F478558

General Info

Members Datasets Scaffolds Average Seq Length
740 321 1480 291

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0718787|Ga0501082_0718787_56_853
Length 265
Sequence MTLDPEIEARIEEPASADAVREARLSPSEAVEHMRIRLPDRGNRKLRRVLERANGDKELRGWWHVANVNAVVRLEINDHSWVHIQIVANIALKLLRQLTKNGVEPSLVRDYGMDGEDAEVVVVLAALTHCVGMSVHRKGHEDWSLFQAITSHRADGEPLSLEAGILRVADALDMAKGRSRIPFERGQVSMHSLSAAAVEEVVITDGDTKPVRIEIVMNNSSGLFQVDGLLRAKLRGSGLEPYVEVIAHIDTDAEKRLVSEYRLEI

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 11.22
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 13.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0718787 3300060353 Unclassified 874
2 JGI24739J22299_10011246 3300001989 Unclassified 3306
3 JGI24743J22301_10001489 3300001991 Bacteria 3254
4 JGI24738J21930_10004979 3300002075 Unclassified 3215
5 JGI24738J21930_10018973 3300002075 Archaea 1436
6 JGI24744J21845_10010350 3300002077 Unclassified 1911
7 JGI24742J22300_10002099 3300002244 Bacteria 3170
8 Ga0070658_10025121 3300005327 Bacteria 4776
9 Ga0070658_10055976 3300005327 Unclassified 3205
10 Ga0070658_10292219 3300005327 Bacteria 1389
11 Ga0070676_10150902 3300005328 Unclassified 1488
12 Ga0070683_100010645 3300005329 Bacteria 7906
13 Ga0070683_100011274 3300005329 Bacteria 7717
14 Ga0070683_100037548 3300005329 Bacteria 4435
15 Ga0070683_100081876 3300005329 Bacteria 3022
16 Ga0070683_100095282 3300005329 Bacteria 2798
17 Ga0070683_100576225 3300005329 Bacteria 1076
18 Ga0070690_100009736 3300005330 Bacteria 5574
19 Ga0070670_100042356 3300005331 Bacteria 3913
20 Ga0070670_100347975 3300005331 Bacteria 1301
21 Ga0068869_100046017 3300005334 Bacteria 3144
22 Ga0070680_100003864 3300005336 Bacteria 11196
23 Ga0070680_100012290 3300005336 Bacteria 6648
24 Ga0070680_100078877 3300005336 Unclassified 2713
25 Ga0070682_100005389 3300005337 Bacteria 7119
26 Ga0070682_100026934 3300005337 Bacteria 3445
27 Ga0070682_100201417 3300005337 Archaea 1404
28 Ga0068868_100023709 3300005338 Bacteria 4647
29 Ga0068868_100079462 3300005338 Bacteria 2627
30 Ga0070660_100425589 3300005339 Bacteria 1100
31 Ga0070689_100010225 3300005340 Bacteria 6684
32 Ga0070689_100060852 3300005340 Unclassified 2936
33 Ga0070691_10011914 3300005341 Unclassified 3980
34 Ga0070687_100074923 3300005343 Archaea 1829
35 Ga0070661_100008413 3300005344 Bacteria 7132
36 Ga0070661_100011485 3300005344 Bacteria 6168
37 Ga0070692_10014221 3300005345 Bacteria 3731
38 Ga0070692_10020404 3300005345 Bacteria 3213
39 Ga0070668_100010845 3300005347 Bacteria 6780
40 Ga0070668_100088306 3300005347 Bacteria 2440
41 Ga0070668_100157338 3300005347 Unclassified 1841
42 Ga0070669_100116514 3300005353 Archaea 2033
43 Ga0070675_100082178 3300005354 Unclassified 2687
44 Ga0070675_100125061 3300005354 Archaea 2187
45 Ga0070671_100073534 3300005355 Bacteria 2855
46 Ga0070671_100087563 3300005355 Bacteria 2606
47 Ga0070674_100004917 3300005356 Bacteria 7656
48 Ga0070674_100048705 3300005356 Bacteria 2909
49 Ga0070674_100058022 3300005356 Unclassified 2689
50 Ga0070674_100065278 3300005356 Bacteria 2554
51 Ga0070673_100187733 3300005364 Archaea 1773
52 Ga0070688_100017320 3300005365 Bacteria 4134
53 Ga0070659_100047707 3300005366 Unclassified 3361
54 Ga0070659_100090699 3300005366 Bacteria 2449
55 Ga0070659_100164871 3300005366 Unclassified 1813
56 Ga0070659_100168785 3300005366 Unclassified 1791
57 Ga0070667_100145761 3300005367 Archaea 2076
58 Ga0070703_10005780 3300005406 Bacteria 3466
59 Ga0070709_10218951 3300005434 Bacteria 1357
60 Ga0070709_10302454 3300005434 Bacteria 1169
61 Ga0070710_10017974 3300005437 Bacteria 3630
62 Ga0070701_10002028 3300005438 Bacteria 7679
63 Ga0070701_10173381 3300005438 Archaea 1257
64 Ga0070711_100000778 3300005439 Bacteria 16654
65 Ga0070711_100050323 3300005439 Bacteria 2857
66 Ga0070705_100012577 3300005440 Bacteria 4306
67 Ga0070700_100004283 3300005441 Bacteria 7448
68 Ga0070694_100055758 3300005444 Bacteria 2681
69 Ga0070708_100056964 3300005445 Bacteria 3478
70 Ga0070663_100038450 3300005455 Bacteria 3338
71 Ga0070678_100010583 3300005456 Bacteria 5644
72 Ga0070678_100120725 3300005456 Bacteria 2066
73 Ga0070662_100005776 3300005457 Bacteria 7927
74 Ga0070662_100097469 3300005457 Bacteria 2219
75 Ga0070681_10003855 3300005458 Bacteria 14112
76 Ga0070681_10045244 3300005458 Bacteria 4403
77 Ga0070681_10087127 3300005458 Bacteria 3075
78 Ga0068867_100026250 3300005459 Bacteria 4182
79 Ga0068867_100363868 3300005459 Archaea 1210
80 Ga0070685_10007351 3300005466 Bacteria 5632
81 Ga0070685_10035833 3300005466 Bacteria 2802
82 Ga0070707_100643592 3300005468 Archaea 1023
83 Ga0070698_100005716 3300005471 Bacteria 13614
84 Ga0070699_100078153 3300005518 Bacteria 2882
85 Ga0070699_100127927 3300005518 Bacteria 2238
86 Ga0070679_100042942 3300005530 Bacteria 4503
87 Ga0070679_100084145 3300005530 Bacteria 3169
88 Ga0070684_100012808 3300005535 Bacteria 6736
89 Ga0070684_100120477 3300005535 Bacteria 2360
90 Ga0070684_100194283 3300005535 Bacteria 1847
91 Ga0068853_100009478 3300005539 Bacteria 7845
92 Ga0068853_100178013 3300005539 Bacteria 1928
93 Ga0068853_100263725 3300005539 Archaea 1584
94 Ga0070672_100040145 3300005543 Bacteria 3589
95 Ga0070696_100026401 3300005546 Bacteria 3951
96 Ga0070693_100027437 3300005547 Bacteria 3086
97 Ga0070693_100059705 3300005547 Unclassified 2211
98 Ga0070693_100167509 3300005547 Unclassified 1404
99 Ga0070665_100160278 3300005548 Bacteria 2251
100 Ga0070704_100006800 3300005549 Bacteria 6771
101 Ga0070704_100126301 3300005549 Archaea 1974
102 Ga0068855_100112091 3300005563 Bacteria 3130
103 Ga0068855_100153220 3300005563 Bacteria 2620
104 Ga0070664_100001655 3300005564 Bacteria 17816
105 Ga0070664_100076158 3300005564 Unclassified 2882
106 Ga0070664_100175449 3300005564 Bacteria 1903
107 Ga0070664_100397718 3300005564 Bacteria 1259
108 Ga0068857_100207853 3300005577 Unclassified 1785
109 Ga0068854_100221324 3300005578 Archaea 1498
110 Ga0068856_100028879 3300005614 Bacteria 5419
111 Ga0068856_100037505 3300005614 Bacteria 4755
112 Ga0070702_100007827 3300005615 Bacteria 5138
113 Ga0070702_100043566 3300005615 Unclassified 2529
114 Ga0068852_100043332 3300005616 Bacteria 3816
115 Ga0068852_100078184 3300005616 Unclassified 2926
116 Ga0068852_100079567 3300005616 Bacteria 2903
117 Ga0068852_100084050 3300005616 Bacteria 2832
118 Ga0068852_100107007 3300005616 Bacteria 2536
119 Ga0068859_100153008 3300005617 Bacteria 2383
120 Ga0068864_100036679 3300005618 Bacteria 4180
121 Ga0068864_100211124 3300005618 Bacteria 1787
122 Ga0068861_100092806 3300005719 Bacteria 2385
123 Ga0068861_100125460 3300005719 Bacteria 2076
124 Ga0068861_100566068 3300005719 Bacteria 1038
125 Ga0068851_10016932 3300005834 Unclassified 3494
126 Ga0068870_10067545 3300005840 Unclassified 1940
127 Ga0068863_100033487 3300005841 Bacteria 4895
128 Ga0068860_100031873 3300005843 Bacteria 5067
129 Ga0068860_100101724 3300005843 Bacteria 2742
130 Ga0081455_10008516 3300005937 Bacteria 10653
131 Ga0081455_10019638 3300005937 Bacteria 6384
132 Ga0081455_10033510 3300005937 Bacteria 4615
133 Ga0081539_10000712 3300005985 Bacteria 66647
134 Ga0081539_10136213 3300005985 Bacteria 1199
135 Ga0075364_10051124 3300006051 Bacteria 2698
136 Ga0075432_10002694 3300006058 Bacteria 5939
137 Ga0075432_10008665 3300006058 Bacteria 3471
138 Ga0075432_10016054 3300006058 Bacteria 2557
139 Ga0070715_10072860 3300006163 Bacteria 1539
140 Ga0070715_10170560 3300006163 Unclassified 1083
141 Ga0070716_100216923 3300006173 Bacteria 1283
142 Ga0070712_100046450 3300006175 Bacteria 3002
143 Ga0070712_100067562 3300006175 Bacteria 2544
144 Ga0070712_100299083 3300006175 Unclassified 1302
145 Ga0097621_100047946 3300006237 Bacteria 3463
146 Ga0097621_100116997 3300006237 Bacteria 2258
147 Ga0097621_100547817 3300006237 Bacteria 1053
148 Ga0068871_100024236 3300006358 Bacteria 4702
149 Ga0068871_100028513 3300006358 Bacteria 4377
150 Ga0068871_100062935 3300006358 Bacteria 3033
151 Ga0068871_100130492 3300006358 Unclassified 2130
152 Ga0075428_100000942 3300006844 Bacteria 30775
153 Ga0075431_100017672 3300006847 Bacteria 7251
154 Ga0075433_10012982 3300006852 Bacteria 6753
155 Ga0075434_100139867 3300006871 Bacteria 2440
156 Ga0075429_100006563 3300006880 Bacteria 10074
157 Ga0068865_100006538 3300006881 Bacteria 7122
158 Ga0068865_100014818 3300006881 Bacteria 4960
159 Ga0068865_100054806 3300006881 Bacteria 2772
160 Ga0075436_100045219 3300006914 Bacteria 3036
161 Ga0097620_100153009 3300006931 Bacteria 2383
162 Ga0075435_100010187 3300007076 Bacteria 6867
163 Ga0105240_10106750 3300009093 Bacteria 3396
164 Ga0111539_10005668 3300009094 Bacteria 16155
165 Ga0111539_10008986 3300009094 Bacteria 12650
166 Ga0111539_10061471 3300009094 Bacteria 4450
167 Ga0111539_10107842 3300009094 Unclassified 3268
168 Ga0111539_10780055 3300009094 Archaea 1112
169 Ga0105245_10002722 3300009098 Bacteria 15912
170 Ga0105245_10003740 3300009098 Bacteria 13558
171 Ga0105245_10011716 3300009098 Bacteria 7631
172 Ga0105245_10030952 3300009098 Bacteria 4733
173 Ga0105245_10086760 3300009098 Bacteria 2871
174 Ga0105245_10123199 3300009098 Bacteria 2424
175 Ga0114129_10006031 3300009147 Bacteria 17180
176 Ga0114129_10006732 3300009147 Bacteria 16319
177 Ga0114129_10231371 3300009147 Bacteria 2489
178 Ga0105243_10019092 3300009148 Bacteria 5198
179 Ga0105243_10022765 3300009148 Bacteria 4764
180 Ga0105243_10029094 3300009148 Bacteria 4247
181 Ga0105243_10035934 3300009148 Bacteria 3842
182 Ga0105243_10381014 3300009148 Bacteria 1304
183 Ga0105243_10426742 3300009148 Archaea 1238
184 Ga0105242_10002896 3300009176 Bacteria 13426
185 Ga0105242_10025238 3300009176 Bacteria 4701
186 Ga0105242_10476757 3300009176 Archaea 1182
187 Ga0105248_10007689 3300009177 Bacteria 11840
188 Ga0105248_10147107 3300009177 Bacteria 2659
189 Ga0105248_10147113 3300009177 Bacteria 2659
190 Ga0105248_10305267 3300009177 Unclassified 1792
191 Ga0105237_10247575 3300009545 Unclassified 1784
192 Ga0105238_10037087 3300009551 Bacteria 4956
193 Ga0105238_10375838 3300009551 Unclassified 1412
194 Ga0105249_10004111 3300009553 Bacteria 12565
195 Ga0105249_10157113 3300009553 Bacteria 2194
196 Ga0105249_10414713 3300009553 Bacteria 1379
197 Ga0105239_10004419 3300010375 Bacteria 16815
198 Ga0105239_10033163 3300010375 Bacteria 5671
199 Ga0105239_10055548 3300010375 Unclassified 4343
200 Ga0105246_10005688 3300011119 Bacteria 7605
201 Ga0105246_10085070 3300011119 Unclassified 2264
202 Ga0157373_10143881 3300013100 Unclassified 1677
203 Ga0157371_10010321 3300013102 Bacteria 7288
204 Ga0157371_10117162 3300013102 Bacteria 1893
205 Ga0157371_10138521 3300013102 Bacteria 1733
206 Ga0157370_10166912 3300013104 Unclassified 2047
207 Ga0157369_10031662 3300013105 Bacteria 5821
208 Ga0157369_10218605 3300013105 Unclassified 1995
209 Ga0157369_10426035 3300013105 Bacteria 1375
210 Ga0157374_10006575 3300013296 Bacteria 9870
211 Ga0163162_10039731 3300013306 Bacteria 4703
212 Ga0163162_10104233 3300013306 Bacteria 2931
213 Ga0163162_10159702 3300013306 Bacteria 2375
214 Ga0163162_10166169 3300013306 Bacteria 2330
215 Ga0157372_10006446 3300013307 Bacteria 12495
216 Ga0157372_10016007 3300013307 Bacteria 8045
217 Ga0157372_10227194 3300013307 Unclassified 2164
218 Ga0157372_10384281 3300013307 Bacteria 1636
219 Ga0157375_10023531 3300013308 Bacteria 5685
220 Ga0157375_10103461 3300013308 Bacteria 2934
221 Ga0157375_10169654 3300013308 Bacteria 2329
222 Ga0157375_10449341 3300013308 Bacteria 1454
223 Ga0157375_10945666 3300013308 Unclassified 1004
224 Ga0163163_10159741 3300014325 Bacteria 2299
225 Ga0163163_10445551 3300014325 Unclassified 1355
226 Ga0157380_10037797 3300014326 Bacteria 3743
227 Ga0157380_10050383 3300014326 Bacteria 3289
228 Ga0157380_10459036 3300014326 Archaea 1226
229 Ga0157377_10007022 3300014745 Bacteria 5408
230 Ga0157377_10013079 3300014745 Bacteria 4191
231 Ga0157377_10068137 3300014745 Bacteria 2050
232 Ga0157379_10067408 3300014968 Bacteria 3199
233 Ga0157376_10011146 3300014969 Bacteria 6614
234 Ga0157376_10034780 3300014969 Bacteria 4071
235 Ga0157376_10169969 3300014969 Bacteria 1984
236 Ga0157376_10345258 3300014969 Bacteria 1423
237 Ga0157376_10633535 3300014969 Bacteria 1068
238 Ga0163161_10087346 3300017792 Bacteria 2303
239 Ga0163161_10218883 3300017792 Bacteria 1474
240 Ga0206353_10640569 3300020082 Unclassified 1505
241 Ga0224712_10076538 3300022467 Unclassified 1371
242 Ga0207653_10007128 3300025885 Bacteria 3492
243 Ga0207692_10014959 3300025898 Bacteria 3403
244 Ga0207642_10017208 3300025899 Bacteria 2744
245 Ga0207688_10018141 3300025901 Bacteria 3830
246 Ga0207647_10055787 3300025904 Bacteria 2427
247 Ga0207699_10078398 3300025906 Bacteria 2040
248 Ga0207699_10109794 3300025906 Bacteria 1766
249 Ga0207645_10137393 3300025907 Unclassified 1592
250 Ga0207643_10015732 3300025908 Bacteria 4120
251 Ga0207643_10158919 3300025908 Bacteria 1359
252 Ga0207705_10099972 3300025909 Unclassified 2133
253 Ga0207705_10130681 3300025909 Unclassified 1869
254 Ga0207654_10171124 3300025911 Archaea 1410
255 Ga0207707_10020297 3300025912 Bacteria 5801
256 Ga0207695_10047042 3300025913 Bacteria 4569
257 Ga0207693_10010927 3300025915 Bacteria 7358
258 Ga0207693_10071413 3300025915 Bacteria 2717
259 Ga0207693_10085853 3300025915 Bacteria 2465
260 Ga0207693_10284094 3300025915 Bacteria 1297
261 Ga0207663_10026556 3300025916 Bacteria 3363
262 Ga0207660_10052625 3300025917 Unclassified 2899
263 Ga0207660_10190249 3300025917 Bacteria 1598
264 Ga0207662_10034397 3300025918 Bacteria 2957
265 Ga0207662_10117577 3300025918 Bacteria 1664
266 Ga0207657_10010086 3300025919 Bacteria 9445
267 Ga0207657_10053270 3300025919 Bacteria 3506
268 Ga0207657_10136263 3300025919 Bacteria 2009
269 Ga0207657_10369038 3300025919 Bacteria 1131
270 Ga0207649_10047442 3300025920 Unclassified 2644
271 Ga0207649_10298527 3300025920 Bacteria 1177
272 Ga0207652_10295645 3300025921 Bacteria 1461
273 Ga0207694_10099848 3300025924 Unclassified 2299
274 Ga0207659_10030066 3300025926 Unclassified 3708
275 Ga0207659_10286411 3300025926 Archaea 1349
276 Ga0207687_10050998 3300025927 Bacteria 2883
277 Ga0207687_10059790 3300025927 Bacteria 2686
278 Ga0207687_10106637 3300025927 Bacteria 2072
279 Ga0207687_10125509 3300025927 Bacteria 1926
280 Ga0207700_10170456 3300025928 Archaea 1816
281 Ga0207644_10062299 3300025931 Bacteria 2705
282 Ga0207644_10120843 3300025931 Archaea 1994
283 Ga0207690_10070781 3300025932 Bacteria 2403
284 Ga0207690_10099725 3300025932 Unclassified 2071
285 Ga0207690_10237437 3300025932 Archaea 1402
286 Ga0207706_10038276 3300025933 Bacteria 4255
287 Ga0207706_10048645 3300025933 Bacteria 3749
288 Ga0207706_10145350 3300025933 Bacteria 2086
289 Ga0207686_10007462 3300025934 Bacteria 5885
290 Ga0207686_10031563 3300025934 Bacteria 3147
291 Ga0207686_10068351 3300025934 Bacteria 2276
292 Ga0207709_10004231 3300025935 Bacteria 8321
293 Ga0207709_10034834 3300025935 Bacteria 2971
294 Ga0207709_10035388 3300025935 Unclassified 2952
295 Ga0207670_10138682 3300025936 Archaea 1791
296 Ga0207669_10014759 3300025937 Bacteria 3923
297 Ga0207669_10211339 3300025937 Bacteria 1416
298 Ga0207669_10402428 3300025937 Bacteria 1073
299 Ga0207704_10007862 3300025938 Bacteria 5062
300 Ga0207704_10078028 3300025938 Bacteria 2129
301 Ga0207704_10096155 3300025938 Bacteria 1961
302 Ga0207665_10011957 3300025939 Bacteria 5701
303 Ga0207665_10062245 3300025939 Bacteria 2531
304 Ga0207691_10009495 3300025940 Bacteria 9342
305 Ga0207691_10019977 3300025940 Bacteria 6337
306 Ga0207691_10104323 3300025940 Bacteria 2527
307 Ga0207691_10136579 3300025940 Bacteria 2162
308 Ga0207691_10423099 3300025940 Bacteria 1135
309 Ga0207711_10052951 3300025941 Bacteria 3480
310 Ga0207711_10121958 3300025941 Bacteria 2328
311 Ga0207711_10183204 3300025941 Unclassified 1905
312 Ga0207689_10124158 3300025942 Unclassified 2124
313 Ga0207661_10000273 3300025944 Bacteria 33324
314 Ga0207661_10030244 3300025944 Bacteria 4169
315 Ga0207661_10059962 3300025944 Bacteria 3068
316 Ga0207661_10083062 3300025944 Bacteria 2650
317 Ga0207679_10011244 3300025945 Bacteria 5785
318 Ga0207679_10082372 3300025945 Bacteria 2463
319 Ga0207679_10318358 3300025945 Bacteria 1346
320 Ga0207667_10122950 3300025949 Bacteria 2674
321 Ga0207667_10177122 3300025949 Unclassified 2190
322 Ga0207667_10426227 3300025949 Bacteria 1349
323 Ga0207651_10144877 3300025960 Archaea 1840
324 Ga0207712_10005182 3300025961 Bacteria 8251
325 Ga0207712_10128430 3300025961 Unclassified 1928
326 Ga0207668_10068533 3300025972 Bacteria 2523
327 Ga0207668_10132156 3300025972 Bacteria 1907
328 Ga0207640_10005036 3300025981 Bacteria 7188
329 Ga0207640_10059396 3300025981 Unclassified 2524
330 Ga0207658_10004151 3300025986 Bacteria 10096
331 Ga0207677_10015516 3300026023 Unclassified 4485
332 Ga0207677_10142865 3300026023 Bacteria 1835
333 Ga0207639_10041361 3300026041 Bacteria 3447
334 Ga0207678_10033959 3300026067 Unclassified 4443
335 Ga0207678_10047340 3300026067 Bacteria 3719
336 Ga0207708_10001826 3300026075 Bacteria 15704
337 Ga0207708_10029676 3300026075 Bacteria 4145
338 Ga0207708_10091870 3300026075 Bacteria 2341
339 Ga0207702_10028163 3300026078 Bacteria 4668
340 Ga0207641_10140396 3300026088 Archaea 2179
341 Ga0207648_10000504 3300026089 Bacteria 43569
342 Ga0207648_10133134 3300026089 Unclassified 2189
343 Ga0207648_10156463 3300026089 Bacteria 2012
344 Ga0207648_10193423 3300026089 Archaea 1804
345 Ga0207676_10184999 3300026095 Archaea 1827
346 Ga0207676_10194894 3300026095 Bacteria 1786
347 Ga0207674_10044028 3300026116 Bacteria 4600
348 Ga0207674_10136767 3300026116 Unclassified 2412
349 Ga0207675_100027437 3300026118 Bacteria 5304
350 Ga0207675_100038087 3300026118 Bacteria 4487
351 Ga0207675_100340004 3300026118 Bacteria 1469
352 Ga0207683_10001483 3300026121 Bacteria 21156
353 Ga0207683_10052152 3300026121 Bacteria 3584
354 Ga0207683_10072940 3300026121 Bacteria 3036
355 Ga0207683_10236265 3300026121 Archaea 1667
356 Ga0207698_10015478 3300026142 Bacteria 5107
357 Ga0207698_10104049 3300026142 Unclassified 2361
358 Ga0207698_10230143 3300026142 Unclassified 1682
359 Ga0207698_10563697 3300026142 Bacteria 1118
360 Ga0207428_10000222 3300027907 Bacteria 78747
361 Ga0207428_10010823 3300027907 Bacteria 8126
362 Ga0207428_10063181 3300027907 Bacteria 2926
363 Ga0268266_10210584 3300028379 Archaea 1782
364 Ga0268265_10260636 3300028380 Archaea 1541
365 Ga0268264_10126903 3300028381 Bacteria 2256
366 Ga0265337_1067712 3300028556 Unclassified 984
367 Ga0265319_1016801 3300028563 Bacteria 2800
368 Ga0265318_10022513 3300028577 Bacteria 2518
369 Ga0265338_10132985 3300028800 Bacteria 1961
370 Ga0265320_10036069 3300031240 Bacteria 2502
371 Ga0265327_10007879 3300031251 Bacteria 8076
372 Ga0307416_100005871 3300032002 Bacteria 7617
373 Ga0307416_100075003 3300032002 Bacteria 2829
374 Ga0307415_100007073 3300032126 Bacteria 6108
375 Ga0373958_0033953 3300034819 Archaea 1014
376 Ga0373926_0035641 3300035083 Bacteria 1766
377 Ga0373941_0042587 3300035115 Archaea 1410
378 Ga0373941_0055561 3300035115 Bacteria 1273
379 Ga0373943_0002579 3300035170 Bacteria 8251
380 Ga0373946_0014784 3300035171 Bacteria 2949
381 Ga0373961_0009431 3300035241 Bacteria 2388
382 Ga0373962_0008415 3300035242 Bacteria 2538
383 Ga0373931_0033478 3300035691 Bacteria 2663
384 Ga0373947_0019921 3300035725 Bacteria 3872
385 Ga0373925_0075236 3300037068 Bacteria 2558
386 Ga0395900_0015005 3300037418 Bacteria 7897
387 Ga0395900_0368717 3300037418 Bacteria 1406
388 Ga0395898_0016145 3300037466 Bacteria 7646
389 Ga0395898_0163407 3300037466 Bacteria 2130
390 Ga0395898_0231517 3300037466 Bacteria 1762
391 Ga0395898_0383501 3300037466 Unclassified 1340
392 Ga0395905_0177317 3300037471 Bacteria 2000
393 Ga0395905_0339521 3300037471 Bacteria 1393
394 Ga0395905_0484893 3300037471 Bacteria 1136
395 Ga0395901_0112921 3300038443 Bacteria 2853
396 Ga0395901_0244751 3300038443 Bacteria 1870
397 Ga0395901_0688630 3300038443 Archaea 1021
398 Ga0451807_1862518 3300041486 Bacteria 1042
399 Ga0439441_002460 3300042001 Bacteria 2614
400 Ga0439448_0055586 3300042005 Unclassified 1302
401 Ga0439449_0056392 3300042007 Unclassified 1451
402 Ga0439450_037602 3300042008 Unclassified 1113
403 Ga0439462_0000831 3300042015 Bacteria 6444
404 Ga0439446_0004313 3300042156 Bacteria 3599
405 Ga0439464_0069137 3300042439 Bacteria 1043
406 Ga0466966_0100587 3300044684 Bacteria 1788
407 Ga0466961_0139218 3300044693 Bacteria 1520
408 Ga0466967_0006293 3300045976 Bacteria 8375
409 Ga0466967_0237480 3300045976 Bacteria 1737
410 Ga0495592_0133474 3300046454 Bacteria 1734
411 Ga0495592_0210571 3300046454 Bacteria 1305
412 Ga0495603_0018540 3300046455 Bacteria 4209
413 Ga0495603_0150082 3300046455 Unclassified 1354
414 Ga0495603_0211385 3300046455 Bacteria 1120
415 Ga0495603_0307403 3300046455 Bacteria 911
416 Ga0495629_0001622 3300046459 Bacteria 17679
417 Ga0495629_0069147 3300046459 Bacteria 2464
418 Ga0495629_0176166 3300046459 Bacteria 1483
419 Ga0495641_0001841 3300046461 Bacteria 17419
420 Ga0495641_0043195 3300046461 Bacteria 2085
421 Ga0495641_0151683 3300046461 Bacteria 1036
422 Ga0495651_0018214 3300046462 Bacteria 5438
423 Ga0495651_0064146 3300046462 Bacteria 2807
424 Ga0495653_0011544 3300046463 Bacteria 7211
425 Ga0495653_0036570 3300046463 Bacteria 3866
426 Ga0495653_0092426 3300046463 Bacteria 2209
427 Ga0495653_0110420 3300046463 Bacteria 1977
428 Ga0495582_0000462 3300046473 Bacteria 22207
429 Ga0495582_0062724 3300046473 Archaea 2053
430 Ga0495582_0184382 3300046473 Unclassified 1190
431 Ga0495639_0005703 3300046475 Bacteria 5355
432 Ga0495639_0042675 3300046475 Bacteria 2047
433 Ga0495662_0004015 3300046476 Bacteria 7414
434 Ga0495664_0202267 3300046477 Bacteria 1203
435 Ga0495664_0204437 3300046477 Bacteria 1196
436 Ga0495594_0035267 3300046499 Bacteria 2725
437 Ga0495594_0053503 3300046499 Bacteria 2224
438 Ga0495594_0150479 3300046499 Archaea 1321
439 Ga0495596_0084159 3300046500 Bacteria 1235
440 Ga0495608_0039817 3300046511 Bacteria 3149
441 Ga0495608_0158081 3300046511 Bacteria 1442
442 Ga0495628_0084657 3300046516 Bacteria 2460
443 Ga0495628_0217698 3300046516 Archaea 1435
444 Ga0495630_0054489 3300046517 Bacteria 2996
445 Ga0495630_0057723 3300046517 Bacteria 2909
446 Ga0495663_0040333 3300046525 Archaea 1417
447 Ga0495666_0017424 3300046526 Bacteria 3578
448 Ga0495652_0085313 3300046529 Bacteria 2595
449 Ga0495665_0003126 3300046531 Bacteria 8953
450 Ga0495640_0004048 3300046533 Bacteria 11731
451 Ga0495640_0152438 3300046533 Bacteria 1484
452 Ga0495609_0114212 3300046538 Archaea 1164
453 Ga0495645_0085532 3300046543 Bacteria 2257
454 Ga0495667_0017056 3300046559 Bacteria 4904
455 Ga0495667_0040061 3300046559 Bacteria 3112
456 Ga0495656_0160861 3300046615 Bacteria 1091
457 Ga0495668_0131518 3300046616 Unclassified 1370
458 Ga0495668_0249142 3300046616 Archaea 973
459 Ga0495634_0030484 3300046642 Bacteria 3724
460 Ga0495634_0085694 3300046642 Bacteria 2053
461 Ga0495634_0098162 3300046642 Bacteria 1895
462 Ga0495635_0023025 3300046663 Bacteria 4342
463 Ga0495635_0031947 3300046663 Bacteria 3653
464 Ga0495659_0030922 3300046664 Archaea 1865
465 Ga0495588_0164601 3300046674 Bacteria 1173
466 Ga0495646_0030015 3300046680 Bacteria 3396
467 Ga0495646_0067604 3300046680 Bacteria 2112
468 Ga0495647_0009375 3300046681 Bacteria 3315
469 Ga0495647_0028537 3300046681 Bacteria 2058
470 Ga0495658_0001666 3300046683 Bacteria 11556
471 Ga0495613_0026261 3300046689 Bacteria 4339
472 Ga0495624_0099534 3300046690 Bacteria 1790
473 Ga0495589_0027915 3300046794 Bacteria 2853
474 Ga0495600_0035044 3300046809 Bacteria 3259
475 Ga0495600_0172318 3300046809 Bacteria 1397
476 Ga0495660_0069317 3300046810 Bacteria 1875
477 Ga0495581_0002858 3300047315 Bacteria 9862
478 Ga0495581_0019449 3300047315 Bacteria 3941
479 Ga0495604_0040214 3300047317 Bacteria 3672
480 Ga0495604_0055131 3300047317 Bacteria 3065
481 Ga0495604_0232939 3300047317 Bacteria 1262
482 Ga0495636_0056551 3300047318 Archaea 1652
483 Ga0495674_0005229 3300047319 Bacteria 12460
484 Ga0495674_0039532 3300047319 Bacteria 4227
485 Ga0495676_0005860 3300047321 Bacteria 11279
486 Ga0495676_0217889 3300047321 Unclassified 1317
487 Ga0495680_0002784 3300047322 Bacteria 17622
488 Ga0495680_0011900 3300047322 Bacteria 7678
489 Ga0495680_0029654 3300047322 Unclassified 4478
490 Ga0495680_0050977 3300047322 Bacteria 3234
491 Ga0495675_0046591 3300047444 Bacteria 2760
492 Ga0495685_067833 3300047447 Unclassified 1198
493 Ga0495684_0045963 3300047471 Bacteria 3340
494 Ga0495684_0135463 3300047471 Bacteria 1848
495 Ga0495593_0001385 3300047673 Bacteria 14192
496 Ga0495615_0048202 3300048090 Unclassified 1088
497 Ga0496100_0033934 3300048903 Bacteria 3197
498 Ga0496100_0041176 3300048903 Bacteria 2943
499 Ga0496100_0078972 3300048903 Bacteria 2216
500 Ga0496100_0151297 3300048903 Bacteria 1655
501 Ga0496101_0002328 3300048904 Bacteria 11634
502 Ga0496101_0017765 3300048904 Bacteria 4826
503 Ga0496101_0039255 3300048904 Bacteria 3366
504 Ga0496101_0068435 3300048904 Bacteria 2596
505 Ga0496101_0072977 3300048904 Unclassified 2520
506 Ga0496101_0112423 3300048904 Bacteria 2051
507 Ga0496101_0131225 3300048904 Unclassified 1903
508 Ga0496102_0005233 3300048905 Bacteria 11011
509 Ga0496102_0015201 3300048905 Bacteria 6700
510 Ga0496102_0029468 3300048905 Bacteria 4911
511 Ga0496102_0123284 3300048905 Bacteria 2421
512 Ga0496102_0331247 3300048905 Bacteria 1434
513 Ga0496103_0012557 3300048906 Bacteria 5023
514 Ga0496103_0012733 3300048906 Bacteria 4989
515 Ga0496103_0030047 3300048906 Bacteria 3305
516 Ga0496103_0074997 3300048906 Bacteria 2121
517 Ga0496103_0284131 3300048906 Archaea 1064
518 Ga0496104_0011721 3300048907 Bacteria 7864
519 Ga0496104_0071352 3300048907 Bacteria 3302
520 Ga0496104_0112972 3300048907 Bacteria 2605
521 Ga0496104_0179912 3300048907 Unclassified 2025
522 Ga0496104_0224622 3300048907 Bacteria 1790
523 Ga0496104_0241826 3300048907 Bacteria 1717
524 Ga0496104_0346175 3300048907 Bacteria 1399
525 Ga0496105_0012905 3300048908 Bacteria 6622
526 Ga0496105_0039714 3300048908 Bacteria 3880
527 Ga0496105_0042911 3300048908 Bacteria 3730
528 Ga0496105_0249752 3300048908 Bacteria 1437
529 Ga0496106_0006885 3300048909 Bacteria 8410
530 Ga0496106_0026307 3300048909 Bacteria 4332
531 Ga0496107_0022718 3300048910 Bacteria 4434
532 Ga0496107_0045062 3300048910 Bacteria 3172
533 Ga0496107_0157642 3300048910 Archaea 1681
534 Ga0496107_0173949 3300048910 Bacteria 1598
535 Ga0496107_0184352 3300048910 Unclassified 1550
536 Ga0496107_0209630 3300048910 Bacteria 1449
537 Ga0496108_0001049 3300048911 Bacteria 21529
538 Ga0496108_0004163 3300048911 Bacteria 11639
539 Ga0496108_0033737 3300048911 Bacteria 4251
540 Ga0496108_0195096 3300048911 Bacteria 1756
541 Ga0496108_0245195 3300048911 Bacteria 1558
542 Ga0496108_0252242 3300048911 Bacteria 1535
543 Ga0496108_0360308 3300048911 Bacteria 1269
544 Ga0496109_0001264 3300048912 Bacteria 21000
545 Ga0496109_0003075 3300048912 Bacteria 13918
546 Ga0496109_0063003 3300048912 Bacteria 3391
547 Ga0496109_0068855 3300048912 Bacteria 3244
548 Ga0496109_0172682 3300048912 Archaea 2028
549 Ga0496109_0201981 3300048912 Unclassified 1869
550 Ga0496109_0591421 3300048912 Bacteria 1046
551 Ga0496110_0002510 3300048913 Bacteria 13781
552 Ga0496110_0049426 3300048913 Bacteria 3689
553 Ga0496110_0058394 3300048913 Bacteria 3398
554 Ga0496111_0001623 3300048914 Bacteria 13021
555 Ga0496111_0020552 3300048914 Bacteria 4597
556 Ga0496111_0035925 3300048914 Bacteria 3543
557 Ga0496111_0055939 3300048914 Bacteria 2854
558 Ga0496111_0061099 3300048914 Bacteria 2732
559 Ga0496112_0001992 3300048915 Bacteria 16159
560 Ga0496112_0022811 3300048915 Bacteria 5973
561 Ga0496112_0324990 3300048915 Unclassified 1482
562 Ga0496113_0012195 3300048916 Bacteria 5769
563 Ga0496113_0036216 3300048916 Bacteria 3614
564 Ga0496113_0083201 3300048916 Bacteria 2455
565 Ga0496113_0491293 3300048916 Bacteria 986
566 Ga0496114_0001590 3300048917 Bacteria 17228
567 Ga0496114_0014614 3300048917 Bacteria 6307
568 Ga0496114_0017636 3300048917 Bacteria 5765
569 Ga0496114_0040087 3300048917 Bacteria 3876
570 Ga0496114_0057517 3300048917 Bacteria 3246
571 Ga0496114_0106978 3300048917 Bacteria 2393
572 Ga0496114_0176422 3300048917 Unclassified 1865
573 Ga0496114_0470532 3300048917 Archaea 1112
574 Ga0496115_0005423 3300048918 Bacteria 9276
575 Ga0496115_0015045 3300048918 Bacteria 5864
576 Ga0496115_0026933 3300048918 Bacteria 4493
577 Ga0496115_0118509 3300048918 Bacteria 2177
578 Ga0496115_0264178 3300048918 Archaea 1415
579 Ga0501031_0025535 3300049568 Bacteria 3852
580 Ga0501031_0025779 3300049568 Bacteria 3836
581 Ga0501031_0153847 3300049568 Bacteria 1503
582 Ga0501032_0036340 3300049569 Bacteria 3362
583 Ga0501033_0015832 3300049570 Bacteria 5714
584 Ga0501036_0011392 3300049572 Bacteria 7360
585 Ga0501036_0018025 3300049572 Bacteria 5911
586 Ga0501036_0028189 3300049572 Bacteria 4748
587 Ga0501036_0044029 3300049572 Bacteria 3780
588 Ga0501036_0099281 3300049572 Bacteria 2462
589 Ga0501037_0024173 3300049573 Bacteria 4493
590 Ga0501037_0028075 3300049573 Bacteria 4156
591 Ga0501038_0067656 3300049574 Bacteria 3038
592 Ga0501038_0103741 3300049574 Bacteria 2364
593 Ga0501038_0316630 3300049574 Bacteria 1221
594 Ga0501039_0010512 3300049575 Bacteria 7054
595 Ga0501039_0069176 3300049575 Bacteria 2741
596 Ga0501039_0087762 3300049575 Unclassified 2423
597 Ga0501040_0011602 3300049576 Bacteria 5768
598 Ga0501040_0015469 3300049576 Bacteria 5041
599 Ga0501040_0059725 3300049576 Bacteria 2620
600 Ga0501040_0072220 3300049576 Bacteria 2383
601 Ga0501040_0131593 3300049576 Unclassified 1759
602 Ga0501041_0006586 3300049577 Bacteria 6802
603 Ga0501041_0014412 3300049577 Unclassified 4694
604 Ga0501041_0036026 3300049577 Bacteria 2999
605 Ga0501041_0036418 3300049577 Bacteria 2981
606 Ga0501042_0021476 3300049578 Bacteria 4500
607 Ga0501042_0032225 3300049578 Bacteria 3710
608 Ga0501042_0151374 3300049578 Bacteria 1673
609 Ga0501042_0343288 3300049578 Bacteria 1079
610 Ga0501043_0023412 3300049579 Bacteria 4844
611 Ga0501043_0070958 3300049579 Bacteria 2736
612 Ga0501046_0021953 3300049580 Bacteria 5261
613 Ga0501046_0037142 3300049580 Bacteria 3915
614 Ga0501046_0114390 3300049580 Unclassified 2058
615 Ga0501046_0125177 3300049580 Bacteria 1953
616 Ga0501047_0042263 3300049581 Bacteria 4405
617 Ga0501047_0195124 3300049581 Unclassified 1887
618 Ga0501048_0006842 3300049582 Bacteria 8662
619 Ga0501048_0075034 3300049582 Bacteria 2385
620 Ga0501048_0145510 3300049582 Bacteria 1676
621 Ga0501048_0244283 3300049582 Unclassified 1274
622 Ga0501067_0099830 3300049583 Bacteria 1612
623 Ga0501068_0017671 3300049584 Bacteria 4126
624 Ga0501068_0064524 3300049584 Bacteria 2229
625 Ga0501068_0178460 3300049584 Unclassified 1342
626 Ga0501068_0295758 3300049584 Archaea 1036
627 Ga0501069_0003998 3300049585 Bacteria 7612
628 Ga0501069_0009267 3300049585 Bacteria 5195
629 Ga0501069_0048048 3300049585 Unclassified 2369
630 Ga0501069_0191228 3300049585 Unclassified 1184
631 Ga0501070_0000463 3300049586 Bacteria 36856
632 Ga0501070_0008965 3300049586 Bacteria 8461
633 Ga0501070_0037460 3300049586 Bacteria 4049
634 Ga0501070_0220077 3300049586 Bacteria 1557
635 Ga0501070_0279859 3300049586 Unclassified 1361
636 Ga0501071_0001633 3300049587 Bacteria 13170
637 Ga0501071_0005316 3300049587 Bacteria 8262
638 Ga0501071_0010776 3300049587 Bacteria 6131
639 Ga0501071_0015215 3300049587 Bacteria 5278
640 Ga0501071_0218536 3300049587 Bacteria 1434
641 Ga0501071_0326288 3300049587 Bacteria 1166
642 Ga0501072_0004430 3300049588 Bacteria 10672
643 Ga0501072_0012942 3300049588 Bacteria 6382
644 Ga0501072_0025240 3300049588 Bacteria 4629
645 Ga0501072_0064725 3300049588 Bacteria 2883
646 Ga0501072_0084774 3300049588 Bacteria 2512
647 Ga0501072_0102940 3300049588 Bacteria 2269
648 Ga0501072_0110372 3300049588 Bacteria 2189
649 Ga0501073_0023917 3300049589 Bacteria 4386
650 Ga0501074_0266465 3300049590 Bacteria 1217
651 Ga0501075_0013771 3300049591 Bacteria 5780
652 Ga0501075_0042726 3300049591 Unclassified 3399
653 Ga0501075_0064604 3300049591 Bacteria 2760
654 Ga0501075_0139400 3300049591 Bacteria 1848
655 Ga0501075_0290930 3300049591 Bacteria 1244
656 Ga0501075_0305132 3300049591 Unclassified 1213
657 Ga0501076_0001355 3300049592 Bacteria 16389
658 Ga0501076_0006095 3300049592 Bacteria 8721
659 Ga0501076_0030833 3300049592 Bacteria 4178
660 Ga0501076_0056359 3300049592 Bacteria 3119
661 Ga0501076_0057549 3300049592 Bacteria 3087
662 Ga0501076_0091582 3300049592 Bacteria 2445
663 Ga0501076_0174261 3300049592 Unclassified 1753
664 Ga0501076_0225087 3300049592 Unclassified 1533
665 Ga0501076_0358816 3300049592 Bacteria 1197
666 Ga0501077_0002034 3300049593 Bacteria 12210
667 Ga0501077_0008596 3300049593 Bacteria 6331
668 Ga0501077_0013622 3300049593 Bacteria 5098
669 Ga0501079_0010820 3300049741 Bacteria 6949
670 Ga0501079_0052703 3300049741 Bacteria 3139
671 Ga0501079_0299023 3300049741 Unclassified 1259
672 Ga0501080_0064086 3300049742 Bacteria 3419
673 Ga0501080_0421310 3300049742 Bacteria 1199
674 Ga0501081_0002437 3300049743 Bacteria 11743
675 Ga0501081_0008222 3300049743 Bacteria 6774
676 Ga0501081_0031038 3300049743 Bacteria 3620
677 Ga0501081_0031067 3300049743 Bacteria 3618
678 Ga0501081_0088525 3300049743 Bacteria 2175
679 Ga0501081_0124829 3300049743 Unclassified 1836
680 Ga0501081_0212005 3300049743 Unclassified 1407
681 Ga0501081_0511919 3300049743 Bacteria 895
682 Ga0501083_0024272 3300049744 Bacteria 4202
683 Ga0501083_0062537 3300049744 Bacteria 2483
684 Ga0501035_0050738 3300049822 Bacteria 3717
685 Ga0501035_0080211 3300049822 Bacteria 2882
686 Ga0501035_0081993 3300049822 Bacteria 2846
687 Ga0501035_0245121 3300049822 Unclassified 1523
688 Ga0501044_0068923 3300049823 Bacteria 3602
689 Ga0501045_0015818 3300049824 Bacteria 5351
690 Ga0501045_0036450 3300049824 Bacteria 3570
691 Ga0501045_0057120 3300049824 Bacteria 2855
692 Ga0501045_0067561 3300049824 Bacteria 2625
693 Ga0501045_0076612 3300049824 Bacteria 2464
694 Ga0501045_0363440 3300049824 Bacteria 1077
695 nmdc:mga00v17_111869_c1 3300050491 Bacteria 1733
696 nmdc:mga00v17_266165_c1 3300050491 Bacteria 1112
697 nmdc:mga0yw44_237102_c1 3300050492 Bacteria 1212
698 nmdc:mga05p37_31823_c1 3300050507 Bacteria 6447
699 nmdc:mga05p37_74528_c1 3300050507 Bacteria 4177
700 nmdc:mga09592_83896_c1 3300050508 Bacteria 2716
701 nmdc:mga06r32_59447_c1 3300050510 Bacteria 1918
702 nmdc:mga08y16_39199_c1 3300050511 Bacteria 4971
703 nmdc:mga08y16_466235_c1 3300050511 Bacteria 1287
704 nmdc:mga08y16_48388_c1 3300050511 Bacteria 4450
705 nmdc:mga08y16_7836_c1 3300050511 Bacteria 11188
706 nmdc:mga0n895_11353_c1 3300050512 Bacteria 7941
707 nmdc:mga0rr50_93717_c1 3300050513 Bacteria 2344
708 nmdc:mga08x19_39226_c1 3300050514 Bacteria 3011
709 nmdc:mga0a205_150221_c1 3300050515 Bacteria 2229
710 nmdc:mga0a205_1575_c1 3300050515 Bacteria 19553
711 nmdc:mga0a205_476264_c1 3300050515 Bacteria 1107
712 nmdc:mga0a205_508747_c1 3300050515 Archaea 1061
713 Ga0495601_0028198 3300053077 Unclassified 3476
714 Ga0495601_0077001 3300053077 Bacteria 2136
715 Ga0495601_0239896 3300053077 Unclassified 1183
716 Ga0495612_0060746 3300053078 Unclassified 1565
717 Ga0495595_0024189 3300053084 Bacteria 2681
718 Ga0495595_0111689 3300053084 Unclassified 1326
719 Ga0495595_0163120 3300053084 Bacteria 1100
720 Ga0495619_0011828 3300053085 Bacteria 5497
721 Ga0495619_0035078 3300053085 Bacteria 3262
722 Ga0495619_0098853 3300053085 Bacteria 1984
723 Ga0495619_0260536 3300053085 Bacteria 1202
724 Ga0501084_0011040 3300054114 Bacteria 7481
725 Ga0501084_0027535 3300054114 Bacteria 4749
726 Ga0501084_0027824 3300054114 Bacteria 4724
727 Ga0501084_0045971 3300054114 Bacteria 3655
728 Ga0501084_0052117 3300054114 Bacteria 3424
729 Ga0501084_0063873 3300054114 Bacteria 3082
730 Ga0590077_029614 3300059426 Bacteria 1191
731 Ga0501082_0015504 3300060353 Bacteria 6560
732 Ga0501082_0038247 3300060353 Bacteria 4139
733 Ga0501082_0065787 3300060353 Bacteria 3121
734 Ga0501082_0147240 3300060353 Bacteria 2044
735 Ga0501082_0210054 3300060353 Bacteria 1693
736 Ga0501082_0250663 3300060353 Bacteria 1541
737 Ga0530510_0056624 3300061734 Bacteria 2832
738 Ga0530510_0057140 3300061734 Bacteria 2819
739 Ga0530510_0065972 3300061734 Unclassified 2623
740 Ga0530510_0297989 3300061734 Unclassified 1206
741 Ga0501082_0718787
742 JGI24739J22299_10011246
743 JGI24743J22301_10001489
744 JGI24738J21930_10004979
745 JGI24738J21930_10018973
746 JGI24744J21845_10010350
747 JGI24742J22300_10002099
748 Ga0070658_10025121
749 Ga0070658_10055976
750 Ga0070658_10292219
751 Ga0070676_10150902
752 Ga0070683_100010645
753 Ga0070683_100011274
754 Ga0070683_100037548
755 Ga0070683_100081876
756 Ga0070683_100095282
757 Ga0070683_100576225
758 Ga0070690_100009736
759 Ga0070670_100042356
760 Ga0070670_100347975
761 Ga0068869_100046017
762 Ga0070680_100003864
763 Ga0070680_100012290
764 Ga0070680_100078877
765 Ga0070682_100005389
766 Ga0070682_100026934
767 Ga0070682_100201417
768 Ga0068868_100023709
769 Ga0068868_100079462
770 Ga0070660_100425589
771 Ga0070689_100010225
772 Ga0070689_100060852
773 Ga0070691_10011914
774 Ga0070687_100074923
775 Ga0070661_100008413
776 Ga0070661_100011485
777 Ga0070692_10014221
778 Ga0070692_10020404
779 Ga0070668_100010845
780 Ga0070668_100088306
781 Ga0070668_100157338
782 Ga0070669_100116514
783 Ga0070675_100082178
784 Ga0070675_100125061
785 Ga0070671_100073534
786 Ga0070671_100087563
787 Ga0070674_100004917
788 Ga0070674_100048705
789 Ga0070674_100058022
790 Ga0070674_100065278
791 Ga0070673_100187733
792 Ga0070688_100017320
793 Ga0070659_100047707
794 Ga0070659_100090699
795 Ga0070659_100164871
796 Ga0070659_100168785
797 Ga0070667_100145761
798 Ga0070703_10005780
799 Ga0070709_10218951
800 Ga0070709_10302454
801 Ga0070710_10017974
802 Ga0070701_10002028
803 Ga0070701_10173381
804 Ga0070711_100000778
805 Ga0070711_100050323
806 Ga0070705_100012577
807 Ga0070700_100004283
808 Ga0070694_100055758
809 Ga0070708_100056964
810 Ga0070663_100038450
811 Ga0070678_100010583
812 Ga0070678_100120725
813 Ga0070662_100005776
814 Ga0070662_100097469
815 Ga0070681_10003855
816 Ga0070681_10045244
817 Ga0070681_10087127
818 Ga0068867_100026250
819 Ga0068867_100363868
820 Ga0070685_10007351
821 Ga0070685_10035833
822 Ga0070707_100643592
823 Ga0070698_100005716
824 Ga0070699_100078153
825 Ga0070699_100127927
826 Ga0070679_100042942
827 Ga0070679_100084145
828 Ga0070684_100012808
829 Ga0070684_100120477
830 Ga0070684_100194283
831 Ga0068853_100009478
832 Ga0068853_100178013
833 Ga0068853_100263725
834 Ga0070672_100040145
835 Ga0070696_100026401
836 Ga0070693_100027437
837 Ga0070693_100059705
838 Ga0070693_100167509
839 Ga0070665_100160278
840 Ga0070704_100006800
841 Ga0070704_100126301
842 Ga0068855_100112091
843 Ga0068855_100153220
844 Ga0070664_100001655
845 Ga0070664_100076158
846 Ga0070664_100175449
847 Ga0070664_100397718
848 Ga0068857_100207853
849 Ga0068854_100221324
850 Ga0068856_100028879
851 Ga0068856_100037505
852 Ga0070702_100007827
853 Ga0070702_100043566
854 Ga0068852_100043332
855 Ga0068852_100078184
856 Ga0068852_100079567
857 Ga0068852_100084050
858 Ga0068852_100107007
859 Ga0068859_100153008
860 Ga0068864_100036679
861 Ga0068864_100211124
862 Ga0068861_100092806
863 Ga0068861_100125460
864 Ga0068861_100566068
865 Ga0068851_10016932
866 Ga0068870_10067545
867 Ga0068863_100033487
868 Ga0068860_100031873
869 Ga0068860_100101724
870 Ga0081455_10008516
871 Ga0081455_10019638
872 Ga0081455_10033510
873 Ga0081539_10000712
874 Ga0081539_10136213
875 Ga0075364_10051124
876 Ga0075432_10002694
877 Ga0075432_10008665
878 Ga0075432_10016054
879 Ga0070715_10072860
880 Ga0070715_10170560
881 Ga0070716_100216923
882 Ga0070712_100046450
883 Ga0070712_100067562
884 Ga0070712_100299083
885 Ga0097621_100047946
886 Ga0097621_100116997
887 Ga0097621_100547817
888 Ga0068871_100024236
889 Ga0068871_100028513
890 Ga0068871_100062935
891 Ga0068871_100130492
892 Ga0075428_100000942
893 Ga0075431_100017672
894 Ga0075433_10012982
895 Ga0075434_100139867
896 Ga0075429_100006563
897 Ga0068865_100006538
898 Ga0068865_100014818
899 Ga0068865_100054806
900 Ga0075436_100045219
901 Ga0097620_100153009
902 Ga0075435_100010187
903 Ga0105240_10106750
904 Ga0111539_10005668
905 Ga0111539_10008986
906 Ga0111539_10061471
907 Ga0111539_10107842
908 Ga0111539_10780055
909 Ga0105245_10002722
910 Ga0105245_10003740
911 Ga0105245_10011716
912 Ga0105245_10030952
913 Ga0105245_10086760
914 Ga0105245_10123199
915 Ga0114129_10006031
916 Ga0114129_10006732
917 Ga0114129_10231371
918 Ga0105243_10019092
919 Ga0105243_10022765
920 Ga0105243_10029094
921 Ga0105243_10035934
922 Ga0105243_10381014
923 Ga0105243_10426742
924 Ga0105242_10002896
925 Ga0105242_10025238
926 Ga0105242_10476757
927 Ga0105248_10007689
928 Ga0105248_10147107
929 Ga0105248_10147113
930 Ga0105248_10305267
931 Ga0105237_10247575
932 Ga0105238_10037087
933 Ga0105238_10375838
934 Ga0105249_10004111
935 Ga0105249_10157113
936 Ga0105249_10414713
937 Ga0105239_10004419
938 Ga0105239_10033163
939 Ga0105239_10055548
940 Ga0105246_10005688
941 Ga0105246_10085070
942 Ga0157373_10143881
943 Ga0157371_10010321
944 Ga0157371_10117162
945 Ga0157371_10138521
946 Ga0157370_10166912
947 Ga0157369_10031662
948 Ga0157369_10218605
949 Ga0157369_10426035
950 Ga0157374_10006575
951 Ga0163162_10039731
952 Ga0163162_10104233
953 Ga0163162_10159702
954 Ga0163162_10166169
955 Ga0157372_10006446
956 Ga0157372_10016007
957 Ga0157372_10227194
958 Ga0157372_10384281
959 Ga0157375_10023531
960 Ga0157375_10103461
961 Ga0157375_10169654
962 Ga0157375_10449341
963 Ga0157375_10945666
964 Ga0163163_10159741
965 Ga0163163_10445551
966 Ga0157380_10037797
967 Ga0157380_10050383
968 Ga0157380_10459036
969 Ga0157377_10007022
970 Ga0157377_10013079
971 Ga0157377_10068137
972 Ga0157379_10067408
973 Ga0157376_10011146
974 Ga0157376_10034780
975 Ga0157376_10169969
976 Ga0157376_10345258
977 Ga0157376_10633535
978 Ga0163161_10087346
979 Ga0163161_10218883
980 Ga0206353_10640569
981 Ga0224712_10076538
982 Ga0207653_10007128
983 Ga0207692_10014959
984 Ga0207642_10017208
985 Ga0207688_10018141
986 Ga0207647_10055787
987 Ga0207699_10078398
988 Ga0207699_10109794
989 Ga0207645_10137393
990 Ga0207643_10015732
991 Ga0207643_10158919
992 Ga0207705_10099972
993 Ga0207705_10130681
994 Ga0207654_10171124
995 Ga0207707_10020297
996 Ga0207695_10047042
997 Ga0207693_10010927
998 Ga0207693_10071413
999 Ga0207693_10085853
1000 Ga0207693_10284094
1001 Ga0207663_10026556
1002 Ga0207660_10052625
1003 Ga0207660_10190249
1004 Ga0207662_10034397
1005 Ga0207662_10117577
1006 Ga0207657_10010086
1007 Ga0207657_10053270
1008 Ga0207657_10136263
1009 Ga0207657_10369038
1010 Ga0207649_10047442
1011 Ga0207649_10298527
1012 Ga0207652_10295645
1013 Ga0207694_10099848
1014 Ga0207659_10030066
1015 Ga0207659_10286411
1016 Ga0207687_10050998
1017 Ga0207687_10059790
1018 Ga0207687_10106637
1019 Ga0207687_10125509
1020 Ga0207700_10170456
1021 Ga0207644_10062299
1022 Ga0207644_10120843
1023 Ga0207690_10070781
1024 Ga0207690_10099725
1025 Ga0207690_10237437
1026 Ga0207706_10038276
1027 Ga0207706_10048645
1028 Ga0207706_10145350
1029 Ga0207686_10007462
1030 Ga0207686_10031563
1031 Ga0207686_10068351
1032 Ga0207709_10004231
1033 Ga0207709_10034834
1034 Ga0207709_10035388
1035 Ga0207670_10138682
1036 Ga0207669_10014759
1037 Ga0207669_10211339
1038 Ga0207669_10402428
1039 Ga0207704_10007862
1040 Ga0207704_10078028
1041 Ga0207704_10096155
1042 Ga0207665_10011957
1043 Ga0207665_10062245
1044 Ga0207691_10009495
1045 Ga0207691_10019977
1046 Ga0207691_10104323
1047 Ga0207691_10136579
1048 Ga0207691_10423099
1049 Ga0207711_10052951
1050 Ga0207711_10121958
1051 Ga0207711_10183204
1052 Ga0207689_10124158
1053 Ga0207661_10000273
1054 Ga0207661_10030244
1055 Ga0207661_10059962
1056 Ga0207661_10083062
1057 Ga0207679_10011244
1058 Ga0207679_10082372
1059 Ga0207679_10318358
1060 Ga0207667_10122950
1061 Ga0207667_10177122
1062 Ga0207667_10426227
1063 Ga0207651_10144877
1064 Ga0207712_10005182
1065 Ga0207712_10128430
1066 Ga0207668_10068533
1067 Ga0207668_10132156
1068 Ga0207640_10005036
1069 Ga0207640_10059396
1070 Ga0207658_10004151
1071 Ga0207677_10015516
1072 Ga0207677_10142865
1073 Ga0207639_10041361
1074 Ga0207678_10033959
1075 Ga0207678_10047340
1076 Ga0207708_10001826
1077 Ga0207708_10029676
1078 Ga0207708_10091870
1079 Ga0207702_10028163
1080 Ga0207641_10140396
1081 Ga0207648_10000504
1082 Ga0207648_10133134
1083 Ga0207648_10156463
1084 Ga0207648_10193423
1085 Ga0207676_10184999
1086 Ga0207676_10194894
1087 Ga0207674_10044028
1088 Ga0207674_10136767
1089 Ga0207675_100027437
1090 Ga0207675_100038087
1091 Ga0207675_100340004
1092 Ga0207683_10001483
1093 Ga0207683_10052152
1094 Ga0207683_10072940
1095 Ga0207683_10236265
1096 Ga0207698_10015478
1097 Ga0207698_10104049
1098 Ga0207698_10230143
1099 Ga0207698_10563697
1100 Ga0207428_10000222
1101 Ga0207428_10010823
1102 Ga0207428_10063181
1103 Ga0268266_10210584
1104 Ga0268265_10260636
1105 Ga0268264_10126903
1106 Ga0265337_1067712
1107 Ga0265319_1016801
1108 Ga0265318_10022513
1109 Ga0265338_10132985
1110 Ga0265320_10036069
1111 Ga0265327_10007879
1112 Ga0307416_100005871
1113 Ga0307416_100075003
1114 Ga0307415_100007073
1115 Ga0373958_0033953
1116 Ga0373926_0035641
1117 Ga0373941_0042587
1118 Ga0373941_0055561
1119 Ga0373943_0002579
1120 Ga0373946_0014784
1121 Ga0373961_0009431
1122 Ga0373962_0008415
1123 Ga0373931_0033478
1124 Ga0373947_0019921
1125 Ga0373925_0075236
1126 Ga0395900_0015005
1127 Ga0395900_0368717
1128 Ga0395898_0016145
1129 Ga0395898_0163407
1130 Ga0395898_0231517
1131 Ga0395898_0383501
1132 Ga0395905_0177317
1133 Ga0395905_0339521
1134 Ga0395905_0484893
1135 Ga0395901_0112921
1136 Ga0395901_0244751
1137 Ga0395901_0688630
1138 Ga0451807_1862518
1139 Ga0439441_002460
1140 Ga0439448_0055586
1141 Ga0439449_0056392
1142 Ga0439450_037602
1143 Ga0439462_0000831
1144 Ga0439446_0004313
1145 Ga0439464_0069137
1146 Ga0466966_0100587
1147 Ga0466961_0139218
1148 Ga0466967_0006293
1149 Ga0466967_0237480
1150 Ga0495592_0133474
1151 Ga0495592_0210571
1152 Ga0495603_0018540
1153 Ga0495603_0150082
1154 Ga0495603_0211385
1155 Ga0495603_0307403
1156 Ga0495629_0001622
1157 Ga0495629_0069147
1158 Ga0495629_0176166
1159 Ga0495641_0001841
1160 Ga0495641_0043195
1161 Ga0495641_0151683
1162 Ga0495651_0018214
1163 Ga0495651_0064146
1164 Ga0495653_0011544
1165 Ga0495653_0036570
1166 Ga0495653_0092426
1167 Ga0495653_0110420
1168 Ga0495582_0000462
1169 Ga0495582_0062724
1170 Ga0495582_0184382
1171 Ga0495639_0005703
1172 Ga0495639_0042675
1173 Ga0495662_0004015
1174 Ga0495664_0202267
1175 Ga0495664_0204437
1176 Ga0495594_0035267
1177 Ga0495594_0053503
1178 Ga0495594_0150479
1179 Ga0495596_0084159
1180 Ga0495608_0039817
1181 Ga0495608_0158081
1182 Ga0495628_0084657
1183 Ga0495628_0217698
1184 Ga0495630_0054489
1185 Ga0495630_0057723
1186 Ga0495663_0040333
1187 Ga0495666_0017424
1188 Ga0495652_0085313
1189 Ga0495665_0003126
1190 Ga0495640_0004048
1191 Ga0495640_0152438
1192 Ga0495609_0114212
1193 Ga0495645_0085532
1194 Ga0495667_0017056
1195 Ga0495667_0040061
1196 Ga0495656_0160861
1197 Ga0495668_0131518
1198 Ga0495668_0249142
1199 Ga0495634_0030484
1200 Ga0495634_0085694
1201 Ga0495634_0098162
1202 Ga0495635_0023025
1203 Ga0495635_0031947
1204 Ga0495659_0030922
1205 Ga0495588_0164601
1206 Ga0495646_0030015
1207 Ga0495646_0067604
1208 Ga0495647_0009375
1209 Ga0495647_0028537
1210 Ga0495658_0001666
1211 Ga0495613_0026261
1212 Ga0495624_0099534
1213 Ga0495589_0027915
1214 Ga0495600_0035044
1215 Ga0495600_0172318
1216 Ga0495660_0069317
1217 Ga0495581_0002858
1218 Ga0495581_0019449
1219 Ga0495604_0040214
1220 Ga0495604_0055131
1221 Ga0495604_0232939
1222 Ga0495636_0056551
1223 Ga0495674_0005229
1224 Ga0495674_0039532
1225 Ga0495676_0005860
1226 Ga0495676_0217889
1227 Ga0495680_0002784
1228 Ga0495680_0011900
1229 Ga0495680_0029654
1230 Ga0495680_0050977
1231 Ga0495675_0046591
1232 Ga0495685_067833
1233 Ga0495684_0045963
1234 Ga0495684_0135463
1235 Ga0495593_0001385
1236 Ga0495615_0048202
1237 Ga0496100_0033934
1238 Ga0496100_0041176
1239 Ga0496100_0078972
1240 Ga0496100_0151297
1241 Ga0496101_0002328
1242 Ga0496101_0017765
1243 Ga0496101_0039255
1244 Ga0496101_0068435
1245 Ga0496101_0072977
1246 Ga0496101_0112423
1247 Ga0496101_0131225
1248 Ga0496102_0005233
1249 Ga0496102_0015201
1250 Ga0496102_0029468
1251 Ga0496102_0123284
1252 Ga0496102_0331247
1253 Ga0496103_0012557
1254 Ga0496103_0012733
1255 Ga0496103_0030047
1256 Ga0496103_0074997
1257 Ga0496103_0284131
1258 Ga0496104_0011721
1259 Ga0496104_0071352
1260 Ga0496104_0112972
1261 Ga0496104_0179912
1262 Ga0496104_0224622
1263 Ga0496104_0241826
1264 Ga0496104_0346175
1265 Ga0496105_0012905
1266 Ga0496105_0039714
1267 Ga0496105_0042911
1268 Ga0496105_0249752
1269 Ga0496106_0006885
1270 Ga0496106_0026307
1271 Ga0496107_0022718
1272 Ga0496107_0045062
1273 Ga0496107_0157642
1274 Ga0496107_0173949
1275 Ga0496107_0184352
1276 Ga0496107_0209630
1277 Ga0496108_0001049
1278 Ga0496108_0004163
1279 Ga0496108_0033737
1280 Ga0496108_0195096
1281 Ga0496108_0245195
1282 Ga0496108_0252242
1283 Ga0496108_0360308
1284 Ga0496109_0001264
1285 Ga0496109_0003075
1286 Ga0496109_0063003
1287 Ga0496109_0068855
1288 Ga0496109_0172682
1289 Ga0496109_0201981
1290 Ga0496109_0591421
1291 Ga0496110_0002510
1292 Ga0496110_0049426
1293 Ga0496110_0058394
1294 Ga0496111_0001623
1295 Ga0496111_0020552
1296 Ga0496111_0035925
1297 Ga0496111_0055939
1298 Ga0496111_0061099
1299 Ga0496112_0001992
1300 Ga0496112_0022811
1301 Ga0496112_0324990
1302 Ga0496113_0012195
1303 Ga0496113_0036216
1304 Ga0496113_0083201
1305 Ga0496113_0491293
1306 Ga0496114_0001590
1307 Ga0496114_0014614
1308 Ga0496114_0017636
1309 Ga0496114_0040087
1310 Ga0496114_0057517
1311 Ga0496114_0106978
1312 Ga0496114_0176422
1313 Ga0496114_0470532
1314 Ga0496115_0005423
1315 Ga0496115_0015045
1316 Ga0496115_0026933
1317 Ga0496115_0118509
1318 Ga0496115_0264178
1319 Ga0501031_0025535
1320 Ga0501031_0025779
1321 Ga0501031_0153847
1322 Ga0501032_0036340
1323 Ga0501033_0015832
1324 Ga0501036_0011392
1325 Ga0501036_0018025
1326 Ga0501036_0028189
1327 Ga0501036_0044029
1328 Ga0501036_0099281
1329 Ga0501037_0024173
1330 Ga0501037_0028075
1331 Ga0501038_0067656
1332 Ga0501038_0103741
1333 Ga0501038_0316630
1334 Ga0501039_0010512
1335 Ga0501039_0069176
1336 Ga0501039_0087762
1337 Ga0501040_0011602
1338 Ga0501040_0015469
1339 Ga0501040_0059725
1340 Ga0501040_0072220
1341 Ga0501040_0131593
1342 Ga0501041_0006586
1343 Ga0501041_0014412
1344 Ga0501041_0036026
1345 Ga0501041_0036418
1346 Ga0501042_0021476
1347 Ga0501042_0032225
1348 Ga0501042_0151374
1349 Ga0501042_0343288
1350 Ga0501043_0023412
1351 Ga0501043_0070958
1352 Ga0501046_0021953
1353 Ga0501046_0037142
1354 Ga0501046_0114390
1355 Ga0501046_0125177
1356 Ga0501047_0042263
1357 Ga0501047_0195124
1358 Ga0501048_0006842
1359 Ga0501048_0075034
1360 Ga0501048_0145510
1361 Ga0501048_0244283
1362 Ga0501067_0099830
1363 Ga0501068_0017671
1364 Ga0501068_0064524
1365 Ga0501068_0178460
1366 Ga0501068_0295758
1367 Ga0501069_0003998
1368 Ga0501069_0009267
1369 Ga0501069_0048048
1370 Ga0501069_0191228
1371 Ga0501070_0000463
1372 Ga0501070_0008965
1373 Ga0501070_0037460
1374 Ga0501070_0220077
1375 Ga0501070_0279859
1376 Ga0501071_0001633
1377 Ga0501071_0005316
1378 Ga0501071_0010776
1379 Ga0501071_0015215
1380 Ga0501071_0218536
1381 Ga0501071_0326288
1382 Ga0501072_0004430
1383 Ga0501072_0012942
1384 Ga0501072_0025240
1385 Ga0501072_0064725
1386 Ga0501072_0084774
1387 Ga0501072_0102940
1388 Ga0501072_0110372
1389 Ga0501073_0023917
1390 Ga0501074_0266465
1391 Ga0501075_0013771
1392 Ga0501075_0042726
1393 Ga0501075_0064604
1394 Ga0501075_0139400
1395 Ga0501075_0290930
1396 Ga0501075_0305132
1397 Ga0501076_0001355
1398 Ga0501076_0006095
1399 Ga0501076_0030833
1400 Ga0501076_0056359
1401 Ga0501076_0057549
1402 Ga0501076_0091582
1403 Ga0501076_0174261
1404 Ga0501076_0225087
1405 Ga0501076_0358816
1406 Ga0501077_0002034
1407 Ga0501077_0008596
1408 Ga0501077_0013622
1409 Ga0501079_0010820
1410 Ga0501079_0052703
1411 Ga0501079_0299023
1412 Ga0501080_0064086
1413 Ga0501080_0421310
1414 Ga0501081_0002437
1415 Ga0501081_0008222
1416 Ga0501081_0031038
1417 Ga0501081_0031067
1418 Ga0501081_0088525
1419 Ga0501081_0124829
1420 Ga0501081_0212005
1421 Ga0501081_0511919
1422 Ga0501083_0024272
1423 Ga0501083_0062537
1424 Ga0501035_0050738
1425 Ga0501035_0080211
1426 Ga0501035_0081993
1427 Ga0501035_0245121
1428 Ga0501044_0068923
1429 Ga0501045_0015818
1430 Ga0501045_0036450
1431 Ga0501045_0057120
1432 Ga0501045_0067561
1433 Ga0501045_0076612
1434 Ga0501045_0363440
1435 nmdc:mga00v17_111869_c1
1436 nmdc:mga00v17_266165_c1
1437 nmdc:mga0yw44_237102_c1
1438 nmdc:mga05p37_31823_c1
1439 nmdc:mga05p37_74528_c1
1440 nmdc:mga09592_83896_c1
1441 nmdc:mga06r32_59447_c1
1442 nmdc:mga08y16_39199_c1
1443 nmdc:mga08y16_466235_c1
1444 nmdc:mga08y16_48388_c1
1445 nmdc:mga08y16_7836_c1
1446 nmdc:mga0n895_11353_c1
1447 nmdc:mga0rr50_93717_c1
1448 nmdc:mga08x19_39226_c1
1449 nmdc:mga0a205_150221_c1
1450 nmdc:mga0a205_1575_c1
1451 nmdc:mga0a205_476264_c1
1452 nmdc:mga0a205_508747_c1
1453 Ga0495601_0028198
1454 Ga0495601_0077001
1455 Ga0495601_0239896
1456 Ga0495612_0060746
1457 Ga0495595_0024189
1458 Ga0495595_0111689
1459 Ga0495595_0163120
1460 Ga0495619_0011828
1461 Ga0495619_0035078
1462 Ga0495619_0098853
1463 Ga0495619_0260536
1464 Ga0501084_0011040
1465 Ga0501084_0027535
1466 Ga0501084_0027824
1467 Ga0501084_0045971
1468 Ga0501084_0052117
1469 Ga0501084_0063873
1470 Ga0590077_029614
1471 Ga0501082_0015504
1472 Ga0501082_0038247
1473 Ga0501082_0065787
1474 Ga0501082_0147240
1475 Ga0501082_0210054
1476 Ga0501082_0250663
1477 Ga0530510_0056624
1478 Ga0530510_0057140
1479 Ga0530510_0065972
1480 Ga0530510_0297989

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pc1-assembly2.cif.gz_D crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp 0.6102 82 272
6pc0-assembly1.cif.gz_B crystal structure of helicobacter pylori ppx/gppa 0.6094 83 272
2pq7-assembly1.cif.gz_A-2 crystal structure of predicted hd superfamily hydrolase (104161995) from uncultured thermotogales bacterium at 1.45 a resolution 0.5728 25 202
6pc1-assembly2.cif.gz_C crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp 0.5614 64 272
5yim-assembly1.cif.gz_A structure of a legionella effector 0.5382 53 203
ID Description Score Start End Superfamily
af_Q58426_28_188_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9422 58 216 1.10.3210.10
af_Q58426_28_188_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9254 58 216 1.10.3210.10
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5779 41 247 1.10.3210.10
af_Q59066_3_118_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.565 118 219 1.10.3210.10
af_Q59066_3_118_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5074 118 219 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2H9NVM2-F1-model_v4 Phosphohydrolase 0.9751 34 179 GO:0016787
AF-A0A2H9NVM2-F1-model_v4 Phosphohydrolase 0.9686 34 179 GO:0016787
AF-A0A3D4FYF8-F1-model_v4 Phosphohydrolase 0.959 39 209 GO:0016787
AF-A0A497N2Z9-F1-model_v4 HD domain-containing protein 0.9487 42 182
AF-X0VKY6-F1-model_v4 HD/PDEase domain-containing protein 0.9482 34 272

Map