F478601
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 741 | 411 | 597 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0001712|Ga0466970_0001712_8845_9900 |
| Length | 351 |
| Sequence | MTDATTPSPAADGTDASRASRPMLQQRRGHEYTRILAFGAARGENVVPNDDLVGPIDSSDEWIRQRTGIVTRKRAGADVEAVDLAETAAREAIEKAGITPDQIGVVLVSTVTHTVATPSMASLLAERIGATPAAAYDVSAACAGYAYGIAQADSFIKSGLADHVLVVGAEKLSDVVDPTDRSISFLLGDGAGAAVVGPSDFPGIAPTIWGSDGSKWDAIGMTATYNEWAAGAPRPTMRQAGQTVFRWAVWEMVKVARQALETAGVAPEDLAAFVPHQANIRIIDEFAKQLGLPDTVTIARDITTTGNTSAASIPLATHRLLEEHPELSGGLALQIGFGAGLVFGAQVVVLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 3 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 4 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 5 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 6 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 7 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 8 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 9 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 10 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 11 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 12 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 13 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 14 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 15 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 16 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 17 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 18 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 19 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 20 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 21 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 22 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 23 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 24 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 25 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 26 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 27 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 28 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 29 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 30 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 31 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 32 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 33 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 34 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 35 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 36 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 37 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 38 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 39 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 40 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 41 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 42 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 43 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 44 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 45 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 46 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 47 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 48 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 49 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 50 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 51 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 52 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 53 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 54 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 55 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 56 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 57 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 58 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 59 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 60 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 61 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 62 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 63 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 64 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 65 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 66 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 67 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 68 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 69 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 70 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 71 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 72 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 73 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 74 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 75 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 76 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 77 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 78 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 79 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 80 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 81 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 82 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 83 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 84 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 85 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 86 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 87 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 88 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 89 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 90 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 91 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 92 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 93 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 94 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 95 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 96 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 97 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 98 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 99 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 100 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 101 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 102 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 103 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 104 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 105 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 106 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 107 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 108 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 109 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 110 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 111 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 112 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 113 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 114 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 115 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 116 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 117 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 118 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 119 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 120 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 121 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 122 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 123 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 124 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 125 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 126 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 127 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 128 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 129 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 130 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 131 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 132 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 133 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 134 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 135 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 136 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 137 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 138 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 139 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 140 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 141 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 142 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 143 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 144 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 145 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 146 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 147 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 150 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 158 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 159 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 160 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 161 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 162 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 163 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 164 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 165 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 166 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 167 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 168 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 169 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 184 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 192 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 201 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 246 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 247 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 248 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 251 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 252 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 268 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 269 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 270 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 271 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 272 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 273 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 275 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 276 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 277 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 278 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 279 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 280 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 281 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 282 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 283 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 284 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 285 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 286 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 292 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 385 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 386 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 387 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 389 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 390 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 394 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 395 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 396 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 398 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 401 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 402 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 403 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 404 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 405 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 406 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 407 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 408 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 409 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 410 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 411 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.68 |
| Metatranscriptomes | 1.89 |
| Isolates | 19.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 10.12 |
| Nodule | 0 |
| Rhizoplane | 6.48 |
| Rhizosphere | 62.08 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 20.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10019274 | 3300001979 | Bacteria | 2406 |
| 2 | JGI25164J39214_1001094 | 3300002772 | Bacteria | 7828 |
| 3 | JGI25165J46597_1000002 | 3300003214 | Bacteria | 765387 |
| 4 | Ga0007423J48922_100085 | 3300003285 | Bacteria | 5105 |
| 5 | Ga0006781J51513_1016252 | 3300003568 | Bacteria | 1970 |
| 6 | Ga0006562J51391_1010318 | 3300003578 | Bacteria | 3705 |
| 7 | Ga0006562J51391_1010319 | 3300003578 | Bacteria | 3480 |
| 8 | Ga0006562J51391_1043582 | 3300003578 | Bacteria | 3561 |
| 9 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 10 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 11 | Ga0055525_1001682 | 3300003759 | Bacteria | 3362 |
| 12 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 13 | Ga0055542_1002506 | 3300003762 | Bacteria | 5934 |
| 14 | Ga0055529_1000065 | 3300003763 | Bacteria | 173112 |
| 15 | Ga0055541_1001922 | 3300003841 | Bacteria | 4302 |
| 16 | Ga0070658_10022612 | 3300005327 | Bacteria | 5045 |
| 17 | Ga0070658_10039005 | 3300005327 | Bacteria | 3831 |
| 18 | Ga0070658_10074571 | 3300005327 | Bacteria | 2782 |
| 19 | Ga0070666_10118330 | 3300005335 | Bacteria | 1836 |
| 20 | Ga0068868_100070367 | 3300005338 | Bacteria | 2790 |
| 21 | Ga0070660_100052441 | 3300005339 | Bacteria | 3145 |
| 22 | Ga0070669_100107544 | 3300005353 | Bacteria | 2113 |
| 23 | Ga0070671_100157352 | 3300005355 | Bacteria | 1920 |
| 24 | Ga0070659_100001568 | 3300005366 | Bacteria | 16463 |
| 25 | Ga0070659_100029781 | 3300005366 | Bacteria | 4220 |
| 26 | Ga0070667_100018034 | 3300005367 | Bacteria | 5850 |
| 27 | Ga0070663_100346367 | 3300005455 | Bacteria | 1202 |
| 28 | Ga0070685_10015029 | 3300005466 | Bacteria | 4109 |
| 29 | Ga0068853_100100228 | 3300005539 | Bacteria | 2560 |
| 30 | Ga0068855_100025111 | 3300005563 | Bacteria | 7134 |
| 31 | Ga0068855_100141129 | 3300005563 | Bacteria | 2746 |
| 32 | Ga0068855_100610323 | 3300005563 | Bacteria | 1175 |
| 33 | Ga0068857_100179652 | 3300005577 | Bacteria | 1926 |
| 34 | Ga0068854_100040007 | 3300005578 | Bacteria | 3305 |
| 35 | Ga0068852_100002346 | 3300005616 | Bacteria | 13031 |
| 36 | Ga0068851_10000003 | 3300005834 | Bacteria | 293018 |
| 37 | Ga0068858_100000114 | 3300005842 | Bacteria | 84795 |
| 38 | Ga0075365_10007107 | 3300006038 | Bacteria | 6243 |
| 39 | Ga0075365_10007174 | 3300006038 | Bacteria | 6221 |
| 40 | Ga0075365_10075558 | 3300006038 | Bacteria | 2274 |
| 41 | Ga0075364_10015746 | 3300006051 | Bacteria | 4694 |
| 42 | Ga0075364_10021485 | 3300006051 | Bacteria | 4069 |
| 43 | Ga0075364_10038271 | 3300006051 | Bacteria | 3107 |
| 44 | Ga0075432_10002026 | 3300006058 | Bacteria | 6735 |
| 45 | Ga0075367_10049284 | 3300006178 | Bacteria | 2482 |
| 46 | Ga0075369_10013652 | 3300006186 | Bacteria | 3230 |
| 47 | Ga0105244_10004742 | 3300009036 | Bacteria | 9257 |
| 48 | Ga0105244_10019348 | 3300009036 | Bacteria | 3803 |
| 49 | Ga0105240_10001674 | 3300009093 | Bacteria | 37626 |
| 50 | Ga0111539_10696939 | 3300009094 | Bacteria | 1182 |
| 51 | Ga0105245_10020927 | 3300009098 | Bacteria | 5735 |
| 52 | Ga0105243_10028060 | 3300009148 | Bacteria | 4318 |
| 53 | Ga0105243_10088709 | 3300009148 | Bacteria | 2541 |
| 54 | Ga0105243_10155422 | 3300009148 | Bacteria | 1966 |
| 55 | Ga0105248_10059248 | 3300009177 | Bacteria | 4300 |
| 56 | Ga0105237_10334434 | 3300009545 | Bacteria | 1519 |
| 57 | Ga0105238_10003197 | 3300009551 | Bacteria | 16352 |
| 58 | Ga0105249_10302755 | 3300009553 | Bacteria | 1604 |
| 59 | Ga0105239_10462870 | 3300010375 | Bacteria | 1439 |
| 60 | Ga0105246_10000351 | 3300011119 | Bacteria | 24715 |
| 61 | Ga0105246_10002288 | 3300011119 | Bacteria | 11546 |
| 62 | Ga0105246_10171443 | 3300011119 | Bacteria | 1662 |
| 63 | Ga0105246_10299568 | 3300011119 | Bacteria | 1297 |
| 64 | Ga0157373_10006949 | 3300013100 | Bacteria | 8426 |
| 65 | Ga0157370_10005607 | 3300013104 | Bacteria | 14052 |
| 66 | Ga0157370_10008506 | 3300013104 | Bacteria | 11069 |
| 67 | Ga0157370_10231816 | 3300013104 | Bacteria | 1709 |
| 68 | Ga0157369_10001845 | 3300013105 | Bacteria | 25607 |
| 69 | Ga0157369_10087698 | 3300013105 | Bacteria | 3322 |
| 70 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 71 | Ga0157374_10574006 | 3300013296 | Bacteria | 1137 |
| 72 | Ga0163162_10145288 | 3300013306 | Bacteria | 2487 |
| 73 | Ga0163162_10212625 | 3300013306 | Bacteria | 2064 |
| 74 | Ga0163162_10245124 | 3300013306 | Bacteria | 1923 |
| 75 | Ga0157372_10017895 | 3300013307 | Bacteria | 7614 |
| 76 | Ga0157372_10637049 | 3300013307 | Bacteria | 1242 |
| 77 | Ga0157375_10362126 | 3300013308 | Bacteria | 1616 |
| 78 | Ga0157380_10009134 | 3300014326 | Bacteria | 7089 |
| 79 | Ga0157380_10222234 | 3300014326 | Bacteria | 1690 |
| 80 | Ga0157379_10003445 | 3300014968 | Bacteria | 13388 |
| 81 | Ga0197907_10640432 | 3300020069 | Bacteria | 6017 |
| 82 | Ga0206353_10586218 | 3300020082 | Bacteria | 6002 |
| 83 | Ga0206353_10968007 | 3300020082 | Bacteria | 3146 |
| 84 | Ga0209566_100455 | 3300025225 | Bacteria | 30192 |
| 85 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 86 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 87 | Ga0209147_100505 | 3300025229 | Bacteria | 22687 |
| 88 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 89 | Ga0209563_105455 | 3300025230 | Bacteria | 2304 |
| 90 | Ga0207427_100052 | 3300025231 | Bacteria | 218228 |
| 91 | Ga0209437_100816 | 3300025233 | Bacteria | 13979 |
| 92 | Ga0207425_1003428 | 3300025245 | Bacteria | 5079 |
| 93 | Ga0209646_1000167 | 3300025246 | Bacteria | 87036 |
| 94 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 95 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 96 | Ga0209148_1003448 | 3300025254 | Bacteria | 4372 |
| 97 | Ga0209129_1000028 | 3300025258 | Bacteria | 405451 |
| 98 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 99 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 100 | Ga0209025_1000428 | 3300025294 | Bacteria | 83354 |
| 101 | Ga0209051_1005262 | 3300025303 | Bacteria | 7622 |
| 102 | Ga0209051_1010966 | 3300025303 | Bacteria | 4521 |
| 103 | Ga0207697_10016651 | 3300025315 | Bacteria | 3028 |
| 104 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 105 | Ga0207655_1003680 | 3300025728 | Bacteria | 11300 |
| 106 | Ga0207655_1003821 | 3300025728 | Bacteria | 10983 |
| 107 | Ga0207655_1004759 | 3300025728 | Bacteria | 9470 |
| 108 | Ga0207692_10054020 | 3300025898 | Bacteria | 2049 |
| 109 | Ga0207688_10076748 | 3300025901 | Bacteria | 1903 |
| 110 | Ga0207680_10088610 | 3300025903 | Bacteria | 1962 |
| 111 | Ga0207680_10100177 | 3300025903 | Bacteria | 1860 |
| 112 | Ga0207647_10015346 | 3300025904 | Bacteria | 5254 |
| 113 | Ga0207645_10043147 | 3300025907 | Bacteria | 2886 |
| 114 | Ga0207643_10020442 | 3300025908 | Bacteria | 3633 |
| 115 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 116 | Ga0207705_10124801 | 3300025909 | Bacteria | 1912 |
| 117 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 118 | Ga0207695_10002367 | 3300025913 | Bacteria | 28011 |
| 119 | Ga0207695_10038666 | 3300025913 | Bacteria | 5134 |
| 120 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 121 | Ga0207657_10008307 | 3300025919 | Bacteria | 10562 |
| 122 | Ga0207681_10066294 | 3300025923 | Bacteria | 2499 |
| 123 | Ga0207694_10000092 | 3300025924 | Bacteria | 100605 |
| 124 | Ga0207687_10009754 | 3300025927 | Bacteria | 6280 |
| 125 | Ga0207644_10236090 | 3300025931 | Bacteria | 1454 |
| 126 | Ga0207690_10000972 | 3300025932 | Bacteria | 18349 |
| 127 | Ga0207709_10012186 | 3300025935 | Bacteria | 4740 |
| 128 | Ga0207669_10127085 | 3300025937 | Bacteria | 1744 |
| 129 | Ga0207691_10002070 | 3300025940 | Bacteria | 19565 |
| 130 | Ga0207711_10000354 | 3300025941 | Bacteria | 48744 |
| 131 | Ga0207667_10005363 | 3300025949 | Bacteria | 15633 |
| 132 | Ga0207667_10006093 | 3300025949 | Bacteria | 14658 |
| 133 | Ga0207667_10007363 | 3300025949 | Bacteria | 13242 |
| 134 | Ga0207667_10098097 | 3300025949 | Bacteria | 3024 |
| 135 | Ga0207667_10226368 | 3300025949 | Bacteria | 1916 |
| 136 | Ga0207668_10256352 | 3300025972 | Bacteria | 1423 |
| 137 | Ga0207640_10361171 | 3300025981 | Bacteria | 1170 |
| 138 | Ga0207658_10004577 | 3300025986 | Bacteria | 9598 |
| 139 | Ga0207703_10000315 | 3300026035 | Bacteria | 52633 |
| 140 | Ga0207639_10074184 | 3300026041 | Bacteria | 2671 |
| 141 | Ga0207678_10018693 | 3300026067 | Bacteria | 6085 |
| 142 | Ga0207678_10123930 | 3300026067 | Bacteria | 2205 |
| 143 | Ga0207702_10012308 | 3300026078 | Bacteria | 7121 |
| 144 | Ga0207674_10116206 | 3300026116 | Bacteria | 2647 |
| 145 | Ga0207675_100137987 | 3300026118 | Bacteria | 2315 |
| 146 | Ga0207683_10047950 | 3300026121 | Bacteria | 3740 |
| 147 | Ga0207698_10000255 | 3300026142 | Bacteria | 32639 |
| 148 | Ga0207698_10003348 | 3300026142 | Bacteria | 9650 |
| 149 | Ga0207428_10019201 | 3300027907 | Bacteria | 5829 |
| 150 | Ga0307515_10185737 | 3300028794 | Bacteria | 2009 |
| 151 | Ga0316176_1094005 | 3300030732 | Bacteria | 2553 |
| 152 | Ga0316179_1000242 | 3300030734 | Bacteria | 1797 |
| 153 | Ga0316181_1152364 | 3300030744 | Bacteria | 1262 |
| 154 | Ga0307513_10218588 | 3300031456 | Bacteria | 1729 |
| 155 | Ga0307408_100009334 | 3300031548 | Bacteria | 6465 |
| 156 | Ga0307408_100055671 | 3300031548 | Bacteria | 2865 |
| 157 | Ga0307408_100058972 | 3300031548 | Bacteria | 2792 |
| 158 | Ga0307408_100079005 | 3300031548 | Bacteria | 2454 |
| 159 | Ga0307408_100115111 | 3300031548 | Bacteria | 2073 |
| 160 | Ga0307408_100133340 | 3300031548 | Bacteria | 1940 |
| 161 | Ga0307408_100168538 | 3300031548 | Bacteria | 1746 |
| 162 | Ga0307514_10053074 | 3300031649 | Bacteria | 3130 |
| 163 | Ga0316575_10000173 | 3300031665 | Bacteria | 16605 |
| 164 | Ga0307405_10010498 | 3300031731 | Bacteria | 4805 |
| 165 | Ga0307405_10011400 | 3300031731 | Bacteria | 4657 |
| 166 | Ga0307405_10034210 | 3300031731 | Bacteria | 3021 |
| 167 | Ga0307405_10119561 | 3300031731 | Bacteria | 1800 |
| 168 | Ga0307405_10190162 | 3300031731 | Bacteria | 1482 |
| 169 | Ga0307405_10265623 | 3300031731 | Bacteria | 1284 |
| 170 | Ga0307413_10040512 | 3300031824 | Bacteria | 2719 |
| 171 | Ga0307413_10124419 | 3300031824 | Bacteria | 1753 |
| 172 | Ga0307413_10163054 | 3300031824 | Bacteria | 1568 |
| 173 | Ga0307410_10000483 | 3300031852 | Bacteria | 16146 |
| 174 | Ga0307410_10007830 | 3300031852 | Bacteria | 5880 |
| 175 | Ga0307410_10011356 | 3300031852 | Bacteria | 5090 |
| 176 | Ga0307410_10014438 | 3300031852 | Bacteria | 4646 |
| 177 | Ga0307410_10069048 | 3300031852 | Bacteria | 2443 |
| 178 | Ga0307410_10071860 | 3300031852 | Bacteria | 2401 |
| 179 | Ga0307410_10227054 | 3300031852 | Bacteria | 1439 |
| 180 | Ga0307406_10000123 | 3300031901 | Bacteria | 45640 |
| 181 | Ga0307406_10000602 | 3300031901 | Bacteria | 20583 |
| 182 | Ga0307406_10111773 | 3300031901 | Bacteria | 1882 |
| 183 | Ga0307407_10033482 | 3300031903 | Bacteria | 2804 |
| 184 | Ga0307407_10054479 | 3300031903 | Bacteria | 2307 |
| 185 | Ga0307407_10063154 | 3300031903 | Bacteria | 2171 |
| 186 | Ga0307407_10091901 | 3300031903 | Bacteria | 1862 |
| 187 | Ga0307407_10130134 | 3300031903 | Bacteria | 1609 |
| 188 | Ga0307412_10004963 | 3300031911 | Bacteria | 7437 |
| 189 | Ga0307412_10006489 | 3300031911 | Bacteria | 6616 |
| 190 | Ga0307412_10017086 | 3300031911 | Bacteria | 4337 |
| 191 | Ga0307412_10024794 | 3300031911 | Bacteria | 3706 |
| 192 | Ga0307412_10030909 | 3300031911 | Bacteria | 3377 |
| 193 | Ga0307412_10142146 | 3300031911 | Bacteria | 1759 |
| 194 | Ga0307412_10176691 | 3300031911 | Bacteria | 1601 |
| 195 | Ga0307412_10383330 | 3300031911 | Bacteria | 1139 |
| 196 | Ga0307409_100016562 | 3300031995 | Bacteria | 4881 |
| 197 | Ga0307409_100017020 | 3300031995 | Bacteria | 4831 |
| 198 | Ga0307409_100018981 | 3300031995 | Bacteria | 4642 |
| 199 | Ga0307409_100059527 | 3300031995 | Bacteria | 2973 |
| 200 | Ga0307409_100096756 | 3300031995 | Bacteria | 2436 |
| 201 | Ga0307409_100198952 | 3300031995 | Bacteria | 1791 |
| 202 | Ga0307409_100240160 | 3300031995 | Bacteria | 1649 |
| 203 | Ga0307416_100007835 | 3300032002 | Bacteria | 6828 |
| 204 | Ga0307416_100025951 | 3300032002 | Bacteria | 4308 |
| 205 | Ga0307416_100027551 | 3300032002 | Bacteria | 4210 |
| 206 | Ga0307416_100040980 | 3300032002 | Bacteria | 3603 |
| 207 | Ga0307416_100055902 | 3300032002 | Bacteria | 3181 |
| 208 | Ga0307416_100064474 | 3300032002 | Bacteria | 3006 |
| 209 | Ga0307416_100250300 | 3300032002 | Bacteria | 1724 |
| 210 | Ga0307416_100448103 | 3300032002 | Bacteria | 1342 |
| 211 | Ga0307414_10011634 | 3300032004 | Bacteria | 5169 |
| 212 | Ga0307414_10152357 | 3300032004 | Bacteria | 1826 |
| 213 | Ga0307414_10195425 | 3300032004 | Bacteria | 1641 |
| 214 | Ga0307414_10199891 | 3300032004 | Bacteria | 1625 |
| 215 | Ga0307414_10228588 | 3300032004 | Bacteria | 1532 |
| 216 | Ga0307414_10416969 | 3300032004 | Bacteria | 1170 |
| 217 | Ga0307411_10191066 | 3300032005 | Bacteria | 1563 |
| 218 | Ga0307411_10217366 | 3300032005 | Bacteria | 1480 |
| 219 | Ga0307415_100018338 | 3300032126 | Bacteria | 4223 |
| 220 | Ga0307415_100022659 | 3300032126 | Bacteria | 3881 |
| 221 | Ga0307415_100052984 | 3300032126 | Bacteria | 2762 |
| 222 | Ga0307415_100348896 | 3300032126 | Bacteria | 1245 |
| 223 | Ga0307415_100354409 | 3300032126 | Bacteria | 1237 |
| 224 | Ga0395899_0002648 | 3300037312 | Bacteria | 14424 |
| 225 | Ga0395899_0026613 | 3300037312 | Bacteria | 4364 |
| 226 | Ga0395899_0037840 | 3300037312 | Bacteria | 3616 |
| 227 | Ga0395899_0039738 | 3300037312 | Bacteria | 3520 |
| 228 | Ga0395899_0175911 | 3300037312 | Bacteria | 1505 |
| 229 | Ga0395900_0019759 | 3300037418 | Bacteria | 6866 |
| 230 | Ga0395900_0035603 | 3300037418 | Bacteria | 5128 |
| 231 | Ga0395900_0036339 | 3300037418 | Bacteria | 5078 |
| 232 | Ga0395900_0039159 | 3300037418 | Bacteria | 4885 |
| 233 | Ga0395900_0054802 | 3300037418 | Bacteria | 4106 |
| 234 | Ga0395900_0147520 | 3300037418 | Bacteria | 2405 |
| 235 | Ga0395900_0198705 | 3300037418 | Bacteria | 2030 |
| 236 | Ga0395898_0000677 | 3300037466 | Bacteria | 61608 |
| 237 | Ga0395898_0019181 | 3300037466 | Bacteria | 6962 |
| 238 | Ga0395898_0101543 | 3300037466 | Bacteria | 2762 |
| 239 | Ga0395898_0127254 | 3300037466 | Bacteria | 2441 |
| 240 | Ga0395898_0262563 | 3300037466 | Bacteria | 1647 |
| 241 | Ga0395898_0529163 | 3300037466 | Bacteria | 1120 |
| 242 | Ga0395905_0072103 | 3300037471 | Bacteria | 3238 |
| 243 | Ga0395901_0003516 | 3300038443 | Bacteria | 15776 |
| 244 | Ga0395901_0051893 | 3300038443 | Bacteria | 4263 |
| 245 | Ga0395901_0057360 | 3300038443 | Bacteria | 4050 |
| 246 | Ga0395901_0065598 | 3300038443 | Bacteria | 3780 |
| 247 | Ga0395901_0126489 | 3300038443 | Bacteria | 2686 |
| 248 | Ga0395901_0160290 | 3300038443 | Bacteria | 2363 |
| 249 | Ga0395901_0170549 | 3300038443 | Bacteria | 2283 |
| 250 | Ga0395901_0208600 | 3300038443 | Bacteria | 2046 |
| 251 | Ga0395901_0327908 | 3300038443 | Bacteria | 1583 |
| 252 | Ga0395901_0421668 | 3300038443 | Bacteria | 1368 |
| 253 | Ga0439436_0002956 | 3300041404 | Bacteria | 5152 |
| 254 | Ga0439447_009652 | 3300041407 | Bacteria | 2910 |
| 255 | Ga0439461_0001316 | 3300041410 | Bacteria | 3817 |
| 256 | Ga0439466_0005317 | 3300041411 | Bacteria | 4924 |
| 257 | Ga0439466_0007923 | 3300041411 | Bacteria | 4006 |
| 258 | Ga0439465_0014410 | 3300041413 | Bacteria | 2463 |
| 259 | Ga0451793_0754086 | 3300041452 | Bacteria | 1468 |
| 260 | Ga0451793_0828623 | 3300041452 | Bacteria | 3308 |
| 261 | Ga0439433_0000490 | 3300041999 | Bacteria | 7351 |
| 262 | Ga0439433_0009092 | 3300041999 | Bacteria | 2162 |
| 263 | Ga0439433_0013464 | 3300041999 | Bacteria | 1796 |
| 264 | Ga0439442_000003 | 3300042002 | Bacteria | 73601 |
| 265 | Ga0439442_000415 | 3300042002 | Bacteria | 10015 |
| 266 | Ga0439442_000785 | 3300042002 | Bacteria | 6604 |
| 267 | Ga0439432_000482 | 3300042006 | Bacteria | 14905 |
| 268 | Ga0439449_0004415 | 3300042007 | Bacteria | 5424 |
| 269 | Ga0439449_0005537 | 3300042007 | Bacteria | 4832 |
| 270 | Ga0439452_001631 | 3300042010 | Bacteria | 8862 |
| 271 | Ga0439457_011477 | 3300042014 | Bacteria | 2015 |
| 272 | Ga0439462_0002134 | 3300042015 | Bacteria | 4543 |
| 273 | Ga0450919_000178 | 3300042121 | Bacteria | 6815 |
| 274 | Ga0450920_000449 | 3300042122 | Bacteria | 6396 |
| 275 | Ga0450920_001395 | 3300042122 | Bacteria | 3994 |
| 276 | Ga0450920_006052 | 3300042122 | Bacteria | 2166 |
| 277 | Ga0450907_000170 | 3300042146 | Bacteria | 23867 |
| 278 | Ga0450907_004717 | 3300042146 | Bacteria | 2335 |
| 279 | Ga0450908_006286 | 3300042184 | Bacteria | 2260 |
| 280 | Ga0450909_003189 | 3300042185 | Bacteria | 2332 |
| 281 | Ga0439434_0000044 | 3300042435 | Bacteria | 30133 |
| 282 | Ga0439434_0000575 | 3300042435 | Bacteria | 10613 |
| 283 | Ga0439434_0028115 | 3300042435 | Bacteria | 1702 |
| 284 | Ga0466972_0007166 | 3300044658 | Bacteria | 5598 |
| 285 | Ga0466972_0056087 | 3300044658 | Bacteria | 1894 |
| 286 | Ga0466965_0000007 | 3300044683 | Bacteria | 131940 |
| 287 | Ga0466965_0003157 | 3300044683 | Bacteria | 7188 |
| 288 | Ga0466965_0009366 | 3300044683 | Bacteria | 4550 |
| 289 | Ga0466965_0093064 | 3300044683 | Bacteria | 1535 |
| 290 | Ga0466966_0073197 | 3300044684 | Bacteria | 2144 |
| 291 | Ga0466966_0221371 | 3300044684 | Bacteria | 1142 |
| 292 | Ga0466961_0011738 | 3300044693 | Bacteria | 5598 |
| 293 | Ga0466961_0052131 | 3300044693 | Bacteria | 2611 |
| 294 | Ga0466961_0186277 | 3300044693 | Bacteria | 1288 |
| 295 | Ga0466971_0068131 | 3300044719 | Bacteria | 1613 |
| 296 | Ga0466968_0020748 | 3300044735 | Bacteria | 2655 |
| 297 | Ga0466970_0000428 | 3300044765 | Bacteria | 20583 |
| 298 | Ga0466970_0001712 | 3300044765 | Bacteria | 10550 |
| 299 | Ga0466970_0012059 | 3300044765 | Bacteria | 4414 |
| 300 | Ga0466970_0040060 | 3300044765 | Bacteria | 2487 |
| 301 | Ga0466970_0080751 | 3300044765 | Bacteria | 1757 |
| 302 | Ga0466957_0106894 | 3300044842 | Bacteria | 1771 |
| 303 | Ga0466957_0112793 | 3300044842 | Bacteria | 1726 |
| 304 | Ga0466957_0125000 | 3300044842 | Bacteria | 1643 |
| 305 | Ga0466960_0006151 | 3300044901 | Bacteria | 4803 |
| 306 | Ga0466960_0011585 | 3300044901 | Bacteria | 3695 |
| 307 | Ga0466960_0024507 | 3300044901 | Bacteria | 2722 |
| 308 | Ga0466959_0006255 | 3300045049 | Bacteria | 8226 |
| 309 | Ga0466959_0092344 | 3300045049 | Bacteria | 2173 |
| 310 | Ga0466959_0291011 | 3300045049 | Bacteria | 1120 |
| 311 | Ga0466958_0211021 | 3300045836 | Bacteria | 1237 |
| 312 | Ga0466967_0246227 | 3300045976 | Bacteria | 1706 |
| 313 | Ga0495627_000742 | 3300046453 | Bacteria | 24523 |
| 314 | Ga0495627_031968 | 3300046453 | Bacteria | 1659 |
| 315 | Ga0495627_055921 | 3300046453 | Bacteria | 1177 |
| 316 | Ga0495590_0000848 | 3300046457 | Bacteria | 13824 |
| 317 | Ga0495638_0062310 | 3300046460 | Bacteria | 2303 |
| 318 | Ga0495653_0037682 | 3300046463 | Bacteria | 3797 |
| 319 | Ga0495650_0003319 | 3300046471 | Bacteria | 11858 |
| 320 | Ga0495650_0049953 | 3300046471 | Bacteria | 1733 |
| 321 | Ga0495580_0009570 | 3300046472 | Bacteria | 7613 |
| 322 | Ga0495580_0261159 | 3300046472 | Bacteria | 1184 |
| 323 | Ga0495582_0143422 | 3300046473 | Bacteria | 1354 |
| 324 | Ga0495639_0002665 | 3300046475 | Bacteria | 7750 |
| 325 | Ga0495610_0055876 | 3300046512 | Bacteria | 1901 |
| 326 | Ga0495665_0005279 | 3300046531 | Bacteria | 6964 |
| 327 | Ga0495586_0016303 | 3300046535 | Bacteria | 3951 |
| 328 | Ga0495586_0040427 | 3300046535 | Bacteria | 2508 |
| 329 | Ga0495587_0055060 | 3300046536 | Bacteria | 2343 |
| 330 | Ga0495609_0043403 | 3300046538 | Bacteria | 2019 |
| 331 | Ga0495645_0007535 | 3300046543 | Bacteria | 7571 |
| 332 | Ga0495645_0011335 | 3300046543 | Bacteria | 6269 |
| 333 | Ga0495667_0044550 | 3300046559 | Bacteria | 2938 |
| 334 | Ga0495656_0042341 | 3300046615 | Bacteria | 1906 |
| 335 | Ga0495668_0031038 | 3300046616 | Bacteria | 3012 |
| 336 | Ga0495635_0186783 | 3300046663 | Bacteria | 1408 |
| 337 | Ga0495588_0003154 | 3300046674 | Bacteria | 7138 |
| 338 | Ga0495588_0007845 | 3300046674 | Bacteria | 4874 |
| 339 | Ga0495588_0035567 | 3300046674 | Bacteria | 2524 |
| 340 | Ga0495588_0076342 | 3300046674 | Bacteria | 1746 |
| 341 | Ga0495613_0328529 | 3300046689 | Bacteria | 1054 |
| 342 | Ga0495670_0080676 | 3300046691 | Bacteria | 1657 |
| 343 | Ga0495600_0020743 | 3300046809 | Bacteria | 4203 |
| 344 | Ga0495581_0010232 | 3300047315 | Bacteria | 5425 |
| 345 | Ga0495581_0223356 | 3300047315 | Bacteria | 1101 |
| 346 | Ga0495672_0109477 | 3300047320 | Bacteria | 1484 |
| 347 | Ga0495677_0012700 | 3300047445 | Bacteria | 3070 |
| 348 | Ga0495686_0079643 | 3300047472 | Bacteria | 2003 |
| 349 | Ga0495593_0056575 | 3300047673 | Bacteria | 2061 |
| 350 | Ga0495615_0034302 | 3300048090 | Bacteria | 1234 |
| 351 | Ga0496100_0056030 | 3300048903 | Bacteria | 2577 |
| 352 | Ga0496101_0041350 | 3300048904 | Bacteria | 3286 |
| 353 | Ga0496101_0229495 | 3300048904 | Bacteria | 1442 |
| 354 | Ga0496102_0036332 | 3300048905 | Bacteria | 4437 |
| 355 | Ga0496102_0056538 | 3300048905 | Bacteria | 3579 |
| 356 | Ga0496102_0072042 | 3300048905 | Bacteria | 3174 |
| 357 | Ga0496102_0102125 | 3300048905 | Bacteria | 2665 |
| 358 | Ga0496103_0028464 | 3300048906 | Bacteria | 3391 |
| 359 | Ga0496103_0098687 | 3300048906 | Bacteria | 1847 |
| 360 | Ga0496104_0009242 | 3300048907 | Bacteria | 8765 |
| 361 | Ga0496105_0032715 | 3300048908 | Bacteria | 4269 |
| 362 | Ga0496105_0037902 | 3300048908 | Bacteria | 3971 |
| 363 | Ga0496105_0090706 | 3300048908 | Bacteria | 2524 |
| 364 | Ga0496105_0122125 | 3300048908 | Bacteria | 2147 |
| 365 | Ga0496106_0070007 | 3300048909 | Bacteria | 2679 |
| 366 | Ga0496106_0150347 | 3300048909 | Bacteria | 1836 |
| 367 | Ga0496107_0007307 | 3300048910 | Bacteria | 7614 |
| 368 | Ga0496107_0017706 | 3300048910 | Bacteria | 5013 |
| 369 | Ga0496108_0133989 | 3300048911 | Bacteria | 2130 |
| 370 | Ga0496109_0031753 | 3300048912 | Bacteria | 4742 |
| 371 | Ga0496109_0132466 | 3300048912 | Bacteria | 2327 |
| 372 | Ga0496110_0179996 | 3300048913 | Bacteria | 1920 |
| 373 | Ga0496110_0316467 | 3300048913 | Bacteria | 1422 |
| 374 | Ga0496111_0008731 | 3300048914 | Bacteria | 6724 |
| 375 | Ga0496111_0032912 | 3300048914 | Bacteria | 3696 |
| 376 | Ga0496112_0013055 | 3300048915 | Bacteria | 7662 |
| 377 | Ga0496112_0027521 | 3300048915 | Bacteria | 5482 |
| 378 | Ga0496112_0216124 | 3300048915 | Bacteria | 1873 |
| 379 | Ga0496112_0437913 | 3300048915 | Bacteria | 1245 |
| 380 | Ga0496113_0017866 | 3300048916 | Bacteria | 4930 |
| 381 | Ga0496113_0149114 | 3300048916 | Bacteria | 1844 |
| 382 | Ga0496114_0007014 | 3300048917 | Bacteria | 8887 |
| 383 | Ga0496114_0011754 | 3300048917 | Bacteria | 7003 |
| 384 | Ga0496114_0035901 | 3300048917 | Bacteria | 4095 |
| 385 | Ga0496114_0040298 | 3300048917 | Bacteria | 3867 |
| 386 | Ga0496114_0040447 | 3300048917 | Bacteria | 3860 |
| 387 | Ga0496114_0041980 | 3300048917 | Bacteria | 3790 |
| 388 | Ga0496114_0179026 | 3300048917 | Bacteria | 1851 |
| 389 | Ga0496114_0244733 | 3300048917 | Bacteria | 1578 |
| 390 | Ga0496114_0275540 | 3300048917 | Bacteria | 1483 |
| 391 | Ga0496114_0340252 | 3300048917 | Bacteria | 1326 |
| 392 | Ga0496115_0044786 | 3300048918 | Bacteria | 3531 |
| 393 | Ga0496115_0060424 | 3300048918 | Bacteria | 3054 |
| 394 | Ga0496115_0067417 | 3300048918 | Bacteria | 2894 |
| 395 | Ga0496115_0235528 | 3300048918 | Bacteria | 1509 |
| 396 | Ga0496115_0393878 | 3300048918 | Bacteria | 1124 |
| 397 | Ga0496116_0009609 | 3300048919 | Bacteria | 8229 |
| 398 | Ga0496117_0000053 | 3300048920 | Bacteria | 279396 |
| 399 | Ga0496117_0001359 | 3300048920 | Bacteria | 35660 |
| 400 | Ga0496117_0002845 | 3300048920 | Bacteria | 21058 |
| 401 | Ga0496117_0004371 | 3300048920 | Bacteria | 15671 |
| 402 | Ga0496117_0027117 | 3300048920 | Bacteria | 4469 |
| 403 | Ga0496117_0028088 | 3300048920 | Bacteria | 4361 |
| 404 | Ga0496117_0082936 | 3300048920 | Bacteria | 2098 |
| 405 | Ga0496118_0000601 | 3300048921 | Bacteria | 59471 |
| 406 | Ga0496118_0015248 | 3300048921 | Bacteria | 7128 |
| 407 | Ga0496118_0019871 | 3300048921 | Bacteria | 5986 |
| 408 | Ga0496118_0186754 | 3300048921 | Bacteria | 1245 |
| 409 | Ga0496119_0000750 | 3300048922 | Bacteria | 43609 |
| 410 | Ga0496119_0001919 | 3300048922 | Bacteria | 23793 |
| 411 | Ga0496119_0002232 | 3300048922 | Bacteria | 21580 |
| 412 | Ga0496119_0008189 | 3300048922 | Bacteria | 9250 |
| 413 | Ga0496119_0008633 | 3300048922 | Bacteria | 8918 |
| 414 | Ga0496119_0046239 | 3300048922 | Bacteria | 2720 |
| 415 | Ga0496119_0080111 | 3300048922 | Bacteria | 1884 |
| 416 | Ga0496119_0129139 | 3300048922 | Bacteria | 1379 |
| 417 | Ga0496119_0202968 | 3300048922 | Bacteria | 1025 |
| 418 | Ga0496120_0000567 | 3300048923 | Bacteria | 56364 |
| 419 | Ga0496120_0002279 | 3300048923 | Bacteria | 19926 |
| 420 | Ga0496120_0005582 | 3300048923 | Bacteria | 9986 |
| 421 | Ga0496121_0000076 | 3300048924 | Bacteria | 239775 |
| 422 | Ga0496121_0019958 | 3300048924 | Bacteria | 6668 |
| 423 | Ga0496121_0131214 | 3300048924 | Bacteria | 1875 |
| 424 | Ga0496121_0136827 | 3300048924 | Bacteria | 1824 |
| 425 | Ga0496121_0172911 | 3300048924 | Bacteria | 1567 |
| 426 | Ga0496121_0417475 | 3300048924 | Bacteria | 874 |
| 427 | Ga0496122_0000030 | 3300048925 | Bacteria | 331586 |
| 428 | Ga0496122_0001351 | 3300048925 | Bacteria | 39991 |
| 429 | Ga0496122_0007238 | 3300048925 | Bacteria | 12410 |
| 430 | Ga0496122_0014337 | 3300048925 | Bacteria | 7671 |
| 431 | Ga0496122_0014414 | 3300048925 | Bacteria | 7647 |
| 432 | Ga0496122_0017802 | 3300048925 | Bacteria | 6608 |
| 433 | Ga0496122_0026081 | 3300048925 | Bacteria | 5054 |
| 434 | Ga0496122_0029012 | 3300048925 | Bacteria | 4678 |
| 435 | Ga0496122_0060649 | 3300048925 | Bacteria | 2784 |
| 436 | Ga0496122_0062031 | 3300048925 | Bacteria | 2739 |
| 437 | Ga0496122_0106325 | 3300048925 | Bacteria | 1858 |
| 438 | Ga0496122_0143875 | 3300048925 | Bacteria | 1486 |
| 439 | Ga0496123_0000024 | 3300048926 | Bacteria | 331587 |
| 440 | Ga0496123_0003288 | 3300048926 | Bacteria | 18310 |
| 441 | Ga0496123_0004463 | 3300048926 | Bacteria | 14680 |
| 442 | Ga0496123_0008629 | 3300048926 | Bacteria | 9322 |
| 443 | Ga0496123_0023942 | 3300048926 | Bacteria | 4658 |
| 444 | Ga0496123_0030146 | 3300048926 | Bacteria | 3976 |
| 445 | Ga0496124_0002211 | 3300048927 | Bacteria | 25901 |
| 446 | Ga0496124_0007376 | 3300048927 | Bacteria | 11698 |
| 447 | Ga0496124_0008675 | 3300048927 | Bacteria | 10574 |
| 448 | Ga0496124_0011174 | 3300048927 | Bacteria | 9003 |
| 449 | Ga0496124_0029747 | 3300048927 | Bacteria | 4859 |
| 450 | Ga0496124_0053605 | 3300048927 | Bacteria | 3417 |
| 451 | Ga0496124_0071521 | 3300048927 | Bacteria | 2875 |
| 452 | Ga0496124_0073160 | 3300048927 | Bacteria | 2836 |
| 453 | Ga0496124_0114336 | 3300048927 | Bacteria | 2167 |
| 454 | Ga0496124_0117814 | 3300048927 | Bacteria | 2127 |
| 455 | Ga0496125_0000061 | 3300048928 | Bacteria | 262739 |
| 456 | Ga0496125_0000094 | 3300048928 | Bacteria | 208341 |
| 457 | Ga0496125_0001852 | 3300048928 | Bacteria | 29169 |
| 458 | Ga0496125_0003349 | 3300048928 | Bacteria | 19512 |
| 459 | Ga0496125_0004791 | 3300048928 | Bacteria | 15401 |
| 460 | Ga0496125_0015344 | 3300048928 | Bacteria | 7416 |
| 461 | Ga0496125_0021752 | 3300048928 | Bacteria | 5969 |
| 462 | Ga0496125_0041712 | 3300048928 | Bacteria | 3920 |
| 463 | Ga0496125_0080008 | 3300048928 | Bacteria | 2503 |
| 464 | Ga0496126_0004531 | 3300048929 | Bacteria | 16531 |
| 465 | Ga0496126_0019540 | 3300048929 | Bacteria | 6669 |
| 466 | Ga0496126_0103876 | 3300048929 | Bacteria | 2482 |
| 467 | Ga0496126_0121254 | 3300048929 | Bacteria | 2267 |
| 468 | Ga0496126_0198272 | 3300048929 | Bacteria | 1696 |
| 469 | Ga0496126_0224979 | 3300048929 | Bacteria | 1574 |
| 470 | Ga0496126_0253788 | 3300048929 | Bacteria | 1464 |
| 471 | Ga0501316_001994 | 3300049532 | Bacteria | 1834 |
| 472 | Ga0501319_002331 | 3300049535 | Bacteria | 1194 |
| 473 | Ga0501321_000365 | 3300049537 | Bacteria | 2796 |
| 474 | Ga0501321_000422 | 3300049537 | Bacteria | 2700 |
| 475 | Ga0501321_005457 | 3300049537 | Bacteria | 1258 |
| 476 | Ga0501031_0008742 | 3300049568 | Bacteria | 6586 |
| 477 | Ga0501031_0065489 | 3300049568 | Bacteria | 2367 |
| 478 | Ga0501032_0000691 | 3300049569 | Bacteria | 27424 |
| 479 | Ga0501032_0010009 | 3300049569 | Bacteria | 6847 |
| 480 | Ga0501032_0014897 | 3300049569 | Bacteria | 5503 |
| 481 | Ga0501032_0133486 | 3300049569 | Bacteria | 1637 |
| 482 | Ga0501033_0006508 | 3300049570 | Bacteria | 9141 |
| 483 | Ga0501033_0007517 | 3300049570 | Bacteria | 8479 |
| 484 | Ga0501033_0019892 | 3300049570 | Bacteria | 5074 |
| 485 | Ga0501033_0022845 | 3300049570 | Bacteria | 4715 |
| 486 | Ga0501033_0035479 | 3300049570 | Bacteria | 3739 |
| 487 | Ga0501034_0000123 | 3300049571 | Bacteria | 143688 |
| 488 | Ga0501034_0006950 | 3300049571 | Bacteria | 12095 |
| 489 | Ga0501034_0018764 | 3300049571 | Bacteria | 7088 |
| 490 | Ga0501034_0025898 | 3300049571 | Bacteria | 5974 |
| 491 | Ga0501034_0035910 | 3300049571 | Bacteria | 5025 |
| 492 | Ga0501034_0039896 | 3300049571 | Bacteria | 4755 |
| 493 | Ga0501034_0055291 | 3300049571 | Bacteria | 3994 |
| 494 | Ga0501034_0061453 | 3300049571 | Bacteria | 3772 |
| 495 | Ga0501034_0120554 | 3300049571 | Bacteria | 2609 |
| 496 | Ga0501034_0127990 | 3300049571 | Bacteria | 2524 |
| 497 | Ga0501034_0142327 | 3300049571 | Bacteria | 2377 |
| 498 | Ga0501034_0201301 | 3300049571 | Bacteria | 1949 |
| 499 | Ga0501034_0469853 | 3300049571 | Bacteria | 1174 |
| 500 | Ga0501036_0024497 | 3300049572 | Bacteria | 5088 |
| 501 | Ga0501036_0134412 | 3300049572 | Bacteria | 2087 |
| 502 | Ga0501036_0297792 | 3300049572 | Bacteria | 1349 |
| 503 | Ga0501037_0009537 | 3300049573 | Bacteria | 7124 |
| 504 | Ga0501037_0037164 | 3300049573 | Bacteria | 3589 |
| 505 | Ga0501037_0144161 | 3300049573 | Bacteria | 1704 |
| 506 | Ga0501038_0005618 | 3300049574 | Bacteria | 11639 |
| 507 | Ga0501038_0029074 | 3300049574 | Bacteria | 4902 |
| 508 | Ga0501038_0046457 | 3300049574 | Bacteria | 3765 |
| 509 | Ga0501038_0095873 | 3300049574 | Bacteria | 2477 |
| 510 | Ga0501038_0147757 | 3300049574 | Bacteria | 1918 |
| 511 | Ga0501038_0160592 | 3300049574 | Bacteria | 1826 |
| 512 | Ga0501039_0009494 | 3300049575 | Bacteria | 7417 |
| 513 | Ga0501039_0095725 | 3300049575 | Bacteria | 2315 |
| 514 | Ga0501039_0155369 | 3300049575 | Bacteria | 1797 |
| 515 | Ga0501042_0003755 | 3300049578 | Bacteria | 9595 |
| 516 | Ga0501042_0028951 | 3300049578 | Bacteria | 3906 |
| 517 | Ga0501043_0001520 | 3300049579 | Bacteria | 20261 |
| 518 | Ga0501043_0022104 | 3300049579 | Bacteria | 4991 |
| 519 | Ga0501043_0062026 | 3300049579 | Bacteria | 2935 |
| 520 | Ga0501043_0119777 | 3300049579 | Bacteria | 2064 |
| 521 | Ga0501043_0158289 | 3300049579 | Bacteria | 1770 |
| 522 | Ga0501043_0276008 | 3300049579 | Bacteria | 1289 |
| 523 | Ga0501043_0282871 | 3300049579 | Bacteria | 1271 |
| 524 | Ga0501046_0030096 | 3300049580 | Bacteria | 4409 |
| 525 | Ga0501047_0003895 | 3300049581 | Bacteria | 14029 |
| 526 | Ga0501047_0014376 | 3300049581 | Bacteria | 7526 |
| 527 | Ga0501047_0047156 | 3300049581 | Bacteria | 4163 |
| 528 | Ga0501047_0081513 | 3300049581 | Bacteria | 3110 |
| 529 | Ga0501048_0001989 | 3300049582 | Bacteria | 15539 |
| 530 | Ga0501067_0071637 | 3300049583 | Bacteria | 1920 |
| 531 | Ga0501068_0075052 | 3300049584 | Bacteria | 2068 |
| 532 | Ga0501070_0000088 | 3300049586 | Bacteria | 77423 |
| 533 | Ga0501070_0002274 | 3300049586 | Bacteria | 16887 |
| 534 | Ga0501070_0015424 | 3300049586 | Bacteria | 6428 |
| 535 | Ga0501070_0022690 | 3300049586 | Bacteria | 5255 |
| 536 | Ga0501070_0081047 | 3300049586 | Bacteria | 2685 |
| 537 | Ga0501073_0000075 | 3300049589 | Bacteria | 61808 |
| 538 | Ga0501073_0026258 | 3300049589 | Bacteria | 4172 |
| 539 | Ga0501074_0033589 | 3300049590 | Bacteria | 3718 |
| 540 | Ga0501080_0000271 | 3300049742 | Bacteria | 39284 |
| 541 | Ga0501080_0081761 | 3300049742 | Bacteria | 3000 |
| 542 | Ga0501083_0000003 | 3300049744 | Bacteria | 235949 |
| 543 | Ga0501083_0019410 | 3300049744 | Bacteria | 4737 |
| 544 | Ga0501035_0010037 | 3300049822 | Bacteria | 8787 |
| 545 | Ga0501035_0061517 | 3300049822 | Bacteria | 3341 |
| 546 | Ga0501035_0098416 | 3300049822 | Bacteria | 2568 |
| 547 | Ga0501035_0317007 | 3300049822 | Bacteria | 1311 |
| 548 | Ga0501044_0017210 | 3300049823 | Bacteria | 7754 |
| 549 | Ga0501044_0050928 | 3300049823 | Bacteria | 4271 |
| 550 | Ga0501044_0086590 | 3300049823 | Bacteria | 3164 |
| 551 | Ga0501044_0410812 | 3300049823 | Bacteria | 1265 |
| 552 | Ga0501045_0042263 | 3300049824 | Bacteria | 3318 |
| 553 | nmdc:mga00v17_47213_c1 | 3300050491 | Bacteria | 2607 |
| 554 | nmdc:mga00v17_8234_c1 | 3300050491 | Bacteria | 5607 |
| 555 | nmdc:mga0yw44_2472_c1 | 3300050492 | Bacteria | 7894 |
| 556 | nmdc:mga0yw44_55263_c1 | 3300050492 | Bacteria | 2415 |
| 557 | nmdc:mga06z11_26546_c1 | 3300050494 | Bacteria | 2757 |
| 558 | nmdc:mga0sz30_55015_c1 | 3300050516 | Bacteria | 1693 |
| 559 | Ga0500635_0000013 | 3300053080 | Bacteria | 133088 |
| 560 | Ga0500635_0005457 | 3300053080 | Bacteria | 3337 |
| 561 | Ga0500643_000275 | 3300053087 | Bacteria | 44588 |
| 562 | Ga0500651_0000791 | 3300053093 | Bacteria | 15456 |
| 563 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 564 | Ga0500556_0000129 | 3300053104 | Bacteria | 64921 |
| 565 | Ga0500562_001760 | 3300053108 | Bacteria | 5409 |
| 566 | Ga0500593_001717 | 3300053117 | Bacteria | 7914 |
| 567 | Ga0500655_002346 | 3300053133 | Bacteria | 3470 |
| 568 | Ga0500559_0000115 | 3300053136 | Bacteria | 63289 |
| 569 | Ga0500559_0000765 | 3300053136 | Bacteria | 21074 |
| 570 | Ga0500559_0002603 | 3300053136 | Bacteria | 9213 |
| 571 | Ga0500559_0015737 | 3300053136 | Bacteria | 3194 |
| 572 | Ga0500559_0027667 | 3300053136 | Bacteria | 2420 |
| 573 | Ga0500568_0000006 | 3300053139 | Bacteria | 522235 |
| 574 | Ga0500568_0000026 | 3300053139 | Bacteria | 165582 |
| 575 | Ga0500568_0000172 | 3300053139 | Bacteria | 56463 |
| 576 | Ga0500568_0007803 | 3300053139 | Bacteria | 5212 |
| 577 | Ga0500568_0042363 | 3300053139 | Bacteria | 1824 |
| 578 | Ga0500573_0000013 | 3300053140 | Bacteria | 196637 |
| 579 | Ga0500573_0004755 | 3300053140 | Bacteria | 7187 |
| 580 | Ga0500573_0024648 | 3300053140 | Bacteria | 3458 |
| 581 | Ga0500573_0042418 | 3300053140 | Bacteria | 2627 |
| 582 | Ga0500573_0061830 | 3300053140 | Bacteria | 2145 |
| 583 | Ga0500573_0082125 | 3300053140 | Bacteria | 1830 |
| 584 | Ga0500573_0101561 | 3300053140 | Bacteria | 1617 |
| 585 | Ga0500573_0109466 | 3300053140 | Bacteria | 1547 |
| 586 | Ga0500573_0195401 | 3300053140 | Bacteria | 1078 |
| 587 | Ga0500588_0000654 | 3300053146 | Bacteria | 5779 |
| 588 | Ga0500590_000536 | 3300053148 | Bacteria | 13239 |
| 589 | Ga0500616_0000734 | 3300053153 | Bacteria | 37933 |
| 590 | Ga0500616_0001005 | 3300053153 | Bacteria | 30333 |
| 591 | Ga0500616_0046676 | 3300053153 | Bacteria | 2302 |
| 592 | Ga0500620_000246 | 3300053155 | Bacteria | 10519 |
| 593 | Ga0587090_000501 | 3300059510 | Bacteria | 3315 |
| 594 | Ga0501082_0007327 | 3300060353 | Bacteria | 9522 |
| 595 | Ga0501082_0146675 | 3300060353 | Bacteria | 2049 |
| 596 | Ga0501082_0159704 | 3300060353 | Bacteria | 1959 |
| 597 | Ga0466962_0028064 | 3300061719 | Bacteria | 2698 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0437913 | Ga0496112_0437913_10_891 | 274 |
| 2 | 3300048924 | Ga0496121_0417475 | Ga0496121_0417475_18_842 | 274 |
| 3 | 3300049579 | Ga0501043_0158289 | Ga0501043_0158289_28_909 | 274 |
| 4 | 3300049535 | Ga0501319_002331 | Ga0501319_002331_260_1168 | 283 |
| 5 | 3300037312 | Ga0395899_0037840 | Ga0395899_0037840_17_919 | 300 |
| 6 | 3300025728 | Ga0207655_1003821 | Ga0207655_10038214 | 303 |
| 7 | 3300053139 | Ga0500568_0007803 | Ga0500568_0007803_2420_3418 | 304 |
| 8 | 3300044693 | Ga0466961_0186277 | Ga0466961_0186277_130_1134 | 305 |
| 9 | 3300044842 | Ga0466957_0125000 | Ga0466957_0125000_526_1530 | 305 |
| 10 | 3300046559 | Ga0495667_0044550 | Ga0495667_0044550_21_1031 | 317 |
| 11 | 3300049537 | Ga0501321_000422 | Ga0501321_000422_1640_2650 | 317 |
| 12 | 3300049571 | Ga0501034_0469853 | Ga0501034_0469853_107_1099 | 317 |
| 13 | 3300044683 | Ga0466965_0093064 | Ga0466965_0093064_49_1053 | 319 |
| 14 | 3300044901 | Ga0466960_0006151 | Ga0466960_0006151_867_1871 | 320 |
| 15 | 3300053140 | Ga0500573_0024648 | Ga0500573_0024648_2209_3213 | 322 |
| 16 | 3300048919 | Ga0496116_0009609 | Ga0496116_0009609_6470_7474 | 323 |
| 17 | 3300048920 | Ga0496117_0028088 | Ga0496117_0028088_2862_3866 | 323 |
| 18 | 3300048921 | Ga0496118_0015248 | Ga0496118_0015248_326_1330 | 323 |
| 19 | 3300048922 | Ga0496119_0008633 | Ga0496119_0008633_372_1376 | 323 |
| 20 | 3300048923 | Ga0496120_0002279 | Ga0496120_0002279_5845_6849 | 323 |
| 21 | 3300048924 | Ga0496121_0172911 | Ga0496121_0172911_57_1028 | 323 |
| 22 | 3300048925 | Ga0496122_0000030 | Ga0496122_0000030_16230_17234 | 323 |
| 23 | 3300048926 | Ga0496123_0000024 | Ga0496123_0000024_16230_17234 | 323 |
| 24 | 3300048926 | Ga0496123_0030146 | Ga0496123_0030146_2085_3056 | 323 |
| 25 | 3300048927 | Ga0496124_0011174 | Ga0496124_0011174_5092_6096 | 323 |
| 26 | 3300048928 | Ga0496125_0015344 | Ga0496125_0015344_5088_6092 | 323 |
| 27 | 3300048929 | Ga0496126_0019540 | Ga0496126_0019540_4484_5488 | 323 |
| 28 | 3300047315 | Ga0495581_0223356 | Ga0495581_0223356_25_1056 | 324 |
| 29 | 3300038443 | Ga0395901_0051893 | Ga0395901_0051893_3209_4210 | 325 |
| 30 | iso_pu_bacteria | 2848551377 | 2848552554 | 325 |
| 31 | 3300025904 | Ga0207647_10015346 | Ga0207647_100153464 | 326 |
| 32 | 3300006038 | Ga0075365_10007107 | Ga0075365_100071072 | 327 |
| 33 | 3300006051 | Ga0075364_10021485 | Ga0075364_100214852 | 327 |
| 34 | 3300050491 | nmdc:mga00v17_8234_c1 | nmdc:mga00v17_8234_c1_1141_2142 | 327 |
| 35 | iso_pu_bacteria | 2738541272 | 2738695304 | 327 |
| 36 | iso_pu_bacteria | 2738543027 | 2739327854 | 327 |
| 37 | iso_pu_bacteria | 2739367654 | 2739606266 | 327 |
| 38 | iso_pu_bacteria | 2758568522 | 2760306912 | 327 |
| 39 | iso_pu_bacteria | 2758568621 | 2760624574 | 327 |
| 40 | iso_pu_bacteria | 2808606394 | 2809029476 | 327 |
| 41 | iso_pu_bacteria | 2857710386 | 2857712781 | 327 |
| 42 | iso_pu_bacteria | 8056579771 | 8056583593 | 327 |
| 43 | 3300049571 | Ga0501034_0018764 | Ga0501034_0018764_151_1143 | 328 |
| 44 | 3300060353 | Ga0501082_0007327 | Ga0501082_0007327_8125_9117 | 328 |
| 45 | iso_pu_bacteria | 2811994880 | 2812364865 | 328 |
| 46 | iso_pu_bacteria | 2835188231 | 2835188708 | 328 |
| 47 | iso_pu_bacteria | 2839986021 | 2839986521 | 328 |
| 48 | iso_pu_bacteria | 2857733635 | 2857735823 | 328 |
| 49 | iso_pu_bacteria | 2857737099 | 2857738049 | 328 |
| 50 | iso_pu_bacteria | 2919395869 | 2919396569 | 328 |
| 51 | 3300003285 | Ga0007423J48922_100085 | Ga0007423J48922_1000853 | 329 |
| 52 | 3300031665 | Ga0316575_10000173 | Ga0316575_1000017312 | 329 |
| 53 | 3300031995 | Ga0307409_100059527 | Ga0307409_1000595272 | 329 |
| 54 | 3300032002 | Ga0307416_100040980 | Ga0307416_1000409802 | 329 |
| 55 | 3300032004 | Ga0307414_10195425 | Ga0307414_101954251 | 329 |
| 56 | 3300032126 | Ga0307415_100052984 | Ga0307415_1000529843 | 329 |
| 57 | 3300045976 | Ga0466967_0246227 | Ga0466967_0246227_319_1371 | 329 |
| 58 | iso_pu_bacteria | 2643221542 | 2643733561 | 329 |
| 59 | iso_pu_bacteria | 2643221546 | 2643752284 | 329 |
| 60 | iso_pu_bacteria | 2643221553 | 2643785944 | 329 |
| 61 | iso_pu_bacteria | 2643221566 | 2643848288 | 329 |
| 62 | iso_pu_bacteria | 2643221597 | 2643995726 | 329 |
| 63 | iso_pu_bacteria | 2643221613 | 2644083050 | 329 |
| 64 | iso_pu_bacteria | 2643221630 | 2644170136 | 329 |
| 65 | iso_pu_bacteria | 2643221632 | 2644183328 | 329 |
| 66 | iso_pu_bacteria | 2643221721 | 2644666065 | 329 |
| 67 | iso_pu_bacteria | 2643221724 | 2644680357 | 329 |
| 68 | iso_pu_bacteria | 2728369380 | 2730229810 | 329 |
| 69 | iso_pu_bacteria | 2747842429 | 2747952029 | 329 |
| 70 | iso_pu_bacteria | 2773857759 | 2774384524 | 329 |
| 71 | iso_pu_bacteria | 2773857763 | 2774399532 | 329 |
| 72 | iso_pu_bacteria | 2808606306 | 2808631182 | 329 |
| 73 | iso_pu_bacteria | 2808606368 | 2808885652 | 329 |
| 74 | iso_pu_bacteria | 2808606447 | 2809227444 | 329 |
| 75 | iso_pu_bacteria | 2811994872 | 2812323119 | 329 |
| 76 | iso_pu_bacteria | 2833709550 | 2833710962 | 329 |
| 77 | iso_pu_bacteria | 2844852863 | 2844855624 | 329 |
| 78 | iso_pu_bacteria | 2852632344 | 2852634202 | 329 |
| 79 | iso_pu_bacteria | 2852646457 | 2852647381 | 329 |
| 80 | iso_pu_bacteria | 2852663356 | 2852665363 | 329 |
| 81 | iso_pu_bacteria | 2857720070 | 2857721614 | 329 |
| 82 | iso_pu_bacteria | 2857723135 | 2857723987 | 329 |
| 83 | iso_pu_bacteria | 2870628048 | 2870630359 | 329 |
| 84 | iso_pu_bacteria | 2906799679 | 2906800721 | 329 |
| 85 | iso_pu_bacteria | 2928090899 | 2928092261 | 329 |
| 86 | iso_pu_bacteria | 2935890801 | 2935891797 | 329 |
| 87 | iso_pu_bacteria | 2945968032 | 2945971863 | 329 |
| 88 | iso_pu_bacteria | 2946003308 | 2946004989 | 329 |
| 89 | iso_pu_bacteria | 2946024296 | 2946026150 | 329 |
| 90 | iso_pu_bacteria | 2946033335 | 2946033697 | 329 |
| 91 | iso_pu_bacteria | 2946041624 | 2946044321 | 329 |
| 92 | iso_pu_bacteria | 2946080515 | 2946080832 | 329 |
| 93 | iso_pu_bacteria | 2964326757 | 2964329518 | 329 |
| 94 | iso_pu_bacteria | 2977251589 | 2977253888 | 329 |
| 95 | iso_pu_bacteria | 2984580707 | 2984580963 | 329 |
| 96 | iso_pu_bacteria | 8004182704 | 8004185066 | 329 |
| 97 | iso_pu_bacteria | 8004212874 | 8004214331 | 329 |
| 98 | iso_pu_bacteria | 8045830549 | 8045831596 | 329 |
| 99 | iso_pu_bacteria | 8056037122 | 8056039491 | 329 |
| 100 | iso_pu_bacteria | 8057345674 | 8057348855 | 329 |
| 101 | 3300006038 | Ga0075365_10075558 | Ga0075365_100755583 | 330 |
| 102 | 3300006051 | Ga0075364_10015746 | Ga0075364_100157464 | 330 |
| 103 | 3300014326 | Ga0157380_10222234 | Ga0157380_102222342 | 330 |
| 104 | 3300030732 | Ga0316176_1094005 | Ga0316176_10940053 | 330 |
| 105 | 3300030734 | Ga0316179_1000242 | Ga0316179_10002422 | 330 |
| 106 | 3300030744 | Ga0316181_1152364 | Ga0316181_11523641 | 330 |
| 107 | 3300032002 | Ga0307416_100064474 | Ga0307416_1000644743 | 330 |
| 108 | 3300032126 | Ga0307415_100354409 | Ga0307415_1003544092 | 330 |
| 109 | 3300046453 | Ga0495627_031968 | Ga0495627_031968_34_1035 | 330 |
| 110 | 3300046453 | Ga0495627_055921 | Ga0495627_055921_123_1124 | 330 |
| 111 | 3300046512 | Ga0495610_0055876 | Ga0495610_0055876_867_1868 | 330 |
| 112 | 3300048090 | Ga0495615_0034302 | Ga0495615_0034302_210_1202 | 330 |
| 113 | 3300048922 | Ga0496119_0046239 | Ga0496119_0046239_508_1512 | 330 |
| 114 | 3300048922 | Ga0496119_0202968 | Ga0496119_0202968_20_1012 | 330 |
| 115 | 3300048925 | Ga0496122_0001351 | Ga0496122_0001351_14513_15517 | 330 |
| 116 | 3300048925 | Ga0496122_0029012 | Ga0496122_0029012_401_1405 | 330 |
| 117 | 3300048926 | Ga0496123_0023942 | Ga0496123_0023942_3278_4282 | 330 |
| 118 | 3300048927 | Ga0496124_0008675 | Ga0496124_0008675_9053_10057 | 330 |
| 119 | 3300048928 | Ga0496125_0000094 | Ga0496125_0000094_59136_60140 | 330 |
| 120 | 3300048928 | Ga0496125_0001852 | Ga0496125_0001852_9569_10573 | 330 |
| 121 | 3300049589 | Ga0501073_0000075 | Ga0501073_0000075_16946_17941 | 330 |
| 122 | 3300050492 | nmdc:mga0yw44_55263_c1 | nmdc:mga0yw44_55263_c1_1011_2009 | 330 |
| 123 | 3300053104 | Ga0500556_0000129 | Ga0500556_0000129_38860_39858 | 330 |
| 124 | 3300053117 | Ga0500593_001717 | Ga0500593_001717_2379_3377 | 330 |
| 125 | 3300053133 | Ga0500655_002346 | Ga0500655_002346_2305_3303 | 330 |
| 126 | 3300053136 | Ga0500559_0000765 | Ga0500559_0000765_15918_16916 | 330 |
| 127 | 3300053139 | Ga0500568_0042363 | Ga0500568_0042363_421_1422 | 330 |
| 128 | 3300053153 | Ga0500616_0046676 | Ga0500616_0046676_623_1621 | 330 |
| 129 | iso_pu_bacteria | 2585428094 | 2587862631 | 330 |
| 130 | iso_pu_bacteria | 2643221549 | 2643767545 | 330 |
| 131 | iso_pu_bacteria | 2643221572 | 2643875391 | 330 |
| 132 | iso_pu_bacteria | 2643221575 | 2643885429 | 330 |
| 133 | iso_pu_bacteria | 2643221616 | 2644095994 | 330 |
| 134 | iso_pu_bacteria | 2643221619 | 2644110819 | 330 |
| 135 | iso_pu_bacteria | 2643221635 | 2644199150 | 330 |
| 136 | iso_pu_bacteria | 2643221649 | 2644279512 | 330 |
| 137 | iso_pu_bacteria | 2643221669 | 2644382446 | 330 |
| 138 | iso_pu_bacteria | 2690315906 | 2691514339 | 330 |
| 139 | iso_pu_bacteria | 2721755702 | 2723642186 | 330 |
| 140 | iso_pu_bacteria | 2751185788 | 2753301752 | 330 |
| 141 | iso_pu_bacteria | 2757320536 | 2758226122 | 330 |
| 142 | iso_pu_bacteria | 2773857758 | 2774380392 | 330 |
| 143 | iso_pu_bacteria | 2775506735 | 2775655333 | 330 |
| 144 | iso_pu_bacteria | 2808606357 | 2808827423 | 330 |
| 145 | iso_pu_bacteria | 2808606360 | 2808852788 | 330 |
| 146 | iso_pu_bacteria | 2808606366 | 2808878957 | 330 |
| 147 | iso_pu_bacteria | 2808606370 | 2808891657 | 330 |
| 148 | iso_pu_bacteria | 2808606371 | 2808896788 | 330 |
| 149 | iso_pu_bacteria | 2808606372 | 2808902264 | 330 |
| 150 | iso_pu_bacteria | 2811994871 | 2812320792 | 330 |
| 151 | iso_pu_bacteria | 2844841374 | 2844842401 | 330 |
| 152 | iso_pu_bacteria | 2844849076 | 2844849251 | 330 |
| 153 | iso_pu_bacteria | 2852643534 | 2852645636 | 330 |
| 154 | iso_pu_bacteria | 2857729791 | 2857729976 | 330 |
| 155 | iso_pu_bacteria | 2857740372 | 2857741602 | 330 |
| 156 | iso_pu_bacteria | 2862993130 | 2862996038 | 330 |
| 157 | iso_pu_bacteria | 2870622029 | 2870623711 | 330 |
| 158 | iso_pu_bacteria | 2884763398 | 2884765354 | 330 |
| 159 | iso_pu_bacteria | 2895660088 | 2895661483 | 330 |
| 160 | iso_pu_bacteria | 2897561785 | 2897563229 | 330 |
| 161 | iso_pu_bacteria | 2904497146 | 2904500133 | 330 |
| 162 | iso_pu_bacteria | 2904509784 | 2904512011 | 330 |
| 163 | iso_pu_bacteria | 2904776348 | 2904776351 | 330 |
| 164 | iso_pu_bacteria | 2905926851 | 2905927288 | 330 |
| 165 | iso_pu_bacteria | 2908678064 | 2908680928 | 330 |
| 166 | iso_pu_bacteria | 2910809715 | 2910811096 | 330 |
| 167 | iso_pu_bacteria | 2919034639 | 2919037482 | 330 |
| 168 | iso_pu_bacteria | 2919051321 | 2919054636 | 330 |
| 169 | iso_pu_bacteria | 2919055335 | 2919058050 | 330 |
| 170 | iso_pu_bacteria | 2919059106 | 2919063345 | 330 |
| 171 | iso_pu_bacteria | 2919069694 | 2919072602 | 330 |
| 172 | iso_pu_bacteria | 2919391150 | 2919391153 | 330 |
| 173 | iso_pu_bacteria | 2919443155 | 2919446054 | 330 |
| 174 | iso_pu_bacteria | 2919523602 | 2919524443 | 330 |
| 175 | iso_pu_bacteria | 2919538618 | 2919541869 | 330 |
| 176 | iso_pu_bacteria | 2928104781 | 2928106530 | 330 |
| 177 | iso_pu_bacteria | 2928121344 | 2928123198 | 330 |
| 178 | iso_pu_bacteria | 2928153084 | 2928155935 | 330 |
| 179 | iso_pu_bacteria | 2932426870 | 2932428970 | 330 |
| 180 | iso_pu_bacteria | 2933418574 | 2933421284 | 330 |
| 181 | iso_pu_bacteria | 2935409751 | 2935411555 | 330 |
| 182 | iso_pu_bacteria | 2939598168 | 2939598396 | 330 |
| 183 | iso_pu_bacteria | 2939647034 | 2939649155 | 330 |
| 184 | iso_pu_bacteria | 2939657138 | 2939658147 | 330 |
| 185 | iso_pu_bacteria | 2939660829 | 2939661216 | 330 |
| 186 | iso_pu_bacteria | 2939674588 | 2939676335 | 330 |
| 187 | iso_pu_bacteria | 2945916053 | 2945918553 | 330 |
| 188 | iso_pu_bacteria | 2945920336 | 2945921167 | 330 |
| 189 | iso_pu_bacteria | 2945941187 | 2945942702 | 330 |
| 190 | iso_pu_bacteria | 2945956166 | 2945959568 | 330 |
| 191 | iso_pu_bacteria | 2946037020 | 2946038590 | 330 |
| 192 | iso_pu_bacteria | 2946059875 | 2946062415 | 330 |
| 193 | iso_pu_bacteria | 2953998280 | 2953999865 | 330 |
| 194 | iso_pu_bacteria | 2966921586 | 2966922303 | 330 |
| 195 | iso_pu_bacteria | 2966924647 | 2966924992 | 330 |
| 196 | iso_pu_bacteria | 2974294766 | 2974297181 | 330 |
| 197 | iso_pu_bacteria | 2974302888 | 2974306582 | 330 |
| 198 | iso_pu_bacteria | 2974324384 | 2974326586 | 330 |
| 199 | iso_pu_bacteria | 2977236895 | 2977240177 | 330 |
| 200 | iso_pu_bacteria | 2977264416 | 2977266623 | 330 |
| 201 | iso_pu_bacteria | 8004021418 | 8004023248 | 330 |
| 202 | iso_pu_bacteria | 8004025490 | 8004029291 | 330 |
| 203 | iso_pu_bacteria | 8016254467 | 8016257553 | 330 |
| 204 | iso_pu_bacteria | 8046352972 | 8046356265 | 330 |
| 205 | iso_pu_bacteria | 8054107350 | 8054107934 | 330 |
| 206 | 3300003762 | Ga0055542_1002506 | Ga0055542_10025065 | 331 |
| 207 | 3300005327 | Ga0070658_10022612 | Ga0070658_100226124 | 331 |
| 208 | 3300005327 | Ga0070658_10039005 | Ga0070658_100390053 | 331 |
| 209 | 3300005327 | Ga0070658_10074571 | Ga0070658_100745712 | 331 |
| 210 | 3300005335 | Ga0070666_10118330 | Ga0070666_101183303 | 331 |
| 211 | 3300005338 | Ga0068868_100070367 | Ga0068868_1000703672 | 331 |
| 212 | 3300005355 | Ga0070671_100157352 | Ga0070671_1001573522 | 331 |
| 213 | 3300005366 | Ga0070659_100001568 | Ga0070659_1000015684 | 331 |
| 214 | 3300005367 | Ga0070667_100018034 | Ga0070667_1000180343 | 331 |
| 215 | 3300005466 | Ga0070685_10015029 | Ga0070685_100150292 | 331 |
| 216 | 3300005539 | Ga0068853_100100228 | Ga0068853_1001002282 | 331 |
| 217 | 3300005563 | Ga0068855_100025111 | Ga0068855_1000251115 | 331 |
| 218 | 3300005563 | Ga0068855_100610323 | Ga0068855_1006103231 | 331 |
| 219 | 3300005578 | Ga0068854_100040007 | Ga0068854_1000400072 | 331 |
| 220 | 3300005616 | Ga0068852_100002346 | Ga0068852_1000023469 | 331 |
| 221 | 3300005834 | Ga0068851_10000003 | Ga0068851_10000003117 | 331 |
| 222 | 3300005842 | Ga0068858_100000114 | Ga0068858_1000001146 | 331 |
| 223 | 3300009093 | Ga0105240_10001674 | Ga0105240_1000167434 | 331 |
| 224 | 3300009098 | Ga0105245_10020927 | Ga0105245_100209274 | 331 |
| 225 | 3300009177 | Ga0105248_10059248 | Ga0105248_100592482 | 331 |
| 226 | 3300009545 | Ga0105237_10334434 | Ga0105237_103344341 | 331 |
| 227 | 3300009551 | Ga0105238_10003197 | Ga0105238_100031974 | 331 |
| 228 | 3300010375 | Ga0105239_10462870 | Ga0105239_104628702 | 331 |
| 229 | 3300013296 | Ga0157374_10574006 | Ga0157374_105740062 | 331 |
| 230 | 3300014968 | Ga0157379_10003445 | Ga0157379_100034454 | 331 |
| 231 | 3300025254 | Ga0209148_1003448 | Ga0209148_10034484 | 331 |
| 232 | 3300025321 | Ga0207656_10000002 | Ga0207656_10000002120 | 331 |
| 233 | 3300025898 | Ga0207692_10054020 | Ga0207692_100540202 | 331 |
| 234 | 3300025903 | Ga0207680_10100177 | Ga0207680_101001773 | 331 |
| 235 | 3300025909 | Ga0207705_10124801 | Ga0207705_101248012 | 331 |
| 236 | 3300025911 | Ga0207654_10000001 | Ga0207654_100000011735 | 331 |
| 237 | 3300025913 | Ga0207695_10002367 | Ga0207695_100023676 | 331 |
| 238 | 3300025913 | Ga0207695_10038666 | Ga0207695_100386663 | 331 |
| 239 | 3300025914 | Ga0207671_10000002 | Ga0207671_10000002414 | 331 |
| 240 | 3300025919 | Ga0207657_10008307 | Ga0207657_100083079 | 331 |
| 241 | 3300025924 | Ga0207694_10000092 | Ga0207694_1000009218 | 331 |
| 242 | 3300025927 | Ga0207687_10009754 | Ga0207687_100097544 | 331 |
| 243 | 3300025931 | Ga0207644_10236090 | Ga0207644_102360902 | 331 |
| 244 | 3300025932 | Ga0207690_10000972 | Ga0207690_1000097214 | 331 |
| 245 | 3300025941 | Ga0207711_10000354 | Ga0207711_1000035416 | 331 |
| 246 | 3300025949 | Ga0207667_10005363 | Ga0207667_1000536311 | 331 |
| 247 | 3300025949 | Ga0207667_10006093 | Ga0207667_100060932 | 331 |
| 248 | 3300025949 | Ga0207667_10007363 | Ga0207667_100073639 | 331 |
| 249 | 3300025949 | Ga0207667_10098097 | Ga0207667_100980972 | 331 |
| 250 | 3300025981 | Ga0207640_10361171 | Ga0207640_103611712 | 331 |
| 251 | 3300025986 | Ga0207658_10004577 | Ga0207658_100045779 | 331 |
| 252 | 3300026035 | Ga0207703_10000315 | Ga0207703_1000031517 | 331 |
| 253 | 3300026041 | Ga0207639_10074184 | Ga0207639_100741843 | 331 |
| 254 | 3300026078 | Ga0207702_10012308 | Ga0207702_100123084 | 331 |
| 255 | 3300026142 | Ga0207698_10000255 | Ga0207698_1000025510 | 331 |
| 256 | 3300026142 | Ga0207698_10003348 | Ga0207698_100033482 | 331 |
| 257 | 3300028794 | Ga0307515_10185737 | Ga0307515_101857371 | 331 |
| 258 | 3300031456 | Ga0307513_10218588 | Ga0307513_102185883 | 331 |
| 259 | 3300031649 | Ga0307514_10053074 | Ga0307514_100530743 | 331 |
| 260 | 3300031852 | Ga0307410_10071860 | Ga0307410_100718603 | 331 |
| 261 | 3300031995 | Ga0307409_100016562 | Ga0307409_1000165624 | 331 |
| 262 | 3300041452 | Ga0451793_0754086 | Ga0451793_0754086_258_1256 | 331 |
| 263 | 3300044683 | Ga0466965_0000007 | Ga0466965_0000007_105302_106303 | 331 |
| 264 | 3300044683 | Ga0466965_0003157 | Ga0466965_0003157_2588_3586 | 331 |
| 265 | 3300044683 | Ga0466965_0009366 | Ga0466965_0009366_2057_3061 | 331 |
| 266 | 3300044735 | Ga0466968_0020748 | Ga0466968_0020748_1456_2493 | 331 |
| 267 | 3300044765 | Ga0466970_0001712 | Ga0466970_0001712_8845_9900 | 331 |
| 268 | 3300044765 | Ga0466970_0040060 | Ga0466970_0040060_110_1108 | 331 |
| 269 | 3300044842 | Ga0466957_0112793 | Ga0466957_0112793_298_1296 | 331 |
| 270 | 3300044901 | Ga0466960_0024507 | Ga0466960_0024507_579_1577 | 331 |
| 271 | 3300045049 | Ga0466959_0092344 | Ga0466959_0092344_1064_2068 | 331 |
| 272 | 3300045049 | Ga0466959_0291011 | Ga0466959_0291011_34_1038 | 331 |
| 273 | 3300046457 | Ga0495590_0000848 | Ga0495590_0000848_524_1552 | 331 |
| 274 | 3300046471 | Ga0495650_0003319 | Ga0495650_0003319_5754_6752 | 331 |
| 275 | 3300046471 | Ga0495650_0049953 | Ga0495650_0049953_477_1514 | 331 |
| 276 | 3300046538 | Ga0495609_0043403 | Ga0495609_0043403_1001_2005 | 331 |
| 277 | 3300047320 | Ga0495672_0109477 | Ga0495672_0109477_263_1264 | 331 |
| 278 | 3300047472 | Ga0495686_0079643 | Ga0495686_0079643_46_1044 | 331 |
| 279 | 3300048917 | Ga0496114_0275540 | Ga0496114_0275540_138_1145 | 331 |
| 280 | 3300048920 | Ga0496117_0001359 | Ga0496117_0001359_32826_33830 | 331 |
| 281 | 3300048920 | Ga0496117_0004371 | Ga0496117_0004371_4254_5258 | 331 |
| 282 | 3300048920 | Ga0496117_0082936 | Ga0496117_0082936_84_1082 | 331 |
| 283 | 3300048921 | Ga0496118_0000601 | Ga0496118_0000601_32246_33250 | 331 |
| 284 | 3300048922 | Ga0496119_0000750 | Ga0496119_0000750_41325_42326 | 331 |
| 285 | 3300048922 | Ga0496119_0080111 | Ga0496119_0080111_396_1451 | 331 |
| 286 | 3300048923 | Ga0496120_0005582 | Ga0496120_0005582_4555_5553 | 331 |
| 287 | 3300048924 | Ga0496121_0131214 | Ga0496121_0131214_607_1605 | 331 |
| 288 | 3300048925 | Ga0496122_0007238 | Ga0496122_0007238_887_1891 | 331 |
| 289 | 3300048925 | Ga0496122_0014337 | Ga0496122_0014337_810_1808 | 331 |
| 290 | 3300048925 | Ga0496122_0060649 | Ga0496122_0060649_765_1820 | 331 |
| 291 | 3300048926 | Ga0496123_0003288 | Ga0496123_0003288_15647_16645 | 331 |
| 292 | 3300048926 | Ga0496123_0008629 | Ga0496123_0008629_5964_6968 | 331 |
| 293 | 3300048927 | Ga0496124_0002211 | Ga0496124_0002211_20073_21077 | 331 |
| 294 | 3300048927 | Ga0496124_0029747 | Ga0496124_0029747_1573_2628 | 331 |
| 295 | 3300048927 | Ga0496124_0073160 | Ga0496124_0073160_1093_2097 | 331 |
| 296 | 3300048927 | Ga0496124_0114336 | Ga0496124_0114336_259_1263 | 331 |
| 297 | 3300048929 | Ga0496126_0198272 | Ga0496126_0198272_28_1035 | 331 |
| 298 | 3300049532 | Ga0501316_001994 | Ga0501316_001994_118_1134 | 331 |
| 299 | 3300049568 | Ga0501031_0065489 | Ga0501031_0065489_229_1230 | 331 |
| 300 | 3300049569 | Ga0501032_0010009 | Ga0501032_0010009_4805_5806 | 331 |
| 301 | 3300049569 | Ga0501032_0014897 | Ga0501032_0014897_1199_2200 | 331 |
| 302 | 3300049569 | Ga0501032_0133486 | Ga0501032_0133486_32_1030 | 331 |
| 303 | 3300049570 | Ga0501033_0019892 | Ga0501033_0019892_3492_4493 | 331 |
| 304 | 3300049570 | Ga0501033_0022845 | Ga0501033_0022845_734_1732 | 331 |
| 305 | 3300049570 | Ga0501033_0035479 | Ga0501033_0035479_988_1986 | 331 |
| 306 | 3300049571 | Ga0501034_0055291 | Ga0501034_0055291_95_1093 | 331 |
| 307 | 3300049571 | Ga0501034_0061453 | Ga0501034_0061453_465_1466 | 331 |
| 308 | 3300049571 | Ga0501034_0120554 | Ga0501034_0120554_1069_2067 | 331 |
| 309 | 3300049571 | Ga0501034_0127990 | Ga0501034_0127990_893_1894 | 331 |
| 310 | 3300049571 | Ga0501034_0142327 | Ga0501034_0142327_322_1320 | 331 |
| 311 | 3300049571 | Ga0501034_0201301 | Ga0501034_0201301_923_1921 | 331 |
| 312 | 3300049572 | Ga0501036_0134412 | Ga0501036_0134412_741_1742 | 331 |
| 313 | 3300049572 | Ga0501036_0297792 | Ga0501036_0297792_46_1044 | 331 |
| 314 | 3300049574 | Ga0501038_0046457 | Ga0501038_0046457_1947_2948 | 331 |
| 315 | 3300049574 | Ga0501038_0147757 | Ga0501038_0147757_800_1801 | 331 |
| 316 | 3300049575 | Ga0501039_0095725 | Ga0501039_0095725_599_1600 | 331 |
| 317 | 3300049578 | Ga0501042_0003755 | Ga0501042_0003755_1600_2598 | 331 |
| 318 | 3300049579 | Ga0501043_0001520 | Ga0501043_0001520_7458_8456 | 331 |
| 319 | 3300049579 | Ga0501043_0119777 | Ga0501043_0119777_349_1347 | 331 |
| 320 | 3300049581 | Ga0501047_0014376 | Ga0501047_0014376_2773_3771 | 331 |
| 321 | 3300049581 | Ga0501047_0047156 | Ga0501047_0047156_1421_2419 | 331 |
| 322 | 3300049584 | Ga0501068_0075052 | Ga0501068_0075052_956_1957 | 331 |
| 323 | 3300049586 | Ga0501070_0002274 | Ga0501070_0002274_14649_15647 | 331 |
| 324 | 3300049586 | Ga0501070_0081047 | Ga0501070_0081047_698_1699 | 331 |
| 325 | 3300049742 | Ga0501080_0000271 | Ga0501080_0000271_19821_20819 | 331 |
| 326 | 3300049744 | Ga0501083_0000003 | Ga0501083_0000003_24026_25024 | 331 |
| 327 | 3300049744 | Ga0501083_0019410 | Ga0501083_0019410_1960_2958 | 331 |
| 328 | 3300049822 | Ga0501035_0098416 | Ga0501035_0098416_39_1037 | 331 |
| 329 | 3300049822 | Ga0501035_0317007 | Ga0501035_0317007_254_1252 | 331 |
| 330 | 3300049823 | Ga0501044_0410812 | Ga0501044_0410812_100_1098 | 331 |
| 331 | 3300053080 | Ga0500635_0005457 | Ga0500635_0005457_515_1513 | 331 |
| 332 | 3300053093 | Ga0500651_0000791 | Ga0500651_0000791_1280_2278 | 331 |
| 333 | 3300053108 | Ga0500562_001760 | Ga0500562_001760_3435_4433 | 331 |
| 334 | 3300053136 | Ga0500559_0000115 | Ga0500559_0000115_33388_34386 | 331 |
| 335 | 3300053139 | Ga0500568_0000026 | Ga0500568_0000026_128085_129083 | 331 |
| 336 | 3300053139 | Ga0500568_0000172 | Ga0500568_0000172_6359_7360 | 331 |
| 337 | 3300053140 | Ga0500573_0000013 | Ga0500573_0000013_66046_67044 | 331 |
| 338 | 3300053146 | Ga0500588_0000654 | Ga0500588_0000654_1125_2123 | 331 |
| 339 | 3300053148 | Ga0500590_000536 | Ga0500590_000536_2323_3321 | 331 |
| 340 | 3300053153 | Ga0500616_0000734 | Ga0500616_0000734_19741_20745 | 331 |
| 341 | 3300053153 | Ga0500616_0001005 | Ga0500616_0001005_11568_12572 | 331 |
| 342 | 3300053155 | Ga0500620_000246 | Ga0500620_000246_1674_2672 | 331 |
| 343 | 3300060353 | Ga0501082_0159704 | Ga0501082_0159704_108_1109 | 331 |
| 344 | iso_pu_bacteria | 2904430863 | 2904433099 | 331 |
| 345 | iso_pu_bacteria | 2904501621 | 2904502780 | 331 |
| 346 | iso_pu_bacteria | 2908674828 | 2908677537 | 331 |
| 347 | iso_pu_bacteria | 2909074476 | 2909075105 | 331 |
| 348 | iso_pu_bacteria | 2919039151 | 2919040518 | 331 |
| 349 | iso_pu_bacteria | 2919042368 | 2919043695 | 331 |
| 350 | iso_pu_bacteria | 2928500415 | 2928501653 | 331 |
| 351 | iso_pu_bacteria | 2984551494 | 2984553915 | 331 |
| 352 | 3300001979 | JGI24740J21852_10019274 | JGI24740J21852_100192741 | 332 |
| 353 | 3300002772 | JGI25164J39214_1001094 | JGI25164J39214_10010942 | 332 |
| 354 | 3300003214 | JGI25165J46597_1000002 | JGI25165J46597_1000002646 | 332 |
| 355 | 3300003568 | Ga0006781J51513_1016252 | Ga0006781J51513_10162522 | 332 |
| 356 | 3300003578 | Ga0006562J51391_1010318 | Ga0006562J51391_10103184 | 332 |
| 357 | 3300003578 | Ga0006562J51391_1010319 | Ga0006562J51391_10103192 | 332 |
| 358 | 3300003578 | Ga0006562J51391_1043582 | Ga0006562J51391_10435824 | 332 |
| 359 | 3300003752 | Ga0055539_1000008 | Ga0055539_1000008336 | 332 |
| 360 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001735 | 332 |
| 361 | 3300003759 | Ga0055525_1001682 | Ga0055525_10016822 | 332 |
| 362 | 3300003760 | Ga0055527_1000001 | Ga0055527_1000001149 | 332 |
| 363 | 3300003763 | Ga0055529_1000065 | Ga0055529_1000065150 | 332 |
| 364 | 3300003841 | Ga0055541_1001922 | Ga0055541_10019223 | 332 |
| 365 | 3300005339 | Ga0070660_100052441 | Ga0070660_1000524412 | 332 |
| 366 | 3300005353 | Ga0070669_100107544 | Ga0070669_1001075442 | 332 |
| 367 | 3300005366 | Ga0070659_100029781 | Ga0070659_1000297814 | 332 |
| 368 | 3300005455 | Ga0070663_100346367 | Ga0070663_1003463671 | 332 |
| 369 | 3300005563 | Ga0068855_100141129 | Ga0068855_1001411293 | 332 |
| 370 | 3300005577 | Ga0068857_100179652 | Ga0068857_1001796522 | 332 |
| 371 | 3300006038 | Ga0075365_10007174 | Ga0075365_100071746 | 332 |
| 372 | 3300006051 | Ga0075364_10038271 | Ga0075364_100382712 | 332 |
| 373 | 3300006058 | Ga0075432_10002026 | Ga0075432_100020264 | 332 |
| 374 | 3300006178 | Ga0075367_10049284 | Ga0075367_100492842 | 332 |
| 375 | 3300006186 | Ga0075369_10013652 | Ga0075369_100136524 | 332 |
| 376 | 3300009036 | Ga0105244_10004742 | Ga0105244_100047424 | 332 |
| 377 | 3300009036 | Ga0105244_10019348 | Ga0105244_100193484 | 332 |
| 378 | 3300009094 | Ga0111539_10696939 | Ga0111539_106969391 | 332 |
| 379 | 3300009148 | Ga0105243_10028060 | Ga0105243_100280604 | 332 |
| 380 | 3300009148 | Ga0105243_10088709 | Ga0105243_100887091 | 332 |
| 381 | 3300009148 | Ga0105243_10155422 | Ga0105243_101554223 | 332 |
| 382 | 3300009553 | Ga0105249_10302755 | Ga0105249_103027552 | 332 |
| 383 | 3300011119 | Ga0105246_10000351 | Ga0105246_1000035124 | 332 |
| 384 | 3300011119 | Ga0105246_10002288 | Ga0105246_1000228813 | 332 |
| 385 | 3300011119 | Ga0105246_10171443 | Ga0105246_101714431 | 332 |
| 386 | 3300011119 | Ga0105246_10299568 | Ga0105246_102995681 | 332 |
| 387 | 3300013100 | Ga0157373_10006949 | Ga0157373_100069494 | 332 |
| 388 | 3300013104 | Ga0157370_10005607 | Ga0157370_100056074 | 332 |
| 389 | 3300013104 | Ga0157370_10008506 | Ga0157370_100085063 | 332 |
| 390 | 3300013104 | Ga0157370_10231816 | Ga0157370_102318162 | 332 |
| 391 | 3300013105 | Ga0157369_10001845 | Ga0157369_1000184511 | 332 |
| 392 | 3300013105 | Ga0157369_10087698 | Ga0157369_100876983 | 332 |
| 393 | 3300013250 | Ga0171462_1003 | Ga0171462_1003395 | 332 |
| 394 | 3300013306 | Ga0163162_10145288 | Ga0163162_101452883 | 332 |
| 395 | 3300013306 | Ga0163162_10212625 | Ga0163162_102126253 | 332 |
| 396 | 3300013306 | Ga0163162_10245124 | Ga0163162_102451242 | 332 |
| 397 | 3300013307 | Ga0157372_10017895 | Ga0157372_100178954 | 332 |
| 398 | 3300013307 | Ga0157372_10637049 | Ga0157372_106370491 | 332 |
| 399 | 3300013308 | Ga0157375_10362126 | Ga0157375_103621262 | 332 |
| 400 | 3300014326 | Ga0157380_10009134 | Ga0157380_100091342 | 332 |
| 401 | 3300020069 | Ga0197907_10640432 | Ga0197907_106404324 | 332 |
| 402 | 3300020082 | Ga0206353_10586218 | Ga0206353_105862187 | 332 |
| 403 | 3300020082 | Ga0206353_10968007 | Ga0206353_109680073 | 332 |
| 404 | 3300025225 | Ga0209566_100455 | Ga0209566_10045512 | 332 |
| 405 | 3300025226 | Ga0209674_100001 | Ga0209674_100001735 | 332 |
| 406 | 3300025228 | Ga0209672_100006 | Ga0209672_100006827 | 332 |
| 407 | 3300025229 | Ga0209147_100505 | Ga0209147_10050524 | 332 |
| 408 | 3300025230 | Ga0209563_100001 | Ga0209563_100001735 | 332 |
| 409 | 3300025230 | Ga0209563_105455 | Ga0209563_1054551 | 332 |
| 410 | 3300025231 | Ga0207427_100052 | Ga0207427_100052213 | 332 |
| 411 | 3300025233 | Ga0209437_100816 | Ga0209437_1008166 | 332 |
| 412 | 3300025245 | Ga0207425_1003428 | Ga0207425_10034283 | 332 |
| 413 | 3300025246 | Ga0209646_1000167 | Ga0209646_10001674 | 332 |
| 414 | 3300025253 | Ga0209677_100001 | Ga0209677_100001735 | 332 |
| 415 | 3300025254 | Ga0209148_1000015 | Ga0209148_1000015671 | 332 |
| 416 | 3300025258 | Ga0209129_1000028 | Ga0209129_100002823 | 332 |
| 417 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000012161 | 332 |
| 418 | 3300025272 | Ga0209455_1000013 | Ga0209455_1000013671 | 332 |
| 419 | 3300025294 | Ga0209025_1000428 | Ga0209025_100042822 | 332 |
| 420 | 3300025303 | Ga0209051_1005262 | Ga0209051_10052627 | 332 |
| 421 | 3300025303 | Ga0209051_1010966 | Ga0209051_10109665 | 332 |
| 422 | 3300025315 | Ga0207697_10016651 | Ga0207697_100166513 | 332 |
| 423 | 3300025728 | Ga0207655_1003680 | Ga0207655_100368010 | 332 |
| 424 | 3300025728 | Ga0207655_1004759 | Ga0207655_100475910 | 332 |
| 425 | 3300025901 | Ga0207688_10076748 | Ga0207688_100767482 | 332 |
| 426 | 3300025903 | Ga0207680_10088610 | Ga0207680_100886101 | 332 |
| 427 | 3300025907 | Ga0207645_10043147 | Ga0207645_100431473 | 332 |
| 428 | 3300025908 | Ga0207643_10020442 | Ga0207643_100204423 | 332 |
| 429 | 3300025909 | Ga0207705_10000006 | Ga0207705_10000006261 | 332 |
| 430 | 3300025923 | Ga0207681_10066294 | Ga0207681_100662941 | 332 |
| 431 | 3300025935 | Ga0207709_10012186 | Ga0207709_100121863 | 332 |
| 432 | 3300025937 | Ga0207669_10127085 | Ga0207669_101270852 | 332 |
| 433 | 3300025940 | Ga0207691_10002070 | Ga0207691_1000207021 | 332 |
| 434 | 3300025949 | Ga0207667_10226368 | Ga0207667_102263682 | 332 |
| 435 | 3300025972 | Ga0207668_10256352 | Ga0207668_102563521 | 332 |
| 436 | 3300026067 | Ga0207678_10018693 | Ga0207678_100186934 | 332 |
| 437 | 3300026067 | Ga0207678_10123930 | Ga0207678_101239303 | 332 |
| 438 | 3300026116 | Ga0207674_10116206 | Ga0207674_101162062 | 332 |
| 439 | 3300026118 | Ga0207675_100137987 | Ga0207675_1001379872 | 332 |
| 440 | 3300026121 | Ga0207683_10047950 | Ga0207683_100479502 | 332 |
| 441 | 3300027907 | Ga0207428_10019201 | Ga0207428_100192014 | 332 |
| 442 | 3300031548 | Ga0307408_100009334 | Ga0307408_1000093345 | 332 |
| 443 | 3300031548 | Ga0307408_100055671 | Ga0307408_1000556711 | 332 |
| 444 | 3300031548 | Ga0307408_100058972 | Ga0307408_1000589723 | 332 |
| 445 | 3300031548 | Ga0307408_100079005 | Ga0307408_1000790051 | 332 |
| 446 | 3300031548 | Ga0307408_100115111 | Ga0307408_1001151112 | 332 |
| 447 | 3300031548 | Ga0307408_100133340 | Ga0307408_1001333402 | 332 |
| 448 | 3300031548 | Ga0307408_100168538 | Ga0307408_1001685381 | 332 |
| 449 | 3300031731 | Ga0307405_10010498 | Ga0307405_100104986 | 332 |
| 450 | 3300031731 | Ga0307405_10011400 | Ga0307405_100114003 | 332 |
| 451 | 3300031731 | Ga0307405_10034210 | Ga0307405_100342102 | 332 |
| 452 | 3300031731 | Ga0307405_10119561 | Ga0307405_101195612 | 332 |
| 453 | 3300031731 | Ga0307405_10190162 | Ga0307405_101901622 | 332 |
| 454 | 3300031731 | Ga0307405_10265623 | Ga0307405_102656232 | 332 |
| 455 | 3300031824 | Ga0307413_10040512 | Ga0307413_100405122 | 332 |
| 456 | 3300031824 | Ga0307413_10124419 | Ga0307413_101244192 | 332 |
| 457 | 3300031824 | Ga0307413_10163054 | Ga0307413_101630542 | 332 |
| 458 | 3300031852 | Ga0307410_10000483 | Ga0307410_1000048319 | 332 |
| 459 | 3300031852 | Ga0307410_10007830 | Ga0307410_100078303 | 332 |
| 460 | 3300031852 | Ga0307410_10011356 | Ga0307410_100113563 | 332 |
| 461 | 3300031852 | Ga0307410_10014438 | Ga0307410_100144383 | 332 |
| 462 | 3300031852 | Ga0307410_10069048 | Ga0307410_100690483 | 332 |
| 463 | 3300031852 | Ga0307410_10227054 | Ga0307410_102270542 | 332 |
| 464 | 3300031901 | Ga0307406_10000123 | Ga0307406_1000012324 | 332 |
| 465 | 3300031901 | Ga0307406_10000602 | Ga0307406_1000060210 | 332 |
| 466 | 3300031901 | Ga0307406_10111773 | Ga0307406_101117731 | 332 |
| 467 | 3300031903 | Ga0307407_10033482 | Ga0307407_100334822 | 332 |
| 468 | 3300031903 | Ga0307407_10054479 | Ga0307407_100544792 | 332 |
| 469 | 3300031903 | Ga0307407_10063154 | Ga0307407_100631542 | 332 |
| 470 | 3300031903 | Ga0307407_10091901 | Ga0307407_100919012 | 332 |
| 471 | 3300031903 | Ga0307407_10130134 | Ga0307407_101301341 | 332 |
| 472 | 3300031911 | Ga0307412_10004963 | Ga0307412_100049633 | 332 |
| 473 | 3300031911 | Ga0307412_10006489 | Ga0307412_100064896 | 332 |
| 474 | 3300031911 | Ga0307412_10017086 | Ga0307412_100170863 | 332 |
| 475 | 3300031911 | Ga0307412_10024794 | Ga0307412_100247943 | 332 |
| 476 | 3300031911 | Ga0307412_10030909 | Ga0307412_100309092 | 332 |
| 477 | 3300031911 | Ga0307412_10142146 | Ga0307412_101421462 | 332 |
| 478 | 3300031911 | Ga0307412_10176691 | Ga0307412_101766912 | 332 |
| 479 | 3300031911 | Ga0307412_10383330 | Ga0307412_103833301 | 332 |
| 480 | 3300031995 | Ga0307409_100017020 | Ga0307409_1000170202 | 332 |
| 481 | 3300031995 | Ga0307409_100018981 | Ga0307409_1000189812 | 332 |
| 482 | 3300031995 | Ga0307409_100096756 | Ga0307409_1000967562 | 332 |
| 483 | 3300031995 | Ga0307409_100198952 | Ga0307409_1001989522 | 332 |
| 484 | 3300031995 | Ga0307409_100240160 | Ga0307409_1002401601 | 332 |
| 485 | 3300032002 | Ga0307416_100007835 | Ga0307416_1000078354 | 332 |
| 486 | 3300032002 | Ga0307416_100025951 | Ga0307416_1000259512 | 332 |
| 487 | 3300032002 | Ga0307416_100027551 | Ga0307416_1000275514 | 332 |
| 488 | 3300032002 | Ga0307416_100055902 | Ga0307416_1000559023 | 332 |
| 489 | 3300032002 | Ga0307416_100250300 | Ga0307416_1002503002 | 332 |
| 490 | 3300032002 | Ga0307416_100448103 | Ga0307416_1004481032 | 332 |
| 491 | 3300032004 | Ga0307414_10011634 | Ga0307414_100116343 | 332 |
| 492 | 3300032004 | Ga0307414_10152357 | Ga0307414_101523572 | 332 |
| 493 | 3300032004 | Ga0307414_10199891 | Ga0307414_101998912 | 332 |
| 494 | 3300032004 | Ga0307414_10228588 | Ga0307414_102285881 | 332 |
| 495 | 3300032004 | Ga0307414_10416969 | Ga0307414_104169691 | 332 |
| 496 | 3300032005 | Ga0307411_10191066 | Ga0307411_101910662 | 332 |
| 497 | 3300032005 | Ga0307411_10217366 | Ga0307411_102173661 | 332 |
| 498 | 3300032126 | Ga0307415_100018338 | Ga0307415_1000183383 | 332 |
| 499 | 3300032126 | Ga0307415_100022659 | Ga0307415_1000226593 | 332 |
| 500 | 3300032126 | Ga0307415_100348896 | Ga0307415_1003488961 | 332 |
| 501 | 3300037312 | Ga0395899_0002648 | Ga0395899_0002648_10923_11984 | 332 |
| 502 | 3300037312 | Ga0395899_0026613 | Ga0395899_0026613_506_1567 | 332 |
| 503 | 3300037312 | Ga0395899_0039738 | Ga0395899_0039738_1351_2355 | 332 |
| 504 | 3300037312 | Ga0395899_0175911 | Ga0395899_0175911_74_1135 | 332 |
| 505 | 3300037418 | Ga0395900_0019759 | Ga0395900_0019759_809_1813 | 332 |
| 506 | 3300037418 | Ga0395900_0035603 | Ga0395900_0035603_205_1266 | 332 |
| 507 | 3300037418 | Ga0395900_0036339 | Ga0395900_0036339_3164_4168 | 332 |
| 508 | 3300037418 | Ga0395900_0039159 | Ga0395900_0039159_2520_3581 | 332 |
| 509 | 3300037418 | Ga0395900_0054802 | Ga0395900_0054802_366_1427 | 332 |
| 510 | 3300037418 | Ga0395900_0147520 | Ga0395900_0147520_802_1863 | 332 |
| 511 | 3300037418 | Ga0395900_0198705 | Ga0395900_0198705_920_1981 | 332 |
| 512 | 3300037466 | Ga0395898_0000677 | Ga0395898_0000677_3005_4009 | 332 |
| 513 | 3300037466 | Ga0395898_0019181 | Ga0395898_0019181_5720_6781 | 332 |
| 514 | 3300037466 | Ga0395898_0101543 | Ga0395898_0101543_1511_2572 | 332 |
| 515 | 3300037466 | Ga0395898_0127254 | Ga0395898_0127254_391_1452 | 332 |
| 516 | 3300037466 | Ga0395898_0262563 | Ga0395898_0262563_234_1295 | 332 |
| 517 | 3300037466 | Ga0395898_0529163 | Ga0395898_0529163_22_1083 | 332 |
| 518 | 3300037471 | Ga0395905_0072103 | Ga0395905_0072103_391_1452 | 332 |
| 519 | 3300038443 | Ga0395901_0003516 | Ga0395901_0003516_11513_12574 | 332 |
| 520 | 3300038443 | Ga0395901_0057360 | Ga0395901_0057360_378_1439 | 332 |
| 521 | 3300038443 | Ga0395901_0065598 | Ga0395901_0065598_1108_2169 | 332 |
| 522 | 3300038443 | Ga0395901_0126489 | Ga0395901_0126489_81_1142 | 332 |
| 523 | 3300038443 | Ga0395901_0160290 | Ga0395901_0160290_365_1426 | 332 |
| 524 | 3300038443 | Ga0395901_0170549 | Ga0395901_0170549_1007_2068 | 332 |
| 525 | 3300038443 | Ga0395901_0208600 | Ga0395901_0208600_235_1239 | 332 |
| 526 | 3300038443 | Ga0395901_0327908 | Ga0395901_0327908_179_1183 | 332 |
| 527 | 3300038443 | Ga0395901_0421668 | Ga0395901_0421668_73_1134 | 332 |
| 528 | 3300041404 | Ga0439436_0002956 | Ga0439436_0002956_2499_3560 | 332 |
| 529 | 3300041407 | Ga0439447_009652 | Ga0439447_009652_456_1505 | 332 |
| 530 | 3300041410 | Ga0439461_0001316 | Ga0439461_0001316_473_1522 | 332 |
| 531 | 3300041411 | Ga0439466_0005317 | Ga0439466_0005317_962_2011 | 332 |
| 532 | 3300041411 | Ga0439466_0007923 | Ga0439466_0007923_193_1254 | 332 |
| 533 | 3300041413 | Ga0439465_0014410 | Ga0439465_0014410_1161_2222 | 332 |
| 534 | 3300041452 | Ga0451793_0828623 | Ga0451793_0828623_722_1726 | 332 |
| 535 | 3300041999 | Ga0439433_0000490 | Ga0439433_0000490_5595_6656 | 332 |
| 536 | 3300041999 | Ga0439433_0009092 | Ga0439433_0009092_246_1295 | 332 |
| 537 | 3300041999 | Ga0439433_0013464 | Ga0439433_0013464_274_1335 | 332 |
| 538 | 3300042002 | Ga0439442_000003 | Ga0439442_000003_33003_34064 | 332 |
| 539 | 3300042002 | Ga0439442_000415 | Ga0439442_000415_1336_2436 | 332 |
| 540 | 3300042002 | Ga0439442_000785 | Ga0439442_000785_2709_3770 | 332 |
| 541 | 3300042006 | Ga0439432_000482 | Ga0439432_000482_6589_7638 | 332 |
| 542 | 3300042007 | Ga0439449_0004415 | Ga0439449_0004415_1127_2188 | 332 |
| 543 | 3300042007 | Ga0439449_0005537 | Ga0439449_0005537_2962_4050 | 332 |
| 544 | 3300042010 | Ga0439452_001631 | Ga0439452_001631_3031_4080 | 332 |
| 545 | 3300042014 | Ga0439457_011477 | Ga0439457_011477_250_1311 | 332 |
| 546 | 3300042015 | Ga0439462_0002134 | Ga0439462_0002134_868_1917 | 332 |
| 547 | 3300042121 | Ga0450919_000178 | Ga0450919_000178_1692_2741 | 332 |
| 548 | 3300042122 | Ga0450920_000449 | Ga0450920_000449_101_1162 | 332 |
| 549 | 3300042122 | Ga0450920_001395 | Ga0450920_001395_1380_2429 | 332 |
| 550 | 3300042122 | Ga0450920_006052 | Ga0450920_006052_202_1263 | 332 |
| 551 | 3300042146 | Ga0450907_000170 | Ga0450907_000170_19523_20584 | 332 |
| 552 | 3300042146 | Ga0450907_004717 | Ga0450907_004717_491_1540 | 332 |
| 553 | 3300042184 | Ga0450908_006286 | Ga0450908_006286_959_2008 | 332 |
| 554 | 3300042185 | Ga0450909_003189 | Ga0450909_003189_1242_2291 | 332 |
| 555 | 3300042435 | Ga0439434_0000044 | Ga0439434_0000044_3284_4345 | 332 |
| 556 | 3300042435 | Ga0439434_0000575 | Ga0439434_0000575_6784_7833 | 332 |
| 557 | 3300042435 | Ga0439434_0028115 | Ga0439434_0028115_622_1683 | 332 |
| 558 | 3300044658 | Ga0466972_0007166 | Ga0466972_0007166_3203_4207 | 332 |
| 559 | 3300044658 | Ga0466972_0056087 | Ga0466972_0056087_253_1257 | 332 |
| 560 | 3300044684 | Ga0466966_0073197 | Ga0466966_0073197_808_1869 | 332 |
| 561 | 3300044684 | Ga0466966_0221371 | Ga0466966_0221371_20_1024 | 332 |
| 562 | 3300044693 | Ga0466961_0011738 | Ga0466961_0011738_3658_4662 | 332 |
| 563 | 3300044693 | Ga0466961_0052131 | Ga0466961_0052131_302_1306 | 332 |
| 564 | 3300044719 | Ga0466971_0068131 | Ga0466971_0068131_228_1232 | 332 |
| 565 | 3300044765 | Ga0466970_0000428 | Ga0466970_0000428_1904_2902 | 332 |
| 566 | 3300044765 | Ga0466970_0012059 | Ga0466970_0012059_243_1247 | 332 |
| 567 | 3300044765 | Ga0466970_0080751 | Ga0466970_0080751_70_1074 | 332 |
| 568 | 3300044842 | Ga0466957_0106894 | Ga0466957_0106894_594_1592 | 332 |
| 569 | 3300044901 | Ga0466960_0011585 | Ga0466960_0011585_1965_2969 | 332 |
| 570 | 3300045049 | Ga0466959_0006255 | Ga0466959_0006255_4229_5233 | 332 |
| 571 | 3300045836 | Ga0466958_0211021 | Ga0466958_0211021_213_1217 | 332 |
| 572 | 3300046453 | Ga0495627_000742 | Ga0495627_000742_2267_3268 | 332 |
| 573 | 3300046460 | Ga0495638_0062310 | Ga0495638_0062310_420_1481 | 332 |
| 574 | 3300046463 | Ga0495653_0037682 | Ga0495653_0037682_1678_2739 | 332 |
| 575 | 3300046472 | Ga0495580_0009570 | Ga0495580_0009570_3521_4582 | 332 |
| 576 | 3300046472 | Ga0495580_0261159 | Ga0495580_0261159_50_1111 | 332 |
| 577 | 3300046473 | Ga0495582_0143422 | Ga0495582_0143422_122_1183 | 332 |
| 578 | 3300046475 | Ga0495639_0002665 | Ga0495639_0002665_889_1950 | 332 |
| 579 | 3300046531 | Ga0495665_0005279 | Ga0495665_0005279_4460_5521 | 332 |
| 580 | 3300046535 | Ga0495586_0016303 | Ga0495586_0016303_1486_2547 | 332 |
| 581 | 3300046535 | Ga0495586_0040427 | Ga0495586_0040427_398_1459 | 332 |
| 582 | 3300046536 | Ga0495587_0055060 | Ga0495587_0055060_1202_2263 | 332 |
| 583 | 3300046543 | Ga0495645_0007535 | Ga0495645_0007535_2490_3491 | 332 |
| 584 | 3300046543 | Ga0495645_0011335 | Ga0495645_0011335_2082_3143 | 332 |
| 585 | 3300046615 | Ga0495656_0042341 | Ga0495656_0042341_198_1202 | 332 |
| 586 | 3300046616 | Ga0495668_0031038 | Ga0495668_0031038_343_1404 | 332 |
| 587 | 3300046663 | Ga0495635_0186783 | Ga0495635_0186783_146_1207 | 332 |
| 588 | 3300046674 | Ga0495588_0003154 | Ga0495588_0003154_839_1900 | 332 |
| 589 | 3300046674 | Ga0495588_0007845 | Ga0495588_0007845_2517_3578 | 332 |
| 590 | 3300046674 | Ga0495588_0035567 | Ga0495588_0035567_441_1502 | 332 |
| 591 | 3300046674 | Ga0495588_0076342 | Ga0495588_0076342_413_1474 | 332 |
| 592 | 3300046689 | Ga0495613_0328529 | Ga0495613_0328529_36_1040 | 332 |
| 593 | 3300046691 | Ga0495670_0080676 | Ga0495670_0080676_558_1619 | 332 |
| 594 | 3300046809 | Ga0495600_0020743 | Ga0495600_0020743_214_1275 | 332 |
| 595 | 3300047315 | Ga0495581_0010232 | Ga0495581_0010232_881_1942 | 332 |
| 596 | 3300047445 | Ga0495677_0012700 | Ga0495677_0012700_1498_2559 | 332 |
| 597 | 3300047673 | Ga0495593_0056575 | Ga0495593_0056575_247_1308 | 332 |
| 598 | 3300048903 | Ga0496100_0056030 | Ga0496100_0056030_933_1934 | 332 |
| 599 | 3300048904 | Ga0496101_0041350 | Ga0496101_0041350_850_1851 | 332 |
| 600 | 3300048904 | Ga0496101_0229495 | Ga0496101_0229495_280_1341 | 332 |
| 601 | 3300048905 | Ga0496102_0036332 | Ga0496102_0036332_3049_4110 | 332 |
| 602 | 3300048905 | Ga0496102_0056538 | Ga0496102_0056538_1844_2905 | 332 |
| 603 | 3300048905 | Ga0496102_0072042 | Ga0496102_0072042_1693_2754 | 332 |
| 604 | 3300048905 | Ga0496102_0102125 | Ga0496102_0102125_841_1842 | 332 |
| 605 | 3300048906 | Ga0496103_0028464 | Ga0496103_0028464_1311_2312 | 332 |
| 606 | 3300048906 | Ga0496103_0098687 | Ga0496103_0098687_319_1323 | 332 |
| 607 | 3300048907 | Ga0496104_0009242 | Ga0496104_0009242_6655_7659 | 332 |
| 608 | 3300048908 | Ga0496105_0032715 | Ga0496105_0032715_2101_3105 | 332 |
| 609 | 3300048908 | Ga0496105_0037902 | Ga0496105_0037902_2500_3501 | 332 |
| 610 | 3300048908 | Ga0496105_0090706 | Ga0496105_0090706_416_1417 | 332 |
| 611 | 3300048908 | Ga0496105_0122125 | Ga0496105_0122125_534_1538 | 332 |
| 612 | 3300048909 | Ga0496106_0070007 | Ga0496106_0070007_182_1243 | 332 |
| 613 | 3300048909 | Ga0496106_0150347 | Ga0496106_0150347_300_1361 | 332 |
| 614 | 3300048910 | Ga0496107_0007307 | Ga0496107_0007307_1025_2026 | 332 |
| 615 | 3300048910 | Ga0496107_0017706 | Ga0496107_0017706_980_1984 | 332 |
| 616 | 3300048911 | Ga0496108_0133989 | Ga0496108_0133989_1008_2009 | 332 |
| 617 | 3300048912 | Ga0496109_0031753 | Ga0496109_0031753_3135_4136 | 332 |
| 618 | 3300048912 | Ga0496109_0132466 | Ga0496109_0132466_269_1330 | 332 |
| 619 | 3300048913 | Ga0496110_0179996 | Ga0496110_0179996_541_1602 | 332 |
| 620 | 3300048913 | Ga0496110_0316467 | Ga0496110_0316467_34_1095 | 332 |
| 621 | 3300048914 | Ga0496111_0008731 | Ga0496111_0008731_3567_4628 | 332 |
| 622 | 3300048914 | Ga0496111_0032912 | Ga0496111_0032912_1832_2833 | 332 |
| 623 | 3300048915 | Ga0496112_0013055 | Ga0496112_0013055_1600_2661 | 332 |
| 624 | 3300048915 | Ga0496112_0027521 | Ga0496112_0027521_2631_3632 | 332 |
| 625 | 3300048915 | Ga0496112_0216124 | Ga0496112_0216124_650_1711 | 332 |
| 626 | 3300048916 | Ga0496113_0017866 | Ga0496113_0017866_2940_3941 | 332 |
| 627 | 3300048916 | Ga0496113_0149114 | Ga0496113_0149114_681_1742 | 332 |
| 628 | 3300048917 | Ga0496114_0007014 | Ga0496114_0007014_3929_4930 | 332 |
| 629 | 3300048917 | Ga0496114_0011754 | Ga0496114_0011754_5919_6920 | 332 |
| 630 | 3300048917 | Ga0496114_0035901 | Ga0496114_0035901_634_1695 | 332 |
| 631 | 3300048917 | Ga0496114_0040298 | Ga0496114_0040298_1998_3002 | 332 |
| 632 | 3300048917 | Ga0496114_0040447 | Ga0496114_0040447_2746_3747 | 332 |
| 633 | 3300048917 | Ga0496114_0041980 | Ga0496114_0041980_1242_2246 | 332 |
| 634 | 3300048917 | Ga0496114_0179026 | Ga0496114_0179026_565_1566 | 332 |
| 635 | 3300048917 | Ga0496114_0244733 | Ga0496114_0244733_92_1093 | 332 |
| 636 | 3300048917 | Ga0496114_0340252 | Ga0496114_0340252_161_1222 | 332 |
| 637 | 3300048918 | Ga0496115_0044786 | Ga0496115_0044786_1528_2532 | 332 |
| 638 | 3300048918 | Ga0496115_0060424 | Ga0496115_0060424_936_1937 | 332 |
| 639 | 3300048918 | Ga0496115_0067417 | Ga0496115_0067417_961_1962 | 332 |
| 640 | 3300048918 | Ga0496115_0235528 | Ga0496115_0235528_273_1334 | 332 |
| 641 | 3300048918 | Ga0496115_0393878 | Ga0496115_0393878_42_1046 | 332 |
| 642 | 3300048920 | Ga0496117_0000053 | Ga0496117_0000053_267070_268074 | 332 |
| 643 | 3300048920 | Ga0496117_0002845 | Ga0496117_0002845_482_1483 | 332 |
| 644 | 3300048920 | Ga0496117_0027117 | Ga0496117_0027117_989_1993 | 332 |
| 645 | 3300048921 | Ga0496118_0019871 | Ga0496118_0019871_2984_3985 | 332 |
| 646 | 3300048921 | Ga0496118_0186754 | Ga0496118_0186754_170_1174 | 332 |
| 647 | 3300048922 | Ga0496119_0001919 | Ga0496119_0001919_517_1521 | 332 |
| 648 | 3300048922 | Ga0496119_0002232 | Ga0496119_0002232_2526_3527 | 332 |
| 649 | 3300048922 | Ga0496119_0008189 | Ga0496119_0008189_6429_7433 | 332 |
| 650 | 3300048922 | Ga0496119_0129139 | Ga0496119_0129139_135_1136 | 332 |
| 651 | 3300048923 | Ga0496120_0000567 | Ga0496120_0000567_30500_31504 | 332 |
| 652 | 3300048924 | Ga0496121_0000076 | Ga0496121_0000076_128966_129997 | 332 |
| 653 | 3300048924 | Ga0496121_0019958 | Ga0496121_0019958_3092_4096 | 332 |
| 654 | 3300048924 | Ga0496121_0136827 | Ga0496121_0136827_220_1221 | 332 |
| 655 | 3300048925 | Ga0496122_0014414 | Ga0496122_0014414_4140_5144 | 332 |
| 656 | 3300048925 | Ga0496122_0017802 | Ga0496122_0017802_3729_4730 | 332 |
| 657 | 3300048925 | Ga0496122_0026081 | Ga0496122_0026081_2527_3528 | 332 |
| 658 | 3300048925 | Ga0496122_0062031 | Ga0496122_0062031_142_1143 | 332 |
| 659 | 3300048925 | Ga0496122_0106325 | Ga0496122_0106325_255_1259 | 332 |
| 660 | 3300048925 | Ga0496122_0143875 | Ga0496122_0143875_244_1248 | 332 |
| 661 | 3300048926 | Ga0496123_0004463 | Ga0496123_0004463_8674_9678 | 332 |
| 662 | 3300048927 | Ga0496124_0007376 | Ga0496124_0007376_2180_3184 | 332 |
| 663 | 3300048927 | Ga0496124_0053605 | Ga0496124_0053605_1060_2121 | 332 |
| 664 | 3300048927 | Ga0496124_0071521 | Ga0496124_0071521_611_1612 | 332 |
| 665 | 3300048927 | Ga0496124_0117814 | Ga0496124_0117814_1092_2093 | 332 |
| 666 | 3300048928 | Ga0496125_0000061 | Ga0496125_0000061_185390_186391 | 332 |
| 667 | 3300048928 | Ga0496125_0003349 | Ga0496125_0003349_10235_11236 | 332 |
| 668 | 3300048928 | Ga0496125_0004791 | Ga0496125_0004791_12209_13213 | 332 |
| 669 | 3300048928 | Ga0496125_0021752 | Ga0496125_0021752_1145_2146 | 332 |
| 670 | 3300048928 | Ga0496125_0041712 | Ga0496125_0041712_2592_3593 | 332 |
| 671 | 3300048928 | Ga0496125_0080008 | Ga0496125_0080008_424_1425 | 332 |
| 672 | 3300048929 | Ga0496126_0004531 | Ga0496126_0004531_4187_5191 | 332 |
| 673 | 3300048929 | Ga0496126_0103876 | Ga0496126_0103876_637_1638 | 332 |
| 674 | 3300048929 | Ga0496126_0121254 | Ga0496126_0121254_327_1328 | 332 |
| 675 | 3300048929 | Ga0496126_0224979 | Ga0496126_0224979_144_1145 | 332 |
| 676 | 3300048929 | Ga0496126_0253788 | Ga0496126_0253788_16_1017 | 332 |
| 677 | 3300049537 | Ga0501321_000365 | Ga0501321_000365_1482_2570 | 332 |
| 678 | 3300049537 | Ga0501321_005457 | Ga0501321_005457_51_1112 | 332 |
| 679 | 3300049568 | Ga0501031_0008742 | Ga0501031_0008742_5003_6007 | 332 |
| 680 | 3300049569 | Ga0501032_0000691 | Ga0501032_0000691_150_1211 | 332 |
| 681 | 3300049570 | Ga0501033_0006508 | Ga0501033_0006508_7328_8332 | 332 |
| 682 | 3300049570 | Ga0501033_0007517 | Ga0501033_0007517_5003_6007 | 332 |
| 683 | 3300049571 | Ga0501034_0000123 | Ga0501034_0000123_139924_140985 | 332 |
| 684 | 3300049571 | Ga0501034_0006950 | Ga0501034_0006950_3070_4071 | 332 |
| 685 | 3300049571 | Ga0501034_0025898 | Ga0501034_0025898_195_1199 | 332 |
| 686 | 3300049571 | Ga0501034_0035910 | Ga0501034_0035910_3928_4926 | 332 |
| 687 | 3300049571 | Ga0501034_0039896 | Ga0501034_0039896_2452_3453 | 332 |
| 688 | 3300049572 | Ga0501036_0024497 | Ga0501036_0024497_3507_4511 | 332 |
| 689 | 3300049573 | Ga0501037_0009537 | Ga0501037_0009537_3168_4229 | 332 |
| 690 | 3300049573 | Ga0501037_0037164 | Ga0501037_0037164_962_2023 | 332 |
| 691 | 3300049573 | Ga0501037_0144161 | Ga0501037_0144161_407_1408 | 332 |
| 692 | 3300049574 | Ga0501038_0005618 | Ga0501038_0005618_2348_3346 | 332 |
| 693 | 3300049574 | Ga0501038_0029074 | Ga0501038_0029074_3362_4423 | 332 |
| 694 | 3300049574 | Ga0501038_0095873 | Ga0501038_0095873_951_2012 | 332 |
| 695 | 3300049574 | Ga0501038_0160592 | Ga0501038_0160592_255_1259 | 332 |
| 696 | 3300049575 | Ga0501039_0009494 | Ga0501039_0009494_3727_4731 | 332 |
| 697 | 3300049575 | Ga0501039_0155369 | Ga0501039_0155369_531_1532 | 332 |
| 698 | 3300049578 | Ga0501042_0028951 | Ga0501042_0028951_852_1856 | 332 |
| 699 | 3300049579 | Ga0501043_0022104 | Ga0501043_0022104_802_1863 | 332 |
| 700 | 3300049579 | Ga0501043_0062026 | Ga0501043_0062026_1897_2901 | 332 |
| 701 | 3300049579 | Ga0501043_0276008 | Ga0501043_0276008_111_1115 | 332 |
| 702 | 3300049579 | Ga0501043_0282871 | Ga0501043_0282871_112_1113 | 332 |
| 703 | 3300049580 | Ga0501046_0030096 | Ga0501046_0030096_880_1896 | 332 |
| 704 | 3300049581 | Ga0501047_0003895 | Ga0501047_0003895_961_1965 | 332 |
| 705 | 3300049581 | Ga0501047_0081513 | Ga0501047_0081513_316_1332 | 332 |
| 706 | 3300049582 | Ga0501048_0001989 | Ga0501048_0001989_30_1034 | 332 |
| 707 | 3300049583 | Ga0501067_0071637 | Ga0501067_0071637_81_1085 | 332 |
| 708 | 3300049586 | Ga0501070_0000088 | Ga0501070_0000088_5577_6581 | 332 |
| 709 | 3300049586 | Ga0501070_0015424 | Ga0501070_0015424_2877_3878 | 332 |
| 710 | 3300049586 | Ga0501070_0022690 | Ga0501070_0022690_3849_4853 | 332 |
| 711 | 3300049589 | Ga0501073_0026258 | Ga0501073_0026258_792_1796 | 332 |
| 712 | 3300049590 | Ga0501074_0033589 | Ga0501074_0033589_1164_2168 | 332 |
| 713 | 3300049742 | Ga0501080_0081761 | Ga0501080_0081761_874_1878 | 332 |
| 714 | 3300049822 | Ga0501035_0010037 | Ga0501035_0010037_4873_5877 | 332 |
| 715 | 3300049822 | Ga0501035_0061517 | Ga0501035_0061517_2286_3290 | 332 |
| 716 | 3300049823 | Ga0501044_0017210 | Ga0501044_0017210_1121_2125 | 332 |
| 717 | 3300049823 | Ga0501044_0050928 | Ga0501044_0050928_2640_3644 | 332 |
| 718 | 3300049823 | Ga0501044_0086590 | Ga0501044_0086590_1812_2873 | 332 |
| 719 | 3300049824 | Ga0501045_0042263 | Ga0501045_0042263_1390_2394 | 332 |
| 720 | 3300050491 | nmdc:mga00v17_47213_c1 | nmdc:mga00v17_47213_c1_465_1466 | 332 |
| 721 | 3300050492 | nmdc:mga0yw44_2472_c1 | nmdc:mga0yw44_2472_c1_4510_5511 | 332 |
| 722 | 3300050494 | nmdc:mga06z11_26546_c1 | nmdc:mga06z11_26546_c1_1251_2252 | 332 |
| 723 | 3300050516 | nmdc:mga0sz30_55015_c1 | nmdc:mga0sz30_55015_c1_481_1482 | 332 |
| 724 | 3300053080 | Ga0500635_0000013 | Ga0500635_0000013_118443_119447 | 332 |
| 725 | 3300053087 | Ga0500643_000275 | Ga0500643_000275_13783_14784 | 332 |
| 726 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_419978_420979 | 332 |
| 727 | 3300053136 | Ga0500559_0002603 | Ga0500559_0002603_305_1309 | 332 |
| 728 | 3300053136 | Ga0500559_0015737 | Ga0500559_0015737_1813_2817 | 332 |
| 729 | 3300053136 | Ga0500559_0027667 | Ga0500559_0027667_249_1253 | 332 |
| 730 | 3300053139 | Ga0500568_0000006 | Ga0500568_0000006_286607_287608 | 332 |
| 731 | 3300053140 | Ga0500573_0004755 | Ga0500573_0004755_1680_2684 | 332 |
| 732 | 3300053140 | Ga0500573_0042418 | Ga0500573_0042418_507_1508 | 332 |
| 733 | 3300053140 | Ga0500573_0061830 | Ga0500573_0061830_208_1212 | 332 |
| 734 | 3300053140 | Ga0500573_0082125 | Ga0500573_0082125_491_1495 | 332 |
| 735 | 3300053140 | Ga0500573_0101561 | Ga0500573_0101561_291_1295 | 332 |
| 736 | 3300053140 | Ga0500573_0109466 | Ga0500573_0109466_520_1524 | 332 |
| 737 | 3300053140 | Ga0500573_0195401 | Ga0500573_0195401_47_1054 | 332 |
| 738 | 3300059510 | Ga0587090_000501 | Ga0587090_000501_469_1530 | 332 |
| 739 | 3300060353 | Ga0501082_0146675 | Ga0501082_0146675_303_1304 | 332 |
| 740 | 3300061719 | Ga0466962_0028064 | Ga0466962_0028064_231_1235 | 332 |
| 741 | iso_pu_bacteria | 2821268502 | 2821270014 | 332 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ewp-assembly3.cif.gz_F | crystal structure of fabh from micrococcus luteus | 0.9868 | 1 | 332 |
| 4ewp-assembly3.cif.gz_F | crystal structure of fabh from micrococcus luteus | 0.9839 | 1 | 332 |
| 2ahb-assembly1.cif.gz_A | x-ray crystal structure of r46a,r161a mutant of mycobacterium tuberculosis fabh | 0.9768 | 1 | 332 |
| 1hzp-assembly1.cif.gz_A | crystal structure of the myobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii | 0.9764 | 1 | 332 |
| 1u6s-assembly1.cif.gz_A | crystal structure of the complex between mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii and lauroyl coenzyme a | 0.9763 | 1 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ewpF01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9852 | 1 | 182 | 3.40.47.10 |
| 4ewpF01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9799 | 1 | 182 | 3.40.47.10 |
| 4ewpC02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9754 | 183 | 331 | 3.40.47.10 |
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9677 | 12 | 180 | 3.40.47.10 |
| 1zowB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9673 | 12 | 180 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5CHN8-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9974 | 1 | 251 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-P64117-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9943 | 12 | 332 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 |
| AF-A0A1H1YAX5-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] synthase-3 | 0.9932 | 1 | 332 |
GO:0004315
GO:0005737 GO:0006633 GO:0044550 |
| AF-A0A1H1YAX5-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] synthase-3 | 0.9903 | 1 | 332 |
GO:0004315
GO:0005737 GO:0006633 GO:0044550 |
| AF-A0A3D5CHN8-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9895 | 1 | 251 |
GO:0004315
GO:0006633 GO:0044550 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar