F478530
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 374 | 1480 | 504 |
Family's Representative Sequence
| Representative Sequence | 3300025907|Ga0207645_10074548|Ga0207645_100745482 |
| Length | 581 |
| Sequence | MRKRPGGCAGAAIYNARPAPPVPRCFHPHSQSARRAATLSPASAHADTAKDSAVPLSERLHALPRDVLNDLRRGIEKESLRVRANGGLATTLHPELLGSALTHPYITTDFSESQLEFVTGVHASAQAVIDELTQIHQFTYRVLQEGRDEMLWVSSMPCGLPIDETIPIGRYGSSNVGRAKSVYRMGLGHRYGRRMQTISGIHYNWSLPGVTSDEYFGLIRNFRRHSFLLLYLFGASPALCSSFVAGRDHGLQPLKGALHMPHGTSLRMGRLGYQSDAQASLAVSYNSLDSYGASLQEALTKPYPPYEAVGIRSPGGEYNQLATSLLQIENEFYGTIRPKRVIRPGERPLHALRERGVEYVEVRCMDLDPFEHVGIAASTMCFLDVFLMHCLLKHSPPDTPQEIASLARNQQRVAARGREPGLTLERGADDVPLADWGKQLLRECEPIAEALDALDGGRKHRDAMLNAWRVIGEPGIAPSARVLATLARDFDDSFVAFTRAQSQQTQAALLARPYSDQLHNRLTRLSQDSIEEQKRIEASDSLLLRERLPSRLLVDLIRRHRPLSGRLDSQVATVASNPVGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 117 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 238 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 239 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 258 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 262 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 263 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 264 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 265 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 331 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 348 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 349 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 354 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 358 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 359 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 360 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 361 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 362 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 363 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 364 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 365 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 366 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 367 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 368 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 369 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 370 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 371 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 372 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 373 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 374 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.7 |
| Metatranscriptomes | 0 |
| Isolates | 2.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.3 |
| Nodule | 0.68 |
| Rhizoplane | 1.49 |
| Rhizosphere | 79.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207645_10074548 | 3300025907 | Bacteria | 2172 |
| 2 | JGI25156J39149_1000218 | 3300002705 | Bacteria | 39862 |
| 3 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 4 | rootH1_10024535 | 3300003316 | Bacteria | 4449 |
| 5 | rootH2_10010286 | 3300003320 | Bacteria | 8010 |
| 6 | Ga0055539_1000240 | 3300003752 | Bacteria | 36494 |
| 7 | Ga0055539_1000791 | 3300003752 | Bacteria | 7539 |
| 8 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 9 | Ga0055525_1000036 | 3300003759 | Bacteria | 298878 |
| 10 | Ga0055525_1001651 | 3300003759 | Bacteria | 3444 |
| 11 | Ga0055535_1000087 | 3300003761 | Bacteria | 102655 |
| 12 | Ga0055529_1000139 | 3300003763 | Bacteria | 102943 |
| 13 | Ga0055526_1010015 | 3300003771 | Bacteria | 4471 |
| 14 | Ga0055524_1000293 | 3300003775 | Bacteria | 48153 |
| 15 | Ga0055524_1000298 | 3300003775 | Bacteria | 47522 |
| 16 | Ga0055524_1003033 | 3300003775 | Bacteria | 8309 |
| 17 | Ga0055530_10000980 | 3300003791 | Bacteria | 23000 |
| 18 | Ga0055530_10003756 | 3300003791 | Bacteria | 8383 |
| 19 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 20 | Ga0055540_1000814 | 3300003792 | Bacteria | 21128 |
| 21 | Ga0055540_1013728 | 3300003792 | Bacteria | 2457 |
| 22 | Ga0055531_10001879 | 3300003794 | Bacteria | 14715 |
| 23 | Ga0055531_10006028 | 3300003794 | Bacteria | 6954 |
| 24 | Ga0055531_10011039 | 3300003794 | Bacteria | 4413 |
| 25 | Ga0055531_10017009 | 3300003794 | Bacteria | 3098 |
| 26 | Ga0065165_1000170 | 3300005262 | Bacteria | 115389 |
| 27 | Ga0065165_1000350 | 3300005262 | Bacteria | 75453 |
| 28 | Ga0065707_10083063 | 3300005295 | Bacteria | 10637 |
| 29 | Ga0070676_10000767 | 3300005328 | Bacteria | 15794 |
| 30 | Ga0070676_10003615 | 3300005328 | Bacteria | 8082 |
| 31 | Ga0070690_100002113 | 3300005330 | Bacteria | 10611 |
| 32 | Ga0070690_100011407 | 3300005330 | Bacteria | 5195 |
| 33 | Ga0070670_100001272 | 3300005331 | Bacteria | 20095 |
| 34 | Ga0070670_100005773 | 3300005331 | Bacteria | 10459 |
| 35 | Ga0070670_100019276 | 3300005331 | Bacteria | 5851 |
| 36 | Ga0070670_100023314 | 3300005331 | Bacteria | 5327 |
| 37 | Ga0070670_100026127 | 3300005331 | Bacteria | 5026 |
| 38 | Ga0070670_100027312 | 3300005331 | Bacteria | 4910 |
| 39 | Ga0070670_100054958 | 3300005331 | Bacteria | 3418 |
| 40 | Ga0070677_10000847 | 3300005333 | Bacteria | 10059 |
| 41 | Ga0068869_100000992 | 3300005334 | Bacteria | 16477 |
| 42 | Ga0068869_100001116 | 3300005334 | Bacteria | 15641 |
| 43 | Ga0068869_100003517 | 3300005334 | Bacteria | 9609 |
| 44 | Ga0068869_100005508 | 3300005334 | Bacteria | 7966 |
| 45 | Ga0068869_100010491 | 3300005334 | Bacteria | 6043 |
| 46 | Ga0068869_100034289 | 3300005334 | Bacteria | 3589 |
| 47 | Ga0070666_10002655 | 3300005335 | Bacteria | 10784 |
| 48 | Ga0070680_100059609 | 3300005336 | Bacteria | 3123 |
| 49 | Ga0070682_100036200 | 3300005337 | Bacteria | 3016 |
| 50 | Ga0068868_100000891 | 3300005338 | Bacteria | 20300 |
| 51 | Ga0068868_100005385 | 3300005338 | Bacteria | 8992 |
| 52 | Ga0068868_100009964 | 3300005338 | Bacteria | 6864 |
| 53 | Ga0068868_100029520 | 3300005338 | Bacteria | 4199 |
| 54 | Ga0068868_100110512 | 3300005338 | Bacteria | 2233 |
| 55 | Ga0070689_100006915 | 3300005340 | Bacteria | 7896 |
| 56 | Ga0070689_100007279 | 3300005340 | Bacteria | 7719 |
| 57 | Ga0070689_100063612 | 3300005340 | Bacteria | 2871 |
| 58 | Ga0070691_10004739 | 3300005341 | Bacteria | 6188 |
| 59 | Ga0070687_100000444 | 3300005343 | Bacteria | 13939 |
| 60 | Ga0070661_100000390 | 3300005344 | Bacteria | 34236 |
| 61 | Ga0070692_10018650 | 3300005345 | Bacteria | 3340 |
| 62 | Ga0070668_100002661 | 3300005347 | Bacteria | 13135 |
| 63 | Ga0070668_100003156 | 3300005347 | Bacteria | 12149 |
| 64 | Ga0070668_100008128 | 3300005347 | Bacteria | 7792 |
| 65 | Ga0070668_100012980 | 3300005347 | Bacteria | 6204 |
| 66 | Ga0070669_100008972 | 3300005353 | Bacteria | 7138 |
| 67 | Ga0070669_100012982 | 3300005353 | Bacteria | 5915 |
| 68 | Ga0070669_100017827 | 3300005353 | Bacteria | 5068 |
| 69 | Ga0070669_100038866 | 3300005353 | Bacteria | 3456 |
| 70 | Ga0070669_100041659 | 3300005353 | Bacteria | 3340 |
| 71 | Ga0070669_100053218 | 3300005353 | Bacteria | 2963 |
| 72 | Ga0070675_100000137 | 3300005354 | Bacteria | 44007 |
| 73 | Ga0070675_100017097 | 3300005354 | Bacteria | 5764 |
| 74 | Ga0070675_100018625 | 3300005354 | Bacteria | 5527 |
| 75 | Ga0070675_100035137 | 3300005354 | Bacteria | 4071 |
| 76 | Ga0070671_100005066 | 3300005355 | Bacteria | 10505 |
| 77 | Ga0070671_100005440 | 3300005355 | Bacteria | 10166 |
| 78 | Ga0070671_100066323 | 3300005355 | Bacteria | 3008 |
| 79 | Ga0070671_100106304 | 3300005355 | Bacteria | 2356 |
| 80 | Ga0070674_100004655 | 3300005356 | Bacteria | 7838 |
| 81 | Ga0070674_100005446 | 3300005356 | Bacteria | 7353 |
| 82 | Ga0070674_100009543 | 3300005356 | Bacteria | 5812 |
| 83 | Ga0070674_100085497 | 3300005356 | Bacteria | 2264 |
| 84 | Ga0070673_100002120 | 3300005364 | Bacteria | 12006 |
| 85 | Ga0070673_100010923 | 3300005364 | Bacteria | 6174 |
| 86 | Ga0070673_100011491 | 3300005364 | Bacteria | 6044 |
| 87 | Ga0070673_100014597 | 3300005364 | Bacteria | 5480 |
| 88 | Ga0070688_100002002 | 3300005365 | Bacteria | 10269 |
| 89 | Ga0070659_100001472 | 3300005366 | Bacteria | 16953 |
| 90 | Ga0070659_100162332 | 3300005366 | Bacteria | 1828 |
| 91 | Ga0070667_100058958 | 3300005367 | Bacteria | 3246 |
| 92 | Ga0070667_100062079 | 3300005367 | Bacteria | 3165 |
| 93 | Ga0070667_100103551 | 3300005367 | Bacteria | 2461 |
| 94 | Ga0070714_100014787 | 3300005435 | Bacteria | 6271 |
| 95 | Ga0070713_100000062 | 3300005436 | Bacteria | 68367 |
| 96 | Ga0070713_100008753 | 3300005436 | Bacteria | 7201 |
| 97 | Ga0070701_10000048 | 3300005438 | Bacteria | 30903 |
| 98 | Ga0070711_100163205 | 3300005439 | Bacteria | 1691 |
| 99 | Ga0070705_100001065 | 3300005440 | Bacteria | 15269 |
| 100 | Ga0070700_100000835 | 3300005441 | Bacteria | 15179 |
| 101 | Ga0070700_100028440 | 3300005441 | Bacteria | 3325 |
| 102 | Ga0070694_100000507 | 3300005444 | Bacteria | 21401 |
| 103 | Ga0070708_100000069 | 3300005445 | Bacteria | 67790 |
| 104 | Ga0070708_100026007 | 3300005445 | Bacteria | 5006 |
| 105 | Ga0070663_100020444 | 3300005455 | Bacteria | 4385 |
| 106 | Ga0070663_100035180 | 3300005455 | Bacteria | 3474 |
| 107 | Ga0070663_100036606 | 3300005455 | Bacteria | 3410 |
| 108 | Ga0070678_100000909 | 3300005456 | Bacteria | 15199 |
| 109 | Ga0070678_100003739 | 3300005456 | Bacteria | 8519 |
| 110 | Ga0070678_100011211 | 3300005456 | Bacteria | 5519 |
| 111 | Ga0070678_100059007 | 3300005456 | Bacteria | 2819 |
| 112 | Ga0070662_100001442 | 3300005457 | Bacteria | 14654 |
| 113 | Ga0070662_100032483 | 3300005457 | Bacteria | 3669 |
| 114 | Ga0070662_100073860 | 3300005457 | Bacteria | 2521 |
| 115 | Ga0070681_10201378 | 3300005458 | Bacteria | 1909 |
| 116 | Ga0068867_100000066 | 3300005459 | Bacteria | 63559 |
| 117 | Ga0068867_100001467 | 3300005459 | Bacteria | 16338 |
| 118 | Ga0068867_100002150 | 3300005459 | Bacteria | 13826 |
| 119 | Ga0068867_100006246 | 3300005459 | Bacteria | 8429 |
| 120 | Ga0068867_100006505 | 3300005459 | Bacteria | 8255 |
| 121 | Ga0068867_100012502 | 3300005459 | Bacteria | 6008 |
| 122 | Ga0068867_100025210 | 3300005459 | Bacteria | 4266 |
| 123 | Ga0068867_100030811 | 3300005459 | Bacteria | 3869 |
| 124 | Ga0068867_100058389 | 3300005459 | Bacteria | 2859 |
| 125 | Ga0070685_10002701 | 3300005466 | Bacteria | 9085 |
| 126 | Ga0070706_100011891 | 3300005467 | Bacteria | 8079 |
| 127 | Ga0070706_100053304 | 3300005467 | Bacteria | 3733 |
| 128 | Ga0070706_100066851 | 3300005467 | Bacteria | 3325 |
| 129 | Ga0070707_100033973 | 3300005468 | Bacteria | 4864 |
| 130 | Ga0070699_100070976 | 3300005518 | Bacteria | 3028 |
| 131 | Ga0070697_100013590 | 3300005536 | Bacteria | 6386 |
| 132 | Ga0068853_100040306 | 3300005539 | Bacteria | 3985 |
| 133 | Ga0068853_100051453 | 3300005539 | Bacteria | 3545 |
| 134 | Ga0068853_100104519 | 3300005539 | Bacteria | 2507 |
| 135 | Ga0070672_100002141 | 3300005543 | Bacteria | 12460 |
| 136 | Ga0070672_100002461 | 3300005543 | Bacteria | 11756 |
| 137 | Ga0070672_100005351 | 3300005543 | Bacteria | 8498 |
| 138 | Ga0070672_100007419 | 3300005543 | Bacteria | 7435 |
| 139 | Ga0070672_100048905 | 3300005543 | Bacteria | 3288 |
| 140 | Ga0070695_100001194 | 3300005545 | Bacteria | 14293 |
| 141 | Ga0070696_100000200 | 3300005546 | Bacteria | 35454 |
| 142 | Ga0070696_100011344 | 3300005546 | Bacteria | 5966 |
| 143 | Ga0070693_100000609 | 3300005547 | Bacteria | 15845 |
| 144 | Ga0070693_100002121 | 3300005547 | Bacteria | 9081 |
| 145 | Ga0070693_100049794 | 3300005547 | Bacteria | 2392 |
| 146 | Ga0070665_100012429 | 3300005548 | Bacteria | 8582 |
| 147 | Ga0070665_100015067 | 3300005548 | Bacteria | 7762 |
| 148 | Ga0070704_100001097 | 3300005549 | Bacteria | 14043 |
| 149 | Ga0070704_100167340 | 3300005549 | Bacteria | 1744 |
| 150 | Ga0068855_100002529 | 3300005563 | Bacteria | 22530 |
| 151 | Ga0068855_100020838 | 3300005563 | Bacteria | 7861 |
| 152 | Ga0068855_100073398 | 3300005563 | Bacteria | 3975 |
| 153 | Ga0068855_100091785 | 3300005563 | Bacteria | 3503 |
| 154 | Ga0068855_100101570 | 3300005563 | Bacteria | 3311 |
| 155 | Ga0070664_100007377 | 3300005564 | Bacteria | 8870 |
| 156 | Ga0070664_100010267 | 3300005564 | Bacteria | 7594 |
| 157 | Ga0068857_100001688 | 3300005577 | Bacteria | 17742 |
| 158 | Ga0068857_100015468 | 3300005577 | Bacteria | 6666 |
| 159 | Ga0068857_100051744 | 3300005577 | Bacteria | 3645 |
| 160 | Ga0068854_100004859 | 3300005578 | Bacteria | 8476 |
| 161 | Ga0068854_100008360 | 3300005578 | Bacteria | 6650 |
| 162 | Ga0068854_100017323 | 3300005578 | Bacteria | 4820 |
| 163 | Ga0068856_100021742 | 3300005614 | Bacteria | 6234 |
| 164 | Ga0068852_100081433 | 3300005616 | Bacteria | 2873 |
| 165 | Ga0068859_100001470 | 3300005617 | Bacteria | 24006 |
| 166 | Ga0068859_100005503 | 3300005617 | Bacteria | 12897 |
| 167 | Ga0068859_100013579 | 3300005617 | Bacteria | 8166 |
| 168 | Ga0068864_100004243 | 3300005618 | Bacteria | 11795 |
| 169 | Ga0068864_100006715 | 3300005618 | Bacteria | 9427 |
| 170 | Ga0068864_100008849 | 3300005618 | Bacteria | 8299 |
| 171 | Ga0068864_100064709 | 3300005618 | Bacteria | 3172 |
| 172 | Ga0068864_100072232 | 3300005618 | Bacteria | 3007 |
| 173 | Ga0068864_100102896 | 3300005618 | Bacteria | 2535 |
| 174 | Ga0068866_10004707 | 3300005718 | Bacteria | 5599 |
| 175 | Ga0068866_10005195 | 3300005718 | Bacteria | 5363 |
| 176 | Ga0068866_10008606 | 3300005718 | Bacteria | 4309 |
| 177 | Ga0068861_100001821 | 3300005719 | Bacteria | 13736 |
| 178 | Ga0068861_100002344 | 3300005719 | Bacteria | 12314 |
| 179 | Ga0068870_10033070 | 3300005840 | Bacteria | 2636 |
| 180 | Ga0068863_100007463 | 3300005841 | Bacteria | 10703 |
| 181 | Ga0068863_100010525 | 3300005841 | Bacteria | 8981 |
| 182 | Ga0068863_100016349 | 3300005841 | Bacteria | 7118 |
| 183 | Ga0068863_100034665 | 3300005841 | Bacteria | 4807 |
| 184 | Ga0068863_100036136 | 3300005841 | Bacteria | 4705 |
| 185 | Ga0068858_100006680 | 3300005842 | Bacteria | 11221 |
| 186 | Ga0068858_100035072 | 3300005842 | Bacteria | 4653 |
| 187 | Ga0068858_100065752 | 3300005842 | Bacteria | 3356 |
| 188 | Ga0068858_100202884 | 3300005842 | Bacteria | 1876 |
| 189 | Ga0068860_100007369 | 3300005843 | Bacteria | 11000 |
| 190 | Ga0068860_100014391 | 3300005843 | Bacteria | 7752 |
| 191 | Ga0068860_100044909 | 3300005843 | Bacteria | 4211 |
| 192 | Ga0068860_100080022 | 3300005843 | Bacteria | 3107 |
| 193 | Ga0068860_100128020 | 3300005843 | Bacteria | 2434 |
| 194 | Ga0068860_100153284 | 3300005843 | Bacteria | 2220 |
| 195 | Ga0068862_100016870 | 3300005844 | Bacteria | 6077 |
| 196 | Ga0068862_100032793 | 3300005844 | Bacteria | 4387 |
| 197 | Ga0068862_100040494 | 3300005844 | Bacteria | 3960 |
| 198 | Ga0068862_100057766 | 3300005844 | Bacteria | 3328 |
| 199 | Ga0068862_100067382 | 3300005844 | Bacteria | 3086 |
| 200 | Ga0068862_100084347 | 3300005844 | Bacteria | 2760 |
| 201 | Ga0075365_10018254 | 3300006038 | Bacteria | 4311 |
| 202 | Ga0075368_10019924 | 3300006042 | Bacteria | 2536 |
| 203 | Ga0075364_10018582 | 3300006051 | Bacteria | 4353 |
| 204 | Ga0070712_100068462 | 3300006175 | Bacteria | 2529 |
| 205 | Ga0075362_10001902 | 3300006177 | Bacteria | 6853 |
| 206 | Ga0075367_10014623 | 3300006178 | Bacteria | 4249 |
| 207 | Ga0075367_10051912 | 3300006178 | Bacteria | 2425 |
| 208 | Ga0075366_10002041 | 3300006195 | Bacteria | 10246 |
| 209 | Ga0075366_10028085 | 3300006195 | Bacteria | 3301 |
| 210 | Ga0075366_10042350 | 3300006195 | Bacteria | 2696 |
| 211 | Ga0075366_10053002 | 3300006195 | Bacteria | 2410 |
| 212 | Ga0097621_100001231 | 3300006237 | Bacteria | 17731 |
| 213 | Ga0097621_100001294 | 3300006237 | Bacteria | 17200 |
| 214 | Ga0097621_100005542 | 3300006237 | Bacteria | 8896 |
| 215 | Ga0075370_10001548 | 3300006353 | Bacteria | 10068 |
| 216 | Ga0075370_10001727 | 3300006353 | Bacteria | 9723 |
| 217 | Ga0075370_10005668 | 3300006353 | Bacteria | 6232 |
| 218 | Ga0075370_10012007 | 3300006353 | Bacteria | 4566 |
| 219 | Ga0075370_10012802 | 3300006353 | Bacteria | 4443 |
| 220 | Ga0075370_10014372 | 3300006353 | Bacteria | 4221 |
| 221 | Ga0075370_10022336 | 3300006353 | Bacteria | 3473 |
| 222 | Ga0075370_10088761 | 3300006353 | Bacteria | 1782 |
| 223 | Ga0068871_100006074 | 3300006358 | Bacteria | 8498 |
| 224 | Ga0068871_100050122 | 3300006358 | Bacteria | 3377 |
| 225 | Ga0068871_100056117 | 3300006358 | Bacteria | 3200 |
| 226 | Ga0075428_100001351 | 3300006844 | Bacteria | 26025 |
| 227 | Ga0075433_10011327 | 3300006852 | Bacteria | 7176 |
| 228 | Ga0075434_100018356 | 3300006871 | Bacteria | 6757 |
| 229 | Ga0075429_100000121 | 3300006880 | Bacteria | 45679 |
| 230 | Ga0068865_100000857 | 3300006881 | Bacteria | 17244 |
| 231 | Ga0068865_100001344 | 3300006881 | Bacteria | 14320 |
| 232 | Ga0068865_100033832 | 3300006881 | Bacteria | 3424 |
| 233 | Ga0075436_100000691 | 3300006914 | Bacteria | 22245 |
| 234 | Ga0075436_100066065 | 3300006914 | Bacteria | 2500 |
| 235 | Ga0097620_100001470 | 3300006931 | Bacteria | 24006 |
| 236 | Ga0097620_100005503 | 3300006931 | Bacteria | 12897 |
| 237 | Ga0097620_100013579 | 3300006931 | Bacteria | 8166 |
| 238 | Ga0099823_1000129 | 3300006944 | Bacteria | 38791 |
| 239 | Ga0079104_1000017 | 3300006946 | Bacteria | 313784 |
| 240 | Ga0075435_100010533 | 3300007076 | Bacteria | 6765 |
| 241 | Ga0105244_10000502 | 3300009036 | Bacteria | 35162 |
| 242 | Ga0105240_10007915 | 3300009093 | Bacteria | 15330 |
| 243 | Ga0105240_10034888 | 3300009093 | Bacteria | 6486 |
| 244 | Ga0105240_10111256 | 3300009093 | Bacteria | 3313 |
| 245 | Ga0105240_10146449 | 3300009093 | Bacteria | 2818 |
| 246 | Ga0111539_10010030 | 3300009094 | Bacteria | 11938 |
| 247 | Ga0111539_10109682 | 3300009094 | Bacteria | 3239 |
| 248 | Ga0105245_10000945 | 3300009098 | Bacteria | 26423 |
| 249 | Ga0105245_10005673 | 3300009098 | Bacteria | 10971 |
| 250 | Ga0105245_10006882 | 3300009098 | Bacteria | 9971 |
| 251 | Ga0105245_10062287 | 3300009098 | Bacteria | 3366 |
| 252 | Ga0105247_10013925 | 3300009101 | Bacteria | 4823 |
| 253 | Ga0105247_10038923 | 3300009101 | Bacteria | 2904 |
| 254 | Ga0114129_10018147 | 3300009147 | Bacteria | 10020 |
| 255 | Ga0105243_10004551 | 3300009148 | Bacteria | 10951 |
| 256 | Ga0105243_10112027 | 3300009148 | Bacteria | 2285 |
| 257 | Ga0105241_10111287 | 3300009174 | Bacteria | 2192 |
| 258 | Ga0105242_10000286 | 3300009176 | Bacteria | 40389 |
| 259 | Ga0105242_10009683 | 3300009176 | Bacteria | 7387 |
| 260 | Ga0105242_10060840 | 3300009176 | Bacteria | 3104 |
| 261 | Ga0105242_10198816 | 3300009176 | Bacteria | 1779 |
| 262 | Ga0105248_10012407 | 3300009177 | Bacteria | 9401 |
| 263 | Ga0105248_10085694 | 3300009177 | Bacteria | 3545 |
| 264 | Ga0105237_10000556 | 3300009545 | Bacteria | 52272 |
| 265 | Ga0105237_10006422 | 3300009545 | Bacteria | 13044 |
| 266 | Ga0105238_10028702 | 3300009551 | Bacteria | 5667 |
| 267 | Ga0105238_10188336 | 3300009551 | Bacteria | 2040 |
| 268 | Ga0105249_10001112 | 3300009553 | Bacteria | 23905 |
| 269 | Ga0105249_10027491 | 3300009553 | Bacteria | 5133 |
| 270 | Ga0105249_10275283 | 3300009553 | Bacteria | 1678 |
| 271 | Ga0105239_10002779 | 3300010375 | Bacteria | 21928 |
| 272 | Ga0105239_10063368 | 3300010375 | Bacteria | 4059 |
| 273 | Ga0105246_10011021 | 3300011119 | Bacteria | 5603 |
| 274 | Ga0157317_1000474 | 3300012475 | Bacteria | 1731 |
| 275 | Ga0157319_1000004 | 3300012497 | Bacteria | 394735 |
| 276 | Ga0157374_10001330 | 3300013296 | Bacteria | 21005 |
| 277 | Ga0157374_10003707 | 3300013296 | Bacteria | 12842 |
| 278 | Ga0157378_10015867 | 3300013297 | Bacteria | 6596 |
| 279 | Ga0157378_10028932 | 3300013297 | Bacteria | 4891 |
| 280 | Ga0163162_10063475 | 3300013306 | Bacteria | 3737 |
| 281 | Ga0163162_10115289 | 3300013306 | Bacteria | 2787 |
| 282 | Ga0157375_10037154 | 3300013308 | Bacteria | 4664 |
| 283 | Ga0157375_10077427 | 3300013308 | Bacteria | 3355 |
| 284 | Ga0157375_10176345 | 3300013308 | Bacteria | 2287 |
| 285 | Ga0163163_10000672 | 3300014325 | Bacteria | 29259 |
| 286 | Ga0163163_10043488 | 3300014325 | Bacteria | 4404 |
| 287 | Ga0163163_10083102 | 3300014325 | Bacteria | 3207 |
| 288 | Ga0157380_10055270 | 3300014326 | Bacteria | 3152 |
| 289 | Ga0182008_10002006 | 3300014497 | Bacteria | 13064 |
| 290 | Ga0182008_10041984 | 3300014497 | Bacteria | 2279 |
| 291 | Ga0157377_10000035 | 3300014745 | Bacteria | 116860 |
| 292 | Ga0157379_10001798 | 3300014968 | Bacteria | 17673 |
| 293 | Ga0157379_10005594 | 3300014968 | Bacteria | 10801 |
| 294 | Ga0157379_10008684 | 3300014968 | Bacteria | 8849 |
| 295 | Ga0157379_10012462 | 3300014968 | Bacteria | 7424 |
| 296 | Ga0157379_10049781 | 3300014968 | Bacteria | 3741 |
| 297 | Ga0157376_10006379 | 3300014969 | Bacteria | 8331 |
| 298 | Ga0157376_10008482 | 3300014969 | Bacteria | 7419 |
| 299 | Ga0157376_10013284 | 3300014969 | Bacteria | 6141 |
| 300 | Ga0157376_10014934 | 3300014969 | Bacteria | 5851 |
| 301 | Ga0157376_10195110 | 3300014969 | Bacteria | 1859 |
| 302 | Ga0182006_1001117 | 3300015261 | Bacteria | 17071 |
| 303 | Ga0182007_10000238 | 3300015262 | Bacteria | 37140 |
| 304 | Ga0163161_10121222 | 3300017792 | Bacteria | 1965 |
| 305 | Ga0163161_10137717 | 3300017792 | Bacteria | 1846 |
| 306 | Ga0213872_10000030 | 3300021361 | Bacteria | 144434 |
| 307 | Ga0213872_10000170 | 3300021361 | Bacteria | 58410 |
| 308 | Ga0213872_10000701 | 3300021361 | Bacteria | 25195 |
| 309 | Ga0213872_10001003 | 3300021361 | Bacteria | 19713 |
| 310 | Ga0213872_10031807 | 3300021361 | Bacteria | 2419 |
| 311 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 312 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 313 | Ga0209563_100141 | 3300025230 | Bacteria | 79513 |
| 314 | Ga0207427_102220 | 3300025231 | Bacteria | 5490 |
| 315 | Ga0209258_100044 | 3300025242 | Bacteria | 376336 |
| 316 | Ga0209258_100531 | 3300025242 | Bacteria | 36288 |
| 317 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 318 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 319 | Ga0209677_100339 | 3300025253 | Bacteria | 29853 |
| 320 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 321 | Ga0209759_1001075 | 3300025256 | Bacteria | 17896 |
| 322 | Ga0209759_1001278 | 3300025256 | Bacteria | 15072 |
| 323 | Ga0209455_1000048 | 3300025272 | Bacteria | 376260 |
| 324 | Ga0209673_1012997 | 3300025273 | Bacteria | 3312 |
| 325 | Ga0209673_1024835 | 3300025273 | Bacteria | 2005 |
| 326 | Ga0209676_1000206 | 3300025292 | Bacteria | 132202 |
| 327 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 328 | Ga0209050_1000393 | 3300025298 | Bacteria | 82050 |
| 329 | Ga0209050_1000512 | 3300025298 | Bacteria | 65551 |
| 330 | Ga0209050_1001205 | 3300025298 | Bacteria | 30315 |
| 331 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 332 | Ga0209256_1000085 | 3300025299 | Bacteria | 219043 |
| 333 | Ga0209256_1000437 | 3300025299 | Bacteria | 64248 |
| 334 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 335 | Ga0209051_1000311 | 3300025303 | Bacteria | 76050 |
| 336 | Ga0209051_1005269 | 3300025303 | Bacteria | 7619 |
| 337 | Ga0209257_1000351 | 3300025304 | Bacteria | 94766 |
| 338 | Ga0209257_1000432 | 3300025304 | Bacteria | 80643 |
| 339 | Ga0209257_1000479 | 3300025304 | Bacteria | 72716 |
| 340 | Ga0209257_1000906 | 3300025304 | Bacteria | 41475 |
| 341 | Ga0207697_10023112 | 3300025315 | Bacteria | 2546 |
| 342 | Ga0207655_1002609 | 3300025728 | Bacteria | 14322 |
| 343 | Ga0207682_10007581 | 3300025893 | Bacteria | 4322 |
| 344 | Ga0207642_10007321 | 3300025899 | Bacteria | 3720 |
| 345 | Ga0207688_10058838 | 3300025901 | Bacteria | 2163 |
| 346 | Ga0207680_10002111 | 3300025903 | Bacteria | 9303 |
| 347 | Ga0207680_10005556 | 3300025903 | Bacteria | 6027 |
| 348 | Ga0207685_10006576 | 3300025905 | Bacteria | 3175 |
| 349 | Ga0207645_10001404 | 3300025907 | Bacteria | 19722 |
| 350 | Ga0207645_10074095 | 3300025907 | Bacteria | 2179 |
| 351 | Ga0207643_10038415 | 3300025908 | Bacteria | 2688 |
| 352 | Ga0207705_10075989 | 3300025909 | Bacteria | 2441 |
| 353 | Ga0207684_10019352 | 3300025910 | Bacteria | 5826 |
| 354 | Ga0207654_10008493 | 3300025911 | Bacteria | 5196 |
| 355 | Ga0207695_10006446 | 3300025913 | Bacteria | 15240 |
| 356 | Ga0207695_10020437 | 3300025913 | Bacteria | 7583 |
| 357 | Ga0207671_10019132 | 3300025914 | Bacteria | 5242 |
| 358 | Ga0207693_10000253 | 3300025915 | Bacteria | 49482 |
| 359 | Ga0207663_10063552 | 3300025916 | Bacteria | 2351 |
| 360 | Ga0207662_10000725 | 3300025918 | Bacteria | 15069 |
| 361 | Ga0207657_10007641 | 3300025919 | Bacteria | 11063 |
| 362 | Ga0207649_10006085 | 3300025920 | Bacteria | 6550 |
| 363 | Ga0207646_10015093 | 3300025922 | Bacteria | 7309 |
| 364 | Ga0207681_10004483 | 3300025923 | Bacteria | 8597 |
| 365 | Ga0207681_10014588 | 3300025923 | Bacteria | 4888 |
| 366 | Ga0207681_10019924 | 3300025923 | Bacteria | 4247 |
| 367 | Ga0207681_10108128 | 3300025923 | Bacteria | 2018 |
| 368 | Ga0207694_10150321 | 3300025924 | Bacteria | 1876 |
| 369 | Ga0207650_10000265 | 3300025925 | Bacteria | 55786 |
| 370 | Ga0207650_10003970 | 3300025925 | Bacteria | 10126 |
| 371 | Ga0207650_10010498 | 3300025925 | Bacteria | 6351 |
| 372 | Ga0207650_10041263 | 3300025925 | Bacteria | 3380 |
| 373 | Ga0207650_10053302 | 3300025925 | Bacteria | 2997 |
| 374 | Ga0207650_10055420 | 3300025925 | Bacteria | 2943 |
| 375 | Ga0207659_10000148 | 3300025926 | Bacteria | 41151 |
| 376 | Ga0207659_10005160 | 3300025926 | Bacteria | 7918 |
| 377 | Ga0207687_10000973 | 3300025927 | Bacteria | 19481 |
| 378 | Ga0207687_10003267 | 3300025927 | Bacteria | 10974 |
| 379 | Ga0207687_10071761 | 3300025927 | Bacteria | 2475 |
| 380 | Ga0207700_10000143 | 3300025928 | Bacteria | 42682 |
| 381 | Ga0207700_10027844 | 3300025928 | Bacteria | 3964 |
| 382 | Ga0207664_10001494 | 3300025929 | Bacteria | 15327 |
| 383 | Ga0207644_10001312 | 3300025931 | Bacteria | 15974 |
| 384 | Ga0207644_10008902 | 3300025931 | Bacteria | 6575 |
| 385 | Ga0207644_10065050 | 3300025931 | Bacteria | 2651 |
| 386 | Ga0207690_10002545 | 3300025932 | Bacteria | 11019 |
| 387 | Ga0207690_10060584 | 3300025932 | Bacteria | 2569 |
| 388 | Ga0207706_10016759 | 3300025933 | Bacteria | 6614 |
| 389 | Ga0207706_10026802 | 3300025933 | Bacteria | 5158 |
| 390 | Ga0207706_10048414 | 3300025933 | Bacteria | 3759 |
| 391 | Ga0207686_10003852 | 3300025934 | Bacteria | 8043 |
| 392 | Ga0207709_10000858 | 3300025935 | Bacteria | 23259 |
| 393 | Ga0207709_10001546 | 3300025935 | Bacteria | 15810 |
| 394 | Ga0207670_10001996 | 3300025936 | Bacteria | 10702 |
| 395 | Ga0207670_10024148 | 3300025936 | Bacteria | 3796 |
| 396 | Ga0207669_10003622 | 3300025937 | Bacteria | 6700 |
| 397 | Ga0207669_10005955 | 3300025937 | Bacteria | 5525 |
| 398 | Ga0207669_10020584 | 3300025937 | Bacteria | 3464 |
| 399 | Ga0207704_10001119 | 3300025938 | Bacteria | 11924 |
| 400 | Ga0207704_10001341 | 3300025938 | Bacteria | 10978 |
| 401 | Ga0207704_10052954 | 3300025938 | Bacteria | 2463 |
| 402 | Ga0207665_10127949 | 3300025939 | Bacteria | 1800 |
| 403 | Ga0207691_10001645 | 3300025940 | Bacteria | 22169 |
| 404 | Ga0207691_10003375 | 3300025940 | Bacteria | 15538 |
| 405 | Ga0207691_10005715 | 3300025940 | Bacteria | 12027 |
| 406 | Ga0207691_10020711 | 3300025940 | Bacteria | 6219 |
| 407 | Ga0207691_10068141 | 3300025940 | Bacteria | 3216 |
| 408 | Ga0207691_10072324 | 3300025940 | Bacteria | 3110 |
| 409 | Ga0207711_10000318 | 3300025941 | Bacteria | 51496 |
| 410 | Ga0207711_10018670 | 3300025941 | Bacteria | 5766 |
| 411 | Ga0207711_10062551 | 3300025941 | Bacteria | 3210 |
| 412 | Ga0207689_10001933 | 3300025942 | Bacteria | 19610 |
| 413 | Ga0207689_10002122 | 3300025942 | Bacteria | 18651 |
| 414 | Ga0207689_10002447 | 3300025942 | Bacteria | 17301 |
| 415 | Ga0207689_10012770 | 3300025942 | Bacteria | 7177 |
| 416 | Ga0207689_10043929 | 3300025942 | Bacteria | 3694 |
| 417 | Ga0207679_10000261 | 3300025945 | Bacteria | 40287 |
| 418 | Ga0207667_10021616 | 3300025949 | Bacteria | 7127 |
| 419 | Ga0207667_10099468 | 3300025949 | Bacteria | 3001 |
| 420 | Ga0207667_10139911 | 3300025949 | Bacteria | 2492 |
| 421 | Ga0207667_10173756 | 3300025949 | Bacteria | 2214 |
| 422 | Ga0207651_10001670 | 3300025960 | Bacteria | 10194 |
| 423 | Ga0207651_10003943 | 3300025960 | Bacteria | 7366 |
| 424 | Ga0207651_10077346 | 3300025960 | Bacteria | 2382 |
| 425 | Ga0207712_10043966 | 3300025961 | Bacteria | 3084 |
| 426 | Ga0207668_10002211 | 3300025972 | Bacteria | 11341 |
| 427 | Ga0207668_10003422 | 3300025972 | Bacteria | 9306 |
| 428 | Ga0207668_10006299 | 3300025972 | Bacteria | 7015 |
| 429 | Ga0207668_10062040 | 3300025972 | Bacteria | 2631 |
| 430 | Ga0207640_10019913 | 3300025981 | Bacteria | 3974 |
| 431 | Ga0207658_10021671 | 3300025986 | Bacteria | 4464 |
| 432 | Ga0207658_10031665 | 3300025986 | Bacteria | 3757 |
| 433 | Ga0207677_10001893 | 3300026023 | Bacteria | 11047 |
| 434 | Ga0207677_10006414 | 3300026023 | Bacteria | 6452 |
| 435 | Ga0207677_10018961 | 3300026023 | Bacteria | 4143 |
| 436 | Ga0207703_10000942 | 3300026035 | Bacteria | 28226 |
| 437 | Ga0207703_10001364 | 3300026035 | Bacteria | 22293 |
| 438 | Ga0207703_10006960 | 3300026035 | Bacteria | 9001 |
| 439 | Ga0207703_10044698 | 3300026035 | Bacteria | 3561 |
| 440 | Ga0207703_10079655 | 3300026035 | Bacteria | 2726 |
| 441 | Ga0207639_10030693 | 3300026041 | Bacteria | 3944 |
| 442 | Ga0207639_10036431 | 3300026041 | Bacteria | 3646 |
| 443 | Ga0207639_10174740 | 3300026041 | Bacteria | 1822 |
| 444 | Ga0207678_10000529 | 3300026067 | Bacteria | 34764 |
| 445 | Ga0207678_10019693 | 3300026067 | Bacteria | 5934 |
| 446 | Ga0207678_10034220 | 3300026067 | Bacteria | 4425 |
| 447 | Ga0207678_10071713 | 3300026067 | Bacteria | 2970 |
| 448 | Ga0207708_10001226 | 3300026075 | Bacteria | 19355 |
| 449 | Ga0207708_10046461 | 3300026075 | Bacteria | 3306 |
| 450 | Ga0207702_10002744 | 3300026078 | Bacteria | 16484 |
| 451 | Ga0207702_10021271 | 3300026078 | Bacteria | 5368 |
| 452 | Ga0207641_10004511 | 3300026088 | Bacteria | 12038 |
| 453 | Ga0207641_10027017 | 3300026088 | Bacteria | 4739 |
| 454 | Ga0207641_10101488 | 3300026088 | Bacteria | 2535 |
| 455 | Ga0207641_10129187 | 3300026088 | Bacteria | 2266 |
| 456 | Ga0207648_10000040 | 3300026089 | Bacteria | 116539 |
| 457 | Ga0207648_10000251 | 3300026089 | Bacteria | 58026 |
| 458 | Ga0207648_10001465 | 3300026089 | Bacteria | 25968 |
| 459 | Ga0207648_10004330 | 3300026089 | Bacteria | 14621 |
| 460 | Ga0207648_10005619 | 3300026089 | Bacteria | 12603 |
| 461 | Ga0207648_10012489 | 3300026089 | Bacteria | 7952 |
| 462 | Ga0207648_10018327 | 3300026089 | Bacteria | 6341 |
| 463 | Ga0207648_10018632 | 3300026089 | Bacteria | 6281 |
| 464 | Ga0207648_10024291 | 3300026089 | Bacteria | 5413 |
| 465 | Ga0207648_10074305 | 3300026089 | Bacteria | 2962 |
| 466 | Ga0207676_10000589 | 3300026095 | Bacteria | 29868 |
| 467 | Ga0207676_10009205 | 3300026095 | Bacteria | 7028 |
| 468 | Ga0207676_10016562 | 3300026095 | Bacteria | 5338 |
| 469 | Ga0207676_10019055 | 3300026095 | Bacteria | 4999 |
| 470 | Ga0207676_10039393 | 3300026095 | Bacteria | 3614 |
| 471 | Ga0207676_10073583 | 3300026095 | Bacteria | 2750 |
| 472 | Ga0207674_10004062 | 3300026116 | Bacteria | 17738 |
| 473 | Ga0207674_10013645 | 3300026116 | Bacteria | 8998 |
| 474 | Ga0207674_10018791 | 3300026116 | Bacteria | 7499 |
| 475 | Ga0207674_10041465 | 3300026116 | Bacteria | 4761 |
| 476 | Ga0207674_10061048 | 3300026116 | Bacteria | 3809 |
| 477 | Ga0207674_10077311 | 3300026116 | Bacteria | 3334 |
| 478 | Ga0207675_100002453 | 3300026118 | Bacteria | 18368 |
| 479 | Ga0207675_100003477 | 3300026118 | Bacteria | 15386 |
| 480 | Ga0207675_100036552 | 3300026118 | Bacteria | 4581 |
| 481 | Ga0207683_10000314 | 3300026121 | Bacteria | 44039 |
| 482 | Ga0207683_10004727 | 3300026121 | Bacteria | 11733 |
| 483 | Ga0207683_10006228 | 3300026121 | Bacteria | 10228 |
| 484 | Ga0207683_10026706 | 3300026121 | Bacteria | 4986 |
| 485 | Ga0207683_10048128 | 3300026121 | Bacteria | 3734 |
| 486 | Ga0209281_1000042 | 3300027111 | Bacteria | 344748 |
| 487 | Ga0209389_1016148 | 3300027296 | Bacteria | 6776 |
| 488 | Ga0209971_1005175 | 3300027682 | Bacteria | 3098 |
| 489 | Ga0209998_10011812 | 3300027717 | Bacteria | 1812 |
| 490 | Ga0209974_10006496 | 3300027876 | Bacteria | 4080 |
| 491 | Ga0207428_10000544 | 3300027907 | Bacteria | 44950 |
| 492 | Ga0268266_10005333 | 3300028379 | Bacteria | 12037 |
| 493 | Ga0268266_10014241 | 3300028379 | Bacteria | 6840 |
| 494 | Ga0268266_10021817 | 3300028379 | Bacteria | 5455 |
| 495 | Ga0268265_10008775 | 3300028380 | Bacteria | 6831 |
| 496 | Ga0268265_10090174 | 3300028380 | Bacteria | 2448 |
| 497 | Ga0268265_10100009 | 3300028380 | Bacteria | 2339 |
| 498 | Ga0268264_10002492 | 3300028381 | Bacteria | 16186 |
| 499 | Ga0268264_10004327 | 3300028381 | Bacteria | 12121 |
| 500 | Ga0268264_10008389 | 3300028381 | Bacteria | 8590 |
| 501 | Ga0268264_10009158 | 3300028381 | Bacteria | 8206 |
| 502 | Ga0268264_10116545 | 3300028381 | Bacteria | 2348 |
| 503 | Ga0268264_10124493 | 3300028381 | Bacteria | 2276 |
| 504 | Ga0265336_10000053 | 3300028666 | Bacteria | 113034 |
| 505 | Ga0307517_10071449 | 3300028786 | Bacteria | 3110 |
| 506 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 507 | Ga0307515_10000101 | 3300028794 | Bacteria | 199593 |
| 508 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 509 | Ga0307515_10000257 | 3300028794 | Bacteria | 131732 |
| 510 | Ga0307515_10000586 | 3300028794 | Bacteria | 85517 |
| 511 | Ga0307515_10001678 | 3300028794 | Bacteria | 49347 |
| 512 | Ga0307515_10003072 | 3300028794 | Bacteria | 35359 |
| 513 | Ga0307515_10008113 | 3300028794 | Bacteria | 20573 |
| 514 | Ga0307515_10035989 | 3300028794 | Bacteria | 8027 |
| 515 | Ga0307515_10056437 | 3300028794 | Bacteria | 5708 |
| 516 | Ga0265324_10000132 | 3300029957 | Bacteria | 58866 |
| 517 | Ga0268256_1008689 | 3300030500 | Bacteria | 3455 |
| 518 | Ga0265330_10000014 | 3300031235 | Bacteria | 175673 |
| 519 | Ga0265332_10000011 | 3300031238 | Bacteria | 284299 |
| 520 | Ga0265332_10000035 | 3300031238 | Bacteria | 139554 |
| 521 | Ga0265332_10011144 | 3300031238 | Bacteria | 3995 |
| 522 | Ga0265328_10004678 | 3300031239 | Bacteria | 5917 |
| 523 | Ga0265325_10015023 | 3300031241 | Bacteria | 4364 |
| 524 | Ga0265331_10002479 | 3300031250 | Bacteria | 12478 |
| 525 | Ga0265327_10000058 | 3300031251 | Bacteria | 237043 |
| 526 | Ga0265327_10000086 | 3300031251 | Bacteria | 202345 |
| 527 | Ga0265316_10000026 | 3300031344 | Bacteria | 165508 |
| 528 | Ga0307513_10004582 | 3300031456 | Bacteria | 18428 |
| 529 | Ga0307513_10049273 | 3300031456 | Bacteria | 4564 |
| 530 | Ga0307513_10059753 | 3300031456 | Bacteria | 4045 |
| 531 | Ga0307408_100043216 | 3300031548 | Bacteria | 3206 |
| 532 | Ga0307508_10000122 | 3300031616 | Bacteria | 92612 |
| 533 | Ga0307514_10002271 | 3300031649 | Bacteria | 20395 |
| 534 | Ga0307514_10004914 | 3300031649 | Bacteria | 12154 |
| 535 | Ga0265314_10000026 | 3300031711 | Bacteria | 284299 |
| 536 | Ga0265314_10000879 | 3300031711 | Bacteria | 35809 |
| 537 | Ga0265314_10054277 | 3300031711 | Bacteria | 2774 |
| 538 | Ga0307516_10000017 | 3300031730 | Bacteria | 202506 |
| 539 | Ga0307516_10000311 | 3300031730 | Bacteria | 63197 |
| 540 | Ga0307516_10005394 | 3300031730 | Bacteria | 15348 |
| 541 | Ga0307516_10021704 | 3300031730 | Bacteria | 6601 |
| 542 | Ga0307516_10079276 | 3300031730 | Bacteria | 3129 |
| 543 | Ga0307405_10058671 | 3300031731 | Bacteria | 2423 |
| 544 | Ga0307407_10051970 | 3300031903 | Bacteria | 2351 |
| 545 | Ga0307412_10089738 | 3300031911 | Bacteria | 2147 |
| 546 | Ga0307416_100082998 | 3300032002 | Bacteria | 2717 |
| 547 | Ga0307411_10001074 | 3300032005 | Bacteria | 10595 |
| 548 | Ga0307411_10019997 | 3300032005 | Bacteria | 3883 |
| 549 | Ga0307507_10105691 | 3300033179 | Bacteria | 2329 |
| 550 | Ga0307510_10036162 | 3300033180 | Bacteria | 5500 |
| 551 | Ga0373959_0005924 | 3300034820 | Bacteria | 2014 |
| 552 | Ga0373926_0006019 | 3300035083 | Bacteria | 4013 |
| 553 | Ga0373944_0010878 | 3300035089 | Bacteria | 2486 |
| 554 | Ga0373945_0004169 | 3300035116 | Bacteria | 4586 |
| 555 | Ga0373946_0004132 | 3300035171 | Bacteria | 5170 |
| 556 | Ga0373931_0006132 | 3300035691 | Bacteria | 5601 |
| 557 | Ga0373931_0028533 | 3300035691 | Bacteria | 2858 |
| 558 | Ga0373935_0042082 | 3300035692 | Bacteria | 2871 |
| 559 | Ga0373927_0017699 | 3300035695 | Bacteria | 4688 |
| 560 | Ga0373927_0031410 | 3300035695 | Bacteria | 3461 |
| 561 | Ga0373933_0003935 | 3300035724 | Bacteria | 8198 |
| 562 | Ga0373937_0001566 | 3300036401 | Bacteria | 19213 |
| 563 | Ga0373925_0004630 | 3300037068 | Bacteria | 10383 |
| 564 | Ga0373925_0025951 | 3300037068 | Bacteria | 4284 |
| 565 | Ga0395899_0012556 | 3300037312 | Bacteria | 6493 |
| 566 | Ga0395900_0006480 | 3300037418 | Bacteria | 12208 |
| 567 | Ga0395900_0038239 | 3300037418 | Bacteria | 4946 |
| 568 | Ga0395898_0008499 | 3300037466 | Bacteria | 10846 |
| 569 | Ga0395898_0035073 | 3300037466 | Bacteria | 4992 |
| 570 | Ga0395898_0092545 | 3300037466 | Bacteria | 2907 |
| 571 | Ga0395905_0000125 | 3300037471 | Bacteria | 126341 |
| 572 | Ga0395905_0021505 | 3300037471 | Bacteria | 6099 |
| 573 | Ga0395905_0147792 | 3300037471 | Bacteria | 2211 |
| 574 | Ga0395905_0168915 | 3300037471 | Bacteria | 2054 |
| 575 | Ga0395901_0025337 | 3300038443 | Bacteria | 6088 |
| 576 | Ga0395901_0044785 | 3300038443 | Bacteria | 4589 |
| 577 | Ga0400483_009461 | 3300039062 | Bacteria | 7016 |
| 578 | Ga0400483_020178 | 3300039062 | Unclassified | 1707 |
| 579 | Ga0400483_151143 | 3300039062 | Bacteria | 268199 |
| 580 | Ga0400483_256170 | 3300039062 | Bacteria | 5432 |
| 581 | Ga0436361_0147437 | 3300039447 | Bacteria | 84337 |
| 582 | Ga0436361_0213573 | 3300039447 | Bacteria | 14676 |
| 583 | Ga0436361_0259649 | 3300039447 | Bacteria | 33673 |
| 584 | Ga0436361_0272384 | 3300039447 | Bacteria | 13210 |
| 585 | Ga0436361_0306252 | 3300039447 | Bacteria | 9351 |
| 586 | Ga0436361_0354255 | 3300039447 | Bacteria | 247479 |
| 587 | Ga0436361_0984533 | 3300039447 | Bacteria | 3095 |
| 588 | Ga0439436_0000162 | 3300041404 | Bacteria | 15681 |
| 589 | Ga0439466_0003184 | 3300041411 | Bacteria | 6387 |
| 590 | Ga0439465_0001313 | 3300041413 | Bacteria | 8009 |
| 591 | Ga0439449_0000243 | 3300042007 | Bacteria | 19659 |
| 592 | Ga0439449_0000525 | 3300042007 | Bacteria | 14260 |
| 593 | Ga0439449_0001484 | 3300042007 | Bacteria | 9187 |
| 594 | Ga0439457_003179 | 3300042014 | Bacteria | 4525 |
| 595 | Ga0450911_000151 | 3300042115 | Bacteria | 27938 |
| 596 | Ga0450910_002021 | 3300042147 | Bacteria | 2631 |
| 597 | Ga0439459_0001404 | 3300042438 | Bacteria | 3535 |
| 598 | Ga0450918_000674 | 3300042531 | Bacteria | 7290 |
| 599 | Ga0451577_0011793 | 3300042876 | Bacteria | 8247 |
| 600 | Ga0451577_0012518 | 3300042876 | Bacteria | 7966 |
| 601 | Ga0451577_0029301 | 3300042876 | Bacteria | 4975 |
| 602 | Ga0451577_0041018 | 3300042876 | Bacteria | 4156 |
| 603 | Ga0451577_0046410 | 3300042876 | Bacteria | 3887 |
| 604 | Ga0466968_0023140 | 3300044735 | Bacteria | 2529 |
| 605 | Ga0451576_0003186 | 3300045051 | Bacteria | 22912 |
| 606 | Ga0451576_0115779 | 3300045051 | Bacteria | 2791 |
| 607 | Ga0451576_0291924 | 3300045051 | Bacteria | 1705 |
| 608 | Ga0495627_008562 | 3300046453 | Bacteria | 3823 |
| 609 | Ga0495592_0137350 | 3300046454 | Bacteria | 1704 |
| 610 | Ga0495603_0001608 | 3300046455 | Bacteria | 13262 |
| 611 | Ga0495638_0032786 | 3300046460 | Bacteria | 3326 |
| 612 | Ga0495650_0024898 | 3300046471 | Bacteria | 2818 |
| 613 | Ga0495580_0020484 | 3300046472 | Bacteria | 4893 |
| 614 | Ga0495582_0015231 | 3300046473 | Bacteria | 4228 |
| 615 | Ga0495639_0021453 | 3300046475 | Bacteria | 2828 |
| 616 | Ga0495594_0012083 | 3300046499 | Bacteria | 4496 |
| 617 | Ga0495594_0060493 | 3300046499 | Bacteria | 2095 |
| 618 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 619 | Ga0495606_0003954 | 3300046507 | Bacteria | 15214 |
| 620 | Ga0495610_0019561 | 3300046512 | Bacteria | 3784 |
| 621 | Ga0495632_0020536 | 3300046519 | Bacteria | 3573 |
| 622 | Ga0495642_0019302 | 3300046528 | Bacteria | 2672 |
| 623 | Ga0495654_0006402 | 3300046530 | Bacteria | 6694 |
| 624 | Ga0495665_0010238 | 3300046531 | Bacteria | 5077 |
| 625 | Ga0495586_0004575 | 3300046535 | Bacteria | 7393 |
| 626 | Ga0495609_0046489 | 3300046538 | Bacteria | 1944 |
| 627 | Ga0495621_0016956 | 3300046539 | Bacteria | 2346 |
| 628 | Ga0495656_0000565 | 3300046615 | Bacteria | 12114 |
| 629 | Ga0495625_0015990 | 3300046660 | Bacteria | 5919 |
| 630 | Ga0495625_0020334 | 3300046660 | Bacteria | 5127 |
| 631 | Ga0495625_0024586 | 3300046660 | Bacteria | 4582 |
| 632 | Ga0495647_0005215 | 3300046681 | Bacteria | 4257 |
| 633 | Ga0495647_0008601 | 3300046681 | Bacteria | 3433 |
| 634 | Ga0495647_0024523 | 3300046681 | Bacteria | 2196 |
| 635 | Ga0495613_0031253 | 3300046689 | Bacteria | 3954 |
| 636 | Ga0495671_0027188 | 3300046692 | Bacteria | 2956 |
| 637 | Ga0495649_0005881 | 3300046694 | Bacteria | 7705 |
| 638 | Ga0495649_0011138 | 3300046694 | Bacteria | 5291 |
| 639 | Ga0495589_0003499 | 3300046794 | Bacteria | 8497 |
| 640 | Ga0495581_0006352 | 3300047315 | Bacteria | 6853 |
| 641 | Ga0495687_001479 | 3300047443 | Bacteria | 21478 |
| 642 | Ga0495686_0004435 | 3300047472 | Bacteria | 11558 |
| 643 | Ga0496101_0040706 | 3300048904 | Bacteria | 3310 |
| 644 | Ga0496103_0089904 | 3300048906 | Bacteria | 1937 |
| 645 | Ga0496104_0005329 | 3300048907 | Bacteria | 11253 |
| 646 | Ga0496106_0113732 | 3300048909 | Bacteria | 2110 |
| 647 | Ga0496107_0019529 | 3300048910 | Bacteria | 4782 |
| 648 | Ga0496109_0020266 | 3300048912 | Bacteria | 5873 |
| 649 | Ga0496112_0000168 | 3300048915 | Bacteria | 41695 |
| 650 | Ga0496114_0003392 | 3300048917 | Bacteria | 12234 |
| 651 | Ga0496114_0050821 | 3300048917 | Bacteria | 3451 |
| 652 | Ga0496114_0124311 | 3300048917 | Bacteria | 2222 |
| 653 | Ga0496115_0068377 | 3300048918 | Bacteria | 2876 |
| 654 | Ga0496116_0016032 | 3300048919 | Bacteria | 5889 |
| 655 | Ga0496118_0036830 | 3300048921 | Bacteria | 3948 |
| 656 | Ga0496124_0011080 | 3300048927 | Bacteria | 9050 |
| 657 | Ga0501031_0011184 | 3300049568 | Bacteria | 5849 |
| 658 | Ga0501032_0113477 | 3300049569 | Bacteria | 1792 |
| 659 | Ga0501033_0004048 | 3300049570 | Bacteria | 11838 |
| 660 | Ga0501036_0001325 | 3300049572 | Bacteria | 19000 |
| 661 | Ga0501037_0042465 | 3300049573 | Bacteria | 3341 |
| 662 | Ga0501038_0000668 | 3300049574 | Bacteria | 30539 |
| 663 | Ga0501039_0000053 | 3300049575 | Bacteria | 94861 |
| 664 | Ga0501040_0000093 | 3300049576 | Bacteria | 44575 |
| 665 | Ga0501040_0013970 | 3300049576 | Bacteria | 5287 |
| 666 | Ga0501041_0000098 | 3300049577 | Bacteria | 35755 |
| 667 | Ga0501042_0000242 | 3300049578 | Bacteria | 26466 |
| 668 | Ga0501043_0008752 | 3300049579 | Bacteria | 7969 |
| 669 | Ga0501043_0105048 | 3300049579 | Bacteria | 2220 |
| 670 | Ga0501046_0000144 | 3300049580 | Bacteria | 74352 |
| 671 | Ga0501047_0035080 | 3300049581 | Bacteria | 4844 |
| 672 | Ga0501047_0070083 | 3300049581 | Bacteria | 3376 |
| 673 | Ga0501048_0005205 | 3300049582 | Bacteria | 9911 |
| 674 | Ga0501048_0074852 | 3300049582 | Bacteria | 2389 |
| 675 | Ga0501070_0022204 | 3300049586 | Bacteria | 5316 |
| 676 | Ga0501072_0000495 | 3300049588 | Bacteria | 28338 |
| 677 | Ga0501074_0003352 | 3300049590 | Bacteria | 11348 |
| 678 | Ga0501075_0000101 | 3300049591 | Bacteria | 39774 |
| 679 | Ga0501076_0001040 | 3300049592 | Bacteria | 18212 |
| 680 | Ga0501077_0000994 | 3300049593 | Bacteria | 17080 |
| 681 | Ga0501198_000031 | 3300049649 | Bacteria | 58064 |
| 682 | Ga0501222_000034 | 3300049662 | Bacteria | 54382 |
| 683 | Ga0501079_0000459 | 3300049741 | Bacteria | 26782 |
| 684 | Ga0501081_0000052 | 3300049743 | Bacteria | 43945 |
| 685 | Ga0501265_000135 | 3300049762 | Bacteria | 6703 |
| 686 | Ga0501035_0009327 | 3300049822 | Bacteria | 9120 |
| 687 | Ga0501045_0002526 | 3300049824 | Bacteria | 12452 |
| 688 | nmdc:mga0k408_1071_c1 | 3300050493 | Bacteria | 15060 |
| 689 | nmdc:mga0k408_134_c1 | 3300050493 | Bacteria | 27880 |
| 690 | nmdc:mga0k408_42468_c1 | 3300050493 | Bacteria | 2619 |
| 691 | nmdc:mga0k408_49360_c1 | 3300050493 | Bacteria | 2436 |
| 692 | nmdc:mga0k408_64915_c1 | 3300050493 | Bacteria | 2124 |
| 693 | nmdc:mga06z11_44129_c1 | 3300050494 | Bacteria | 2246 |
| 694 | nmdc:mga06z11_44955_c1 | 3300050494 | Bacteria | 2230 |
| 695 | nmdc:mga07m45_10731_c1 | 3300050496 | Bacteria | 4793 |
| 696 | nmdc:mga07m45_12553_c2 | 3300050496 | Bacteria | 2254 |
| 697 | nmdc:mga07m45_12755_c1 | 3300050496 | Bacteria | 4444 |
| 698 | nmdc:mga07m45_29445_c1 | 3300050496 | Bacteria | 3037 |
| 699 | nmdc:mga07m45_3728_c1 | 3300050496 | Bacteria | 7375 |
| 700 | nmdc:mga07m45_6669_c1 | 3300050496 | Bacteria | 5855 |
| 701 | nmdc:mga07m45_75_c1 | 3300050496 | Bacteria | 29787 |
| 702 | nmdc:mga07m45_8241_c1 | 3300050496 | Bacteria | 5347 |
| 703 | nmdc:mga07m45_85980_c1 | 3300050496 | Bacteria | 1799 |
| 704 | nmdc:mga05p37_60509_c1 | 3300050507 | Bacteria | 4663 |
| 705 | nmdc:mga08y16_250592_c1 | 3300050511 | Bacteria | 1830 |
| 706 | nmdc:mga08y16_29832_c1 | 3300050511 | Bacteria | 5744 |
| 707 | nmdc:mga0n895_5705_c1 | 3300050512 | Bacteria | 10440 |
| 708 | nmdc:mga0rr50_37346_c1 | 3300050513 | Bacteria | 3506 |
| 709 | nmdc:mga0a205_3742_c1 | 3300050515 | Bacteria | 13626 |
| 710 | Ga0500635_0001602 | 3300053080 | Bacteria | 5459 |
| 711 | Ga0495619_0048295 | 3300053085 | Bacteria | 2804 |
| 712 | Ga0500578_0022819 | 3300053086 | Bacteria | 4018 |
| 713 | Ga0500593_000730 | 3300053117 | Bacteria | 12447 |
| 714 | Ga0500593_000920 | 3300053117 | Bacteria | 10947 |
| 715 | Ga0500658_0000175 | 3300053134 | Bacteria | 30638 |
| 716 | Ga0500568_0003121 | 3300053139 | Bacteria | 9441 |
| 717 | Ga0500616_0009338 | 3300053153 | Bacteria | 5973 |
| 718 | Ga0500619_000049 | 3300053154 | Bacteria | 37278 |
| 719 | Ga0500622_0046870 | 3300053156 | Bacteria | 2233 |
| 720 | Ga0500636_0015032 | 3300053177 | Bacteria | 4557 |
| 721 | Ga0501084_0020476 | 3300054114 | Bacteria | 5516 |
| 722 | Ga0501082_0002549 | 3300060353 | Bacteria | 15965 |
| 723 | Ga0530510_0000221 | 3300061734 | Bacteria | 35515 |
| 724 | 2513229417 | 2513020051 | Bacteria | 6053213 |
| 725 | 2587756816 | 2585428062 | Bacteria | 6842168 |
| 726 | 2644247600 | 2643221644 | Bacteria | 6865017 |
| 727 | 2644324918 | 2643221658 | Bacteria | 6064537 |
| 728 | 2644396787 | 2643221672 | Bacteria | 6322190 |
| 729 | 2831865213 | 2831864461 | Bacteria | 6502356 |
| 730 | 2842680472 | 2842677519 | Bacteria | 5615038 |
| 731 | 2885196009 | 2885192300 | Bacteria | 5882526 |
| 732 | 2885204773 | 2885198086 | Bacteria | 7212419 |
| 733 | 2885218540 | 2885211737 | Bacteria | 7212420 |
| 734 | 2886854387 | 2886848708 | Bacteria | 5632523 |
| 735 | 2904480341 | 2904479285 | Bacteria | 5073931 |
| 736 | 2904548700 | 2904541872 | Bacteria | 8915136 |
| 737 | 2919466367 | 2919462493 | Bacteria | 5817112 |
| 738 | 2928087319 | 2928084124 | Bacteria | 7159212 |
| 739 | 2929164634 | 2929160207 | Bacteria | 9075316 |
| 740 | 2939631971 | 2939631187 | Bacteria | 6118131 |
| 741 | Ga0207645_10074548 | |||
| 742 | JGI25156J39149_1000218 | |||
| 743 | JGI25157J39369_1000018 | |||
| 744 | rootH1_10024535 | |||
| 745 | rootH2_10010286 | |||
| 746 | Ga0055539_1000240 | |||
| 747 | Ga0055539_1000791 | |||
| 748 | Ga0055533_1000103 | |||
| 749 | Ga0055525_1000036 | |||
| 750 | Ga0055525_1001651 | |||
| 751 | Ga0055535_1000087 | |||
| 752 | Ga0055529_1000139 | |||
| 753 | Ga0055526_1010015 | |||
| 754 | Ga0055524_1000293 | |||
| 755 | Ga0055524_1000298 | |||
| 756 | Ga0055524_1003033 | |||
| 757 | Ga0055530_10000980 | |||
| 758 | Ga0055530_10003756 | |||
| 759 | Ga0055540_1000002 | |||
| 760 | Ga0055540_1000814 | |||
| 761 | Ga0055540_1013728 | |||
| 762 | Ga0055531_10001879 | |||
| 763 | Ga0055531_10006028 | |||
| 764 | Ga0055531_10011039 | |||
| 765 | Ga0055531_10017009 | |||
| 766 | Ga0065165_1000170 | |||
| 767 | Ga0065165_1000350 | |||
| 768 | Ga0065707_10083063 | |||
| 769 | Ga0070676_10000767 | |||
| 770 | Ga0070676_10003615 | |||
| 771 | Ga0070690_100002113 | |||
| 772 | Ga0070690_100011407 | |||
| 773 | Ga0070670_100001272 | |||
| 774 | Ga0070670_100005773 | |||
| 775 | Ga0070670_100019276 | |||
| 776 | Ga0070670_100023314 | |||
| 777 | Ga0070670_100026127 | |||
| 778 | Ga0070670_100027312 | |||
| 779 | Ga0070670_100054958 | |||
| 780 | Ga0070677_10000847 | |||
| 781 | Ga0068869_100000992 | |||
| 782 | Ga0068869_100001116 | |||
| 783 | Ga0068869_100003517 | |||
| 784 | Ga0068869_100005508 | |||
| 785 | Ga0068869_100010491 | |||
| 786 | Ga0068869_100034289 | |||
| 787 | Ga0070666_10002655 | |||
| 788 | Ga0070680_100059609 | |||
| 789 | Ga0070682_100036200 | |||
| 790 | Ga0068868_100000891 | |||
| 791 | Ga0068868_100005385 | |||
| 792 | Ga0068868_100009964 | |||
| 793 | Ga0068868_100029520 | |||
| 794 | Ga0068868_100110512 | |||
| 795 | Ga0070689_100006915 | |||
| 796 | Ga0070689_100007279 | |||
| 797 | Ga0070689_100063612 | |||
| 798 | Ga0070691_10004739 | |||
| 799 | Ga0070687_100000444 | |||
| 800 | Ga0070661_100000390 | |||
| 801 | Ga0070692_10018650 | |||
| 802 | Ga0070668_100002661 | |||
| 803 | Ga0070668_100003156 | |||
| 804 | Ga0070668_100008128 | |||
| 805 | Ga0070668_100012980 | |||
| 806 | Ga0070669_100008972 | |||
| 807 | Ga0070669_100012982 | |||
| 808 | Ga0070669_100017827 | |||
| 809 | Ga0070669_100038866 | |||
| 810 | Ga0070669_100041659 | |||
| 811 | Ga0070669_100053218 | |||
| 812 | Ga0070675_100000137 | |||
| 813 | Ga0070675_100017097 | |||
| 814 | Ga0070675_100018625 | |||
| 815 | Ga0070675_100035137 | |||
| 816 | Ga0070671_100005066 | |||
| 817 | Ga0070671_100005440 | |||
| 818 | Ga0070671_100066323 | |||
| 819 | Ga0070671_100106304 | |||
| 820 | Ga0070674_100004655 | |||
| 821 | Ga0070674_100005446 | |||
| 822 | Ga0070674_100009543 | |||
| 823 | Ga0070674_100085497 | |||
| 824 | Ga0070673_100002120 | |||
| 825 | Ga0070673_100010923 | |||
| 826 | Ga0070673_100011491 | |||
| 827 | Ga0070673_100014597 | |||
| 828 | Ga0070688_100002002 | |||
| 829 | Ga0070659_100001472 | |||
| 830 | Ga0070659_100162332 | |||
| 831 | Ga0070667_100058958 | |||
| 832 | Ga0070667_100062079 | |||
| 833 | Ga0070667_100103551 | |||
| 834 | Ga0070714_100014787 | |||
| 835 | Ga0070713_100000062 | |||
| 836 | Ga0070713_100008753 | |||
| 837 | Ga0070701_10000048 | |||
| 838 | Ga0070711_100163205 | |||
| 839 | Ga0070705_100001065 | |||
| 840 | Ga0070700_100000835 | |||
| 841 | Ga0070700_100028440 | |||
| 842 | Ga0070694_100000507 | |||
| 843 | Ga0070708_100000069 | |||
| 844 | Ga0070708_100026007 | |||
| 845 | Ga0070663_100020444 | |||
| 846 | Ga0070663_100035180 | |||
| 847 | Ga0070663_100036606 | |||
| 848 | Ga0070678_100000909 | |||
| 849 | Ga0070678_100003739 | |||
| 850 | Ga0070678_100011211 | |||
| 851 | Ga0070678_100059007 | |||
| 852 | Ga0070662_100001442 | |||
| 853 | Ga0070662_100032483 | |||
| 854 | Ga0070662_100073860 | |||
| 855 | Ga0070681_10201378 | |||
| 856 | Ga0068867_100000066 | |||
| 857 | Ga0068867_100001467 | |||
| 858 | Ga0068867_100002150 | |||
| 859 | Ga0068867_100006246 | |||
| 860 | Ga0068867_100006505 | |||
| 861 | Ga0068867_100012502 | |||
| 862 | Ga0068867_100025210 | |||
| 863 | Ga0068867_100030811 | |||
| 864 | Ga0068867_100058389 | |||
| 865 | Ga0070685_10002701 | |||
| 866 | Ga0070706_100011891 | |||
| 867 | Ga0070706_100053304 | |||
| 868 | Ga0070706_100066851 | |||
| 869 | Ga0070707_100033973 | |||
| 870 | Ga0070699_100070976 | |||
| 871 | Ga0070697_100013590 | |||
| 872 | Ga0068853_100040306 | |||
| 873 | Ga0068853_100051453 | |||
| 874 | Ga0068853_100104519 | |||
| 875 | Ga0070672_100002141 | |||
| 876 | Ga0070672_100002461 | |||
| 877 | Ga0070672_100005351 | |||
| 878 | Ga0070672_100007419 | |||
| 879 | Ga0070672_100048905 | |||
| 880 | Ga0070695_100001194 | |||
| 881 | Ga0070696_100000200 | |||
| 882 | Ga0070696_100011344 | |||
| 883 | Ga0070693_100000609 | |||
| 884 | Ga0070693_100002121 | |||
| 885 | Ga0070693_100049794 | |||
| 886 | Ga0070665_100012429 | |||
| 887 | Ga0070665_100015067 | |||
| 888 | Ga0070704_100001097 | |||
| 889 | Ga0070704_100167340 | |||
| 890 | Ga0068855_100002529 | |||
| 891 | Ga0068855_100020838 | |||
| 892 | Ga0068855_100073398 | |||
| 893 | Ga0068855_100091785 | |||
| 894 | Ga0068855_100101570 | |||
| 895 | Ga0070664_100007377 | |||
| 896 | Ga0070664_100010267 | |||
| 897 | Ga0068857_100001688 | |||
| 898 | Ga0068857_100015468 | |||
| 899 | Ga0068857_100051744 | |||
| 900 | Ga0068854_100004859 | |||
| 901 | Ga0068854_100008360 | |||
| 902 | Ga0068854_100017323 | |||
| 903 | Ga0068856_100021742 | |||
| 904 | Ga0068852_100081433 | |||
| 905 | Ga0068859_100001470 | |||
| 906 | Ga0068859_100005503 | |||
| 907 | Ga0068859_100013579 | |||
| 908 | Ga0068864_100004243 | |||
| 909 | Ga0068864_100006715 | |||
| 910 | Ga0068864_100008849 | |||
| 911 | Ga0068864_100064709 | |||
| 912 | Ga0068864_100072232 | |||
| 913 | Ga0068864_100102896 | |||
| 914 | Ga0068866_10004707 | |||
| 915 | Ga0068866_10005195 | |||
| 916 | Ga0068866_10008606 | |||
| 917 | Ga0068861_100001821 | |||
| 918 | Ga0068861_100002344 | |||
| 919 | Ga0068870_10033070 | |||
| 920 | Ga0068863_100007463 | |||
| 921 | Ga0068863_100010525 | |||
| 922 | Ga0068863_100016349 | |||
| 923 | Ga0068863_100034665 | |||
| 924 | Ga0068863_100036136 | |||
| 925 | Ga0068858_100006680 | |||
| 926 | Ga0068858_100035072 | |||
| 927 | Ga0068858_100065752 | |||
| 928 | Ga0068858_100202884 | |||
| 929 | Ga0068860_100007369 | |||
| 930 | Ga0068860_100014391 | |||
| 931 | Ga0068860_100044909 | |||
| 932 | Ga0068860_100080022 | |||
| 933 | Ga0068860_100128020 | |||
| 934 | Ga0068860_100153284 | |||
| 935 | Ga0068862_100016870 | |||
| 936 | Ga0068862_100032793 | |||
| 937 | Ga0068862_100040494 | |||
| 938 | Ga0068862_100057766 | |||
| 939 | Ga0068862_100067382 | |||
| 940 | Ga0068862_100084347 | |||
| 941 | Ga0075365_10018254 | |||
| 942 | Ga0075368_10019924 | |||
| 943 | Ga0075364_10018582 | |||
| 944 | Ga0070712_100068462 | |||
| 945 | Ga0075362_10001902 | |||
| 946 | Ga0075367_10014623 | |||
| 947 | Ga0075367_10051912 | |||
| 948 | Ga0075366_10002041 | |||
| 949 | Ga0075366_10028085 | |||
| 950 | Ga0075366_10042350 | |||
| 951 | Ga0075366_10053002 | |||
| 952 | Ga0097621_100001231 | |||
| 953 | Ga0097621_100001294 | |||
| 954 | Ga0097621_100005542 | |||
| 955 | Ga0075370_10001548 | |||
| 956 | Ga0075370_10001727 | |||
| 957 | Ga0075370_10005668 | |||
| 958 | Ga0075370_10012007 | |||
| 959 | Ga0075370_10012802 | |||
| 960 | Ga0075370_10014372 | |||
| 961 | Ga0075370_10022336 | |||
| 962 | Ga0075370_10088761 | |||
| 963 | Ga0068871_100006074 | |||
| 964 | Ga0068871_100050122 | |||
| 965 | Ga0068871_100056117 | |||
| 966 | Ga0075428_100001351 | |||
| 967 | Ga0075433_10011327 | |||
| 968 | Ga0075434_100018356 | |||
| 969 | Ga0075429_100000121 | |||
| 970 | Ga0068865_100000857 | |||
| 971 | Ga0068865_100001344 | |||
| 972 | Ga0068865_100033832 | |||
| 973 | Ga0075436_100000691 | |||
| 974 | Ga0075436_100066065 | |||
| 975 | Ga0097620_100001470 | |||
| 976 | Ga0097620_100005503 | |||
| 977 | Ga0097620_100013579 | |||
| 978 | Ga0099823_1000129 | |||
| 979 | Ga0079104_1000017 | |||
| 980 | Ga0075435_100010533 | |||
| 981 | Ga0105244_10000502 | |||
| 982 | Ga0105240_10007915 | |||
| 983 | Ga0105240_10034888 | |||
| 984 | Ga0105240_10111256 | |||
| 985 | Ga0105240_10146449 | |||
| 986 | Ga0111539_10010030 | |||
| 987 | Ga0111539_10109682 | |||
| 988 | Ga0105245_10000945 | |||
| 989 | Ga0105245_10005673 | |||
| 990 | Ga0105245_10006882 | |||
| 991 | Ga0105245_10062287 | |||
| 992 | Ga0105247_10013925 | |||
| 993 | Ga0105247_10038923 | |||
| 994 | Ga0114129_10018147 | |||
| 995 | Ga0105243_10004551 | |||
| 996 | Ga0105243_10112027 | |||
| 997 | Ga0105241_10111287 | |||
| 998 | Ga0105242_10000286 | |||
| 999 | Ga0105242_10009683 | |||
| 1000 | Ga0105242_10060840 | |||
| 1001 | Ga0105242_10198816 | |||
| 1002 | Ga0105248_10012407 | |||
| 1003 | Ga0105248_10085694 | |||
| 1004 | Ga0105237_10000556 | |||
| 1005 | Ga0105237_10006422 | |||
| 1006 | Ga0105238_10028702 | |||
| 1007 | Ga0105238_10188336 | |||
| 1008 | Ga0105249_10001112 | |||
| 1009 | Ga0105249_10027491 | |||
| 1010 | Ga0105249_10275283 | |||
| 1011 | Ga0105239_10002779 | |||
| 1012 | Ga0105239_10063368 | |||
| 1013 | Ga0105246_10011021 | |||
| 1014 | Ga0157317_1000474 | |||
| 1015 | Ga0157319_1000004 | |||
| 1016 | Ga0157374_10001330 | |||
| 1017 | Ga0157374_10003707 | |||
| 1018 | Ga0157378_10015867 | |||
| 1019 | Ga0157378_10028932 | |||
| 1020 | Ga0163162_10063475 | |||
| 1021 | Ga0163162_10115289 | |||
| 1022 | Ga0157375_10037154 | |||
| 1023 | Ga0157375_10077427 | |||
| 1024 | Ga0157375_10176345 | |||
| 1025 | Ga0163163_10000672 | |||
| 1026 | Ga0163163_10043488 | |||
| 1027 | Ga0163163_10083102 | |||
| 1028 | Ga0157380_10055270 | |||
| 1029 | Ga0182008_10002006 | |||
| 1030 | Ga0182008_10041984 | |||
| 1031 | Ga0157377_10000035 | |||
| 1032 | Ga0157379_10001798 | |||
| 1033 | Ga0157379_10005594 | |||
| 1034 | Ga0157379_10008684 | |||
| 1035 | Ga0157379_10012462 | |||
| 1036 | Ga0157379_10049781 | |||
| 1037 | Ga0157376_10006379 | |||
| 1038 | Ga0157376_10008482 | |||
| 1039 | Ga0157376_10013284 | |||
| 1040 | Ga0157376_10014934 | |||
| 1041 | Ga0157376_10195110 | |||
| 1042 | Ga0182006_1001117 | |||
| 1043 | Ga0182007_10000238 | |||
| 1044 | Ga0163161_10121222 | |||
| 1045 | Ga0163161_10137717 | |||
| 1046 | Ga0213872_10000030 | |||
| 1047 | Ga0213872_10000170 | |||
| 1048 | Ga0213872_10000701 | |||
| 1049 | Ga0213872_10001003 | |||
| 1050 | Ga0213872_10031807 | |||
| 1051 | Ga0209674_100003 | |||
| 1052 | Ga0209563_100014 | |||
| 1053 | Ga0209563_100141 | |||
| 1054 | Ga0207427_102220 | |||
| 1055 | Ga0209258_100044 | |||
| 1056 | Ga0209258_100531 | |||
| 1057 | Ga0209646_1000067 | |||
| 1058 | Ga0209026_1000033 | |||
| 1059 | Ga0209677_100339 | |||
| 1060 | Ga0209759_1000024 | |||
| 1061 | Ga0209759_1001075 | |||
| 1062 | Ga0209759_1001278 | |||
| 1063 | Ga0209455_1000048 | |||
| 1064 | Ga0209673_1012997 | |||
| 1065 | Ga0209673_1024835 | |||
| 1066 | Ga0209676_1000206 | |||
| 1067 | Ga0209564_1000021 | |||
| 1068 | Ga0209050_1000393 | |||
| 1069 | Ga0209050_1000512 | |||
| 1070 | Ga0209050_1001205 | |||
| 1071 | Ga0209256_1000011 | |||
| 1072 | Ga0209256_1000085 | |||
| 1073 | Ga0209256_1000437 | |||
| 1074 | Ga0209051_1000024 | |||
| 1075 | Ga0209051_1000311 | |||
| 1076 | Ga0209051_1005269 | |||
| 1077 | Ga0209257_1000351 | |||
| 1078 | Ga0209257_1000432 | |||
| 1079 | Ga0209257_1000479 | |||
| 1080 | Ga0209257_1000906 | |||
| 1081 | Ga0207697_10023112 | |||
| 1082 | Ga0207655_1002609 | |||
| 1083 | Ga0207682_10007581 | |||
| 1084 | Ga0207642_10007321 | |||
| 1085 | Ga0207688_10058838 | |||
| 1086 | Ga0207680_10002111 | |||
| 1087 | Ga0207680_10005556 | |||
| 1088 | Ga0207685_10006576 | |||
| 1089 | Ga0207645_10001404 | |||
| 1090 | Ga0207645_10074095 | |||
| 1091 | Ga0207643_10038415 | |||
| 1092 | Ga0207705_10075989 | |||
| 1093 | Ga0207684_10019352 | |||
| 1094 | Ga0207654_10008493 | |||
| 1095 | Ga0207695_10006446 | |||
| 1096 | Ga0207695_10020437 | |||
| 1097 | Ga0207671_10019132 | |||
| 1098 | Ga0207693_10000253 | |||
| 1099 | Ga0207663_10063552 | |||
| 1100 | Ga0207662_10000725 | |||
| 1101 | Ga0207657_10007641 | |||
| 1102 | Ga0207649_10006085 | |||
| 1103 | Ga0207646_10015093 | |||
| 1104 | Ga0207681_10004483 | |||
| 1105 | Ga0207681_10014588 | |||
| 1106 | Ga0207681_10019924 | |||
| 1107 | Ga0207681_10108128 | |||
| 1108 | Ga0207694_10150321 | |||
| 1109 | Ga0207650_10000265 | |||
| 1110 | Ga0207650_10003970 | |||
| 1111 | Ga0207650_10010498 | |||
| 1112 | Ga0207650_10041263 | |||
| 1113 | Ga0207650_10053302 | |||
| 1114 | Ga0207650_10055420 | |||
| 1115 | Ga0207659_10000148 | |||
| 1116 | Ga0207659_10005160 | |||
| 1117 | Ga0207687_10000973 | |||
| 1118 | Ga0207687_10003267 | |||
| 1119 | Ga0207687_10071761 | |||
| 1120 | Ga0207700_10000143 | |||
| 1121 | Ga0207700_10027844 | |||
| 1122 | Ga0207664_10001494 | |||
| 1123 | Ga0207644_10001312 | |||
| 1124 | Ga0207644_10008902 | |||
| 1125 | Ga0207644_10065050 | |||
| 1126 | Ga0207690_10002545 | |||
| 1127 | Ga0207690_10060584 | |||
| 1128 | Ga0207706_10016759 | |||
| 1129 | Ga0207706_10026802 | |||
| 1130 | Ga0207706_10048414 | |||
| 1131 | Ga0207686_10003852 | |||
| 1132 | Ga0207709_10000858 | |||
| 1133 | Ga0207709_10001546 | |||
| 1134 | Ga0207670_10001996 | |||
| 1135 | Ga0207670_10024148 | |||
| 1136 | Ga0207669_10003622 | |||
| 1137 | Ga0207669_10005955 | |||
| 1138 | Ga0207669_10020584 | |||
| 1139 | Ga0207704_10001119 | |||
| 1140 | Ga0207704_10001341 | |||
| 1141 | Ga0207704_10052954 | |||
| 1142 | Ga0207665_10127949 | |||
| 1143 | Ga0207691_10001645 | |||
| 1144 | Ga0207691_10003375 | |||
| 1145 | Ga0207691_10005715 | |||
| 1146 | Ga0207691_10020711 | |||
| 1147 | Ga0207691_10068141 | |||
| 1148 | Ga0207691_10072324 | |||
| 1149 | Ga0207711_10000318 | |||
| 1150 | Ga0207711_10018670 | |||
| 1151 | Ga0207711_10062551 | |||
| 1152 | Ga0207689_10001933 | |||
| 1153 | Ga0207689_10002122 | |||
| 1154 | Ga0207689_10002447 | |||
| 1155 | Ga0207689_10012770 | |||
| 1156 | Ga0207689_10043929 | |||
| 1157 | Ga0207679_10000261 | |||
| 1158 | Ga0207667_10021616 | |||
| 1159 | Ga0207667_10099468 | |||
| 1160 | Ga0207667_10139911 | |||
| 1161 | Ga0207667_10173756 | |||
| 1162 | Ga0207651_10001670 | |||
| 1163 | Ga0207651_10003943 | |||
| 1164 | Ga0207651_10077346 | |||
| 1165 | Ga0207712_10043966 | |||
| 1166 | Ga0207668_10002211 | |||
| 1167 | Ga0207668_10003422 | |||
| 1168 | Ga0207668_10006299 | |||
| 1169 | Ga0207668_10062040 | |||
| 1170 | Ga0207640_10019913 | |||
| 1171 | Ga0207658_10021671 | |||
| 1172 | Ga0207658_10031665 | |||
| 1173 | Ga0207677_10001893 | |||
| 1174 | Ga0207677_10006414 | |||
| 1175 | Ga0207677_10018961 | |||
| 1176 | Ga0207703_10000942 | |||
| 1177 | Ga0207703_10001364 | |||
| 1178 | Ga0207703_10006960 | |||
| 1179 | Ga0207703_10044698 | |||
| 1180 | Ga0207703_10079655 | |||
| 1181 | Ga0207639_10030693 | |||
| 1182 | Ga0207639_10036431 | |||
| 1183 | Ga0207639_10174740 | |||
| 1184 | Ga0207678_10000529 | |||
| 1185 | Ga0207678_10019693 | |||
| 1186 | Ga0207678_10034220 | |||
| 1187 | Ga0207678_10071713 | |||
| 1188 | Ga0207708_10001226 | |||
| 1189 | Ga0207708_10046461 | |||
| 1190 | Ga0207702_10002744 | |||
| 1191 | Ga0207702_10021271 | |||
| 1192 | Ga0207641_10004511 | |||
| 1193 | Ga0207641_10027017 | |||
| 1194 | Ga0207641_10101488 | |||
| 1195 | Ga0207641_10129187 | |||
| 1196 | Ga0207648_10000040 | |||
| 1197 | Ga0207648_10000251 | |||
| 1198 | Ga0207648_10001465 | |||
| 1199 | Ga0207648_10004330 | |||
| 1200 | Ga0207648_10005619 | |||
| 1201 | Ga0207648_10012489 | |||
| 1202 | Ga0207648_10018327 | |||
| 1203 | Ga0207648_10018632 | |||
| 1204 | Ga0207648_10024291 | |||
| 1205 | Ga0207648_10074305 | |||
| 1206 | Ga0207676_10000589 | |||
| 1207 | Ga0207676_10009205 | |||
| 1208 | Ga0207676_10016562 | |||
| 1209 | Ga0207676_10019055 | |||
| 1210 | Ga0207676_10039393 | |||
| 1211 | Ga0207676_10073583 | |||
| 1212 | Ga0207674_10004062 | |||
| 1213 | Ga0207674_10013645 | |||
| 1214 | Ga0207674_10018791 | |||
| 1215 | Ga0207674_10041465 | |||
| 1216 | Ga0207674_10061048 | |||
| 1217 | Ga0207674_10077311 | |||
| 1218 | Ga0207675_100002453 | |||
| 1219 | Ga0207675_100003477 | |||
| 1220 | Ga0207675_100036552 | |||
| 1221 | Ga0207683_10000314 | |||
| 1222 | Ga0207683_10004727 | |||
| 1223 | Ga0207683_10006228 | |||
| 1224 | Ga0207683_10026706 | |||
| 1225 | Ga0207683_10048128 | |||
| 1226 | Ga0209281_1000042 | |||
| 1227 | Ga0209389_1016148 | |||
| 1228 | Ga0209971_1005175 | |||
| 1229 | Ga0209998_10011812 | |||
| 1230 | Ga0209974_10006496 | |||
| 1231 | Ga0207428_10000544 | |||
| 1232 | Ga0268266_10005333 | |||
| 1233 | Ga0268266_10014241 | |||
| 1234 | Ga0268266_10021817 | |||
| 1235 | Ga0268265_10008775 | |||
| 1236 | Ga0268265_10090174 | |||
| 1237 | Ga0268265_10100009 | |||
| 1238 | Ga0268264_10002492 | |||
| 1239 | Ga0268264_10004327 | |||
| 1240 | Ga0268264_10008389 | |||
| 1241 | Ga0268264_10009158 | |||
| 1242 | Ga0268264_10116545 | |||
| 1243 | Ga0268264_10124493 | |||
| 1244 | Ga0265336_10000053 | |||
| 1245 | Ga0307517_10071449 | |||
| 1246 | Ga0307515_10000020 | |||
| 1247 | Ga0307515_10000101 | |||
| 1248 | Ga0307515_10000179 | |||
| 1249 | Ga0307515_10000257 | |||
| 1250 | Ga0307515_10000586 | |||
| 1251 | Ga0307515_10001678 | |||
| 1252 | Ga0307515_10003072 | |||
| 1253 | Ga0307515_10008113 | |||
| 1254 | Ga0307515_10035989 | |||
| 1255 | Ga0307515_10056437 | |||
| 1256 | Ga0265324_10000132 | |||
| 1257 | Ga0268256_1008689 | |||
| 1258 | Ga0265330_10000014 | |||
| 1259 | Ga0265332_10000011 | |||
| 1260 | Ga0265332_10000035 | |||
| 1261 | Ga0265332_10011144 | |||
| 1262 | Ga0265328_10004678 | |||
| 1263 | Ga0265325_10015023 | |||
| 1264 | Ga0265331_10002479 | |||
| 1265 | Ga0265327_10000058 | |||
| 1266 | Ga0265327_10000086 | |||
| 1267 | Ga0265316_10000026 | |||
| 1268 | Ga0307513_10004582 | |||
| 1269 | Ga0307513_10049273 | |||
| 1270 | Ga0307513_10059753 | |||
| 1271 | Ga0307408_100043216 | |||
| 1272 | Ga0307508_10000122 | |||
| 1273 | Ga0307514_10002271 | |||
| 1274 | Ga0307514_10004914 | |||
| 1275 | Ga0265314_10000026 | |||
| 1276 | Ga0265314_10000879 | |||
| 1277 | Ga0265314_10054277 | |||
| 1278 | Ga0307516_10000017 | |||
| 1279 | Ga0307516_10000311 | |||
| 1280 | Ga0307516_10005394 | |||
| 1281 | Ga0307516_10021704 | |||
| 1282 | Ga0307516_10079276 | |||
| 1283 | Ga0307405_10058671 | |||
| 1284 | Ga0307407_10051970 | |||
| 1285 | Ga0307412_10089738 | |||
| 1286 | Ga0307416_100082998 | |||
| 1287 | Ga0307411_10001074 | |||
| 1288 | Ga0307411_10019997 | |||
| 1289 | Ga0307507_10105691 | |||
| 1290 | Ga0307510_10036162 | |||
| 1291 | Ga0373959_0005924 | |||
| 1292 | Ga0373926_0006019 | |||
| 1293 | Ga0373944_0010878 | |||
| 1294 | Ga0373945_0004169 | |||
| 1295 | Ga0373946_0004132 | |||
| 1296 | Ga0373931_0006132 | |||
| 1297 | Ga0373931_0028533 | |||
| 1298 | Ga0373935_0042082 | |||
| 1299 | Ga0373927_0017699 | |||
| 1300 | Ga0373927_0031410 | |||
| 1301 | Ga0373933_0003935 | |||
| 1302 | Ga0373937_0001566 | |||
| 1303 | Ga0373925_0004630 | |||
| 1304 | Ga0373925_0025951 | |||
| 1305 | Ga0395899_0012556 | |||
| 1306 | Ga0395900_0006480 | |||
| 1307 | Ga0395900_0038239 | |||
| 1308 | Ga0395898_0008499 | |||
| 1309 | Ga0395898_0035073 | |||
| 1310 | Ga0395898_0092545 | |||
| 1311 | Ga0395905_0000125 | |||
| 1312 | Ga0395905_0021505 | |||
| 1313 | Ga0395905_0147792 | |||
| 1314 | Ga0395905_0168915 | |||
| 1315 | Ga0395901_0025337 | |||
| 1316 | Ga0395901_0044785 | |||
| 1317 | Ga0400483_009461 | |||
| 1318 | Ga0400483_020178 | |||
| 1319 | Ga0400483_151143 | |||
| 1320 | Ga0400483_256170 | |||
| 1321 | Ga0436361_0147437 | |||
| 1322 | Ga0436361_0213573 | |||
| 1323 | Ga0436361_0259649 | |||
| 1324 | Ga0436361_0272384 | |||
| 1325 | Ga0436361_0306252 | |||
| 1326 | Ga0436361_0354255 | |||
| 1327 | Ga0436361_0984533 | |||
| 1328 | Ga0439436_0000162 | |||
| 1329 | Ga0439466_0003184 | |||
| 1330 | Ga0439465_0001313 | |||
| 1331 | Ga0439449_0000243 | |||
| 1332 | Ga0439449_0000525 | |||
| 1333 | Ga0439449_0001484 | |||
| 1334 | Ga0439457_003179 | |||
| 1335 | Ga0450911_000151 | |||
| 1336 | Ga0450910_002021 | |||
| 1337 | Ga0439459_0001404 | |||
| 1338 | Ga0450918_000674 | |||
| 1339 | Ga0451577_0011793 | |||
| 1340 | Ga0451577_0012518 | |||
| 1341 | Ga0451577_0029301 | |||
| 1342 | Ga0451577_0041018 | |||
| 1343 | Ga0451577_0046410 | |||
| 1344 | Ga0466968_0023140 | |||
| 1345 | Ga0451576_0003186 | |||
| 1346 | Ga0451576_0115779 | |||
| 1347 | Ga0451576_0291924 | |||
| 1348 | Ga0495627_008562 | |||
| 1349 | Ga0495592_0137350 | |||
| 1350 | Ga0495603_0001608 | |||
| 1351 | Ga0495638_0032786 | |||
| 1352 | Ga0495650_0024898 | |||
| 1353 | Ga0495580_0020484 | |||
| 1354 | Ga0495582_0015231 | |||
| 1355 | Ga0495639_0021453 | |||
| 1356 | Ga0495594_0012083 | |||
| 1357 | Ga0495594_0060493 | |||
| 1358 | Ga0495583_0000159 | |||
| 1359 | Ga0495606_0003954 | |||
| 1360 | Ga0495610_0019561 | |||
| 1361 | Ga0495632_0020536 | |||
| 1362 | Ga0495642_0019302 | |||
| 1363 | Ga0495654_0006402 | |||
| 1364 | Ga0495665_0010238 | |||
| 1365 | Ga0495586_0004575 | |||
| 1366 | Ga0495609_0046489 | |||
| 1367 | Ga0495621_0016956 | |||
| 1368 | Ga0495656_0000565 | |||
| 1369 | Ga0495625_0015990 | |||
| 1370 | Ga0495625_0020334 | |||
| 1371 | Ga0495625_0024586 | |||
| 1372 | Ga0495647_0005215 | |||
| 1373 | Ga0495647_0008601 | |||
| 1374 | Ga0495647_0024523 | |||
| 1375 | Ga0495613_0031253 | |||
| 1376 | Ga0495671_0027188 | |||
| 1377 | Ga0495649_0005881 | |||
| 1378 | Ga0495649_0011138 | |||
| 1379 | Ga0495589_0003499 | |||
| 1380 | Ga0495581_0006352 | |||
| 1381 | Ga0495687_001479 | |||
| 1382 | Ga0495686_0004435 | |||
| 1383 | Ga0496101_0040706 | |||
| 1384 | Ga0496103_0089904 | |||
| 1385 | Ga0496104_0005329 | |||
| 1386 | Ga0496106_0113732 | |||
| 1387 | Ga0496107_0019529 | |||
| 1388 | Ga0496109_0020266 | |||
| 1389 | Ga0496112_0000168 | |||
| 1390 | Ga0496114_0003392 | |||
| 1391 | Ga0496114_0050821 | |||
| 1392 | Ga0496114_0124311 | |||
| 1393 | Ga0496115_0068377 | |||
| 1394 | Ga0496116_0016032 | |||
| 1395 | Ga0496118_0036830 | |||
| 1396 | Ga0496124_0011080 | |||
| 1397 | Ga0501031_0011184 | |||
| 1398 | Ga0501032_0113477 | |||
| 1399 | Ga0501033_0004048 | |||
| 1400 | Ga0501036_0001325 | |||
| 1401 | Ga0501037_0042465 | |||
| 1402 | Ga0501038_0000668 | |||
| 1403 | Ga0501039_0000053 | |||
| 1404 | Ga0501040_0000093 | |||
| 1405 | Ga0501040_0013970 | |||
| 1406 | Ga0501041_0000098 | |||
| 1407 | Ga0501042_0000242 | |||
| 1408 | Ga0501043_0008752 | |||
| 1409 | Ga0501043_0105048 | |||
| 1410 | Ga0501046_0000144 | |||
| 1411 | Ga0501047_0035080 | |||
| 1412 | Ga0501047_0070083 | |||
| 1413 | Ga0501048_0005205 | |||
| 1414 | Ga0501048_0074852 | |||
| 1415 | Ga0501070_0022204 | |||
| 1416 | Ga0501072_0000495 | |||
| 1417 | Ga0501074_0003352 | |||
| 1418 | Ga0501075_0000101 | |||
| 1419 | Ga0501076_0001040 | |||
| 1420 | Ga0501077_0000994 | |||
| 1421 | Ga0501198_000031 | |||
| 1422 | Ga0501222_000034 | |||
| 1423 | Ga0501079_0000459 | |||
| 1424 | Ga0501081_0000052 | |||
| 1425 | Ga0501265_000135 | |||
| 1426 | Ga0501035_0009327 | |||
| 1427 | Ga0501045_0002526 | |||
| 1428 | nmdc:mga0k408_1071_c1 | |||
| 1429 | nmdc:mga0k408_134_c1 | |||
| 1430 | nmdc:mga0k408_42468_c1 | |||
| 1431 | nmdc:mga0k408_49360_c1 | |||
| 1432 | nmdc:mga0k408_64915_c1 | |||
| 1433 | nmdc:mga06z11_44129_c1 | |||
| 1434 | nmdc:mga06z11_44955_c1 | |||
| 1435 | nmdc:mga07m45_10731_c1 | |||
| 1436 | nmdc:mga07m45_12553_c2 | |||
| 1437 | nmdc:mga07m45_12755_c1 | |||
| 1438 | nmdc:mga07m45_29445_c1 | |||
| 1439 | nmdc:mga07m45_3728_c1 | |||
| 1440 | nmdc:mga07m45_6669_c1 | |||
| 1441 | nmdc:mga07m45_75_c1 | |||
| 1442 | nmdc:mga07m45_8241_c1 | |||
| 1443 | nmdc:mga07m45_85980_c1 | |||
| 1444 | nmdc:mga05p37_60509_c1 | |||
| 1445 | nmdc:mga08y16_250592_c1 | |||
| 1446 | nmdc:mga08y16_29832_c1 | |||
| 1447 | nmdc:mga0n895_5705_c1 | |||
| 1448 | nmdc:mga0rr50_37346_c1 | |||
| 1449 | nmdc:mga0a205_3742_c1 | |||
| 1450 | Ga0500635_0001602 | |||
| 1451 | Ga0495619_0048295 | |||
| 1452 | Ga0500578_0022819 | |||
| 1453 | Ga0500593_000730 | |||
| 1454 | Ga0500593_000920 | |||
| 1455 | Ga0500658_0000175 | |||
| 1456 | Ga0500568_0003121 | |||
| 1457 | Ga0500616_0009338 | |||
| 1458 | Ga0500619_000049 | |||
| 1459 | Ga0500622_0046870 | |||
| 1460 | Ga0500636_0015032 | |||
| 1461 | Ga0501084_0020476 | |||
| 1462 | Ga0501082_0002549 | |||
| 1463 | Ga0530510_0000221 | |||
| 1464 | 2513229417 | |||
| 1465 | 2587756816 | |||
| 1466 | 2644247600 | |||
| 1467 | 2644324918 | |||
| 1468 | 2644396787 | |||
| 1469 | 2831865213 | |||
| 1470 | 2842680472 | |||
| 1471 | 2885196009 | |||
| 1472 | 2885204773 | |||
| 1473 | 2885218540 | |||
| 1474 | 2886854387 | |||
| 1475 | 2904480341 | |||
| 1476 | 2904548700 | |||
| 1477 | 2919466367 | |||
| 1478 | 2928087319 | |||
| 1479 | 2929164634 | |||
| 1480 | 2939631971 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d32-assembly1.cif.gz_D | crystal structure of michaelis complex of gamma-glutamylcysteine synthetase | 0.9435 | 4 | 495 |
| 3nzt-assembly1.cif.gz_A | 2.0 angstrom crystal structure of glutamate--cysteine ligase (gsha) ftom francisella tularensis in complex with amp | 0.9433 | 18 | 502 |
| 2d32-assembly1.cif.gz_A | crystal structure of michaelis complex of gamma-glutamylcysteine synthetase | 0.9407 | 4 | 496 |
| 1v4g-assembly1.cif.gz_C | crystal structure of gamma-glutamylcysteine synthetase from escherichia coli b | 0.9377 | 4 | 496 |
| 1va6-assembly1.cif.gz_A | crystal structure of gamma-glutamylcysteine synthetase from escherichia coli b complexed with transition-state analogue | 0.9377 | 4 | 494 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6W9_18_518_3.30.590.20 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.9519 | 16 | 496 | 3.30.590.20 |
| 3nztA00 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.9433 | 18 | 502 | 3.30.590.20 |
| 2d33D02 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.9367 | 16 | 495 | 3.30.590.20 |
| 2d33D02 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.9281 | 16 | 495 | 3.30.590.20 |
| 3nztA00 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.9177 | 18 | 502 | 3.30.590.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257JEE7-F1-model_v4 | Glutamate--cysteine ligase (EC 6.3.2.2) | 0.9919 | 229 | 457 |
GO:0004357
GO:0005829 GO:0006750 GO:0046872 |
| AF-A0A1F4JQ58-F1-model_v4 | deleted | 0.9917 | 112 | 504 |
|
| AF-F3LUI7-F1-model_v4 | deleted | 0.9911 | 20 | 505 |
|
| AF-A0A4Q5UJZ8-F1-model_v4 | deleted | 0.991 | 95 | 472 |
|
| AF-A0A7S1GWP9-F1-model_v4 | glutamate--cysteine ligase (EC 6.3.2.2) | 0.9895 | 16 | 105 |
GO:0004357
GO:0005829 GO:0006750 GO:0046872 |