F478600

General Info

Members Datasets Scaffolds Average Seq Length
741 286 650 230

Family's Representative Sequence

Representative Sequence 3300042137|Ga0450902_000126|Ga0450902_000126_2101_2853
Length 250
Sequence MKMTMAMESDLMKALMVMASLLLLGGCATDGQAPWTTMLAPASCSKLSSEQELSLNLADDLVNDGKLHASLANLQSLPDNLVEVRLRKAKVYRLLGRSEAEPLYRSLLGTCLNADAEHGLGQLYAARGDNGQAQAHLQRAARLAPTNENIRNDLGVVYLNQLRLEDARFEFLTAIELKQNNQLATLNLVTLLLYQNNWQQAAEVVSRAHLTPEQFSDAQERAEKLKSPVRARPVAGNQVAVAIDAQPAIK

Samples

Sample ID Description Type Environment
1 2511231010 Pseudomonas sp. GM25 Isolate Nodule
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2511231031 Pseudomonas sp. GM16 Isolate Nodule
6 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
7 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
8 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
9 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
10 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
11 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
12 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
13 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
14 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
15 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
16 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
17 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
18 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
19 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
20 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
21 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
22 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
23 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
24 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
25 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
26 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
27 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
28 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
29 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
30 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
31 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
32 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
33 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
34 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
35 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
36 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
37 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
38 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
39 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
40 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
41 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
42 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
43 2773857673 Pseudomonas sp. 443 Isolate Unclassified
44 2784132063 Pseudomonas sp. 424 Isolate Unclassified
45 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
46 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
47 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
48 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
49 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
50 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
51 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
52 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
53 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
54 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
55 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
56 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
57 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
58 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
59 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
60 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
61 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
62 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
63 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
64 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
65 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
66 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
67 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
68 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
69 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
70 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
71 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
72 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
73 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
74 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
75 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
76 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
77 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
78 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
79 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
80 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
81 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
82 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
83 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
84 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
85 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
86 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
87 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
88 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
89 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
90 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
91 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
161 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
165 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
166 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
167 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
168 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
171 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
172 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
173 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
174 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
175 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
176 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
177 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
178 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
179 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
180 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
183 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
269 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
270 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
271 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
274 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
275 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
276 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
277 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
278 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
279 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
280 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
281 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
282 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
283 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
284 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
285 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
286 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.37
Nodule 1.08
Rhizoplane 4.32
Rhizosphere 78.27
Stem 0
Stem Tuber 0
Unclassified 12.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000195 3300002737 Bacteria 63625
2 JGI25163J39215_1000123 3300002771 Bacteria 32339
3 JGI25164J39214_1000225 3300002772 Bacteria 44028
4 JGI25165J46597_1000291 3300003214 Bacteria 63625
5 Ga0055536_1000299 3300003781 Bacteria 37245
6 Ga0055536_1002690 3300003781 Bacteria 9864
7 Ga0055530_10000340 3300003791 Bacteria 42245
8 Ga0055540_1000162 3300003792 Bacteria 66694
9 Ga0055531_10000734 3300003794 Bacteria 27738
10 Ga0065714_10005355 3300005288 Bacteria 4141
11 Ga0065714_10064550 3300005288 Bacteria 37462
12 Ga0065714_10095920 3300005288 Bacteria 1774
13 Ga0065704_10101121 3300005289 Bacteria 2249
14 Ga0065712_10091402 3300005290 Bacteria 2375
15 Ga0070670_100001980 3300005331 Bacteria 16755
16 Ga0070669_100000487 3300005353 Bacteria 30089
17 Ga0070669_100000956 3300005353 Bacteria 21096
18 Ga0070662_100000137 3300005457 Bacteria 41312
19 Ga0070662_100014133 3300005457 Bacteria 5327
20 Ga0068853_100003083 3300005539 Bacteria 12733
21 Ga0070665_100044833 3300005548 Bacteria 4440
22 Ga0070665_100180913 3300005548 Bacteria 2109
23 Ga0070664_100004017 3300005564 Bacteria 11813
24 Ga0068854_100052077 3300005578 Bacteria 2934
25 Ga0068851_10000004 3300005834 Bacteria 269685
26 Ga0075363_100195622 3300006048 Bacteria 1154
27 Ga0075364_10023533 3300006051 Bacteria 3901
28 Ga0075432_10001534 3300006058 Bacteria 7573
29 Ga0079104_1008163 3300006946 Bacteria 3701
30 Ga0105251_10000378 3300009011 Bacteria 43722
31 Ga0105251_10001590 3300009011 Bacteria 19393
32 Ga0105251_10002232 3300009011 Bacteria 15456
33 Ga0105251_10002448 3300009011 Bacteria 14586
34 Ga0105251_10004027 3300009011 Bacteria 10360
35 Ga0105251_10005274 3300009011 Bacteria 8502
36 Ga0105251_10011087 3300009011 Bacteria 5170
37 Ga0105251_10011613 3300009011 Bacteria 5025
38 Ga0105251_10025992 3300009011 Bacteria 2986
39 Ga0105251_10195102 3300009011 Bacteria 912
40 Ga0105244_10001726 3300009036 Bacteria 17210
41 Ga0105244_10003786 3300009036 Bacteria 10673
42 Ga0105244_10012893 3300009036 Bacteria 4919
43 Ga0105244_10029320 3300009036 Bacteria 2943
44 Ga0105244_10134580 3300009036 Bacteria 1191
45 Ga0105250_10001060 3300009092 Bacteria 15713
46 Ga0105250_10001756 3300009092 Bacteria 11420
47 Ga0105250_10002278 3300009092 Bacteria 9754
48 Ga0105250_10015196 3300009092 Bacteria 3154
49 Ga0105250_10015343 3300009092 Bacteria 3137
50 Ga0105250_10015500 3300009092 Bacteria 3121
51 Ga0105243_10000225 3300009148 Bacteria 65179
52 Ga0105243_10001399 3300009148 Bacteria 21339
53 Ga0105243_10051250 3300009148 Bacteria 3264
54 Ga0105248_10013078 3300009177 Bacteria 9140
55 Ga0105239_10367155 3300010375 Bacteria 1626
56 Ga0105246_10000388 3300011119 Bacteria 23524
57 Ga0105246_10001581 3300011119 Bacteria 13546
58 Ga0105246_10005439 3300011119 Bacteria 7759
59 Ga0157345_1000032 3300012498 Bacteria 34992
60 Ga0157373_10000478 3300013100 Bacteria 31776
61 Ga0157373_10000520 3300013100 Bacteria 30210
62 Ga0157373_10000957 3300013100 Bacteria 22395
63 Ga0157373_10001143 3300013100 Bacteria 20374
64 Ga0157373_10003846 3300013100 Bacteria 11351
65 Ga0157373_10004155 3300013100 Bacteria 10919
66 Ga0157373_10041792 3300013100 Bacteria 3279
67 Ga0157373_10063759 3300013100 Bacteria 2609
68 Ga0157371_10001273 3300013102 Bacteria 26580
69 Ga0157371_10002656 3300013102 Bacteria 16922
70 Ga0157371_10004342 3300013102 Bacteria 12430
71 Ga0157371_10012005 3300013102 Bacteria 6640
72 Ga0157370_10056395 3300013104 Bacteria 3739
73 Ga0157370_10124707 3300013104 Bacteria 2404
74 Ga0157370_10252986 3300013104 Bacteria 1629
75 Ga0157370_10297740 3300013104 Bacteria 1489
76 Ga0157369_10001544 3300013105 Bacteria 28184
77 Ga0157369_10002672 3300013105 Bacteria 21260
78 Ga0157369_10009425 3300013105 Bacteria 11160
79 Ga0157369_10025492 3300013105 Bacteria 6566
80 Ga0157369_10089566 3300013105 Bacteria 3285
81 Ga0157369_10093228 3300013105 Bacteria 3215
82 Ga0163162_10000902 3300013306 Bacteria 27672
83 Ga0163162_10001902 3300013306 Bacteria 19672
84 Ga0163162_10027322 3300013306 Bacteria 5643
85 Ga0163162_10079639 3300013306 Bacteria 3342
86 Ga0163162_10109707 3300013306 Bacteria 2856
87 Ga0157372_10001315 3300013307 Bacteria 26899
88 Ga0157375_10030722 3300013308 Bacteria 5069
89 Ga0157375_10421181 3300013308 Bacteria 1501
90 Ga0182008_10000453 3300014497 Bacteria 31306
91 Ga0182008_10002063 3300014497 Bacteria 12875
92 Ga0182008_10002202 3300014497 Bacteria 12361
93 Ga0182008_10003707 3300014497 Bacteria 9113
94 Ga0182008_10003797 3300014497 Bacteria 8976
95 Ga0182006_1000793 3300015261 Bacteria 21248
96 Ga0182006_1001453 3300015261 Bacteria 14278
97 Ga0182006_1019703 3300015261 Bacteria 2837
98 Ga0182006_1062786 3300015261 Bacteria 1397
99 Ga0182006_1089673 3300015261 Bacteria 1108
100 Ga0182006_1089847 3300015261 Bacteria 1107
101 Ga0182006_1098899 3300015261 Bacteria 1038
102 Ga0182007_10000283 3300015262 Bacteria 33739
103 Ga0182007_10056599 3300015262 Bacteria 1288
104 Ga0182005_1014025 3300015265 Bacteria 2248
105 Ga0182005_1053790 3300015265 Bacteria 1096
106 Ga0182005_1055009 3300015265 Bacteria 1084
107 Ga0163161_10002587 3300017792 Bacteria 12909
108 Ga0163161_10002849 3300017792 Bacteria 12268
109 Ga0163161_10004085 3300017792 Bacteria 10210
110 Ga0163161_10006965 3300017792 Bacteria 7815
111 Ga0163161_10010903 3300017792 Bacteria 6301
112 Ga0163161_10018631 3300017792 Bacteria 4866
113 Ga0163161_10037911 3300017792 Bacteria 3455
114 Ga0163161_10234423 3300017792 Bacteria 1425
115 Ga0163161_10281818 3300017792 Bacteria 1304
116 Ga0163161_10292061 3300017792 Bacteria 1282
117 Ga0209760_100031 3300025207 Bacteria 141487
118 Ga0209563_101022 3300025230 Bacteria 8139
119 Ga0207427_100067 3300025231 Bacteria 164839
120 Ga0209437_100016 3300025233 Bacteria 710118
121 Ga0209233_1000156 3300025261 Bacteria 164839
122 Ga0209675_1008238 3300025291 Bacteria 3864
123 Ga0209676_1000025 3300025292 Bacteria 577569
124 Ga0209676_1000426 3300025292 Bacteria 73938
125 Ga0209050_1000500 3300025298 Bacteria 66746
126 Ga0209051_1000089 3300025303 Bacteria 175572
127 Ga0209257_1000034 3300025304 Bacteria 662719
128 Ga0207656_10000007 3300025321 Bacteria 289154
129 Ga0207696_1000085 3300025711 Bacteria 195968
130 Ga0207696_1000494 3300025711 Bacteria 33110
131 Ga0207696_1002204 3300025711 Bacteria 9758
132 Ga0207696_1014255 3300025711 Bacteria 2734
133 Ga0207696_1022429 3300025711 Bacteria 2006
134 Ga0207655_1000946 3300025728 Bacteria 30094
135 Ga0207655_1002034 3300025728 Bacteria 17088
136 Ga0207655_1002631 3300025728 Bacteria 14222
137 Ga0207655_1013895 3300025728 Bacteria 4589
138 Ga0207713_1000323 3300025735 Bacteria 54106
139 Ga0207713_1000494 3300025735 Bacteria 40630
140 Ga0207713_1000540 3300025735 Bacteria 37977
141 Ga0207713_1001743 3300025735 Bacteria 16708
142 Ga0207713_1001804 3300025735 Bacteria 16362
143 Ga0207713_1002389 3300025735 Bacteria 13716
144 Ga0207713_1004120 3300025735 Bacteria 9571
145 Ga0207713_1007421 3300025735 Bacteria 6472
146 Ga0207713_1057402 3300025735 Bacteria 1505
147 Ga0207681_10001305 3300025923 Bacteria 16063
148 Ga0207681_10002871 3300025923 Bacteria 10884
149 Ga0207650_10000073 3300025925 Bacteria 137141
150 Ga0207706_10000178 3300025933 Bacteria 70787
151 Ga0207706_10024333 3300025933 Bacteria 5428
152 Ga0207709_10000022 3300025935 Bacteria 383573
153 Ga0207709_10000634 3300025935 Bacteria 28758
154 Ga0207711_10102403 3300025941 Bacteria 2535
155 Ga0207679_10031482 3300025945 Bacteria 3713
156 Ga0207640_10249701 3300025981 Bacteria 1376
157 Ga0207639_10014912 3300026041 Bacteria 5474
158 Ga0209281_1006417 3300027111 Bacteria 3073
159 Ga0207428_10111887 3300027907 Bacteria 2101
160 Ga0268266_10084356 3300028379 Bacteria 2774
161 Ga0268266_10223068 3300028379 Bacteria 1733
162 Ga0268266_10287500 3300028379 Bacteria 1530
163 Ga0307517_10024989 3300028786 Bacteria 7330
164 Ga0307515_10373416 3300028794 Bacteria 1062
165 Ga0307511_10142496 3300030521 Bacteria 1403
166 Ga0316178_1157834 3300030735 Bacteria 9732
167 Ga0307509_10025355 3300031507 Bacteria 6623
168 Ga0307408_100009264 3300031548 Bacteria 6490
169 Ga0307516_10280580 3300031730 Bacteria 1348
170 Ga0307405_10000102 3300031731 Bacteria 35010
171 Ga0307412_10006331 3300031911 Bacteria 6685
172 Ga0307412_10087703 3300031911 Bacteria 2168
173 Ga0307414_10317061 3300032004 Bacteria 1325
174 Ga0307411_10055804 3300032005 Bacteria 2600
175 Ga0307510_10001007 3300033180 Bacteria 29876
176 Ga0439438_000202 3300041405 Bacteria 27274
177 Ga0439438_000461 3300041405 Bacteria 18366
178 Ga0439447_001229 3300041407 Bacteria 9331
179 Ga0439445_0002057 3300042004 Bacteria 4446
180 Ga0439432_002878 3300042006 Bacteria 6412
181 Ga0439432_003172 3300042006 Bacteria 6115
182 Ga0439451_000325 3300042009 Bacteria 9276
183 Ga0439451_000367 3300042009 Bacteria 8724
184 Ga0439451_000406 3300042009 Bacteria 8401
185 Ga0439451_003273 3300042009 Bacteria 3283
186 Ga0439451_026996 3300042009 Bacteria 1157
187 Ga0439452_000251 3300042010 Bacteria 36945
188 Ga0439452_000279 3300042010 Bacteria 33718
189 Ga0439452_005026 3300042010 Bacteria 4321
190 Ga0439452_025736 3300042010 Bacteria 1491
191 Ga0439456_003808 3300042013 Bacteria 3069
192 Ga0439463_013773 3300042016 Bacteria 1992
193 Ga0450911_000222 3300042115 Bacteria 22157
194 Ga0450923_065373 3300042125 Bacteria 799
195 Ga0450892_007631 3300042130 Bacteria 916
196 Ga0450894_004725 3300042131 Bacteria 1767
197 Ga0450896_007777 3300042133 Bacteria 1480
198 Ga0450898_000500 3300042134 Bacteria 4580
199 Ga0450899_003279 3300042135 Bacteria 1743
200 Ga0450902_000126 3300042137 Bacteria 8236
201 Ga0450903_000290 3300042138 Bacteria 11087
202 Ga0450903_001109 3300042138 Bacteria 5110
203 Ga0450904_000401 3300042139 Bacteria 8872
204 Ga0450905_000016 3300042142 Bacteria 15938
205 Ga0450906_000142 3300042145 Bacteria 13113
206 Ga0450908_015984 3300042184 Bacteria 1341
207 Ga0450918_004664 3300042531 Bacteria 2486
208 Ga0450893_0001166 3300042532 Bacteria 3963
209 Ga0450893_0012758 3300042532 Bacteria 1396
210 Ga0495617_003955 3300046452 Bacteria 5458
211 Ga0495617_008190 3300046452 Bacteria 3609
212 Ga0495617_008301 3300046452 Bacteria 3583
213 Ga0495617_008758 3300046452 Bacteria 3484
214 Ga0495617_009272 3300046452 Bacteria 3378
215 Ga0495617_012325 3300046452 Bacteria 2912
216 Ga0495617_013075 3300046452 Bacteria 2828
217 Ga0495617_013134 3300046452 Bacteria 2820
218 Ga0495617_024895 3300046452 Bacteria 2018
219 Ga0495617_055170 3300046452 Bacteria 1318
220 Ga0495627_000147 3300046453 Bacteria 84285
221 Ga0495627_000549 3300046453 Bacteria 30961
222 Ga0495627_000859 3300046453 Bacteria 21684
223 Ga0495627_001809 3300046453 Bacteria 11397
224 Ga0495627_006732 3300046453 Bacteria 4472
225 Ga0495627_009104 3300046453 Bacteria 3667
226 Ga0495627_026082 3300046453 Bacteria 1888
227 Ga0495627_058420 3300046453 Bacteria 1145
228 Ga0495627_116131 3300046453 Bacteria 757
229 Ga0495592_0014254 3300046454 Bacteria 6037
230 Ga0495590_0001031 3300046457 Bacteria 12276
231 Ga0495590_0001766 3300046457 Bacteria 9177
232 Ga0495590_0010833 3300046457 Bacteria 3416
233 Ga0495590_0012641 3300046457 Bacteria 3128
234 Ga0495591_000620 3300046458 Bacteria 26619
235 Ga0495591_000927 3300046458 Bacteria 20169
236 Ga0495591_000952 3300046458 Bacteria 19793
237 Ga0495591_004093 3300046458 Bacteria 7259
238 Ga0495591_004366 3300046458 Bacteria 6965
239 Ga0495591_005039 3300046458 Bacteria 6215
240 Ga0495591_010535 3300046458 Bacteria 3575
241 Ga0495591_010610 3300046458 Bacteria 3554
242 Ga0495591_016064 3300046458 Bacteria 2621
243 Ga0495638_0000542 3300046460 Bacteria 43515
244 Ga0495638_0000910 3300046460 Bacteria 30212
245 Ga0495638_0002355 3300046460 Bacteria 15490
246 Ga0495638_0003401 3300046460 Bacteria 12542
247 Ga0495638_0004095 3300046460 Bacteria 11154
248 Ga0495638_0011875 3300046460 Bacteria 5988
249 Ga0495638_0023083 3300046460 Bacteria 4075
250 Ga0495638_0035370 3300046460 Bacteria 3185
251 Ga0495638_0057641 3300046460 Bacteria 2408
252 Ga0495653_0001932 3300046463 Bacteria 16339
253 Ga0495653_0112087 3300046463 Bacteria 1958
254 Ga0495653_0156194 3300046463 Bacteria 1588
255 Ga0495650_0001112 3300046471 Bacteria 29424
256 Ga0495650_0003482 3300046471 Bacteria 11436
257 Ga0495650_0007130 3300046471 Bacteria 6787
258 Ga0495650_0021904 3300046471 Bacteria 3074
259 Ga0495650_0032901 3300046471 Bacteria 2313
260 Ga0495605_0003210 3300046474 Bacteria 9807
261 Ga0495605_0008531 3300046474 Bacteria 5791
262 Ga0495605_0009602 3300046474 Bacteria 5434
263 Ga0495605_0012283 3300046474 Bacteria 4753
264 Ga0495605_0013957 3300046474 Bacteria 4411
265 Ga0495605_0014740 3300046474 Bacteria 4270
266 Ga0495605_0014927 3300046474 Bacteria 4236
267 Ga0495584_0001647 3300046491 Bacteria 13128
268 Ga0495584_0006548 3300046491 Bacteria 6087
269 Ga0495584_0013026 3300046491 Bacteria 4243
270 Ga0495584_0051294 3300046491 Bacteria 2077
271 Ga0495584_0077911 3300046491 Bacteria 1667
272 Ga0495584_0098344 3300046491 Bacteria 1478
273 Ga0495585_0000748 3300046492 Bacteria 28801
274 Ga0495585_0001333 3300046492 Bacteria 19603
275 Ga0495585_0001365 3300046492 Bacteria 19315
276 Ga0495585_0002530 3300046492 Bacteria 12996
277 Ga0495585_0002556 3300046492 Bacteria 12895
278 Ga0495585_0013168 3300046492 Bacteria 4846
279 Ga0495585_0015297 3300046492 Bacteria 4458
280 Ga0495585_0016751 3300046492 Bacteria 4245
281 Ga0495596_0002694 3300046500 Bacteria 9366
282 Ga0495607_0000550 3300046501 Bacteria 36652
283 Ga0495607_0003006 3300046501 Bacteria 13165
284 Ga0495607_0004334 3300046501 Bacteria 10465
285 Ga0495607_0004810 3300046501 Bacteria 9850
286 Ga0495607_0014080 3300046501 Bacteria 5220
287 Ga0495607_0015682 3300046501 Bacteria 4905
288 Ga0495607_0017469 3300046501 Bacteria 4603
289 Ga0495607_0023361 3300046501 Bacteria 3871
290 Ga0495607_0030624 3300046501 Bacteria 3302
291 Ga0495607_0032769 3300046501 Bacteria 3168
292 Ga0495607_0035585 3300046501 Bacteria 3010
293 Ga0495607_0097371 3300046501 Bacteria 1582
294 Ga0495583_0001460 3300046506 Bacteria 23844
295 Ga0495583_0002079 3300046506 Bacteria 18065
296 Ga0495606_0001304 3300046507 Bacteria 34367
297 Ga0495606_0001668 3300046507 Bacteria 28854
298 Ga0495606_0002205 3300046507 Bacteria 23321
299 Ga0495606_0003653 3300046507 Bacteria 16123
300 Ga0495606_0006071 3300046507 Bacteria 11286
301 Ga0495606_0006248 3300046507 Bacteria 11059
302 Ga0495606_0011154 3300046507 Bacteria 7362
303 Ga0495606_0027041 3300046507 Bacteria 4074
304 Ga0495606_0041587 3300046507 Bacteria 3081
305 Ga0495606_0081022 3300046507 Bacteria 2018
306 Ga0495610_0001179 3300046512 Bacteria 23660
307 Ga0495610_0001556 3300046512 Bacteria 20208
308 Ga0495610_0001951 3300046512 Bacteria 17738
309 Ga0495610_0005126 3300046512 Bacteria 9414
310 Ga0495610_0008970 3300046512 Bacteria 6394
311 Ga0495610_0009308 3300046512 Bacteria 6224
312 Ga0495610_0009680 3300046512 Bacteria 6064
313 Ga0495610_0010659 3300046512 Bacteria 5691
314 Ga0495610_0018408 3300046512 Bacteria 3947
315 Ga0495610_0041445 3300046512 Bacteria 2311
316 Ga0495616_0000505 3300046513 Bacteria 29552
317 Ga0495616_0000511 3300046513 Bacteria 29411
318 Ga0495616_0000706 3300046513 Bacteria 24753
319 Ga0495616_0001350 3300046513 Bacteria 17116
320 Ga0495616_0009378 3300046513 Bacteria 5733
321 Ga0495616_0014433 3300046513 Bacteria 4421
322 Ga0495616_0031845 3300046513 Bacteria 2758
323 Ga0495616_0034389 3300046513 Bacteria 2632
324 Ga0495616_0042765 3300046513 Bacteria 2304
325 Ga0495620_0000355 3300046515 Bacteria 31797
326 Ga0495620_0001051 3300046515 Bacteria 16934
327 Ga0495620_0003252 3300046515 Bacteria 9312
328 Ga0495620_0006617 3300046515 Bacteria 6349
329 Ga0495620_0008488 3300046515 Bacteria 5512
330 Ga0495620_0021596 3300046515 Bacteria 3123
331 Ga0495631_0000286 3300046518 Bacteria 35275
332 Ga0495631_0000532 3300046518 Bacteria 25537
333 Ga0495631_0001328 3300046518 Bacteria 15161
334 Ga0495631_0003875 3300046518 Bacteria 8101
335 Ga0495631_0014785 3300046518 Bacteria 3758
336 Ga0495631_0038245 3300046518 Bacteria 2134
337 Ga0495632_0000497 3300046519 Bacteria 37001
338 Ga0495632_0001765 3300046519 Bacteria 17499
339 Ga0495632_0014476 3300046519 Bacteria 4460
340 Ga0495632_0015046 3300046519 Bacteria 4351
341 Ga0495632_0019015 3300046519 Bacteria 3751
342 Ga0495632_0020606 3300046519 Bacteria 3566
343 Ga0495632_0020770 3300046519 Bacteria 3548
344 Ga0495632_0024211 3300046519 Bacteria 3229
345 Ga0495632_0024436 3300046519 Bacteria 3208
346 Ga0495632_0026375 3300046519 Bacteria 3059
347 Ga0495632_0058350 3300046519 Bacteria 1881
348 Ga0495632_0064957 3300046519 Bacteria 1763
349 Ga0495632_0083436 3300046519 Bacteria 1521
350 Ga0495637_0000655 3300046520 Bacteria 24162
351 Ga0495637_0001364 3300046520 Bacteria 14664
352 Ga0495637_0002550 3300046520 Bacteria 10023
353 Ga0495637_0003412 3300046520 Bacteria 8438
354 Ga0495637_0014090 3300046520 Bacteria 3779
355 Ga0495637_0030428 3300046520 Bacteria 2395
356 Ga0495637_0045023 3300046520 Bacteria 1874
357 Ga0495637_0063916 3300046520 Bacteria 1502
358 Ga0495637_0201306 3300046520 Bacteria 731
359 Ga0495643_0002882 3300046522 Bacteria 13041
360 Ga0495643_0021217 3300046522 Bacteria 3730
361 Ga0495643_0043048 3300046522 Bacteria 2458
362 Ga0495643_0131278 3300046522 Bacteria 1257
363 Ga0495644_0000278 3300046523 Bacteria 23512
364 Ga0495644_0000335 3300046523 Bacteria 21541
365 Ga0495648_0000215 3300046524 Bacteria 66028
366 Ga0495648_0000735 3300046524 Bacteria 34912
367 Ga0495648_0001320 3300046524 Bacteria 24586
368 Ga0495648_0006966 3300046524 Bacteria 9117
369 Ga0495648_0012221 3300046524 Bacteria 6417
370 Ga0495648_0026658 3300046524 Bacteria 3886
371 Ga0495648_0041652 3300046524 Bacteria 2897
372 Ga0495648_0053914 3300046524 Bacteria 2432
373 Ga0495648_0070908 3300046524 Bacteria 2022
374 Ga0495666_0001177 3300046526 Bacteria 12580
375 Ga0495666_0159970 3300046526 Bacteria 1044
376 Ga0495654_0000412 3300046530 Bacteria 36467
377 Ga0495654_0000786 3300046530 Bacteria 24451
378 Ga0495654_0000951 3300046530 Bacteria 21452
379 Ga0495654_0002256 3300046530 Bacteria 12476
380 Ga0495654_0002723 3300046530 Bacteria 11158
381 Ga0495654_0003741 3300046530 Bacteria 9214
382 Ga0495654_0004154 3300046530 Bacteria 8688
383 Ga0495654_0022278 3300046530 Bacteria 3291
384 Ga0495654_0032070 3300046530 Bacteria 2664
385 Ga0495654_0033459 3300046530 Bacteria 2601
386 Ga0495654_0039929 3300046530 Bacteria 2340
387 Ga0495654_0078461 3300046530 Bacteria 1552
388 Ga0495654_0081115 3300046530 Bacteria 1521
389 Ga0495654_0118955 3300046530 Bacteria 1197
390 Ga0495587_0012305 3300046536 Bacteria 5393
391 Ga0495587_0023022 3300046536 Bacteria 3830
392 Ga0495609_0000505 3300046538 Bacteria 31398
393 Ga0495609_0012433 3300046538 Bacteria 4038
394 Ga0495609_0014930 3300046538 Bacteria 3643
395 Ga0495609_0020787 3300046538 Bacteria 3029
396 Ga0495609_0049260 3300046538 Bacteria 1880
397 Ga0495597_0000659 3300046542 Bacteria 28075
398 Ga0495597_0004542 3300046542 Bacteria 7594
399 Ga0495597_0006301 3300046542 Bacteria 6146
400 Ga0495597_0025178 3300046542 Bacteria 2740
401 Ga0495597_0026390 3300046542 Bacteria 2668
402 Ga0495597_0124827 3300046542 Bacteria 1070
403 Ga0495645_0011416 3300046543 Bacteria 6250
404 Ga0495622_0000739 3300046557 Bacteria 18390
405 Ga0495622_0011990 3300046557 Bacteria 4008
406 Ga0495622_0089187 3300046557 Bacteria 1417
407 Ga0495633_0001604 3300046558 Bacteria 17147
408 Ga0495633_0006087 3300046558 Bacteria 7228
409 Ga0495633_0007049 3300046558 Bacteria 6544
410 Ga0495633_0144587 3300046558 Bacteria 1099
411 Ga0495656_0087346 3300046615 Bacteria 1420
412 Ga0495668_0000891 3300046616 Bacteria 33605
413 Ga0495668_0028975 3300046616 Bacteria 3129
414 Ga0495668_0081667 3300046616 Bacteria 1773
415 Ga0495668_0125832 3300046616 Bacteria 1403
416 Ga0495634_0000750 3300046642 Bacteria 31392
417 Ga0495634_0007094 3300046642 Bacteria 8450
418 Ga0495611_0000255 3300046648 Bacteria 36899
419 Ga0495611_0014616 3300046648 Bacteria 3356
420 Ga0495611_0087104 3300046648 Bacteria 1441
421 Ga0495625_0002197 3300046660 Bacteria 21607
422 Ga0495625_0009697 3300046660 Bacteria 8019
423 Ga0495625_0019920 3300046660 Bacteria 5190
424 Ga0495625_0032472 3300046660 Bacteria 3869
425 Ga0495625_0038779 3300046660 Bacteria 3484
426 Ga0495625_0070957 3300046660 Bacteria 2445
427 Ga0495635_0000942 3300046663 Bacteria 19194
428 Ga0495661_0000363 3300046665 Bacteria 49099
429 Ga0495661_0001713 3300046665 Bacteria 17741
430 Ga0495661_0009466 3300046665 Bacteria 6687
431 Ga0495661_0015380 3300046665 Bacteria 5107
432 Ga0495661_0030675 3300046665 Bacteria 3420
433 Ga0495661_0031300 3300046665 Bacteria 3379
434 Ga0495661_0082255 3300046665 Bacteria 1854
435 Ga0495661_0138151 3300046665 Bacteria 1328
436 Ga0495661_0210817 3300046665 Bacteria 1011
437 Ga0495588_0010988 3300046674 Bacteria 4236
438 Ga0495588_0023567 3300046674 Bacteria 3049
439 Ga0495623_0007457 3300046679 Bacteria 7102
440 Ga0495623_0008514 3300046679 Bacteria 6662
441 Ga0495646_0016256 3300046680 Bacteria 4723
442 Ga0495613_0002793 3300046689 Bacteria 13111
443 Ga0495613_0036504 3300046689 Bacteria 3644
444 Ga0495613_0198749 3300046689 Bacteria 1414
445 Ga0495624_0000185 3300046690 Bacteria 46826
446 Ga0495670_0000410 3300046691 Bacteria 20521
447 Ga0495670_0009802 3300046691 Bacteria 4708
448 Ga0495670_0014410 3300046691 Bacteria 3886
449 Ga0495670_0137577 3300046691 Bacteria 1276
450 Ga0495670_0213317 3300046691 Bacteria 1024
451 Ga0495671_0001703 3300046692 Bacteria 14350
452 Ga0495671_0004276 3300046692 Bacteria 8580
453 Ga0495671_0006964 3300046692 Bacteria 6484
454 Ga0495671_0010655 3300046692 Bacteria 5085
455 Ga0495671_0013376 3300046692 Bacteria 4447
456 Ga0495671_0016278 3300046692 Bacteria 3973
457 Ga0495671_0023634 3300046692 Bacteria 3210
458 Ga0495671_0029795 3300046692 Bacteria 2799
459 Ga0495671_0034411 3300046692 Bacteria 2575
460 Ga0495671_0060970 3300046692 Bacteria 1861
461 Ga0495649_0001334 3300046694 Bacteria 18764
462 Ga0495649_0001421 3300046694 Bacteria 18097
463 Ga0495649_0002090 3300046694 Bacteria 14348
464 Ga0495649_0002896 3300046694 Bacteria 11884
465 Ga0495649_0004480 3300046694 Bacteria 9118
466 Ga0495649_0004685 3300046694 Bacteria 8880
467 Ga0495649_0004975 3300046694 Bacteria 8552
468 Ga0495649_0013193 3300046694 Bacteria 4772
469 Ga0495649_0138953 3300046694 Bacteria 1279
470 Ga0495589_0000425 3300046794 Bacteria 31317
471 Ga0495589_0004022 3300046794 Bacteria 7878
472 Ga0495589_0015647 3300046794 Bacteria 3900
473 Ga0495589_0019091 3300046794 Bacteria 3517
474 Ga0495589_0024165 3300046794 Bacteria 3089
475 Ga0495600_0037531 3300046809 Bacteria 3150
476 Ga0495600_0046433 3300046809 Bacteria 2833
477 Ga0495660_0000504 3300046810 Bacteria 32167
478 Ga0495660_0002181 3300046810 Bacteria 12603
479 Ga0495660_0005835 3300046810 Bacteria 7345
480 Ga0495660_0015245 3300046810 Bacteria 4441
481 Ga0495660_0030600 3300046810 Bacteria 3031
482 Ga0495660_0052370 3300046810 Bacteria 2217
483 Ga0495660_0069640 3300046810 Bacteria 1869
484 Ga0495660_0131674 3300046810 Bacteria 1254
485 Ga0495660_0243870 3300046810 Bacteria 836
486 Ga0495604_0011205 3300047317 Bacteria 7118
487 Ga0495604_0015620 3300047317 Bacteria 6062
488 Ga0495674_0020483 3300047319 Bacteria 6120
489 Ga0495672_0000726 3300047320 Bacteria 36268
490 Ga0495672_0001739 3300047320 Bacteria 21032
491 Ga0495672_0002786 3300047320 Bacteria 15610
492 Ga0495672_0008066 3300047320 Bacteria 7826
493 Ga0495672_0009193 3300047320 Bacteria 7196
494 Ga0495672_0014554 3300047320 Bacteria 5380
495 Ga0495672_0028260 3300047320 Bacteria 3550
496 Ga0495672_0033347 3300047320 Bacteria 3190
497 Ga0495672_0071300 3300047320 Bacteria 1966
498 Ga0495676_0000884 3300047321 Bacteria 25009
499 Ga0495676_0001079 3300047321 Bacteria 23112
500 Ga0495680_0001910 3300047322 Bacteria 21867
501 Ga0495680_0010782 3300047322 Bacteria 8141
502 Ga0495680_0055316 3300047322 Bacteria 3078
503 Ga0495680_0099088 3300047322 Bacteria 2173
504 Ga0495680_0397819 3300047322 Bacteria 951
505 Ga0495683_0000452 3300047323 Bacteria 32302
506 Ga0495683_0001738 3300047323 Bacteria 13776
507 Ga0495683_0002619 3300047323 Bacteria 10764
508 Ga0495683_0016173 3300047323 Bacteria 3874
509 Ga0495683_0027610 3300047323 Bacteria 2902
510 Ga0495675_0137170 3300047444 Bacteria 1518
511 Ga0495677_0202361 3300047445 Bacteria 772
512 Ga0495679_001297 3300047446 Bacteria 14566
513 Ga0495679_001838 3300047446 Bacteria 11480
514 Ga0495679_004171 3300047446 Bacteria 6748
515 Ga0495679_005915 3300047446 Bacteria 5360
516 Ga0495679_011441 3300047446 Bacteria 3425
517 Ga0495673_0000759 3300047469 Bacteria 30614
518 Ga0495673_0000890 3300047469 Bacteria 27481
519 Ga0495673_0001076 3300047469 Bacteria 23960
520 Ga0495673_0002437 3300047469 Bacteria 13100
521 Ga0495673_0009592 3300047469 Bacteria 5346
522 Ga0495673_0026582 3300047469 Bacteria 2765
523 Ga0495673_0038735 3300047469 Bacteria 2166
524 Ga0495673_0072708 3300047469 Bacteria 1442
525 Ga0495681_0000171 3300047470 Bacteria 54448
526 Ga0495681_0000457 3300047470 Bacteria 31283
527 Ga0495681_0000508 3300047470 Bacteria 29718
528 Ga0495681_0000981 3300047470 Bacteria 21817
529 Ga0495681_0005014 3300047470 Bacteria 8926
530 Ga0495681_0008238 3300047470 Bacteria 6551
531 Ga0495681_0008861 3300047470 Bacteria 6253
532 Ga0495681_0012190 3300047470 Bacteria 5065
533 Ga0495681_0016417 3300047470 Bacteria 4152
534 Ga0495681_0027611 3300047470 Bacteria 2933
535 Ga0495684_0002673 3300047471 Bacteria 14124
536 Ga0495686_0002074 3300047472 Bacteria 19701
537 Ga0495686_0011047 3300047472 Bacteria 6387
538 Ga0495686_0030379 3300047472 Bacteria 3509
539 Ga0495686_0080202 3300047472 Bacteria 1995
540 Ga0495593_0003815 3300047673 Bacteria 9003
541 Ga0495593_0006571 3300047673 Bacteria 6803
542 Ga0495593_0011499 3300047673 Bacteria 5081
543 Ga0495593_0024249 3300047673 Bacteria 3363
544 Ga0495602_0000848 3300048088 Bacteria 29417
545 Ga0495614_0074733 3300048089 Bacteria 1464
546 Ga0495626_0000726 3300048091 Bacteria 30830
547 Ga0495626_0001495 3300048091 Bacteria 18442
548 Ga0495626_0006234 3300048091 Bacteria 6811
549 Ga0495626_0010707 3300048091 Bacteria 4876
550 Ga0495626_0010974 3300048091 Bacteria 4809
551 Ga0495626_0011213 3300048091 Bacteria 4747
552 Ga0495626_0015308 3300048091 Bacteria 3931
553 Ga0496101_0518212 3300048904 Bacteria 942
554 Ga0496102_0000419 3300048905 Bacteria 48952
555 Ga0496103_0001964 3300048906 Bacteria 13296
556 Ga0496106_0055543 3300048909 Bacteria 2993
557 Ga0496106_0180064 3300048909 Bacteria 1678
558 Ga0496110_0080720 3300048913 Bacteria 2899
559 Ga0496111_0209034 3300048914 Bacteria 1450
560 Ga0496116_0000338 3300048919 Bacteria 75100
561 Ga0496116_0001012 3300048919 Bacteria 34285
562 Ga0496116_0002599 3300048919 Bacteria 18786
563 Ga0496116_0004365 3300048919 Bacteria 13523
564 Ga0496116_0012636 3300048919 Bacteria 6877
565 Ga0496116_0024608 3300048919 Bacteria 4447
566 Ga0496116_0049883 3300048919 Bacteria 2794
567 Ga0496116_0109461 3300048919 Bacteria 1628
568 Ga0496117_0000712 3300048920 Bacteria 52613
569 Ga0496117_0003653 3300048920 Bacteria 17695
570 Ga0496117_0005368 3300048920 Bacteria 13500
571 Ga0496117_0005706 3300048920 Bacteria 12956
572 Ga0496117_0006175 3300048920 Bacteria 12236
573 Ga0496117_0006888 3300048920 Bacteria 11278
574 Ga0496117_0015564 3300048920 Bacteria 6475
575 Ga0496117_0027875 3300048920 Bacteria 4386
576 Ga0496117_0046700 3300048920 Bacteria 3113
577 Ga0496118_0004004 3300048921 Bacteria 17933
578 Ga0496118_0005607 3300048921 Bacteria 14179
579 Ga0496118_0028792 3300048921 Bacteria 4670
580 Ga0496118_0039993 3300048921 Bacteria 3733
581 Ga0496118_0109646 3300048921 Bacteria 1836
582 Ga0496119_0003010 3300048922 Bacteria 17854
583 Ga0496119_0011059 3300048922 Bacteria 7521
584 Ga0496119_0075535 3300048922 Bacteria 1958
585 Ga0496119_0104940 3300048922 Bacteria 1579
586 Ga0496120_0001345 3300048923 Bacteria 30280
587 Ga0496120_0006476 3300048923 Bacteria 8983
588 Ga0496120_0020080 3300048923 Bacteria 4257
589 Ga0496121_0000713 3300048924 Bacteria 61654
590 Ga0496121_0001802 3300048924 Bacteria 34607
591 Ga0496121_0005084 3300048924 Bacteria 17154
592 Ga0496121_0006906 3300048924 Bacteria 13851
593 Ga0496121_0013221 3300048924 Bacteria 8894
594 Ga0496121_0029593 3300048924 Bacteria 5058
595 Ga0496121_0055549 3300048924 Bacteria 3298
596 Ga0496122_0003076 3300048925 Bacteria 22461
597 Ga0496122_0004317 3300048925 Bacteria 17801
598 Ga0496122_0008121 3300048925 Bacteria 11434
599 Ga0496122_0009196 3300048925 Bacteria 10464
600 Ga0496122_0009627 3300048925 Bacteria 10121
601 Ga0496122_0009764 3300048925 Bacteria 10024
602 Ga0496122_0014063 3300048925 Bacteria 7768
603 Ga0496122_0033721 3300048925 Bacteria 4204
604 Ga0496122_0164034 3300048925 Bacteria 1350
605 Ga0496123_0002303 3300048926 Bacteria 23972
606 Ga0496123_0004296 3300048926 Bacteria 15141
607 Ga0496123_0006317 3300048926 Bacteria 11517
608 Ga0496123_0008403 3300048926 Bacteria 9488
609 Ga0496123_0010737 3300048926 Bacteria 8047
610 Ga0496123_0012181 3300048926 Bacteria 7360
611 Ga0496123_0035016 3300048926 Bacteria 3586
612 Ga0496123_0072847 3300048926 Bacteria 2134
613 Ga0496124_0001071 3300048927 Bacteria 43253
614 Ga0496124_0001277 3300048927 Bacteria 38265
615 Ga0496124_0003709 3300048927 Bacteria 18440
616 Ga0496124_0005979 3300048927 Bacteria 13435
617 Ga0496124_0007771 3300048927 Bacteria 11328
618 Ga0496124_0029997 3300048927 Bacteria 4835
619 Ga0496124_0334065 3300048927 Bacteria 1079
620 Ga0496125_0000948 3300048928 Bacteria 45536
621 Ga0496125_0002443 3300048928 Bacteria 24133
622 Ga0496125_0004226 3300048928 Bacteria 16728
623 Ga0496125_0007586 3300048928 Bacteria 11522
624 Ga0496125_0011572 3300048928 Bacteria 8814
625 Ga0496125_0015480 3300048928 Bacteria 7372
626 Ga0496125_0064739 3300048928 Bacteria 2902
627 Ga0496125_0146537 3300048928 Bacteria 1630
628 Ga0496126_0011442 3300048929 Bacteria 9183
629 Ga0495678_000534 3300049459 Bacteria 36836
630 Ga0495678_001271 3300049459 Bacteria 20466
631 Ga0495678_005619 3300049459 Bacteria 6860
632 Ga0495678_006249 3300049459 Bacteria 6365
633 Ga0495678_006916 3300049459 Bacteria 5953
634 Ga0495678_009530 3300049459 Bacteria 4797
635 Ga0495678_015047 3300049459 Bacteria 3574
636 Ga0495678_015398 3300049459 Bacteria 3518
637 Ga0495678_017139 3300049459 Bacteria 3290
638 Ga0495678_046412 3300049459 Bacteria 1708
639 Ga0495678_085437 3300049459 Bacteria 1124
640 Ga0495682_0001524 3300049460 Bacteria 12276
641 Ga0495682_0002821 3300049460 Bacteria 8016
642 Ga0495682_0007293 3300049460 Bacteria 4409
643 Ga0495682_0007711 3300049460 Bacteria 4268
644 Ga0495682_0053429 3300049460 Bacteria 1467
645 Ga0501240_000795 3300049673 Bacteria 2804
646 Ga0501241_000245 3300049758 Bacteria 12157
647 Ga0501269_002785 3300049766 Bacteria 2131
648 nmdc:mga00v17_14617_c2 3300050491 Bacteria 2909
649 Ga0500572_000413 3300053111 Bacteria 15022
650 Ga0500634_0000868 3300053161 Bacteria 10758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047445 Ga0495677_0202361 Ga0495677_0202361_58_639 175
2 3300046665 Ga0495661_0210817 Ga0495661_0210817_347_940 181
3 3300046665 Ga0495661_0031300 Ga0495661_0031300_2192_2800 184
4 3300046616 Ga0495668_0081667 Ga0495668_0081667_1070_1711 185
5 3300046689 Ga0495613_0198749 Ga0495613_0198749_76_684 186
6 3300049460 Ga0495682_0053429 Ga0495682_0053429_826_1434 186
7 3300046463 Ga0495653_0156194 Ga0495653_0156194_12_704 189
8 3300046520 Ga0495637_0201306 Ga0495637_0201306_50_667 189
9 3300048905 Ga0496102_0000419 Ga0496102_0000419_17078_17797 189
10 3300048906 Ga0496103_0001964 Ga0496103_0001964_2315_3034 189
11 3300048919 Ga0496116_0024608 Ga0496116_0024608_2109_2828 189
12 3300048920 Ga0496117_0005706 Ga0496117_0005706_1622_2341 189
13 3300047322 Ga0495680_0397819 Ga0495680_0397819_134_859 196
14 3300046453 Ga0495627_001809 Ga0495627_001809_1007_1729 197
15 3300046458 Ga0495591_000927 Ga0495591_000927_15096_15818 197
16 3300046501 Ga0495607_0003006 Ga0495607_0003006_9346_10068 197
17 3300046519 Ga0495632_0001765 Ga0495632_0001765_4345_5067 197
18 3300046665 Ga0495661_0000363 Ga0495661_0000363_25106_25828 197
19 3300047470 Ga0495681_0005014 Ga0495681_0005014_4336_5058 197
20 3300010375 Ga0105239_10367155 Ga0105239_103671553 198
21 3300047323 Ga0495683_0027610 Ga0495683_0027610_2217_2861 198
22 3300014497 Ga0182008_10003797 Ga0182008_1000379710 199
23 3300046452 Ga0495617_003955 Ga0495617_003955_4280_4930 199
24 3300046453 Ga0495627_000147 Ga0495627_000147_35439_36089 199
25 3300046471 Ga0495650_0021904 Ga0495650_0021904_2142_2792 199
26 3300046518 Ga0495631_0001328 Ga0495631_0001328_611_1261 199
27 3300046519 Ga0495632_0024211 Ga0495632_0024211_1576_2226 199
28 3300046530 Ga0495654_0002256 Ga0495654_0002256_11177_11827 199
29 3300046692 Ga0495671_0001703 Ga0495671_0001703_3952_4602 199
30 3300047320 Ga0495672_0071300 Ga0495672_0071300_743_1393 199
31 3300046692 Ga0495671_0004276 Ga0495671_0004276_1992_2705 200
32 3300046491 Ga0495584_0013026 Ga0495584_0013026_1440_2129 201
33 3300046507 Ga0495606_0006071 Ga0495606_0006071_2362_3051 201
34 3300046513 Ga0495616_0014433 Ga0495616_0014433_2148_2837 201
35 3300046515 Ga0495620_0000355 Ga0495620_0000355_8279_8968 201
36 3300046518 Ga0495631_0003875 Ga0495631_0003875_5156_5845 201
37 3300046519 Ga0495632_0014476 Ga0495632_0014476_1536_2225 201
38 3300046520 Ga0495637_0003412 Ga0495637_0003412_2402_3091 201
39 3300046530 Ga0495654_0081115 Ga0495654_0081115_742_1431 201
40 3300046538 Ga0495609_0000505 Ga0495609_0000505_8265_8954 201
41 3300046660 Ga0495625_0009697 Ga0495625_0009697_5183_5872 201
42 3300046694 Ga0495649_0004975 Ga0495649_0004975_5331_6020 201
43 3300046794 Ga0495589_0000425 Ga0495589_0000425_22355_23044 201
44 3300046810 Ga0495660_0069640 Ga0495660_0069640_70_759 201
45 3300047470 Ga0495681_0000457 Ga0495681_0000457_8276_8965 201
46 3300049459 Ga0495678_006249 Ga0495678_006249_3377_4066 201
47 3300005548 Ga0070665_100044833 Ga0070665_1000448334 202
48 3300028379 Ga0268266_10084356 Ga0268266_100843562 202
49 3300041407 Ga0439447_001229 Ga0439447_001229_1919_2629 202
50 3300042006 Ga0439432_002878 Ga0439432_002878_2071_2781 202
51 3300042010 Ga0439452_000251 Ga0439452_000251_19682_20395 202
52 3300042010 Ga0439452_005026 Ga0439452_005026_2245_2955 202
53 3300042125 Ga0450923_065373 Ga0450923_065373_77_787 202
54 3300046460 Ga0495638_0035370 Ga0495638_0035370_659_1372 202
55 3300046519 Ga0495632_0019015 Ga0495632_0019015_2345_3058 202
56 3300046520 Ga0495637_0002550 Ga0495637_0002550_8724_9437 202
57 3300046520 Ga0495637_0014090 Ga0495637_0014090_2375_3088 202
58 3300046694 Ga0495649_0004685 Ga0495649_0004685_4211_4924 202
59 3300046694 Ga0495649_0013193 Ga0495649_0013193_1018_1752 202
60 3300046794 Ga0495589_0019091 Ga0495589_0019091_2136_2849 202
61 3300048925 Ga0496122_0009627 Ga0496122_0009627_2336_3046 202
62 3300048926 Ga0496123_0012181 Ga0496123_0012181_2557_3267 202
63 3300046507 Ga0495606_0006248 Ga0495606_0006248_8157_8879 203
64 3300046492 Ga0495585_0015297 Ga0495585_0015297_10_675 205
65 3300046679 Ga0495623_0008514 Ga0495623_0008514_2302_3015 205
66 3300046809 Ga0495600_0037531 Ga0495600_0037531_2236_2949 205
67 3300047317 Ga0495604_0015620 Ga0495604_0015620_3140_3853 205
68 3300047322 Ga0495680_0099088 Ga0495680_0099088_960_1673 205
69 3300047673 Ga0495593_0003815 Ga0495593_0003815_5997_6710 205
70 3300015261 Ga0182006_1089673 Ga0182006_10896732 207
71 3300046512 Ga0495610_0008970 Ga0495610_0008970_3393_4115 208
72 3300009011 Ga0105251_10004027 Ga0105251_1000402710 209
73 3300011119 Ga0105246_10000388 Ga0105246_1000038816 209
74 3300017792 Ga0163161_10010903 Ga0163161_100109036 209
75 3300025711 Ga0207696_1014255 Ga0207696_10142552 209
76 3300025735 Ga0207713_1000494 Ga0207713_100049417 209
77 3300025735 Ga0207713_1002389 Ga0207713_10023896 209
78 3300046457 Ga0495590_0010833 Ga0495590_0010833_392_1075 209
79 3300046458 Ga0495591_005039 Ga0495591_005039_3596_4279 209
80 3300046460 Ga0495638_0000542 Ga0495638_0000542_28004_28687 209
81 3300046491 Ga0495584_0077911 Ga0495584_0077911_290_973 209
82 3300046501 Ga0495607_0004810 Ga0495607_0004810_5570_6253 209
83 3300046513 Ga0495616_0031845 Ga0495616_0031845_537_1220 209
84 3300046519 Ga0495632_0026375 Ga0495632_0026375_2242_2925 209
85 3300046523 Ga0495644_0000335 Ga0495644_0000335_9506_10189 209
86 3300046648 Ga0495611_0014616 Ga0495611_0014616_359_1042 209
87 3300046692 Ga0495671_0010655 Ga0495671_0010655_2211_2894 209
88 3300046694 Ga0495649_0002090 Ga0495649_0002090_3514_4197 209
89 3300046810 Ga0495660_0052370 Ga0495660_0052370_434_1117 209
90 3300047320 Ga0495672_0001739 Ga0495672_0001739_4263_4946 209
91 3300047320 Ga0495672_0014554 Ga0495672_0014554_436_1119 209
92 3300047469 Ga0495673_0000759 Ga0495673_0000759_15298_15981 209
93 3300048914 Ga0496111_0209034 Ga0496111_0209034_416_1099 209
94 3300048927 Ga0496124_0001277 Ga0496124_0001277_9713_10396 209
95 3300048928 Ga0496125_0011572 Ga0496125_0011572_905_1624 209
96 3300049459 Ga0495678_015398 Ga0495678_015398_2135_2818 209
97 iso_pu_bacteria 2511231023 2511367155 209
98 iso_pu_bacteria 3007614139 3007617533 209
99 3300013104 Ga0157370_10297740 Ga0157370_102977402 210
100 3300042184 Ga0450908_015984 Ga0450908_015984_218_904 210
101 3300046453 Ga0495627_000859 Ga0495627_000859_6487_7167 210
102 3300046471 Ga0495650_0007130 Ga0495650_0007130_2982_3662 210
103 3300046474 Ga0495605_0008531 Ga0495605_0008531_2917_3597 210
104 3300046492 Ga0495585_0002530 Ga0495585_0002530_10096_10776 210
105 3300046500 Ga0495596_0002694 Ga0495596_0002694_5899_6579 210
106 3300046501 Ga0495607_0015682 Ga0495607_0015682_931_1617 210
107 3300046507 Ga0495606_0001668 Ga0495606_0001668_22435_23115 210
108 3300046512 Ga0495610_0001951 Ga0495610_0001951_2509_3189 210
109 3300046512 Ga0495610_0009680 Ga0495610_0009680_3124_3804 210
110 3300046513 Ga0495616_0001350 Ga0495616_0001350_11034_11714 210
111 3300046519 Ga0495632_0015046 Ga0495632_0015046_2522_3202 210
112 3300046519 Ga0495632_0020606 Ga0495632_0020606_555_1241 210
113 3300046522 Ga0495643_0043048 Ga0495643_0043048_932_1618 210
114 3300046524 Ga0495648_0001320 Ga0495648_0001320_9740_10420 210
115 3300046530 Ga0495654_0000951 Ga0495654_0000951_14651_15331 210
116 3300046542 Ga0495597_0000659 Ga0495597_0000659_11036_11716 210
117 3300046542 Ga0495597_0026390 Ga0495597_0026390_452_1138 210
118 3300046557 Ga0495622_0000739 Ga0495622_0000739_3236_3916 210
119 3300046694 Ga0495649_0001334 Ga0495649_0001334_15350_16030 210
120 3300046810 Ga0495660_0002181 Ga0495660_0002181_8923_9603 210
121 3300047446 Ga0495679_001297 Ga0495679_001297_10837_11517 210
122 3300047472 Ga0495686_0080202 Ga0495686_0080202_912_1598 210
123 3300048091 Ga0495626_0001495 Ga0495626_0001495_3146_3826 210
124 3300049459 Ga0495678_000534 Ga0495678_000534_22211_22891 210
125 3300049459 Ga0495678_006916 Ga0495678_006916_4522_5208 210
126 3300049460 Ga0495682_0007711 Ga0495682_0007711_1877_2557 210
127 3300005331 Ga0070670_100001980 Ga0070670_1000019809 211
128 3300009011 Ga0105251_10005274 Ga0105251_100052743 211
129 3300025925 Ga0207650_10000073 Ga0207650_1000007334 211
130 3300046692 Ga0495671_0029795 Ga0495671_0029795_143_826 211
131 3300047323 Ga0495683_0002619 Ga0495683_0002619_1919_2602 211
132 3300049459 Ga0495678_017139 Ga0495678_017139_2219_2935 211
133 iso_pu_bacteria 2852657418 2852660219 211
134 iso_pu_bacteria 2511231021 2511359992 212
135 3300009011 Ga0105251_10001590 Ga0105251_100015907 213
136 3300009011 Ga0105251_10025992 Ga0105251_100259922 213
137 3300012498 Ga0157345_1000032 Ga0157345_100003224 213
138 3300013105 Ga0157369_10001544 Ga0157369_100015448 213
139 3300013308 Ga0157375_10421181 Ga0157375_104211812 213
140 3300025735 Ga0207713_1004120 Ga0207713_10041205 213
141 3300046453 Ga0495627_006732 Ga0495627_006732_2356_3045 213
142 3300046474 Ga0495605_0014740 Ga0495605_0014740_2264_2953 213
143 3300046501 Ga0495607_0035585 Ga0495607_0035585_261_950 213
144 3300046501 Ga0495607_0097371 Ga0495607_0097371_48_737 213
145 3300046507 Ga0495606_0001304 Ga0495606_0001304_22264_22953 213
146 3300046513 Ga0495616_0000706 Ga0495616_0000706_22776_23465 213
147 3300046515 Ga0495620_0021596 Ga0495620_0021596_2216_2905 213
148 3300046519 Ga0495632_0020770 Ga0495632_0020770_2186_2875 213
149 3300046522 Ga0495643_0131278 Ga0495643_0131278_301_990 213
150 3300046524 Ga0495648_0026658 Ga0495648_0026658_1428_2117 213
151 3300046530 Ga0495654_0000786 Ga0495654_0000786_22474_23163 213
152 3300046538 Ga0495609_0020787 Ga0495609_0020787_269_958 213
153 3300046542 Ga0495597_0124827 Ga0495597_0124827_207_902 213
154 3300046558 Ga0495633_0007049 Ga0495633_0007049_3096_3785 213
155 3300046558 Ga0495633_0144587 Ga0495633_0144587_275_964 213
156 3300046616 Ga0495668_0000891 Ga0495668_0000891_22261_22950 213
157 3300046660 Ga0495625_0038779 Ga0495625_0038779_2300_2989 213
158 3300046691 Ga0495670_0213317 Ga0495670_0213317_80_769 213
159 3300046692 Ga0495671_0013376 Ga0495671_0013376_1430_2119 213
160 3300046694 Ga0495649_0001421 Ga0495649_0001421_736_1425 213
161 3300046694 Ga0495649_0004480 Ga0495649_0004480_2233_2922 213
162 3300046810 Ga0495660_0030600 Ga0495660_0030600_310_999 213
163 3300047446 Ga0495679_005915 Ga0495679_005915_2063_2752 213
164 3300047446 Ga0495679_011441 Ga0495679_011441_2173_2862 213
165 3300047469 Ga0495673_0026582 Ga0495673_0026582_1513_2202 213
166 3300048091 Ga0495626_0010974 Ga0495626_0010974_2099_2788 213
167 3300048091 Ga0495626_0011213 Ga0495626_0011213_1289_1978 213
168 3300048919 Ga0496116_0004365 Ga0496116_0004365_2159_2848 213
169 3300048920 Ga0496117_0006888 Ga0496117_0006888_8439_9128 213
170 3300048921 Ga0496118_0004004 Ga0496118_0004004_2230_2919 213
171 3300048925 Ga0496122_0014063 Ga0496122_0014063_2165_2854 213
172 3300048926 Ga0496123_0006317 Ga0496123_0006317_8666_9355 213
173 3300049459 Ga0495678_005619 Ga0495678_005619_4003_4692 213
174 3300049459 Ga0495678_085437 Ga0495678_085437_255_944 213
175 3300015262 Ga0182007_10000283 Ga0182007_1000028314 214
176 3300042010 Ga0439452_025736 Ga0439452_025736_122_820 214
177 3300048913 Ga0496110_0080720 Ga0496110_0080720_1846_2544 214
178 3300009011 Ga0105251_10002232 Ga0105251_100022322 215
179 3300009092 Ga0105250_10001060 Ga0105250_100010605 215
180 3300009092 Ga0105250_10015343 Ga0105250_100153434 215
181 3300013100 Ga0157373_10004155 Ga0157373_100041552 215
182 3300013102 Ga0157371_10012005 Ga0157371_100120056 215
183 3300013105 Ga0157369_10009425 Ga0157369_1000942513 215
184 3300013307 Ga0157372_10001315 Ga0157372_100013154 215
185 3300017792 Ga0163161_10002587 Ga0163161_1000258713 215
186 3300025711 Ga0207696_1000085 Ga0207696_100008536 215
187 3300025711 Ga0207696_1022429 Ga0207696_10224292 215
188 3300025735 Ga0207713_1001804 Ga0207713_10018042 215
189 3300048904 Ga0496101_0518212 Ga0496101_0518212_104_799 215
190 3300048909 Ga0496106_0055543 Ga0496106_0055543_318_1013 215
191 3300048924 Ga0496121_0001802 Ga0496121_0001802_22058_22753 215
192 3300048925 Ga0496122_0033721 Ga0496122_0033721_1216_1911 215
193 3300048926 Ga0496123_0072847 Ga0496123_0072847_1204_1899 215
194 3300048927 Ga0496124_0003709 Ga0496124_0003709_903_1598 215
195 3300048928 Ga0496125_0007586 Ga0496125_0007586_4079_4774 215
196 3300006058 Ga0075432_10001534 Ga0075432_100015346 216
197 3300027907 Ga0207428_10111887 Ga0207428_101118872 216
198 3300046452 Ga0495617_008758 Ga0495617_008758_544_1242 216
199 3300046453 Ga0495627_026082 Ga0495627_026082_508_1206 216
200 3300046458 Ga0495591_004366 Ga0495591_004366_1685_2383 216
201 3300046460 Ga0495638_0057641 Ga0495638_0057641_544_1242 216
202 3300046474 Ga0495605_0012283 Ga0495605_0012283_1781_2479 216
203 3300046512 Ga0495610_0041445 Ga0495610_0041445_1341_2039 216
204 3300046513 Ga0495616_0034389 Ga0495616_0034389_974_1672 216
205 3300046519 Ga0495632_0083436 Ga0495632_0083436_538_1236 216
206 3300046520 Ga0495637_0063916 Ga0495637_0063916_297_995 216
207 3300046523 Ga0495644_0000278 Ga0495644_0000278_13228_13926 216
208 3300046524 Ga0495648_0012221 Ga0495648_0012221_2118_2816 216
209 3300046530 Ga0495654_0118955 Ga0495654_0118955_212_910 216
210 3300046615 Ga0495656_0087346 Ga0495656_0087346_203_901 216
211 3300046660 Ga0495625_0019920 Ga0495625_0019920_587_1285 216
212 3300046691 Ga0495670_0009802 Ga0495670_0009802_1218_1916 216
213 3300046692 Ga0495671_0034411 Ga0495671_0034411_799_1497 216
214 3300046794 Ga0495589_0015647 Ga0495589_0015647_900_1598 216
215 3300047320 Ga0495672_0008066 Ga0495672_0008066_288_986 216
216 3300047323 Ga0495683_0001738 Ga0495683_0001738_11491_12189 216
217 3300047469 Ga0495673_0072708 Ga0495673_0072708_473_1171 216
218 3300047470 Ga0495681_0000981 Ga0495681_0000981_13639_14337 216
219 3300048089 Ga0495614_0074733 Ga0495614_0074733_153_851 216
220 iso_pu_bacteria 2599185167 2599402187 216
221 iso_pu_bacteria 2599185179 2599454605 216
222 iso_pu_bacteria 2599185190 2599516013 216
223 iso_pu_bacteria 2599185191 2599521812 216
224 iso_pu_bacteria 2599185288 2599882870 216
225 iso_pu_bacteria 2599185290 2599895391 216
226 iso_pu_bacteria 2599185303 2599950989 216
227 iso_pu_bacteria 2643221633 2644190015 216
228 iso_pu_bacteria 2738541294 2738807692 216
229 iso_pu_bacteria 2738541309 2738895052 216
230 iso_pu_bacteria 2834028612 2834032011 216
231 iso_pu_bacteria 2929189879 2929190496 216
232 iso_pu_bacteria 2931390751 2931391590 216
233 3300046810 Ga0495660_0005835 Ga0495660_0005835_1373_2089 217
234 iso_pu_bacteria 2643221565 2643841211 217
235 iso_pu_bacteria 2860339153 2860345629 217
236 iso_pu_bacteria 2919456309 2919460210 217
237 iso_pu_bacteria 2931396565 2931399065 217
238 iso_pu_bacteria 3007619802 3007620889 217
239 iso_pu_bacteria 8056177738 8056182820 217
240 3300013100 Ga0157373_10001143 Ga0157373_100011435 218
241 3300046453 Ga0495627_116131 Ga0495627_116131_39_743 218
242 3300046512 Ga0495610_0001179 Ga0495610_0001179_14821_15525 218
243 3300046530 Ga0495654_0002723 Ga0495654_0002723_8025_8729 218
244 iso_pu_bacteria 2808606445 2809218194 218
245 iso_pu_bacteria 8055817908 8055818608 218
246 3300046452 Ga0495617_008190 Ga0495617_008190_893_1615 219
247 3300046460 Ga0495638_0000910 Ga0495638_0000910_9844_10566 219
248 3300046460 Ga0495638_0002355 Ga0495638_0002355_382_1095 219
249 3300046474 Ga0495605_0014927 Ga0495605_0014927_900_1622 219
250 3300046491 Ga0495584_0098344 Ga0495584_0098344_266_979 219
251 3300046492 Ga0495585_0001333 Ga0495585_0001333_4325_5038 219
252 3300046492 Ga0495585_0001365 Ga0495585_0001365_8375_9097 219
253 3300046507 Ga0495606_0041587 Ga0495606_0041587_2274_2987 219
254 3300046512 Ga0495610_0010659 Ga0495610_0010659_485_1198 219
255 3300046518 Ga0495631_0038245 Ga0495631_0038245_362_1084 219
256 3300046519 Ga0495632_0024436 Ga0495632_0024436_1850_2563 219
257 3300046520 Ga0495637_0001364 Ga0495637_0001364_13645_14367 219
258 3300046520 Ga0495637_0045023 Ga0495637_0045023_592_1305 219
259 3300046530 Ga0495654_0039929 Ga0495654_0039929_286_1008 219
260 3300046530 Ga0495654_0078461 Ga0495654_0078461_549_1262 219
261 3300046538 Ga0495609_0049260 Ga0495609_0049260_550_1272 219
262 3300046542 Ga0495597_0025178 Ga0495597_0025178_1144_1857 219
263 3300046557 Ga0495622_0089187 Ga0495622_0089187_53_775 219
264 3300046694 Ga0495649_0138953 Ga0495649_0138953_267_989 219
265 3300047320 Ga0495672_0002786 Ga0495672_0002786_2208_2915 219
266 3300047469 Ga0495673_0038735 Ga0495673_0038735_1425_2147 219
267 3300047470 Ga0495681_0008238 Ga0495681_0008238_1181_1894 219
268 3300047472 Ga0495686_0002074 Ga0495686_0002074_4525_5238 219
269 3300048091 Ga0495626_0006234 Ga0495626_0006234_309_1031 219
270 3300049459 Ga0495678_046412 Ga0495678_046412_313_1020 219
271 iso_pu_bacteria 2600255318 2601798054 219
272 iso_pu_bacteria 2603880185 2606076463 219
273 iso_pu_bacteria 2603880199 2606129123 219
274 iso_pu_bacteria 2623620443 2624478452 219
275 iso_pu_bacteria 2713897149 2715759571 219
276 iso_pu_bacteria 2878029506 2878030387 219
277 iso_pu_bacteria 2919063839 2919065921 219
278 iso_pu_bacteria 2945928738 2945929957 219
279 iso_pu_bacteria 3007395558 3007399836 219
280 iso_pu_bacteria 8056161164 8056161622 219
281 3300005288 Ga0065714_10064550 Ga0065714_1006455017 220
282 3300005290 Ga0065712_10091402 Ga0065712_100914023 220
283 3300005353 Ga0070669_100000487 Ga0070669_10000048722 220
284 3300005457 Ga0070662_100000137 Ga0070662_1000001377 220
285 3300005539 Ga0068853_100003083 Ga0068853_10000308312 220
286 3300005548 Ga0070665_100180913 Ga0070665_1001809132 220
287 3300005564 Ga0070664_100004017 Ga0070664_10000401711 220
288 3300005578 Ga0068854_100052077 Ga0068854_1000520774 220
289 3300005834 Ga0068851_10000004 Ga0068851_1000000435 220
290 3300009011 Ga0105251_10000378 Ga0105251_1000037815 220
291 3300009011 Ga0105251_10002448 Ga0105251_100024484 220
292 3300009036 Ga0105244_10029320 Ga0105244_100293202 220
293 3300009092 Ga0105250_10015196 Ga0105250_100151964 220
294 3300009148 Ga0105243_10051250 Ga0105243_100512505 220
295 3300009177 Ga0105248_10013078 Ga0105248_100130786 220
296 3300011119 Ga0105246_10005439 Ga0105246_100054396 220
297 3300013100 Ga0157373_10000520 Ga0157373_1000052014 220
298 3300013100 Ga0157373_10000957 Ga0157373_1000095714 220
299 3300013100 Ga0157373_10003846 Ga0157373_1000384611 220
300 3300013105 Ga0157369_10025492 Ga0157369_100254925 220
301 3300013306 Ga0163162_10001902 Ga0163162_100019028 220
302 3300013306 Ga0163162_10109707 Ga0163162_101097074 220
303 3300014497 Ga0182008_10002202 Ga0182008_1000220210 220
304 3300014497 Ga0182008_10003707 Ga0182008_100037072 220
305 3300015261 Ga0182006_1000793 Ga0182006_100079312 220
306 3300015261 Ga0182006_1098899 Ga0182006_10988992 220
307 3300015262 Ga0182007_10056599 Ga0182007_100565992 220
308 3300017792 Ga0163161_10006965 Ga0163161_100069655 220
309 3300017792 Ga0163161_10018631 Ga0163161_100186312 220
310 3300025321 Ga0207656_10000007 Ga0207656_10000007219 220
311 3300025728 Ga0207655_1013895 Ga0207655_10138951 220
312 3300025735 Ga0207713_1000323 Ga0207713_100032323 220
313 3300025735 Ga0207713_1000540 Ga0207713_100054028 220
314 3300025923 Ga0207681_10002871 Ga0207681_100028719 220
315 3300025933 Ga0207706_10000178 Ga0207706_1000017829 220
316 3300025941 Ga0207711_10102403 Ga0207711_101024032 220
317 3300025945 Ga0207679_10031482 Ga0207679_100314823 220
318 3300025981 Ga0207640_10249701 Ga0207640_102497011 220
319 3300026041 Ga0207639_10014912 Ga0207639_100149123 220
320 3300028379 Ga0268266_10287500 Ga0268266_102875002 220
321 3300028794 Ga0307515_10373416 Ga0307515_103734162 220
322 3300031731 Ga0307405_10000102 Ga0307405_1000010217 220
323 3300042009 Ga0439451_026996 Ga0439451_026996_395_1105 220
324 3300042131 Ga0450894_004725 Ga0450894_004725_614_1324 220
325 3300042133 Ga0450896_007777 Ga0450896_007777_732_1442 220
326 3300042134 Ga0450898_000500 Ga0450898_000500_1213_1923 220
327 3300042135 Ga0450899_003279 Ga0450899_003279_766_1476 220
328 3300046452 Ga0495617_012325 Ga0495617_012325_1773_2483 220
329 3300046458 Ga0495591_004093 Ga0495591_004093_2114_2824 220
330 3300046460 Ga0495638_0011875 Ga0495638_0011875_984_1694 220
331 3300046474 Ga0495605_0003210 Ga0495605_0003210_163_873 220
332 3300046491 Ga0495584_0006548 Ga0495584_0006548_4451_5161 220
333 3300046492 Ga0495585_0000748 Ga0495585_0000748_16636_17346 220
334 3300046506 Ga0495583_0001460 Ga0495583_0001460_8183_8893 220
335 3300046507 Ga0495606_0003653 Ga0495606_0003653_14755_15465 220
336 3300046512 Ga0495610_0005126 Ga0495610_0005126_8151_8861 220
337 3300046513 Ga0495616_0009378 Ga0495616_0009378_455_1165 220
338 3300046515 Ga0495620_0006617 Ga0495620_0006617_4256_4966 220
339 3300046520 Ga0495637_0030428 Ga0495637_0030428_1148_1858 220
340 3300046524 Ga0495648_0053914 Ga0495648_0053914_1444_2154 220
341 3300046530 Ga0495654_0000412 Ga0495654_0000412_14948_15658 220
342 3300046530 Ga0495654_0033459 Ga0495654_0033459_1580_2320 220
343 3300046542 Ga0495597_0004542 Ga0495597_0004542_2307_3017 220
344 3300046648 Ga0495611_0087104 Ga0495611_0087104_599_1309 220
345 3300046665 Ga0495661_0001713 Ga0495661_0001713_2726_3436 220
346 3300046665 Ga0495661_0009466 Ga0495661_0009466_4248_4958 220
347 3300046674 Ga0495588_0010988 Ga0495588_0010988_1717_2427 220
348 3300046691 Ga0495670_0014410 Ga0495670_0014410_786_1496 220
349 3300046692 Ga0495671_0006964 Ga0495671_0006964_1623_2333 220
350 3300046692 Ga0495671_0060970 Ga0495671_0060970_1086_1796 220
351 3300046810 Ga0495660_0015245 Ga0495660_0015245_2764_3474 220
352 3300047446 Ga0495679_001838 Ga0495679_001838_2834_3544 220
353 3300047469 Ga0495673_0001076 Ga0495673_0001076_13862_14572 220
354 3300047469 Ga0495673_0009592 Ga0495673_0009592_2147_2857 220
355 3300047470 Ga0495681_0012190 Ga0495681_0012190_426_1136 220
356 3300048091 Ga0495626_0000726 Ga0495626_0000726_15357_16067 220
357 3300048920 Ga0496117_0027875 Ga0496117_0027875_3574_4284 220
358 3300048922 Ga0496119_0104940 Ga0496119_0104940_685_1395 220
359 3300048923 Ga0496120_0006476 Ga0496120_0006476_8075_8785 220
360 3300048924 Ga0496121_0029593 Ga0496121_0029593_4070_4780 220
361 3300048925 Ga0496122_0164034 Ga0496122_0164034_571_1281 220
362 3300048927 Ga0496124_0005979 Ga0496124_0005979_5678_6388 220
363 3300048927 Ga0496124_0029997 Ga0496124_0029997_2070_2780 220
364 3300048928 Ga0496125_0015480 Ga0496125_0015480_1461_2171 220
365 3300048928 Ga0496125_0146537 Ga0496125_0146537_746_1456 220
366 3300048929 Ga0496126_0011442 Ga0496126_0011442_4152_4862 220
367 3300049459 Ga0495678_009530 Ga0495678_009530_1807_2517 220
368 3300049460 Ga0495682_0007293 Ga0495682_0007293_2093_2803 220
369 3300053161 Ga0500634_0000868 Ga0500634_0000868_2647_3357 220
370 iso_pu_bacteria 2511231010 2511292119 220
371 iso_pu_bacteria 2511231011 2511294789 220
372 iso_pu_bacteria 2511231031 2511413821 220
373 iso_pu_bacteria 2597489889 2597867601 220
374 iso_pu_bacteria 2643221571 2643872416 220
375 iso_pu_bacteria 2675903420 2677899555 220
376 iso_pu_bacteria 2713897148 2715753913 220
377 iso_pu_bacteria 2718217725 2718632380 220
378 iso_pu_bacteria 2738543025 2739316818 220
379 iso_pu_bacteria 2773857673 2774134964 220
380 iso_pu_bacteria 2784132063 2784260814 220
381 iso_pu_bacteria 2818991456 2819657459 220
382 iso_pu_bacteria 2842832357 2842834381 220
383 iso_pu_bacteria 2842843487 2842846141 220
384 iso_pu_bacteria 2880230671 2880231342 220
385 iso_pu_bacteria 2904518522 2904519798 220
386 iso_pu_bacteria 2908446538 2908447238 220
387 iso_pu_bacteria 2919385768 2919389549 220
388 iso_pu_bacteria 2919487758 2919488481 220
389 iso_pu_bacteria 2945961074 2945967810 220
390 iso_pu_bacteria 2946006987 2946012290 220
391 iso_pu_bacteria 2946027586 2946028845 220
392 iso_pu_bacteria 2947233263 2947235380 220
393 iso_pu_bacteria 2969304461 2969305183 220
394 iso_pu_bacteria 2974289157 2974293127 220
395 iso_pu_bacteria 2998139840 2998140685 220
396 iso_pu_bacteria 3007718800 3007722144 220
397 iso_pu_bacteria 3007855910 3007859914 220
398 iso_pu_bacteria 3007861166 3007864106 220
399 iso_pu_bacteria 8029995093 8030000054 220
400 iso_pu_bacteria 8056148874 8056152682 220
401 iso_pu_bacteria 8056166840 8056170361 220
402 iso_pu_bacteria 8056172158 8056176488 220
403 iso_pu_bacteria 8056569372 8056573521 220
404 3300013102 Ga0157371_10002656 Ga0157371_1000265615 221
405 3300013104 Ga0157370_10056395 Ga0157370_100563953 221
406 3300015261 Ga0182006_1062786 Ga0182006_10627862 221
407 3300015265 Ga0182005_1014025 Ga0182005_10140253 221
408 3300015265 Ga0182005_1055009 Ga0182005_10550092 221
409 3300028786 Ga0307517_10024989 Ga0307517_100249893 221
410 3300031507 Ga0307509_10025355 Ga0307509_100253554 221
411 3300042009 Ga0439451_000367 Ga0439451_000367_3133_3846 221
412 3300042009 Ga0439451_000406 Ga0439451_000406_564_1277 221
413 3300046453 Ga0495627_009104 Ga0495627_009104_775_1488 221
414 3300046458 Ga0495591_016064 Ga0495591_016064_147_860 221
415 3300046460 Ga0495638_0004095 Ga0495638_0004095_2276_2989 221
416 3300046471 Ga0495650_0032901 Ga0495650_0032901_1345_2058 221
417 3300046474 Ga0495605_0009602 Ga0495605_0009602_2333_3052 221
418 3300046474 Ga0495605_0013957 Ga0495605_0013957_2579_3292 221
419 3300046491 Ga0495584_0051294 Ga0495584_0051294_450_1163 221
420 3300046492 Ga0495585_0016751 Ga0495585_0016751_3387_4100 221
421 3300046501 Ga0495607_0030624 Ga0495607_0030624_2305_3018 221
422 3300046507 Ga0495606_0081022 Ga0495606_0081022_128_841 221
423 3300046513 Ga0495616_0042765 Ga0495616_0042765_547_1260 221
424 3300046515 Ga0495620_0008488 Ga0495620_0008488_626_1339 221
425 3300046518 Ga0495631_0000286 Ga0495631_0000286_1510_2223 221
426 3300046524 Ga0495648_0070908 Ga0495648_0070908_1017_1730 221
427 3300046526 Ga0495666_0159970 Ga0495666_0159970_230_949 221
428 3300046530 Ga0495654_0003741 Ga0495654_0003741_2321_3034 221
429 3300046536 Ga0495587_0023022 Ga0495587_0023022_563_1282 221
430 3300046558 Ga0495633_0001604 Ga0495633_0001604_5701_6414 221
431 3300046616 Ga0495668_0125832 Ga0495668_0125832_331_1044 221
432 3300046642 Ga0495634_0000750 Ga0495634_0000750_16549_17268 221
433 3300046660 Ga0495625_0032472 Ga0495625_0032472_2338_3051 221
434 3300046663 Ga0495635_0000942 Ga0495635_0000942_15701_16420 221
435 3300046679 Ga0495623_0007457 Ga0495623_0007457_4578_5297 221
436 3300046691 Ga0495670_0137577 Ga0495670_0137577_52_765 221
437 3300046810 Ga0495660_0131674 Ga0495660_0131674_147_860 221
438 3300047319 Ga0495674_0020483 Ga0495674_0020483_1771_2490 221
439 3300047322 Ga0495680_0010782 Ga0495680_0010782_2328_3041 221
440 3300047322 Ga0495680_0055316 Ga0495680_0055316_1209_1928 221
441 3300047323 Ga0495683_0000452 Ga0495683_0000452_16636_17349 221
442 3300047469 Ga0495673_0000890 Ga0495673_0000890_14931_15644 221
443 3300047673 Ga0495593_0011499 Ga0495593_0011499_2622_3341 221
444 3300047673 Ga0495593_0024249 Ga0495593_0024249_2106_2819 221
445 3300048909 Ga0496106_0180064 Ga0496106_0180064_724_1443 221
446 3300048922 Ga0496119_0075535 Ga0496119_0075535_1191_1904 221
447 3300048924 Ga0496121_0055549 Ga0496121_0055549_2206_2919 221
448 3300048925 Ga0496122_0008121 Ga0496122_0008121_8134_8847 221
449 3300048926 Ga0496123_0002303 Ga0496123_0002303_8084_8797 221
450 3300048927 Ga0496124_0334065 Ga0496124_0334065_314_1027 221
451 3300048928 Ga0496125_0002443 Ga0496125_0002443_15130_15843 221
452 3300048928 Ga0496125_0004226 Ga0496125_0004226_8454_9167 221
453 3300013105 Ga0157369_10002672 Ga0157369_100026728 222
454 3300017792 Ga0163161_10002849 Ga0163161_100028495 222
455 3300042139 Ga0450904_000401 Ga0450904_000401_1977_2693 222
456 3300046524 Ga0495648_0006966 Ga0495648_0006966_364_1080 222
457 3300046794 Ga0495589_0024165 Ga0495589_0024165_2012_2728 222
458 iso_pu_bacteria 8054285046 8054286356 222
459 3300005288 Ga0065714_10005355 Ga0065714_100053552 223
460 3300005353 Ga0070669_100000956 Ga0070669_1000009564 223
461 3300006048 Ga0075363_100195622 Ga0075363_1001956222 223
462 3300009011 Ga0105251_10011087 Ga0105251_100110872 223
463 3300015261 Ga0182006_1089847 Ga0182006_10898472 223
464 3300025291 Ga0209675_1008238 Ga0209675_10082384 223
465 3300025735 Ga0207713_1007421 Ga0207713_10074212 223
466 3300025923 Ga0207681_10001305 Ga0207681_1000130513 223
467 3300032004 Ga0307414_10317061 Ga0307414_103170612 223
468 3300042009 Ga0439451_000325 Ga0439451_000325_6414_7133 223
469 3300042016 Ga0439463_013773 Ga0439463_013773_519_1238 223
470 3300042137 Ga0450902_000126 Ga0450902_000126_2101_2853 223
471 3300042138 Ga0450903_000290 Ga0450903_000290_3774_4493 223
472 3300042142 Ga0450905_000016 Ga0450905_000016_14531_15250 223
473 3300048919 Ga0496116_0109461 Ga0496116_0109461_633_1352 223
474 3300048920 Ga0496117_0046700 Ga0496117_0046700_2128_2847 223
475 3300048921 Ga0496118_0109646 Ga0496118_0109646_181_900 223
476 3300048924 Ga0496121_0013221 Ga0496121_0013221_277_996 223
477 3300003781 Ga0055536_1000299 Ga0055536_100029917 224
478 3300003781 Ga0055536_1002690 Ga0055536_10026904 224
479 3300003791 Ga0055530_10000340 Ga0055530_1000034022 224
480 3300003792 Ga0055540_1000162 Ga0055540_100016246 224
481 3300003794 Ga0055531_10000734 Ga0055531_1000073415 224
482 3300005288 Ga0065714_10095920 Ga0065714_100959202 224
483 3300005289 Ga0065704_10101121 Ga0065704_101011213 224
484 3300005457 Ga0070662_100014133 Ga0070662_1000141333 224
485 3300006051 Ga0075364_10023533 Ga0075364_100235334 224
486 3300006946 Ga0079104_1008163 Ga0079104_10081632 224
487 3300009011 Ga0105251_10011613 Ga0105251_100116132 224
488 3300009011 Ga0105251_10195102 Ga0105251_101951022 224
489 3300009036 Ga0105244_10001726 Ga0105244_100017267 224
490 3300009036 Ga0105244_10003786 Ga0105244_100037866 224
491 3300009036 Ga0105244_10012893 Ga0105244_100128935 224
492 3300009036 Ga0105244_10134580 Ga0105244_101345802 224
493 3300009092 Ga0105250_10001756 Ga0105250_1000175612 224
494 3300009092 Ga0105250_10002278 Ga0105250_100022789 224
495 3300009092 Ga0105250_10015500 Ga0105250_100155004 224
496 3300009148 Ga0105243_10001399 Ga0105243_100013997 224
497 3300011119 Ga0105246_10001581 Ga0105246_100015814 224
498 3300013100 Ga0157373_10000478 Ga0157373_1000047816 224
499 3300013100 Ga0157373_10041792 Ga0157373_100417922 224
500 3300013100 Ga0157373_10063759 Ga0157373_100637592 224
501 3300013102 Ga0157371_10004342 Ga0157371_1000434212 224
502 3300013104 Ga0157370_10124707 Ga0157370_101247073 224
503 3300013104 Ga0157370_10252986 Ga0157370_102529862 224
504 3300013105 Ga0157369_10089566 Ga0157369_100895664 224
505 3300013105 Ga0157369_10093228 Ga0157369_100932283 224
506 3300013306 Ga0163162_10000902 Ga0163162_1000090220 224
507 3300013306 Ga0163162_10027322 Ga0163162_100273222 224
508 3300013306 Ga0163162_10079639 Ga0163162_100796394 224
509 3300013308 Ga0157375_10030722 Ga0157375_100307223 224
510 3300014497 Ga0182008_10000453 Ga0182008_1000045325 224
511 3300015261 Ga0182006_1001453 Ga0182006_10014534 224
512 3300015261 Ga0182006_1019703 Ga0182006_10197034 224
513 3300015265 Ga0182005_1053790 Ga0182005_10537902 224
514 3300017792 Ga0163161_10004085 Ga0163161_1000408510 224
515 3300017792 Ga0163161_10037911 Ga0163161_100379114 224
516 3300017792 Ga0163161_10234423 Ga0163161_102344232 224
517 3300017792 Ga0163161_10281818 Ga0163161_102818182 224
518 3300017792 Ga0163161_10292061 Ga0163161_102920611 224
519 3300025230 Ga0209563_101022 Ga0209563_1010225 224
520 3300025292 Ga0209676_1000025 Ga0209676_100002546 224
521 3300025292 Ga0209676_1000426 Ga0209676_100042624 224
522 3300025298 Ga0209050_1000500 Ga0209050_100050016 224
523 3300025303 Ga0209051_1000089 Ga0209051_100008947 224
524 3300025304 Ga0209257_1000034 Ga0209257_100003446 224
525 3300025711 Ga0207696_1000494 Ga0207696_100049420 224
526 3300025711 Ga0207696_1002204 Ga0207696_10022049 224
527 3300025728 Ga0207655_1000946 Ga0207655_10009467 224
528 3300025728 Ga0207655_1002034 Ga0207655_100203412 224
529 3300025728 Ga0207655_1002631 Ga0207655_100263114 224
530 3300025735 Ga0207713_1001743 Ga0207713_10017432 224
531 3300025735 Ga0207713_1057402 Ga0207713_10574022 224
532 3300025933 Ga0207706_10024333 Ga0207706_100243333 224
533 3300025935 Ga0207709_10000022 Ga0207709_1000002246 224
534 3300027111 Ga0209281_1006417 Ga0209281_10064174 224
535 3300028379 Ga0268266_10223068 Ga0268266_102230682 224
536 3300030521 Ga0307511_10142496 Ga0307511_101424961 224
537 3300030735 Ga0316178_1157834 Ga0316178_11578349 224
538 3300031548 Ga0307408_100009264 Ga0307408_1000092642 224
539 3300031730 Ga0307516_10280580 Ga0307516_102805801 224
540 3300031911 Ga0307412_10006331 Ga0307412_100063312 224
541 3300031911 Ga0307412_10087703 Ga0307412_100877033 224
542 3300032005 Ga0307411_10055804 Ga0307411_100558043 224
543 3300033180 Ga0307510_10001007 Ga0307510_1000100716 224
544 3300041405 Ga0439438_000202 Ga0439438_000202_9201_9923 224
545 3300041405 Ga0439438_000461 Ga0439438_000461_15251_15973 224
546 3300042004 Ga0439445_0002057 Ga0439445_0002057_2224_2946 224
547 3300042006 Ga0439432_003172 Ga0439432_003172_3204_3926 224
548 3300042009 Ga0439451_003273 Ga0439451_003273_1088_1810 224
549 3300042010 Ga0439452_000279 Ga0439452_000279_16730_17452 224
550 3300042013 Ga0439456_003808 Ga0439456_003808_85_807 224
551 3300042115 Ga0450911_000222 Ga0450911_000222_16626_17348 224
552 3300042130 Ga0450892_007631 Ga0450892_007631_120_842 224
553 3300042138 Ga0450903_001109 Ga0450903_001109_268_990 224
554 3300042145 Ga0450906_000142 Ga0450906_000142_2256_2978 224
555 3300042531 Ga0450918_004664 Ga0450918_004664_1512_2234 224
556 3300042532 Ga0450893_0001166 Ga0450893_0001166_1113_1835 224
557 3300042532 Ga0450893_0012758 Ga0450893_0012758_204_926 224
558 3300046452 Ga0495617_008301 Ga0495617_008301_2100_2822 224
559 3300046452 Ga0495617_009272 Ga0495617_009272_528_1250 224
560 3300046452 Ga0495617_013075 Ga0495617_013075_878_1600 224
561 3300046452 Ga0495617_013134 Ga0495617_013134_1056_1778 224
562 3300046452 Ga0495617_024895 Ga0495617_024895_1068_1790 224
563 3300046452 Ga0495617_055170 Ga0495617_055170_268_990 224
564 3300046453 Ga0495627_000549 Ga0495627_000549_18537_19259 224
565 3300046453 Ga0495627_058420 Ga0495627_058420_281_1003 224
566 3300046454 Ga0495592_0014254 Ga0495592_0014254_3046_3768 224
567 3300046457 Ga0495590_0001031 Ga0495590_0001031_9363_10085 224
568 3300046457 Ga0495590_0001766 Ga0495590_0001766_741_1463 224
569 3300046457 Ga0495590_0012641 Ga0495590_0012641_2312_3034 224
570 3300046458 Ga0495591_000620 Ga0495591_000620_9012_9734 224
571 3300046458 Ga0495591_000952 Ga0495591_000952_16702_17424 224
572 3300046458 Ga0495591_010535 Ga0495591_010535_1965_2687 224
573 3300046458 Ga0495591_010610 Ga0495591_010610_2357_3079 224
574 3300046460 Ga0495638_0003401 Ga0495638_0003401_9610_10332 224
575 3300046460 Ga0495638_0023083 Ga0495638_0023083_2265_2987 224
576 3300046463 Ga0495653_0001932 Ga0495653_0001932_2632_3354 224
577 3300046463 Ga0495653_0112087 Ga0495653_0112087_226_948 224
578 3300046471 Ga0495650_0001112 Ga0495650_0001112_19133_19855 224
579 3300046471 Ga0495650_0003482 Ga0495650_0003482_2110_2832 224
580 3300046491 Ga0495584_0001647 Ga0495584_0001647_10167_10889 224
581 3300046492 Ga0495585_0002556 Ga0495585_0002556_2320_3042 224
582 3300046492 Ga0495585_0013168 Ga0495585_0013168_1785_2507 224
583 3300046501 Ga0495607_0000550 Ga0495607_0000550_20682_21404 224
584 3300046501 Ga0495607_0004334 Ga0495607_0004334_1399_2121 224
585 3300046501 Ga0495607_0014080 Ga0495607_0014080_3660_4382 224
586 3300046501 Ga0495607_0017469 Ga0495607_0017469_2187_2909 224
587 3300046501 Ga0495607_0023361 Ga0495607_0023361_2121_2843 224
588 3300046501 Ga0495607_0032769 Ga0495607_0032769_2055_2777 224
589 3300046506 Ga0495583_0002079 Ga0495583_0002079_16898_17620 224
590 3300046507 Ga0495606_0002205 Ga0495606_0002205_13822_14544 224
591 3300046507 Ga0495606_0011154 Ga0495606_0011154_4478_5200 224
592 3300046507 Ga0495606_0027041 Ga0495606_0027041_1133_1855 224
593 3300046512 Ga0495610_0001556 Ga0495610_0001556_18438_19160 224
594 3300046512 Ga0495610_0018408 Ga0495610_0018408_2309_3031 224
595 3300046513 Ga0495616_0000505 Ga0495616_0000505_11962_12684 224
596 3300046513 Ga0495616_0000511 Ga0495616_0000511_19134_19856 224
597 3300046515 Ga0495620_0001051 Ga0495620_0001051_2464_3186 224
598 3300046515 Ga0495620_0003252 Ga0495620_0003252_2075_2797 224
599 3300046518 Ga0495631_0000532 Ga0495631_0000532_17210_17932 224
600 3300046518 Ga0495631_0014785 Ga0495631_0014785_2117_2839 224
601 3300046519 Ga0495632_0000497 Ga0495632_0000497_18344_19066 224
602 3300046519 Ga0495632_0058350 Ga0495632_0058350_546_1268 224
603 3300046519 Ga0495632_0064957 Ga0495632_0064957_917_1639 224
604 3300046520 Ga0495637_0000655 Ga0495637_0000655_18439_19161 224
605 3300046522 Ga0495643_0002882 Ga0495643_0002882_617_1339 224
606 3300046522 Ga0495643_0021217 Ga0495643_0021217_914_1636 224
607 3300046524 Ga0495648_0000215 Ga0495648_0000215_34918_35640 224
608 3300046524 Ga0495648_0000735 Ga0495648_0000735_17944_18666 224
609 3300046524 Ga0495648_0041652 Ga0495648_0041652_2154_2876 224
610 3300046526 Ga0495666_0001177 Ga0495666_0001177_7497_8219 224
611 3300046530 Ga0495654_0004154 Ga0495654_0004154_1295_2017 224
612 3300046530 Ga0495654_0022278 Ga0495654_0022278_351_1073 224
613 3300046530 Ga0495654_0032070 Ga0495654_0032070_870_1592 224
614 3300046536 Ga0495587_0012305 Ga0495587_0012305_2768_3490 224
615 3300046538 Ga0495609_0012433 Ga0495609_0012433_1353_2075 224
616 3300046538 Ga0495609_0014930 Ga0495609_0014930_740_1462 224
617 3300046542 Ga0495597_0006301 Ga0495597_0006301_5390_6112 224
618 3300046543 Ga0495645_0011416 Ga0495645_0011416_2955_3677 224
619 3300046557 Ga0495622_0011990 Ga0495622_0011990_1305_2027 224
620 3300046558 Ga0495633_0006087 Ga0495633_0006087_4308_5030 224
621 3300046616 Ga0495668_0028975 Ga0495668_0028975_2149_2871 224
622 3300046642 Ga0495634_0007094 Ga0495634_0007094_2331_3053 224
623 3300046648 Ga0495611_0000255 Ga0495611_0000255_2315_3037 224
624 3300046660 Ga0495625_0002197 Ga0495625_0002197_2542_3264 224
625 3300046660 Ga0495625_0070957 Ga0495625_0070957_586_1308 224
626 3300046665 Ga0495661_0015380 Ga0495661_0015380_2178_2900 224
627 3300046665 Ga0495661_0030675 Ga0495661_0030675_2166_2888 224
628 3300046665 Ga0495661_0082255 Ga0495661_0082255_747_1469 224
629 3300046665 Ga0495661_0138151 Ga0495661_0138151_559_1281 224
630 3300046674 Ga0495588_0023567 Ga0495588_0023567_2145_2867 224
631 3300046680 Ga0495646_0016256 Ga0495646_0016256_2410_3132 224
632 3300046689 Ga0495613_0002793 Ga0495613_0002793_8217_8939 224
633 3300046689 Ga0495613_0036504 Ga0495613_0036504_726_1448 224
634 3300046690 Ga0495624_0000185 Ga0495624_0000185_21635_22357 224
635 3300046691 Ga0495670_0000410 Ga0495670_0000410_1353_2075 224
636 3300046692 Ga0495671_0016278 Ga0495671_0016278_2328_3050 224
637 3300046692 Ga0495671_0023634 Ga0495671_0023634_378_1100 224
638 3300046694 Ga0495649_0002896 Ga0495649_0002896_8969_9691 224
639 3300046794 Ga0495589_0004022 Ga0495589_0004022_2763_3485 224
640 3300046809 Ga0495600_0046433 Ga0495600_0046433_935_1657 224
641 3300046810 Ga0495660_0000504 Ga0495660_0000504_15621_16343 224
642 3300046810 Ga0495660_0243870 Ga0495660_0243870_101_823 224
643 3300047317 Ga0495604_0011205 Ga0495604_0011205_3954_4676 224
644 3300047320 Ga0495672_0000726 Ga0495672_0000726_13944_14666 224
645 3300047320 Ga0495672_0009193 Ga0495672_0009193_2257_2979 224
646 3300047320 Ga0495672_0028260 Ga0495672_0028260_509_1231 224
647 3300047320 Ga0495672_0033347 Ga0495672_0033347_917_1639 224
648 3300047321 Ga0495676_0000884 Ga0495676_0000884_16221_16943 224
649 3300047321 Ga0495676_0001079 Ga0495676_0001079_21002_21724 224
650 3300047322 Ga0495680_0001910 Ga0495680_0001910_19068_19790 224
651 3300047323 Ga0495683_0016173 Ga0495683_0016173_871_1593 224
652 3300047444 Ga0495675_0137170 Ga0495675_0137170_247_969 224
653 3300047446 Ga0495679_004171 Ga0495679_004171_3740_4462 224
654 3300047469 Ga0495673_0002437 Ga0495673_0002437_10168_10890 224
655 3300047470 Ga0495681_0000171 Ga0495681_0000171_15160_15882 224
656 3300047470 Ga0495681_0000508 Ga0495681_0000508_18889_19611 224
657 3300047470 Ga0495681_0008861 Ga0495681_0008861_4300_5022 224
658 3300047470 Ga0495681_0016417 Ga0495681_0016417_1303_2025 224
659 3300047470 Ga0495681_0027611 Ga0495681_0027611_1404_2126 224
660 3300047471 Ga0495684_0002673 Ga0495684_0002673_2407_3129 224
661 3300047472 Ga0495686_0011047 Ga0495686_0011047_2250_2972 224
662 3300047472 Ga0495686_0030379 Ga0495686_0030379_2300_3022 224
663 3300047673 Ga0495593_0006571 Ga0495593_0006571_2354_3076 224
664 3300048088 Ga0495602_0000848 Ga0495602_0000848_10970_11692 224
665 3300048091 Ga0495626_0010707 Ga0495626_0010707_1965_2687 224
666 3300048091 Ga0495626_0015308 Ga0495626_0015308_1263_1985 224
667 3300048919 Ga0496116_0001012 Ga0496116_0001012_22769_23491 224
668 3300048919 Ga0496116_0002599 Ga0496116_0002599_1900_2622 224
669 3300048919 Ga0496116_0012636 Ga0496116_0012636_3905_4627 224
670 3300048919 Ga0496116_0049883 Ga0496116_0049883_1248_1970 224
671 3300048920 Ga0496117_0000712 Ga0496117_0000712_13936_14658 224
672 3300048920 Ga0496117_0003653 Ga0496117_0003653_14829_15551 224
673 3300048920 Ga0496117_0006175 Ga0496117_0006175_11354_12076 224
674 3300048920 Ga0496117_0015564 Ga0496117_0015564_3348_4070 224
675 3300048921 Ga0496118_0005607 Ga0496118_0005607_10764_11486 224
676 3300048921 Ga0496118_0039993 Ga0496118_0039993_2104_2826 224
677 3300048922 Ga0496119_0003010 Ga0496119_0003010_3184_3906 224
678 3300048922 Ga0496119_0011059 Ga0496119_0011059_5062_5784 224
679 3300048923 Ga0496120_0001345 Ga0496120_0001345_15558_16280 224
680 3300048923 Ga0496120_0020080 Ga0496120_0020080_1279_2001 224
681 3300048924 Ga0496121_0005084 Ga0496121_0005084_903_1625 224
682 3300048924 Ga0496121_0006906 Ga0496121_0006906_1850_2572 224
683 3300048925 Ga0496122_0004317 Ga0496122_0004317_4197_4919 224
684 3300048925 Ga0496122_0009196 Ga0496122_0009196_9610_10332 224
685 3300048925 Ga0496122_0009764 Ga0496122_0009764_2065_2787 224
686 3300048926 Ga0496123_0008403 Ga0496123_0008403_7583_8305 224
687 3300048926 Ga0496123_0010737 Ga0496123_0010737_5132_5854 224
688 3300048926 Ga0496123_0035016 Ga0496123_0035016_1736_2458 224
689 3300048927 Ga0496124_0001071 Ga0496124_0001071_13865_14587 224
690 3300048927 Ga0496124_0007771 Ga0496124_0007771_3177_3899 224
691 3300048928 Ga0496125_0000948 Ga0496125_0000948_14794_15516 224
692 3300048928 Ga0496125_0064739 Ga0496125_0064739_584_1306 224
693 3300049459 Ga0495678_001271 Ga0495678_001271_17406_18128 224
694 3300049459 Ga0495678_015047 Ga0495678_015047_2483_3205 224
695 3300049460 Ga0495682_0001524 Ga0495682_0001524_9427_10149 224
696 3300049460 Ga0495682_0002821 Ga0495682_0002821_5134_5856 224
697 3300049673 Ga0501240_000795 Ga0501240_000795_320_1042 224
698 3300049758 Ga0501241_000245 Ga0501241_000245_9255_9977 224
699 3300049766 Ga0501269_002785 Ga0501269_002785_1143_1865 224
700 3300050491 nmdc:mga00v17_14617_c2 nmdc:mga00v17_14617_c2_212_934 224
701 3300053111 Ga0500572_000413 Ga0500572_000413_2183_2905 224
702 iso_pu_bacteria 2554235341 2555667643 224
703 iso_pu_bacteria 2599185160 2599356862 224
704 iso_pu_bacteria 2599185161 2599363108 224
705 iso_pu_bacteria 2599185162 2599369940 224
706 iso_pu_bacteria 2599185163 2599376217 224
707 iso_pu_bacteria 2599185164 2599381967 224
708 iso_pu_bacteria 2599185165 2599387889 224
709 iso_pu_bacteria 2599185166 2599395585 224
710 iso_pu_bacteria 2599185168 2599407350 224
711 iso_pu_bacteria 2599185181 2599463695 224
712 iso_pu_bacteria 2599185182 2599468957 224
713 iso_pu_bacteria 2599185186 2599492714 224
714 iso_pu_bacteria 2599185356 2600216324 224
715 iso_pu_bacteria 2600255313 2601776491 224
716 iso_pu_bacteria 2667528171 2671099749 224
717 iso_pu_bacteria 2818991464 2819705435 224
718 iso_pu_bacteria 2917070673 2917071396 224
719 iso_pu_bacteria 2935353572 2935359222 224
720 iso_pu_bacteria 637000220 637318035 224
721 iso_pu_bacteria 8019769354 8019770514 224
722 iso_pu_bacteria 8057798959 8057802921 224
723 3300046512 Ga0495610_0009308 Ga0495610_0009308_1181_1921 226
724 3300002737 JGI25162J39368_1000195 JGI25162J39368_100019516 228
725 3300002771 JGI25163J39215_1000123 JGI25163J39215_100012315 228
726 3300002772 JGI25164J39214_1000225 JGI25164J39214_100022528 228
727 3300003214 JGI25165J46597_1000291 JGI25165J46597_100029116 228
728 3300009148 Ga0105243_10000225 Ga0105243_1000022548 228
729 3300013102 Ga0157371_10001273 Ga0157371_1000127316 228
730 3300014497 Ga0182008_10002063 Ga0182008_100020636 228
731 3300025207 Ga0209760_100031 Ga0209760_10003127 228
732 3300025231 Ga0207427_100067 Ga0207427_100067114 228
733 3300025233 Ga0209437_100016 Ga0209437_10001644 228
734 3300025261 Ga0209233_1000156 Ga0209233_1000156114 228
735 3300025935 Ga0207709_10000634 Ga0207709_1000063425 228
736 3300048919 Ga0496116_0000338 Ga0496116_0000338_25945_26679 228
737 3300048920 Ga0496117_0005368 Ga0496117_0005368_11254_11988 228
738 3300048921 Ga0496118_0028792 Ga0496118_0028792_1545_2279 228
739 3300048924 Ga0496121_0000713 Ga0496121_0000713_48533_49267 228
740 3300048925 Ga0496122_0003076 Ga0496122_0003076_9922_10656 228
741 3300048926 Ga0496123_0004296 Ga0496123_0004296_11773_12507 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13414

TPR_11

TPR repeat

121

161

0.97

PF13181

TPR_8

Tetratricopeptide repeat

114

147

0.93

PF14559

TPR_19

Tetratricopeptide repeat

124

183

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.8593 102 181
7msp-assembly2.cif.gz_B suns glycosin s-glycosyltransferase 0.7868 102 191
7msn-assembly1.cif.gz_A suns glycosin s-glycosyltransferase 0.7642 102 198
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.7561 120 197
4uzy-assembly1.cif.gz_A crystal structure of the chlamydomonas ift70 and ift52 complex 0.7521 103 197
ID Description Score Start End Superfamily
af_Q8N394_759_830_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9649 103 169 1.25.40.10
af_Q8IUR5_529_612_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9581 103 181 1.25.40.10
af_Q4DCN5_349_413_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9503 103 164 1.25.40.10
af_M0RBH7_295_374_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9482 102 169 1.25.40.10
af_Q67YJ9_465_551_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9446 107 181 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0P9VN55-F1-model_v4 Uncharacterized protein 0.8509 113 215
AF-A0A0P9VN55-F1-model_v4 Uncharacterized protein 0.8196 113 215
AF-A0A3M3ZFS6-F1-model_v4 Uncharacterized protein 0.7929 101 220
AF-A0A0P9P984-F1-model_v4 Lipoprotein 0.7844 10 114
AF-A0A7S0MD92-F1-model_v4 Uncharacterized protein 0.7552 102 212 GO:0051087

Feature Viewer

pLDDT pTM Quality
78.59 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map