016548790 | 8016551638 | 522 |
| 467 | 3300005983 | Ga0081540_1029895 | Ga0081540_10298952 | 523 |
| 468 | 3300025295 | Ga0209564_1000485 | Ga0209564_100048519 | 523 |
| 469 | 3300025913 | Ga0207695_10054932 | Ga0207695_100549322 | 523 |
| 470 | 3300045976 | Ga0466967_0155660 | Ga0466967_0155660_54_1853 | 523 |
| 471 | 3300046455 | Ga0495603_0033308 | Ga0495603_0033308_1238_3007 | 523 |
| 472 | 3300025261 | Ga0209233_1001581 | Ga0209233_10015815 | 524 |
| 473 | 3300048918 | Ga0496115_0098202 | Ga0496115_0098202_306_2093 | 524 |
| 474 | 3300053105 | Ga0500557_000041 | Ga0500557_000041_47254_49059 | 524 |
| 475 | 3300053130 | Ga0500642_0000140 | Ga0500642_0000140_18499_20304 | 524 |
| 476 | 3300005834 | Ga0068851_10001608 | Ga0068851_100016082 | 526 |
| 477 | 3300006942 | Ga0099824_1031088 | Ga0099824_10310881 | 526 |
| 478 | 3300006943 | Ga0099822_1000022 | Ga0099822_100002215 | 526 |
| 479 | 3300009174 | Ga0105241_10000538 | Ga0105241_1000053823 | 526 |
| 480 | 3300009551 | Ga0105238_10007630 | Ga0105238_100076302 | 526 |
| 481 | 3300025911 | Ga0207654_10000323 | Ga0207654_100003235 | 526 |
| 482 | 3300025913 | Ga0207695_10000497 | Ga0207695_1000049719 | 526 |
| 483 | 3300025924 | Ga0207694_10000212 | Ga0207694_1000021247 | 526 |
| 484 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003394 | 526 |
| 485 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006367 | 526 |
| 486 | 3300027361 | Ga0209489_100007 | Ga0209489_100007367 | 526 |
| 487 | 3300027363 | Ga0209700_100008 | Ga0209700_100008367 | 526 |
| 488 | 3300031711 | Ga0265314_10027164 | Ga0265314_100271643 | 526 |
| 489 | 3300035170 | Ga0373943_0025435 | Ga0373943_0025435_935_2731 | 526 |
| 490 | 3300046524 | Ga0495648_0002765 | Ga0495648_0002765_7268_9052 | 526 |
| 491 | 3300048909 | Ga0496106_0048853 | Ga0496106_0048853_1176_2948 | 526 |
| 492 | 3300025917 | Ga0207660_10060552 | Ga0207660_100605521 | 528 |
| 493 | 3300025919 | Ga0207657_10008531 | Ga0207657_100085314 | 528 |
| 494 | 3300006844 | Ga0075428_100108453 | Ga0075428_1001084532 | 529 |
| 495 | 3300047319 | Ga0495674_0086896 | Ga0495674_0086896_441_2228 | 529 |
| 496 | iso_pu_bacteria | 2844315083 | 2844316920 | 529 |
| 497 | iso_pu_bacteria | 2857524615 | 2857529972 | 529 |
| 498 | iso_pu_bacteria | 2903727486 | 2903733970 | 529 |
| 499 | iso_pu_bacteria | 2904711408 | 2904719222 | 529 |
| 500 | iso_pu_bacteria | 2906602504 | 2906604586 | 529 |
| 501 | iso_pu_bacteria | 2919073203 | 2919077173 | 529 |
| 502 | iso_pu_bacteria | 8056967851 | 8056969727 | 529 |
| 503 | 3300002244 | JGI24742J22300_10002888 | JGI24742J22300_100028882 | 530 |
| 504 | 3300005356 | Ga0070674_100063129 | Ga0070674_1000631291 | 530 |
| 505 | 3300005457 | Ga0070662_100121640 | Ga0070662_1001216401 | 530 |
| 506 | 3300021377 | Ga0213874_10003592 | Ga0213874_100035922 | 530 |
| 507 | 3300025901 | Ga0207688_10050812 | Ga0207688_100508122 | 530 |
| 508 | 3300028786 | Ga0307517_10000085 | Ga0307517_10000085107 | 530 |
| 509 | 3300033180 | Ga0307510_10047949 | Ga0307510_100479491 | 530 |
| 510 | 3300039450 | Ga0436363_1183593 | Ga0436363_1183593_1344_3083 | 530 |
| 511 | 3300048924 | Ga0496121_0008145 | Ga0496121_0008145_608_2434 | 530 |
| 512 | 3300053096 | Ga0500641_0017847 | Ga0500641_0017847_371_2182 | 530 |
| 513 | iso_pu_bacteria | 2513237092 | 2513623480 | 530 |
| 514 | iso_pu_bacteria | 2513237104 | 2513716911 | 530 |
| 515 | iso_pu_bacteria | 2617270741 | 2617373139 | 530 |
| 516 | iso_pu_bacteria | 2874604998 | 2874612587 | 530 |
| 517 | iso_pu_bacteria | 2881665667 | 2881672690 | 530 |
| 518 | iso_pu_bacteria | 2908775508 | 2908781593 | 530 |
| 519 | iso_pu_bacteria | 2922393267 | 2922393570 | 530 |
| 520 | iso_pu_bacteria | 3005483717 | 3005486189 | 530 |
| 521 | iso_pu_bacteria | 3005587118 | 3005588492 | 530 |
| 522 | 3300005539 | Ga0068853_100024007 | Ga0068853_1000240072 | 531 |
| 523 | 3300026116 | Ga0207674_10069718 | Ga0207674_100697182 | 531 |
| 524 | 3300053119 | Ga0500595_011523 | Ga0500595_011523_33_1865 | 531 |
| 525 | iso_pu_bacteria | 2517093001 | 2517100585 | 531 |
| 526 | iso_pu_bacteria | 2524023228 | 2524534486 | 531 |
| 527 | iso_pu_bacteria | 2841957949 | 2841960225 | 531 |
| 528 | iso_pu_bacteria | 2842045827 | 2842050753 | 531 |
| 529 | iso_pu_bacteria | 2874612657 | 2874617703 | 531 |
| 530 | iso_pu_bacteria | 2885366525 | 2885366941 | 531 |
| 531 | iso_pu_bacteria | 2904690495 | 2904697721 | 531 |
| 532 | iso_pu_bacteria | 2904699407 | 2904705783 | 531 |
| 533 | iso_pu_bacteria | 2908756301 | 2908757182 | 531 |
| 534 | iso_pu_bacteria | 3005506211 | 3005507130 | 531 |
| 535 | iso_pu_bacteria | 3005594810 | 3005596554 | 531 |
| 536 | iso_pu_bacteria | 3005710791 | 3005712622 | 531 |
| 537 | iso_pu_bacteria | 3005718088 | 3005719683 | 531 |
| 538 | iso_pu_bacteria | 8006933436 | 8006933607 | 531 |
| 539 | iso_pu_bacteria | 8006973647 | 8006983280 | 531 |
| 540 | 3300005983 | Ga0081540_1001143 | Ga0081540_10011435 | 532 |
| 541 | 3300006042 | Ga0075368_10016141 | Ga0075368_100161412 | 532 |
| 542 | 3300033180 | Ga0307510_10004348 | Ga0307510_100043482 | 532 |
| 543 | 3300046455 | Ga0495603_0011088 | Ga0495603_0011088_3410_5221 | 532 |
| 544 | 3300053093 | Ga0500651_0053755 | Ga0500651_0053755_330_2153 | 532 |
| 545 | 3300053178 | Ga0500637_0005097 | Ga0500637_0005097_237_2048 | 532 |
| 546 | iso_pu_bacteria | 2507262055 | 2507511005 | 532 |
| 547 | iso_pu_bacteria | 2508501009 | 2508544826 | 532 |
| 548 | iso_pu_bacteria | 2508501042 | 2508696946 | 532 |
| 549 | iso_pu_bacteria | 2511231028 | 2511394084 | 532 |
| 550 | iso_pu_bacteria | 2513237094 | 2513637474 | 532 |
| 551 | iso_pu_bacteria | 2513237095 | 2513649676 | 532 |
| 552 | iso_pu_bacteria | 2513237102 | 2513699949 | 532 |
| 553 | iso_pu_bacteria | 2513237141 | 2513892079 | 532 |
| 554 | iso_pu_bacteria | 2515154112 | 2515625442 | 532 |
| 555 | iso_pu_bacteria | 2524023205 | 2524438192 | 532 |
| 556 | iso_pu_bacteria | 2528768022 | 2528849826 | 532 |
| 557 | iso_pu_bacteria | 2602042107 | 2603862625 | 532 |
| 558 | iso_pu_bacteria | 2617270735 | 2617350770 | 532 |
| 559 | iso_pu_bacteria | 2643221651 | 2644287355 | 532 |
| 560 | iso_pu_bacteria | 2667528175 | 2671119151 | 532 |
| 561 | iso_pu_bacteria | 2721755755 | 2723843082 | 532 |
| 562 | iso_pu_bacteria | 2744054633 | 2745076926 | 532 |
| 563 | iso_pu_bacteria | 2791355196 | 2793064658 | 532 |
| 564 | iso_pu_bacteria | 2791355197 | 2793071212 | 532 |
| 565 | iso_pu_bacteria | 2802429603 | 2805916643 | 532 |
| 566 | iso_pu_bacteria | 2816332527 | 2818238147 | 532 |
| 567 | iso_pu_bacteria | 2838122688 | 2838127890 | 532 |
| 568 | iso_pu_bacteria | 2841941048 | 2841943183 | 532 |
| 569 | iso_pu_bacteria | 2841949485 | 2841954086 | 532 |
| 570 | iso_pu_bacteria | 2841966195 | 2841968176 | 532 |
| 571 | iso_pu_bacteria | 2841974524 | 2841976614 | 532 |
| 572 | iso_pu_bacteria | 2841983080 | 2841987987 | 532 |
| 573 | iso_pu_bacteria | 2847930680 | 2847938557 | 532 |
| 574 | iso_pu_bacteria | 2847939898 | 2847944243 | 532 |
| 575 | iso_pu_bacteria | 2849076700 | 2849081524 | 532 |
| 576 | iso_pu_bacteria | 2857509624 | 2857512183 | 532 |
| 577 | iso_pu_bacteria | 2874590934 | 2874597743 | 532 |
| 578 | iso_pu_bacteria | 2874620515 | 2874623441 | 532 |
| 579 | iso_pu_bacteria | 2874628541 | 2874630649 | 532 |
| 580 | iso_pu_bacteria | 2874645413 | 2874651272 | 532 |
| 581 | iso_pu_bacteria | 2876761206 | 2876762408 | 532 |
| 582 | iso_pu_bacteria | 2876771140 | 2876776343 | 532 |
| 583 | iso_pu_bacteria | 2876818435 | 2876820911 | 532 |
| 584 | iso_pu_bacteria | 2879074833 | 2879081794 | 532 |
| 585 | iso_pu_bacteria | 2879099564 | 2879101355 | 532 |
| 586 | iso_pu_bacteria | 2879127579 | 2879130509 | 532 |
| 587 | iso_pu_bacteria | 2879142872 | 2879146395 | 532 |
| 588 | iso_pu_bacteria | 2881364244 | 2881370674 | 532 |
| 589 | iso_pu_bacteria | 2885409591 | 2885413438 | 532 |
| 590 | iso_pu_bacteria | 2888378607 | 2888381530 | 532 |
| 591 | iso_pu_bacteria | 2888388044 | 2888389109 | 532 |
| 592 | iso_pu_bacteria | 2888419890 | 2888421933 | 532 |
| 593 | iso_pu_bacteria | 2903748898 | 2903751420 | 532 |
| 594 | iso_pu_bacteria | 2904666416 | 2904667328 | 532 |
| 595 | iso_pu_bacteria | 2906610324 | 2906611457 | 532 |
| 596 | iso_pu_bacteria | 2906626472 | 2906635173 | 532 |
| 597 | iso_pu_bacteria | 2908739725 | 2908745049 | 532 |
| 598 | iso_pu_bacteria | 2922368715 | 2922371198 | 532 |
| 599 | iso_pu_bacteria | 2922425934 | 2922427900 | 532 |
| 600 | iso_pu_bacteria | 2929615660 | 2929619582 | 532 |
| 601 | iso_pu_bacteria | 2929624759 | 2929627948 | 532 |
| 602 | iso_pu_bacteria | 2932784394 | 2932785912 | 532 |
| 603 | iso_pu_bacteria | 2932794094 | 2932798308 | 532 |
| 604 | iso_pu_bacteria | 2932801729 | 2932804104 | 532 |
| 605 | iso_pu_bacteria | 2932809354 | 2932817283 | 532 |
| 606 | iso_pu_bacteria | 2932818245 | 2932826880 | 532 |
| 607 | iso_pu_bacteria | 2932828146 | 2932830956 | 532 |
| 608 | iso_pu_bacteria | 2933577622 | 2933581502 | 532 |
| 609 | iso_pu_bacteria | 2935608549 | 2935612757 | 532 |
| 610 | iso_pu_bacteria | 2935616580 | 2935621021 | 532 |
| 611 | iso_pu_bacteria | 2935638405 | 2935640097 | 532 |
| 612 | iso_pu_bacteria | 2935648319 | 2935656715 | 532 |
| 613 | iso_pu_bacteria | 2935656913 | 2935665546 | 532 |
| 614 | iso_pu_bacteria | 2935665750 | 2935667064 | 532 |
| 615 | iso_pu_bacteria | 2935675223 | 2935680293 | 532 |
| 616 | iso_pu_bacteria | 2935684952 | 2935690196 | 532 |
| 617 | iso_pu_bacteria | 2935694250 | 2935699718 | 532 |
| 618 | iso_pu_bacteria | 2935703347 | 2935704820 | 532 |
| 619 | iso_pu_bacteria | 2935713505 | 2935718107 | 532 |
| 620 | iso_pu_bacteria | 2935722832 | 2935726743 | 532 |
| 621 | iso_pu_bacteria | 2935732158 | 2935735512 | 532 |
| 622 | iso_pu_bacteria | 2935741537 | 2935745217 | 532 |
| 623 | iso_pu_bacteria | 2935750917 | 2935755207 | 532 |
| 624 | iso_pu_bacteria | 2935760218 | 2935762276 | 532 |
| 625 | iso_pu_bacteria | 2935777560 | 2935780218 | 532 |
| 626 | iso_pu_bacteria | 2935785616 | 2935788432 | 532 |
| 627 | iso_pu_bacteria | 2935793552 | 2935796588 | 532 |
| 628 | iso_pu_bacteria | 2935801545 | 2935803778 | 532 |
| 629 | iso_pu_bacteria | 2935810662 | 2935811694 | 532 |
| 630 | iso_pu_bacteria | 2935819856 | 2935824246 | 532 |
| 631 | iso_pu_bacteria | 2935827899 | 2935829580 | 532 |
| 632 | iso_pu_bacteria | 2935837841 | 2935843086 | 532 |
| 633 | iso_pu_bacteria | 2935847175 | 2935852607 | 532 |
| 634 | iso_pu_bacteria | 2935855204 | 2935858828 | 532 |
| 635 | iso_pu_bacteria | 2935864058 | 2935866774 | 532 |
| 636 | iso_pu_bacteria | 2935873716 | 2935876905 | 532 |
| 637 | iso_pu_bacteria | 2935883170 | 2935884090 | 532 |
| 638 | iso_pu_bacteria | 2935908558 | 2935912247 | 532 |
| 639 | iso_pu_bacteria | 2935916978 | 2935924079 | 532 |
| 640 | iso_pu_bacteria | 2935926038 | 2935929276 | 532 |
| 641 | iso_pu_bacteria | 2935934488 | 2935935907 | 532 |
| 642 | iso_pu_bacteria | 2935942939 | 2935950415 | 532 |
| 643 | iso_pu_bacteria | 2935951376 | 2935957427 | 532 |
| 644 | iso_pu_bacteria | 2935959822 | 2935962050 | 532 |
| 645 | iso_pu_bacteria | 2935967501 | 2935968458 | 532 |
| 646 | iso_pu_bacteria | 2935975950 | 2935976647 | 532 |
| 647 | iso_pu_bacteria | 2935984226 | 2935990729 | 532 |
| 648 | iso_pu_bacteria | 2935992306 | 2935993458 | 532 |
| 649 | iso_pu_bacteria | 2936002035 | 2936004353 | 532 |
| 650 | iso_pu_bacteria | 2936011229 | 2936019578 | 532 |
| 651 | iso_pu_bacteria | 2936019824 | 2936028194 | 532 |
| 652 | iso_pu_bacteria | 2936028420 | 2936037067 | 532 |
| 653 | iso_pu_bacteria | 2936037263 | 2936038276 | 532 |
| 654 | iso_pu_bacteria | 2936046547 | 2936055051 | 532 |
| 655 | iso_pu_bacteria | 2936055302 | 2936058613 | 532 |
| 656 | iso_pu_bacteria | 2940556831 | 2940561512 | 532 |
| 657 | iso_pu_bacteria | 2941531003 | 2941533703 | 532 |
| 658 | iso_pu_bacteria | 2941538514 | 2941544310 | 532 |
| 659 | iso_pu_bacteria | 3005474847 | 3005477610 | 532 |
| 660 | iso_pu_bacteria | 8006984368 | 8006989349 | 532 |
| 661 | iso_pu_bacteria | 8006994254 | 8006997831 | 532 |
| 662 | iso_pu_bacteria | 8016511872 | 8016516429 | 532 |
| 663 | iso_pu_bacteria | 8016530956 | 8016537361 | 532 |
| 664 | iso_pu_bacteria | 8016566248 | 8016567015 | 532 |
| 665 | iso_pu_bacteria | 8016575299 | 8016579734 | 532 |
| 666 | iso_pu_bacteria | 8016595262 | 8016597949 | 532 |
| 667 | iso_pu_bacteria | 8016603502 | 8016604089 | 532 |
| 668 | iso_pu_bacteria | 8016613128 | 8016620670 | 532 |
| 669 | iso_pu_bacteria | 8016622563 | 8016629327 | 532 |
| 670 | iso_pu_bacteria | 8017057580 | 8017060108 | 532 |
| 671 | iso_pu_bacteria | 8019538911 | 8019542496 | 532 |
| 672 | iso_pu_bacteria | 8019547302 | 8019548258 | 532 |
| 673 | iso_pu_bacteria | 8019555841 | 8019559543 | 532 |
| 674 | iso_pu_bacteria | 8019565922 | 8019569647 | 532 |
| 675 | iso_pu_bacteria | 8019586578 | 8019587329 | 532 |
| 676 | iso_pu_bacteria | 8019597564 | 8019604012 | 532 |
| 677 | iso_pu_bacteria | 8019619141 | 8019625144 | 532 |
| 678 | iso_pu_bacteria | 8019629233 | 8019637037 | 532 |
| 679 | iso_pu_bacteria | 8019648815 | 8019650018 | 532 |
| 680 | iso_pu_bacteria | 8019659431 | 8019664879 | 532 |
| 681 | iso_pu_bacteria | 8019668869 | 8019674437 | 532 |
| 682 | iso_pu_bacteria | 8019678201 | 8019681664 | 532 |
| 683 | iso_pu_bacteria | 8019687851 | 8019694107 | 532 |
| 684 | iso_pu_bacteria | 8055742211 | 8055749160 | 532 |
| 685 | 3300005937 | Ga0081455_10006756 | Ga0081455_100067565 | 533 |
| 686 | 3300035086 | Ga0373934_0008722 | Ga0373934_0008722_1274_3067 | 533 |
| 687 | iso_pu_bacteria | 2513237096 | 2513655020 | 533 |
| 688 | iso_pu_bacteria | 2513237137 | 2513861035 | 533 |
| 689 | iso_pu_bacteria | 2513237145 | 2513915957 | 533 |
| 690 | iso_pu_bacteria | 2517572143 | 2517894736 | 533 |
| 691 | iso_pu_bacteria | 2906660503 | 2906660807 | 533 |
| 692 | iso_pu_bacteria | 2935630451 | 2935632172 | 533 |
| 693 | iso_pu_bacteria | 2941507105 | 2941508120 | 533 |
| 694 | iso_pu_bacteria | 2941515067 | 2941515375 | 533 |
| 695 | iso_pu_bacteria | 2941523033 | 2941524050 | 533 |
| 696 | iso_pu_bacteria | 8006926726 | 8006932248 | 533 |
| 697 | 3300005719 | Ga0068861_100109804 | Ga0068861_1001098041 | 534 |
| 698 | 3300006881 | Ga0068865_100062481 | Ga0068865_1000624812 | 534 |
| 699 | 3300025927 | Ga0207687_10088865 | Ga0207687_100888651 | 534 |
| 700 | 3300025931 | Ga0207644_10034045 | Ga0207644_100340452 | 534 |
| 701 | 3300025935 | Ga0207709_10024068 | Ga0207709_100240682 | 534 |
| 702 | iso_pu_bacteria | 2791355199 | 2793079511 | 534 |
| 703 | iso_pu_bacteria | 2889033259 | 2889033616 | 534 |
| 704 | iso_pu_bacteria | 2893066018 | 2893069385 | 534 |
| 705 | iso_pu_bacteria | 2922361189 | 2922366985 | 534 |
| 706 | iso_pu_bacteria | 8056673599 | 8056674865 | 534 |
| 707 | 3300046689 | Ga0495613_0000929 | Ga0495613_0000929_20565_22337 | 535 |
| 708 | 3300053119 | Ga0500595_001914 | Ga0500595_001914_1202_2992 | 535 |
| 709 | 3300053178 | Ga0500637_0000121 | Ga0500637_0000121_10797_12587 | 535 |
| 710 | iso_pu_bacteria | 2508501128 | 2509148869 | 535 |
| 711 | iso_pu_bacteria | 2513237098 | 2513677790 | 535 |
| 712 | iso_pu_bacteria | 2513237101 | 2513697426 | 535 |
| 713 | iso_pu_bacteria | 2524023210 | 2524464069 | 535 |
| 714 | iso_pu_bacteria | 2879110137 | 2879118028 | 535 |
| 715 | iso_pu_bacteria | 2922386360 | 2922390234 | 535 |
| 716 | iso_pu_bacteria | 8006964411 | 8006966521 | 535 |
| 717 | iso_pu_bacteria | 8056681323 | 8056682388 | 535 |
| 718 | 3300013296 | Ga0157374_10047518 | Ga0157374_100475181 | 537 |
| 719 | 3300031456 | Ga0307513_10112096 | Ga0307513_101120962 | 537 |
| 720 | 3300048904 | Ga0496101_0029634 | Ga0496101_0029634_1991_3784 | 537 |
| 721 | 3300047320 | Ga0495672_0020995 | Ga0495672_0020995_952_2763 | 538 |
| 722 | 3300031616 | Ga0307508_10014686 | Ga0307508_100146863 | 539 |
| 723 | 3300031241 | Ga0265325_10009754 | Ga0265325_100097543 | 540 |
| 724 | 3300031711 | Ga0265314_10057208 | Ga0265314_100572081 | 540 |
| 725 | 3300001990 | JGI24737J22298_10001955 | JGI24737J22298_100019552 | 542 |
| 726 | 3300005539 | Ga0068853_100098898 | Ga0068853_1000988982 | 542 |
| 727 | 3300005563 | Ga0068855_100157838 | Ga0068855_1001578382 | 542 |
| 728 | 3300005577 | Ga0068857_100061834 | Ga0068857_1000618342 | 542 |
| 729 | 3300005616 | Ga0068852_100103362 | Ga0068852_1001033622 | 542 |
| 730 | 3300009093 | Ga0105240_10076691 | Ga0105240_100766912 | 542 |
| 731 | 3300009551 | Ga0105238_10020275 | Ga0105238_100202752 | 542 |
| 732 | 3300025904 | Ga0207647_10001688 | Ga0207647_1000168811 | 542 |
| 733 | 3300025913 | Ga0207695_10018045 | Ga0207695_100180456 | 542 |
| 734 | 3300025924 | Ga0207694_10009680 | Ga0207694_100096802 | 542 |
| 735 | 3300025949 | Ga0207667_10010126 | Ga0207667_100101262 | 542 |
| 736 | 3300025981 | Ga0207640_10011719 | Ga0207640_100117192 | 542 |
| 737 | 3300026041 | Ga0207639_10082674 | Ga0207639_100826742 | 542 |
| 738 | 3300026078 | Ga0207702_10007932 | Ga0207702_100079325 | 542 |
| 739 | 3300026116 | Ga0207674_10069601 | Ga0207674_100696011 | 542 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar