F478601

General Info

Members Datasets Scaffolds Average Seq Length
741 411 597 338

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0001712|Ga0466970_0001712_8845_9900
Length 351
Sequence MTDATTPSPAADGTDASRASRPMLQQRRGHEYTRILAFGAARGENVVPNDDLVGPIDSSDEWIRQRTGIVTRKRAGADVEAVDLAETAAREAIEKAGITPDQIGVVLVSTVTHTVATPSMASLLAERIGATPAAAYDVSAACAGYAYGIAQADSFIKSGLADHVLVVGAEKLSDVVDPTDRSISFLLGDGAGAAVVGPSDFPGIAPTIWGSDGSKWDAIGMTATYNEWAAGAPRPTMRQAGQTVFRWAVWEMVKVARQALETAGVAPEDLAAFVPHQANIRIIDEFAKQLGLPDTVTIARDITTTGNTSAASIPLATHRLLEEHPELSGGLALQIGFGAGLVFGAQVVVLP

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221549 Agromyces sp. Root1464 Isolate Unclassified
5 2643221553 Microbacterium sp. Root553 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221572 Leifsonia sp. Root60 Isolate Unclassified
8 2643221575 Microbacterium sp. Root61 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221613 Oerskovia sp. Root22 Isolate Unclassified
11 2643221616 Leifsonia sp. Root227 Isolate Unclassified
12 2643221619 Agromyces sp. Root81 Isolate Unclassified
13 2643221630 Microbacterium sp. Root322 Isolate Unclassified
14 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
15 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
16 2643221649 Leifsonia sp. Root4 Isolate Unclassified
17 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
18 2643221721 Oerskovia sp. Root918 Isolate Unclassified
19 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
20 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
21 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
22 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
23 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
24 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
25 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
26 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
27 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
28 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
29 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
30 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
31 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
32 2773857759 Microbacterium sp. 1294 Isolate Unclassified
33 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
34 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
35 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
36 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
37 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
38 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
39 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
40 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
41 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
42 2808606372 Agromyces sp. 23-23 Isolate Unclassified
43 2808606394 Promicromonospora sp. C35 Isolate Unclassified
44 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
45 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
46 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
47 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
48 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
49 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
50 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
51 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
52 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
53 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
54 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
55 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
56 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
57 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
58 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
59 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
60 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
61 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
62 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
63 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
64 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
65 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
66 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
67 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
68 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
69 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
70 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
71 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
72 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
73 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
74 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
75 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
76 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
77 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
78 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
79 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
80 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
81 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
82 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
83 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
84 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
85 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
86 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
87 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
88 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
89 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
90 2919069694 Microbacterium sp. 1154 Isolate Unclassified
91 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
92 2919395869 Microbacterium resistens 2980 Isolate Unclassified
93 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
94 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
95 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
96 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
97 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
98 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
99 2928153084 Leifsonia sp. 563 Isolate Unclassified
100 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
101 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
102 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
103 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
104 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
105 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
106 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
107 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
108 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
109 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
110 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
111 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
112 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
113 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
114 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
115 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
116 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
117 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
118 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
119 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
120 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
121 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
122 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
123 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
124 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
125 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
126 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
127 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
128 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
129 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
130 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
131 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
132 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
133 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
134 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
135 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
136 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
137 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
138 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
139 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
140 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
141 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
142 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
143 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
144 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
145 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
146 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
147 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
148 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
149 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
150 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
151 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
152 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
153 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
154 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
155 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
156 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
157 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
158 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
159 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
162 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
163 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
164 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
165 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
166 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
167 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
168 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
169 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
173 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
174 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
175 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
176 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
177 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
178 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
179 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
180 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
181 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
182 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
183 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
184 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
185 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
186 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
187 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
198 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
199 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
200 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
201 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
204 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
205 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
207 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
246 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
247 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
251 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
269 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
270 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
271 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
274 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
275 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
276 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
277 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
278 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
279 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
280 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
281 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
282 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
283 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
284 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
285 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
286 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
300 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
376 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
377 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
384 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
385 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
386 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
387 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
388 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
389 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
390 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
394 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
395 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
396 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
397 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
398 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
401 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
402 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
403 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
404 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
405 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
406 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
407 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
408 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
409 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
410 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
411 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.68
Metatranscriptomes 1.89
Isolates 19.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 10.12
Nodule 0
Rhizoplane 6.48
Rhizosphere 62.08
Stem 0
Stem Tuber 0.13
Unclassified 20.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019274 3300001979 Bacteria 2406
2 JGI25164J39214_1001094 3300002772 Bacteria 7828
3 JGI25165J46597_1000002 3300003214 Bacteria 765387
4 Ga0007423J48922_100085 3300003285 Bacteria 5105
5 Ga0006781J51513_1016252 3300003568 Bacteria 1970
6 Ga0006562J51391_1010318 3300003578 Bacteria 3705
7 Ga0006562J51391_1010319 3300003578 Bacteria 3480
8 Ga0006562J51391_1043582 3300003578 Bacteria 3561
9 Ga0055539_1000008 3300003752 Bacteria 537665
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1001682 3300003759 Bacteria 3362
12 Ga0055527_1000001 3300003760 Bacteria 850044
13 Ga0055542_1002506 3300003762 Bacteria 5934
14 Ga0055529_1000065 3300003763 Bacteria 173112
15 Ga0055541_1001922 3300003841 Bacteria 4302
16 Ga0070658_10022612 3300005327 Bacteria 5045
17 Ga0070658_10039005 3300005327 Bacteria 3831
18 Ga0070658_10074571 3300005327 Bacteria 2782
19 Ga0070666_10118330 3300005335 Bacteria 1836
20 Ga0068868_100070367 3300005338 Bacteria 2790
21 Ga0070660_100052441 3300005339 Bacteria 3145
22 Ga0070669_100107544 3300005353 Bacteria 2113
23 Ga0070671_100157352 3300005355 Bacteria 1920
24 Ga0070659_100001568 3300005366 Bacteria 16463
25 Ga0070659_100029781 3300005366 Bacteria 4220
26 Ga0070667_100018034 3300005367 Bacteria 5850
27 Ga0070663_100346367 3300005455 Bacteria 1202
28 Ga0070685_10015029 3300005466 Bacteria 4109
29 Ga0068853_100100228 3300005539 Bacteria 2560
30 Ga0068855_100025111 3300005563 Bacteria 7134
31 Ga0068855_100141129 3300005563 Bacteria 2746
32 Ga0068855_100610323 3300005563 Bacteria 1175
33 Ga0068857_100179652 3300005577 Bacteria 1926
34 Ga0068854_100040007 3300005578 Bacteria 3305
35 Ga0068852_100002346 3300005616 Bacteria 13031
36 Ga0068851_10000003 3300005834 Bacteria 293018
37 Ga0068858_100000114 3300005842 Bacteria 84795
38 Ga0075365_10007107 3300006038 Bacteria 6243
39 Ga0075365_10007174 3300006038 Bacteria 6221
40 Ga0075365_10075558 3300006038 Bacteria 2274
41 Ga0075364_10015746 3300006051 Bacteria 4694
42 Ga0075364_10021485 3300006051 Bacteria 4069
43 Ga0075364_10038271 3300006051 Bacteria 3107
44 Ga0075432_10002026 3300006058 Bacteria 6735
45 Ga0075367_10049284 3300006178 Bacteria 2482
46 Ga0075369_10013652 3300006186 Bacteria 3230
47 Ga0105244_10004742 3300009036 Bacteria 9257
48 Ga0105244_10019348 3300009036 Bacteria 3803
49 Ga0105240_10001674 3300009093 Bacteria 37626
50 Ga0111539_10696939 3300009094 Bacteria 1182
51 Ga0105245_10020927 3300009098 Bacteria 5735
52 Ga0105243_10028060 3300009148 Bacteria 4318
53 Ga0105243_10088709 3300009148 Bacteria 2541
54 Ga0105243_10155422 3300009148 Bacteria 1966
55 Ga0105248_10059248 3300009177 Bacteria 4300
56 Ga0105237_10334434 3300009545 Bacteria 1519
57 Ga0105238_10003197 3300009551 Bacteria 16352
58 Ga0105249_10302755 3300009553 Bacteria 1604
59 Ga0105239_10462870 3300010375 Bacteria 1439
60 Ga0105246_10000351 3300011119 Bacteria 24715
61 Ga0105246_10002288 3300011119 Bacteria 11546
62 Ga0105246_10171443 3300011119 Bacteria 1662
63 Ga0105246_10299568 3300011119 Bacteria 1297
64 Ga0157373_10006949 3300013100 Bacteria 8426
65 Ga0157370_10005607 3300013104 Bacteria 14052
66 Ga0157370_10008506 3300013104 Bacteria 11069
67 Ga0157370_10231816 3300013104 Bacteria 1709
68 Ga0157369_10001845 3300013105 Bacteria 25607
69 Ga0157369_10087698 3300013105 Bacteria 3322
70 Ga0171462_1003 3300013250 Bacteria 853796
71 Ga0157374_10574006 3300013296 Bacteria 1137
72 Ga0163162_10145288 3300013306 Bacteria 2487
73 Ga0163162_10212625 3300013306 Bacteria 2064
74 Ga0163162_10245124 3300013306 Bacteria 1923
75 Ga0157372_10017895 3300013307 Bacteria 7614
76 Ga0157372_10637049 3300013307 Bacteria 1242
77 Ga0157375_10362126 3300013308 Bacteria 1616
78 Ga0157380_10009134 3300014326 Bacteria 7089
79 Ga0157380_10222234 3300014326 Bacteria 1690
80 Ga0157379_10003445 3300014968 Bacteria 13388
81 Ga0197907_10640432 3300020069 Bacteria 6017
82 Ga0206353_10586218 3300020082 Bacteria 6002
83 Ga0206353_10968007 3300020082 Bacteria 3146
84 Ga0209566_100455 3300025225 Bacteria 30192
85 Ga0209674_100001 3300025226 Bacteria 4013750
86 Ga0209672_100006 3300025228 Bacteria 1004497
87 Ga0209147_100505 3300025229 Bacteria 22687
88 Ga0209563_100001 3300025230 Bacteria 4013775
89 Ga0209563_105455 3300025230 Bacteria 2304
90 Ga0207427_100052 3300025231 Bacteria 218228
91 Ga0209437_100816 3300025233 Bacteria 13979
92 Ga0207425_1003428 3300025245 Bacteria 5079
93 Ga0209646_1000167 3300025246 Bacteria 87036
94 Ga0209677_100001 3300025253 Bacteria 4013787
95 Ga0209148_1000015 3300025254 Bacteria 850103
96 Ga0209148_1003448 3300025254 Bacteria 4372
97 Ga0209129_1000028 3300025258 Bacteria 405451
98 Ga0209233_1000001 3300025261 Bacteria 2992747
99 Ga0209455_1000013 3300025272 Bacteria 850103
100 Ga0209025_1000428 3300025294 Bacteria 83354
101 Ga0209051_1005262 3300025303 Bacteria 7622
102 Ga0209051_1010966 3300025303 Bacteria 4521
103 Ga0207697_10016651 3300025315 Bacteria 3028
104 Ga0207656_10000002 3300025321 Bacteria 792178
105 Ga0207655_1003680 3300025728 Bacteria 11300
106 Ga0207655_1003821 3300025728 Bacteria 10983
107 Ga0207655_1004759 3300025728 Bacteria 9470
108 Ga0207692_10054020 3300025898 Bacteria 2049
109 Ga0207688_10076748 3300025901 Bacteria 1903
110 Ga0207680_10088610 3300025903 Bacteria 1962
111 Ga0207680_10100177 3300025903 Bacteria 1860
112 Ga0207647_10015346 3300025904 Bacteria 5254
113 Ga0207645_10043147 3300025907 Bacteria 2886
114 Ga0207643_10020442 3300025908 Bacteria 3633
115 Ga0207705_10000006 3300025909 Bacteria 657147
116 Ga0207705_10124801 3300025909 Bacteria 1912
117 Ga0207654_10000001 3300025911 Bacteria 1816198
118 Ga0207695_10002367 3300025913 Bacteria 28011
119 Ga0207695_10038666 3300025913 Bacteria 5134
120 Ga0207671_10000002 3300025914 Bacteria 1144816
121 Ga0207657_10008307 3300025919 Bacteria 10562
122 Ga0207681_10066294 3300025923 Bacteria 2499
123 Ga0207694_10000092 3300025924 Bacteria 100605
124 Ga0207687_10009754 3300025927 Bacteria 6280
125 Ga0207644_10236090 3300025931 Bacteria 1454
126 Ga0207690_10000972 3300025932 Bacteria 18349
127 Ga0207709_10012186 3300025935 Bacteria 4740
128 Ga0207669_10127085 3300025937 Bacteria 1744
129 Ga0207691_10002070 3300025940 Bacteria 19565
130 Ga0207711_10000354 3300025941 Bacteria 48744
131 Ga0207667_10005363 3300025949 Bacteria 15633
132 Ga0207667_10006093 3300025949 Bacteria 14658
133 Ga0207667_10007363 3300025949 Bacteria 13242
134 Ga0207667_10098097 3300025949 Bacteria 3024
135 Ga0207667_10226368 3300025949 Bacteria 1916
136 Ga0207668_10256352 3300025972 Bacteria 1423
137 Ga0207640_10361171 3300025981 Bacteria 1170
138 Ga0207658_10004577 3300025986 Bacteria 9598
139 Ga0207703_10000315 3300026035 Bacteria 52633
140 Ga0207639_10074184 3300026041 Bacteria 2671
141 Ga0207678_10018693 3300026067 Bacteria 6085
142 Ga0207678_10123930 3300026067 Bacteria 2205
143 Ga0207702_10012308 3300026078 Bacteria 7121
144 Ga0207674_10116206 3300026116 Bacteria 2647
145 Ga0207675_100137987 3300026118 Bacteria 2315
146 Ga0207683_10047950 3300026121 Bacteria 3740
147 Ga0207698_10000255 3300026142 Bacteria 32639
148 Ga0207698_10003348 3300026142 Bacteria 9650
149 Ga0207428_10019201 3300027907 Bacteria 5829
150 Ga0307515_10185737 3300028794 Bacteria 2009
151 Ga0316176_1094005 3300030732 Bacteria 2553
152 Ga0316179_1000242 3300030734 Bacteria 1797
153 Ga0316181_1152364 3300030744 Bacteria 1262
154 Ga0307513_10218588 3300031456 Bacteria 1729
155 Ga0307408_100009334 3300031548 Bacteria 6465
156 Ga0307408_100055671 3300031548 Bacteria 2865
157 Ga0307408_100058972 3300031548 Bacteria 2792
158 Ga0307408_100079005 3300031548 Bacteria 2454
159 Ga0307408_100115111 3300031548 Bacteria 2073
160 Ga0307408_100133340 3300031548 Bacteria 1940
161 Ga0307408_100168538 3300031548 Bacteria 1746
162 Ga0307514_10053074 3300031649 Bacteria 3130
163 Ga0316575_10000173 3300031665 Bacteria 16605
164 Ga0307405_10010498 3300031731 Bacteria 4805
165 Ga0307405_10011400 3300031731 Bacteria 4657
166 Ga0307405_10034210 3300031731 Bacteria 3021
167 Ga0307405_10119561 3300031731 Bacteria 1800
168 Ga0307405_10190162 3300031731 Bacteria 1482
169 Ga0307405_10265623 3300031731 Bacteria 1284
170 Ga0307413_10040512 3300031824 Bacteria 2719
171 Ga0307413_10124419 3300031824 Bacteria 1753
172 Ga0307413_10163054 3300031824 Bacteria 1568
173 Ga0307410_10000483 3300031852 Bacteria 16146
174 Ga0307410_10007830 3300031852 Bacteria 5880
175 Ga0307410_10011356 3300031852 Bacteria 5090
176 Ga0307410_10014438 3300031852 Bacteria 4646
177 Ga0307410_10069048 3300031852 Bacteria 2443
178 Ga0307410_10071860 3300031852 Bacteria 2401
179 Ga0307410_10227054 3300031852 Bacteria 1439
180 Ga0307406_10000123 3300031901 Bacteria 45640
181 Ga0307406_10000602 3300031901 Bacteria 20583
182 Ga0307406_10111773 3300031901 Bacteria 1882
183 Ga0307407_10033482 3300031903 Bacteria 2804
184 Ga0307407_10054479 3300031903 Bacteria 2307
185 Ga0307407_10063154 3300031903 Bacteria 2171
186 Ga0307407_10091901 3300031903 Bacteria 1862
187 Ga0307407_10130134 3300031903 Bacteria 1609
188 Ga0307412_10004963 3300031911 Bacteria 7437
189 Ga0307412_10006489 3300031911 Bacteria 6616
190 Ga0307412_10017086 3300031911 Bacteria 4337
191 Ga0307412_10024794 3300031911 Bacteria 3706
192 Ga0307412_10030909 3300031911 Bacteria 3377
193 Ga0307412_10142146 3300031911 Bacteria 1759
194 Ga0307412_10176691 3300031911 Bacteria 1601
195 Ga0307412_10383330 3300031911 Bacteria 1139
196 Ga0307409_100016562 3300031995 Bacteria 4881
197 Ga0307409_100017020 3300031995 Bacteria 4831
198 Ga0307409_100018981 3300031995 Bacteria 4642
199 Ga0307409_100059527 3300031995 Bacteria 2973
200 Ga0307409_100096756 3300031995 Bacteria 2436
201 Ga0307409_100198952 3300031995 Bacteria 1791
202 Ga0307409_100240160 3300031995 Bacteria 1649
203 Ga0307416_100007835 3300032002 Bacteria 6828
204 Ga0307416_100025951 3300032002 Bacteria 4308
205 Ga0307416_100027551 3300032002 Bacteria 4210
206 Ga0307416_100040980 3300032002 Bacteria 3603
207 Ga0307416_100055902 3300032002 Bacteria 3181
208 Ga0307416_100064474 3300032002 Bacteria 3006
209 Ga0307416_100250300 3300032002 Bacteria 1724
210 Ga0307416_100448103 3300032002 Bacteria 1342
211 Ga0307414_10011634 3300032004 Bacteria 5169
212 Ga0307414_10152357 3300032004 Bacteria 1826
213 Ga0307414_10195425 3300032004 Bacteria 1641
214 Ga0307414_10199891 3300032004 Bacteria 1625
215 Ga0307414_10228588 3300032004 Bacteria 1532
216 Ga0307414_10416969 3300032004 Bacteria 1170
217 Ga0307411_10191066 3300032005 Bacteria 1563
218 Ga0307411_10217366 3300032005 Bacteria 1480
219 Ga0307415_100018338 3300032126 Bacteria 4223
220 Ga0307415_100022659 3300032126 Bacteria 3881
221 Ga0307415_100052984 3300032126 Bacteria 2762
222 Ga0307415_100348896 3300032126 Bacteria 1245
223 Ga0307415_100354409 3300032126 Bacteria 1237
224 Ga0395899_0002648 3300037312 Bacteria 14424
225 Ga0395899_0026613 3300037312 Bacteria 4364
226 Ga0395899_0037840 3300037312 Bacteria 3616
227 Ga0395899_0039738 3300037312 Bacteria 3520
228 Ga0395899_0175911 3300037312 Bacteria 1505
229 Ga0395900_0019759 3300037418 Bacteria 6866
230 Ga0395900_0035603 3300037418 Bacteria 5128
231 Ga0395900_0036339 3300037418 Bacteria 5078
232 Ga0395900_0039159 3300037418 Bacteria 4885
233 Ga0395900_0054802 3300037418 Bacteria 4106
234 Ga0395900_0147520 3300037418 Bacteria 2405
235 Ga0395900_0198705 3300037418 Bacteria 2030
236 Ga0395898_0000677 3300037466 Bacteria 61608
237 Ga0395898_0019181 3300037466 Bacteria 6962
238 Ga0395898_0101543 3300037466 Bacteria 2762
239 Ga0395898_0127254 3300037466 Bacteria 2441
240 Ga0395898_0262563 3300037466 Bacteria 1647
241 Ga0395898_0529163 3300037466 Bacteria 1120
242 Ga0395905_0072103 3300037471 Bacteria 3238
243 Ga0395901_0003516 3300038443 Bacteria 15776
244 Ga0395901_0051893 3300038443 Bacteria 4263
245 Ga0395901_0057360 3300038443 Bacteria 4050
246 Ga0395901_0065598 3300038443 Bacteria 3780
247 Ga0395901_0126489 3300038443 Bacteria 2686
248 Ga0395901_0160290 3300038443 Bacteria 2363
249 Ga0395901_0170549 3300038443 Bacteria 2283
250 Ga0395901_0208600 3300038443 Bacteria 2046
251 Ga0395901_0327908 3300038443 Bacteria 1583
252 Ga0395901_0421668 3300038443 Bacteria 1368
253 Ga0439436_0002956 3300041404 Bacteria 5152
254 Ga0439447_009652 3300041407 Bacteria 2910
255 Ga0439461_0001316 3300041410 Bacteria 3817
256 Ga0439466_0005317 3300041411 Bacteria 4924
257 Ga0439466_0007923 3300041411 Bacteria 4006
258 Ga0439465_0014410 3300041413 Bacteria 2463
259 Ga0451793_0754086 3300041452 Bacteria 1468
260 Ga0451793_0828623 3300041452 Bacteria 3308
261 Ga0439433_0000490 3300041999 Bacteria 7351
262 Ga0439433_0009092 3300041999 Bacteria 2162
263 Ga0439433_0013464 3300041999 Bacteria 1796
264 Ga0439442_000003 3300042002 Bacteria 73601
265 Ga0439442_000415 3300042002 Bacteria 10015
266 Ga0439442_000785 3300042002 Bacteria 6604
267 Ga0439432_000482 3300042006 Bacteria 14905
268 Ga0439449_0004415 3300042007 Bacteria 5424
269 Ga0439449_0005537 3300042007 Bacteria 4832
270 Ga0439452_001631 3300042010 Bacteria 8862
271 Ga0439457_011477 3300042014 Bacteria 2015
272 Ga0439462_0002134 3300042015 Bacteria 4543
273 Ga0450919_000178 3300042121 Bacteria 6815
274 Ga0450920_000449 3300042122 Bacteria 6396
275 Ga0450920_001395 3300042122 Bacteria 3994
276 Ga0450920_006052 3300042122 Bacteria 2166
277 Ga0450907_000170 3300042146 Bacteria 23867
278 Ga0450907_004717 3300042146 Bacteria 2335
279 Ga0450908_006286 3300042184 Bacteria 2260
280 Ga0450909_003189 3300042185 Bacteria 2332
281 Ga0439434_0000044 3300042435 Bacteria 30133
282 Ga0439434_0000575 3300042435 Bacteria 10613
283 Ga0439434_0028115 3300042435 Bacteria 1702
284 Ga0466972_0007166 3300044658 Bacteria 5598
285 Ga0466972_0056087 3300044658 Bacteria 1894
286 Ga0466965_0000007 3300044683 Bacteria 131940
287 Ga0466965_0003157 3300044683 Bacteria 7188
288 Ga0466965_0009366 3300044683 Bacteria 4550
289 Ga0466965_0093064 3300044683 Bacteria 1535
290 Ga0466966_0073197 3300044684 Bacteria 2144
291 Ga0466966_0221371 3300044684 Bacteria 1142
292 Ga0466961_0011738 3300044693 Bacteria 5598
293 Ga0466961_0052131 3300044693 Bacteria 2611
294 Ga0466961_0186277 3300044693 Bacteria 1288
295 Ga0466971_0068131 3300044719 Bacteria 1613
296 Ga0466968_0020748 3300044735 Bacteria 2655
297 Ga0466970_0000428 3300044765 Bacteria 20583
298 Ga0466970_0001712 3300044765 Bacteria 10550
299 Ga0466970_0012059 3300044765 Bacteria 4414
300 Ga0466970_0040060 3300044765 Bacteria 2487
301 Ga0466970_0080751 3300044765 Bacteria 1757
302 Ga0466957_0106894 3300044842 Bacteria 1771
303 Ga0466957_0112793 3300044842 Bacteria 1726
304 Ga0466957_0125000 3300044842 Bacteria 1643
305 Ga0466960_0006151 3300044901 Bacteria 4803
306 Ga0466960_0011585 3300044901 Bacteria 3695
307 Ga0466960_0024507 3300044901 Bacteria 2722
308 Ga0466959_0006255 3300045049 Bacteria 8226
309 Ga0466959_0092344 3300045049 Bacteria 2173
310 Ga0466959_0291011 3300045049 Bacteria 1120
311 Ga0466958_0211021 3300045836 Bacteria 1237
312 Ga0466967_0246227 3300045976 Bacteria 1706
313 Ga0495627_000742 3300046453 Bacteria 24523
314 Ga0495627_031968 3300046453 Bacteria 1659
315 Ga0495627_055921 3300046453 Bacteria 1177
316 Ga0495590_0000848 3300046457 Bacteria 13824
317 Ga0495638_0062310 3300046460 Bacteria 2303
318 Ga0495653_0037682 3300046463 Bacteria 3797
319 Ga0495650_0003319 3300046471 Bacteria 11858
320 Ga0495650_0049953 3300046471 Bacteria 1733
321 Ga0495580_0009570 3300046472 Bacteria 7613
322 Ga0495580_0261159 3300046472 Bacteria 1184
323 Ga0495582_0143422 3300046473 Bacteria 1354
324 Ga0495639_0002665 3300046475 Bacteria 7750
325 Ga0495610_0055876 3300046512 Bacteria 1901
326 Ga0495665_0005279 3300046531 Bacteria 6964
327 Ga0495586_0016303 3300046535 Bacteria 3951
328 Ga0495586_0040427 3300046535 Bacteria 2508
329 Ga0495587_0055060 3300046536 Bacteria 2343
330 Ga0495609_0043403 3300046538 Bacteria 2019
331 Ga0495645_0007535 3300046543 Bacteria 7571
332 Ga0495645_0011335 3300046543 Bacteria 6269
333 Ga0495667_0044550 3300046559 Bacteria 2938
334 Ga0495656_0042341 3300046615 Bacteria 1906
335 Ga0495668_0031038 3300046616 Bacteria 3012
336 Ga0495635_0186783 3300046663 Bacteria 1408
337 Ga0495588_0003154 3300046674 Bacteria 7138
338 Ga0495588_0007845 3300046674 Bacteria 4874
339 Ga0495588_0035567 3300046674 Bacteria 2524
340 Ga0495588_0076342 3300046674 Bacteria 1746
341 Ga0495613_0328529 3300046689 Bacteria 1054
342 Ga0495670_0080676 3300046691 Bacteria 1657
343 Ga0495600_0020743 3300046809 Bacteria 4203
344 Ga0495581_0010232 3300047315 Bacteria 5425
345 Ga0495581_0223356 3300047315 Bacteria 1101
346 Ga0495672_0109477 3300047320 Bacteria 1484
347 Ga0495677_0012700 3300047445 Bacteria 3070
348 Ga0495686_0079643 3300047472 Bacteria 2003
349 Ga0495593_0056575 3300047673 Bacteria 2061
350 Ga0495615_0034302 3300048090 Bacteria 1234
351 Ga0496100_0056030 3300048903 Bacteria 2577
352 Ga0496101_0041350 3300048904 Bacteria 3286
353 Ga0496101_0229495 3300048904 Bacteria 1442
354 Ga0496102_0036332 3300048905 Bacteria 4437
355 Ga0496102_0056538 3300048905 Bacteria 3579
356 Ga0496102_0072042 3300048905 Bacteria 3174
357 Ga0496102_0102125 3300048905 Bacteria 2665
358 Ga0496103_0028464 3300048906 Bacteria 3391
359 Ga0496103_0098687 3300048906 Bacteria 1847
360 Ga0496104_0009242 3300048907 Bacteria 8765
361 Ga0496105_0032715 3300048908 Bacteria 4269
362 Ga0496105_0037902 3300048908 Bacteria 3971
363 Ga0496105_0090706 3300048908 Bacteria 2524
364 Ga0496105_0122125 3300048908 Bacteria 2147
365 Ga0496106_0070007 3300048909 Bacteria 2679
366 Ga0496106_0150347 3300048909 Bacteria 1836
367 Ga0496107_0007307 3300048910 Bacteria 7614
368 Ga0496107_0017706 3300048910 Bacteria 5013
369 Ga0496108_0133989 3300048911 Bacteria 2130
370 Ga0496109_0031753 3300048912 Bacteria 4742
371 Ga0496109_0132466 3300048912 Bacteria 2327
372 Ga0496110_0179996 3300048913 Bacteria 1920
373 Ga0496110_0316467 3300048913 Bacteria 1422
374 Ga0496111_0008731 3300048914 Bacteria 6724
375 Ga0496111_0032912 3300048914 Bacteria 3696
376 Ga0496112_0013055 3300048915 Bacteria 7662
377 Ga0496112_0027521 3300048915 Bacteria 5482
378 Ga0496112_0216124 3300048915 Bacteria 1873
379 Ga0496112_0437913 3300048915 Bacteria 1245
380 Ga0496113_0017866 3300048916 Bacteria 4930
381 Ga0496113_0149114 3300048916 Bacteria 1844
382 Ga0496114_0007014 3300048917 Bacteria 8887
383 Ga0496114_0011754 3300048917 Bacteria 7003
384 Ga0496114_0035901 3300048917 Bacteria 4095
385 Ga0496114_0040298 3300048917 Bacteria 3867
386 Ga0496114_0040447 3300048917 Bacteria 3860
387 Ga0496114_0041980 3300048917 Bacteria 3790
388 Ga0496114_0179026 3300048917 Bacteria 1851
389 Ga0496114_0244733 3300048917 Bacteria 1578
390 Ga0496114_0275540 3300048917 Bacteria 1483
391 Ga0496114_0340252 3300048917 Bacteria 1326
392 Ga0496115_0044786 3300048918 Bacteria 3531
393 Ga0496115_0060424 3300048918 Bacteria 3054
394 Ga0496115_0067417 3300048918 Bacteria 2894
395 Ga0496115_0235528 3300048918 Bacteria 1509
396 Ga0496115_0393878 3300048918 Bacteria 1124
397 Ga0496116_0009609 3300048919 Bacteria 8229
398 Ga0496117_0000053 3300048920 Bacteria 279396
399 Ga0496117_0001359 3300048920 Bacteria 35660
400 Ga0496117_0002845 3300048920 Bacteria 21058
401 Ga0496117_0004371 3300048920 Bacteria 15671
402 Ga0496117_0027117 3300048920 Bacteria 4469
403 Ga0496117_0028088 3300048920 Bacteria 4361
404 Ga0496117_0082936 3300048920 Bacteria 2098
405 Ga0496118_0000601 3300048921 Bacteria 59471
406 Ga0496118_0015248 3300048921 Bacteria 7128
407 Ga0496118_0019871 3300048921 Bacteria 5986
408 Ga0496118_0186754 3300048921 Bacteria 1245
409 Ga0496119_0000750 3300048922 Bacteria 43609
410 Ga0496119_0001919 3300048922 Bacteria 23793
411 Ga0496119_0002232 3300048922 Bacteria 21580
412 Ga0496119_0008189 3300048922 Bacteria 9250
413 Ga0496119_0008633 3300048922 Bacteria 8918
414 Ga0496119_0046239 3300048922 Bacteria 2720
415 Ga0496119_0080111 3300048922 Bacteria 1884
416 Ga0496119_0129139 3300048922 Bacteria 1379
417 Ga0496119_0202968 3300048922 Bacteria 1025
418 Ga0496120_0000567 3300048923 Bacteria 56364
419 Ga0496120_0002279 3300048923 Bacteria 19926
420 Ga0496120_0005582 3300048923 Bacteria 9986
421 Ga0496121_0000076 3300048924 Bacteria 239775
422 Ga0496121_0019958 3300048924 Bacteria 6668
423 Ga0496121_0131214 3300048924 Bacteria 1875
424 Ga0496121_0136827 3300048924 Bacteria 1824
425 Ga0496121_0172911 3300048924 Bacteria 1567
426 Ga0496121_0417475 3300048924 Bacteria 874
427 Ga0496122_0000030 3300048925 Bacteria 331586
428 Ga0496122_0001351 3300048925 Bacteria 39991
429 Ga0496122_0007238 3300048925 Bacteria 12410
430 Ga0496122_0014337 3300048925 Bacteria 7671
431 Ga0496122_0014414 3300048925 Bacteria 7647
432 Ga0496122_0017802 3300048925 Bacteria 6608
433 Ga0496122_0026081 3300048925 Bacteria 5054
434 Ga0496122_0029012 3300048925 Bacteria 4678
435 Ga0496122_0060649 3300048925 Bacteria 2784
436 Ga0496122_0062031 3300048925 Bacteria 2739
437 Ga0496122_0106325 3300048925 Bacteria 1858
438 Ga0496122_0143875 3300048925 Bacteria 1486
439 Ga0496123_0000024 3300048926 Bacteria 331587
440 Ga0496123_0003288 3300048926 Bacteria 18310
441 Ga0496123_0004463 3300048926 Bacteria 14680
442 Ga0496123_0008629 3300048926 Bacteria 9322
443 Ga0496123_0023942 3300048926 Bacteria 4658
444 Ga0496123_0030146 3300048926 Bacteria 3976
445 Ga0496124_0002211 3300048927 Bacteria 25901
446 Ga0496124_0007376 3300048927 Bacteria 11698
447 Ga0496124_0008675 3300048927 Bacteria 10574
448 Ga0496124_0011174 3300048927 Bacteria 9003
449 Ga0496124_0029747 3300048927 Bacteria 4859
450 Ga0496124_0053605 3300048927 Bacteria 3417
451 Ga0496124_0071521 3300048927 Bacteria 2875
452 Ga0496124_0073160 3300048927 Bacteria 2836
453 Ga0496124_0114336 3300048927 Bacteria 2167
454 Ga0496124_0117814 3300048927 Bacteria 2127
455 Ga0496125_0000061 3300048928 Bacteria 262739
456 Ga0496125_0000094 3300048928 Bacteria 208341
457 Ga0496125_0001852 3300048928 Bacteria 29169
458 Ga0496125_0003349 3300048928 Bacteria 19512
459 Ga0496125_0004791 3300048928 Bacteria 15401
460 Ga0496125_0015344 3300048928 Bacteria 7416
461 Ga0496125_0021752 3300048928 Bacteria 5969
462 Ga0496125_0041712 3300048928 Bacteria 3920
463 Ga0496125_0080008 3300048928 Bacteria 2503
464 Ga0496126_0004531 3300048929 Bacteria 16531
465 Ga0496126_0019540 3300048929 Bacteria 6669
466 Ga0496126_0103876 3300048929 Bacteria 2482
467 Ga0496126_0121254 3300048929 Bacteria 2267
468 Ga0496126_0198272 3300048929 Bacteria 1696
469 Ga0496126_0224979 3300048929 Bacteria 1574
470 Ga0496126_0253788 3300048929 Bacteria 1464
471 Ga0501316_001994 3300049532 Bacteria 1834
472 Ga0501319_002331 3300049535 Bacteria 1194
473 Ga0501321_000365 3300049537 Bacteria 2796
474 Ga0501321_000422 3300049537 Bacteria 2700
475 Ga0501321_005457 3300049537 Bacteria 1258
476 Ga0501031_0008742 3300049568 Bacteria 6586
477 Ga0501031_0065489 3300049568 Bacteria 2367
478 Ga0501032_0000691 3300049569 Bacteria 27424
479 Ga0501032_0010009 3300049569 Bacteria 6847
480 Ga0501032_0014897 3300049569 Bacteria 5503
481 Ga0501032_0133486 3300049569 Bacteria 1637
482 Ga0501033_0006508 3300049570 Bacteria 9141
483 Ga0501033_0007517 3300049570 Bacteria 8479
484 Ga0501033_0019892 3300049570 Bacteria 5074
485 Ga0501033_0022845 3300049570 Bacteria 4715
486 Ga0501033_0035479 3300049570 Bacteria 3739
487 Ga0501034_0000123 3300049571 Bacteria 143688
488 Ga0501034_0006950 3300049571 Bacteria 12095
489 Ga0501034_0018764 3300049571 Bacteria 7088
490 Ga0501034_0025898 3300049571 Bacteria 5974
491 Ga0501034_0035910 3300049571 Bacteria 5025
492 Ga0501034_0039896 3300049571 Bacteria 4755
493 Ga0501034_0055291 3300049571 Bacteria 3994
494 Ga0501034_0061453 3300049571 Bacteria 3772
495 Ga0501034_0120554 3300049571 Bacteria 2609
496 Ga0501034_0127990 3300049571 Bacteria 2524
497 Ga0501034_0142327 3300049571 Bacteria 2377
498 Ga0501034_0201301 3300049571 Bacteria 1949
499 Ga0501034_0469853 3300049571 Bacteria 1174
500 Ga0501036_0024497 3300049572 Bacteria 5088
501 Ga0501036_0134412 3300049572 Bacteria 2087
502 Ga0501036_0297792 3300049572 Bacteria 1349
503 Ga0501037_0009537 3300049573 Bacteria 7124
504 Ga0501037_0037164 3300049573 Bacteria 3589
505 Ga0501037_0144161 3300049573 Bacteria 1704
506 Ga0501038_0005618 3300049574 Bacteria 11639
507 Ga0501038_0029074 3300049574 Bacteria 4902
508 Ga0501038_0046457 3300049574 Bacteria 3765
509 Ga0501038_0095873 3300049574 Bacteria 2477
510 Ga0501038_0147757 3300049574 Bacteria 1918
511 Ga0501038_0160592 3300049574 Bacteria 1826
512 Ga0501039_0009494 3300049575 Bacteria 7417
513 Ga0501039_0095725 3300049575 Bacteria 2315
514 Ga0501039_0155369 3300049575 Bacteria 1797
515 Ga0501042_0003755 3300049578 Bacteria 9595
516 Ga0501042_0028951 3300049578 Bacteria 3906
517 Ga0501043_0001520 3300049579 Bacteria 20261
518 Ga0501043_0022104 3300049579 Bacteria 4991
519 Ga0501043_0062026 3300049579 Bacteria 2935
520 Ga0501043_0119777 3300049579 Bacteria 2064
521 Ga0501043_0158289 3300049579 Bacteria 1770
522 Ga0501043_0276008 3300049579 Bacteria 1289
523 Ga0501043_0282871 3300049579 Bacteria 1271
524 Ga0501046_0030096 3300049580 Bacteria 4409
525 Ga0501047_0003895 3300049581 Bacteria 14029
526 Ga0501047_0014376 3300049581 Bacteria 7526
527 Ga0501047_0047156 3300049581 Bacteria 4163
528 Ga0501047_0081513 3300049581 Bacteria 3110
529 Ga0501048_0001989 3300049582 Bacteria 15539
530 Ga0501067_0071637 3300049583 Bacteria 1920
531 Ga0501068_0075052 3300049584 Bacteria 2068
532 Ga0501070_0000088 3300049586 Bacteria 77423
533 Ga0501070_0002274 3300049586 Bacteria 16887
534 Ga0501070_0015424 3300049586 Bacteria 6428
535 Ga0501070_0022690 3300049586 Bacteria 5255
536 Ga0501070_0081047 3300049586 Bacteria 2685
537 Ga0501073_0000075 3300049589 Bacteria 61808
538 Ga0501073_0026258 3300049589 Bacteria 4172
539 Ga0501074_0033589 3300049590 Bacteria 3718
540 Ga0501080_0000271 3300049742 Bacteria 39284
541 Ga0501080_0081761 3300049742 Bacteria 3000
542 Ga0501083_0000003 3300049744 Bacteria 235949
543 Ga0501083_0019410 3300049744 Bacteria 4737
544 Ga0501035_0010037 3300049822 Bacteria 8787
545 Ga0501035_0061517 3300049822 Bacteria 3341
546 Ga0501035_0098416 3300049822 Bacteria 2568
547 Ga0501035_0317007 3300049822 Bacteria 1311
548 Ga0501044_0017210 3300049823 Bacteria 7754
549 Ga0501044_0050928 3300049823 Bacteria 4271
550 Ga0501044_0086590 3300049823 Bacteria 3164
551 Ga0501044_0410812 3300049823 Bacteria 1265
552 Ga0501045_0042263 3300049824 Bacteria 3318
553 nmdc:mga00v17_47213_c1 3300050491 Bacteria 2607
554 nmdc:mga00v17_8234_c1 3300050491 Bacteria 5607
555 nmdc:mga0yw44_2472_c1 3300050492 Bacteria 7894
556 nmdc:mga0yw44_55263_c1 3300050492 Bacteria 2415
557 nmdc:mga06z11_26546_c1 3300050494 Bacteria 2757
558 nmdc:mga0sz30_55015_c1 3300050516 Bacteria 1693
559 Ga0500635_0000013 3300053080 Bacteria 133088
560 Ga0500635_0005457 3300053080 Bacteria 3337
561 Ga0500643_000275 3300053087 Bacteria 44588
562 Ga0500651_0000791 3300053093 Bacteria 15456
563 Ga0500556_0000001 3300053104 Bacteria 1135060
564 Ga0500556_0000129 3300053104 Bacteria 64921
565 Ga0500562_001760 3300053108 Bacteria 5409
566 Ga0500593_001717 3300053117 Bacteria 7914
567 Ga0500655_002346 3300053133 Bacteria 3470
568 Ga0500559_0000115 3300053136 Bacteria 63289
569 Ga0500559_0000765 3300053136 Bacteria 21074
570 Ga0500559_0002603 3300053136 Bacteria 9213
571 Ga0500559_0015737 3300053136 Bacteria 3194
572 Ga0500559_0027667 3300053136 Bacteria 2420
573 Ga0500568_0000006 3300053139 Bacteria 522235
574 Ga0500568_0000026 3300053139 Bacteria 165582
575 Ga0500568_0000172 3300053139 Bacteria 56463
576 Ga0500568_0007803 3300053139 Bacteria 5212
577 Ga0500568_0042363 3300053139 Bacteria 1824
578 Ga0500573_0000013 3300053140 Bacteria 196637
579 Ga0500573_0004755 3300053140 Bacteria 7187
580 Ga0500573_0024648 3300053140 Bacteria 3458
581 Ga0500573_0042418 3300053140 Bacteria 2627
582 Ga0500573_0061830 3300053140 Bacteria 2145
583 Ga0500573_0082125 3300053140 Bacteria 1830
584 Ga0500573_0101561 3300053140 Bacteria 1617
585 Ga0500573_0109466 3300053140 Bacteria 1547
586 Ga0500573_0195401 3300053140 Bacteria 1078
587 Ga0500588_0000654 3300053146 Bacteria 5779
588 Ga0500590_000536 3300053148 Bacteria 13239
589 Ga0500616_0000734 3300053153 Bacteria 37933
590 Ga0500616_0001005 3300053153 Bacteria 30333
591 Ga0500616_0046676 3300053153 Bacteria 2302
592 Ga0500620_000246 3300053155 Bacteria 10519
593 Ga0587090_000501 3300059510 Bacteria 3315
594 Ga0501082_0007327 3300060353 Bacteria 9522
595 Ga0501082_0146675 3300060353 Bacteria 2049
596 Ga0501082_0159704 3300060353 Bacteria 1959
597 Ga0466962_0028064 3300061719 Bacteria 2698

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0437913 Ga0496112_0437913_10_891 274
2 3300048924 Ga0496121_0417475 Ga0496121_0417475_18_842 274
3 3300049579 Ga0501043_0158289 Ga0501043_0158289_28_909 274
4 3300049535 Ga0501319_002331 Ga0501319_002331_260_1168 283
5 3300037312 Ga0395899_0037840 Ga0395899_0037840_17_919 300
6 3300025728 Ga0207655_1003821 Ga0207655_10038214 303
7 3300053139 Ga0500568_0007803 Ga0500568_0007803_2420_3418 304
8 3300044693 Ga0466961_0186277 Ga0466961_0186277_130_1134 305
9 3300044842 Ga0466957_0125000 Ga0466957_0125000_526_1530 305
10 3300046559 Ga0495667_0044550 Ga0495667_0044550_21_1031 317
11 3300049537 Ga0501321_000422 Ga0501321_000422_1640_2650 317
12 3300049571 Ga0501034_0469853 Ga0501034_0469853_107_1099 317
13 3300044683 Ga0466965_0093064 Ga0466965_0093064_49_1053 319
14 3300044901 Ga0466960_0006151 Ga0466960_0006151_867_1871 320
15 3300053140 Ga0500573_0024648 Ga0500573_0024648_2209_3213 322
16 3300048919 Ga0496116_0009609 Ga0496116_0009609_6470_7474 323
17 3300048920 Ga0496117_0028088 Ga0496117_0028088_2862_3866 323
18 3300048921 Ga0496118_0015248 Ga0496118_0015248_326_1330 323
19 3300048922 Ga0496119_0008633 Ga0496119_0008633_372_1376 323
20 3300048923 Ga0496120_0002279 Ga0496120_0002279_5845_6849 323
21 3300048924 Ga0496121_0172911 Ga0496121_0172911_57_1028 323
22 3300048925 Ga0496122_0000030 Ga0496122_0000030_16230_17234 323
23 3300048926 Ga0496123_0000024 Ga0496123_0000024_16230_17234 323
24 3300048926 Ga0496123_0030146 Ga0496123_0030146_2085_3056 323
25 3300048927 Ga0496124_0011174 Ga0496124_0011174_5092_6096 323
26 3300048928 Ga0496125_0015344 Ga0496125_0015344_5088_6092 323
27 3300048929 Ga0496126_0019540 Ga0496126_0019540_4484_5488 323
28 3300047315 Ga0495581_0223356 Ga0495581_0223356_25_1056 324
29 3300038443 Ga0395901_0051893 Ga0395901_0051893_3209_4210 325
30 iso_pu_bacteria 2848551377 2848552554 325
31 3300025904 Ga0207647_10015346 Ga0207647_100153464 326
32 3300006038 Ga0075365_10007107 Ga0075365_100071072 327
33 3300006051 Ga0075364_10021485 Ga0075364_100214852 327
34 3300050491 nmdc:mga00v17_8234_c1 nmdc:mga00v17_8234_c1_1141_2142 327
35 iso_pu_bacteria 2738541272 2738695304 327
36 iso_pu_bacteria 2738543027 2739327854 327
37 iso_pu_bacteria 2739367654 2739606266 327
38 iso_pu_bacteria 2758568522 2760306912 327
39 iso_pu_bacteria 2758568621 2760624574 327
40 iso_pu_bacteria 2808606394 2809029476 327
41 iso_pu_bacteria 2857710386 2857712781 327
42 iso_pu_bacteria 8056579771 8056583593 327
43 3300049571 Ga0501034_0018764 Ga0501034_0018764_151_1143 328
44 3300060353 Ga0501082_0007327 Ga0501082_0007327_8125_9117 328
45 iso_pu_bacteria 2811994880 2812364865 328
46 iso_pu_bacteria 2835188231 2835188708 328
47 iso_pu_bacteria 2839986021 2839986521 328
48 iso_pu_bacteria 2857733635 2857735823 328
49 iso_pu_bacteria 2857737099 2857738049 328
50 iso_pu_bacteria 2919395869 2919396569 328
51 3300003285 Ga0007423J48922_100085 Ga0007423J48922_1000853 329
52 3300031665 Ga0316575_10000173 Ga0316575_1000017312 329
53 3300031995 Ga0307409_100059527 Ga0307409_1000595272 329
54 3300032002 Ga0307416_100040980 Ga0307416_1000409802 329
55 3300032004 Ga0307414_10195425 Ga0307414_101954251 329
56 3300032126 Ga0307415_100052984 Ga0307415_1000529843 329
57 3300045976 Ga0466967_0246227 Ga0466967_0246227_319_1371 329
58 iso_pu_bacteria 2643221542 2643733561 329
59 iso_pu_bacteria 2643221546 2643752284 329
60 iso_pu_bacteria 2643221553 2643785944 329
61 iso_pu_bacteria 2643221566 2643848288 329
62 iso_pu_bacteria 2643221597 2643995726 329
63 iso_pu_bacteria 2643221613 2644083050 329
64 iso_pu_bacteria 2643221630 2644170136 329
65 iso_pu_bacteria 2643221632 2644183328 329
66 iso_pu_bacteria 2643221721 2644666065 329
67 iso_pu_bacteria 2643221724 2644680357 329
68 iso_pu_bacteria 2728369380 2730229810 329
69 iso_pu_bacteria 2747842429 2747952029 329
70 iso_pu_bacteria 2773857759 2774384524 329
71 iso_pu_bacteria 2773857763 2774399532 329
72 iso_pu_bacteria 2808606306 2808631182 329
73 iso_pu_bacteria 2808606368 2808885652 329
74 iso_pu_bacteria 2808606447 2809227444 329
75 iso_pu_bacteria 2811994872 2812323119 329
76 iso_pu_bacteria 2833709550 2833710962 329
77 iso_pu_bacteria 2844852863 2844855624 329
78 iso_pu_bacteria 2852632344 2852634202 329
79 iso_pu_bacteria 2852646457 2852647381 329
80 iso_pu_bacteria 2852663356 2852665363 329
81 iso_pu_bacteria 2857720070 2857721614 329
82 iso_pu_bacteria 2857723135 2857723987 329
83 iso_pu_bacteria 2870628048 2870630359 329
84 iso_pu_bacteria 2906799679 2906800721 329
85 iso_pu_bacteria 2928090899 2928092261 329
86 iso_pu_bacteria 2935890801 2935891797 329
87 iso_pu_bacteria 2945968032 2945971863 329
88 iso_pu_bacteria 2946003308 2946004989 329
89 iso_pu_bacteria 2946024296 2946026150 329
90 iso_pu_bacteria 2946033335 2946033697 329
91 iso_pu_bacteria 2946041624 2946044321 329
92 iso_pu_bacteria 2946080515 2946080832 329
93 iso_pu_bacteria 2964326757 2964329518 329
94 iso_pu_bacteria 2977251589 2977253888 329
95 iso_pu_bacteria 2984580707 2984580963 329
96 iso_pu_bacteria 8004182704 8004185066 329
97 iso_pu_bacteria 8004212874 8004214331 329
98 iso_pu_bacteria 8045830549 8045831596 329
99 iso_pu_bacteria 8056037122 8056039491 329
100 iso_pu_bacteria 8057345674 8057348855 329
101 3300006038 Ga0075365_10075558 Ga0075365_100755583 330
102 3300006051 Ga0075364_10015746 Ga0075364_100157464 330
103 3300014326 Ga0157380_10222234 Ga0157380_102222342 330
104 3300030732 Ga0316176_1094005 Ga0316176_10940053 330
105 3300030734 Ga0316179_1000242 Ga0316179_10002422 330
106 3300030744 Ga0316181_1152364 Ga0316181_11523641 330
107 3300032002 Ga0307416_100064474 Ga0307416_1000644743 330
108 3300032126 Ga0307415_100354409 Ga0307415_1003544092 330
109 3300046453 Ga0495627_031968 Ga0495627_031968_34_1035 330
110 3300046453 Ga0495627_055921 Ga0495627_055921_123_1124 330
111 3300046512 Ga0495610_0055876 Ga0495610_0055876_867_1868 330
112 3300048090 Ga0495615_0034302 Ga0495615_0034302_210_1202 330
113 3300048922 Ga0496119_0046239 Ga0496119_0046239_508_1512 330
114 3300048922 Ga0496119_0202968 Ga0496119_0202968_20_1012 330
115 3300048925 Ga0496122_0001351 Ga0496122_0001351_14513_15517 330
116 3300048925 Ga0496122_0029012 Ga0496122_0029012_401_1405 330
117 3300048926 Ga0496123_0023942 Ga0496123_0023942_3278_4282 330
118 3300048927 Ga0496124_0008675 Ga0496124_0008675_9053_10057 330
119 3300048928 Ga0496125_0000094 Ga0496125_0000094_59136_60140 330
120 3300048928 Ga0496125_0001852 Ga0496125_0001852_9569_10573 330
121 3300049589 Ga0501073_0000075 Ga0501073_0000075_16946_17941 330
122 3300050492 nmdc:mga0yw44_55263_c1 nmdc:mga0yw44_55263_c1_1011_2009 330
123 3300053104 Ga0500556_0000129 Ga0500556_0000129_38860_39858 330
124 3300053117 Ga0500593_001717 Ga0500593_001717_2379_3377 330
125 3300053133 Ga0500655_002346 Ga0500655_002346_2305_3303 330
126 3300053136 Ga0500559_0000765 Ga0500559_0000765_15918_16916 330
127 3300053139 Ga0500568_0042363 Ga0500568_0042363_421_1422 330
128 3300053153 Ga0500616_0046676 Ga0500616_0046676_623_1621 330
129 iso_pu_bacteria 2585428094 2587862631 330
130 iso_pu_bacteria 2643221549 2643767545 330
131 iso_pu_bacteria 2643221572 2643875391 330
132 iso_pu_bacteria 2643221575 2643885429 330
133 iso_pu_bacteria 2643221616 2644095994 330
134 iso_pu_bacteria 2643221619 2644110819 330
135 iso_pu_bacteria 2643221635 2644199150 330
136 iso_pu_bacteria 2643221649 2644279512 330
137 iso_pu_bacteria 2643221669 2644382446 330
138 iso_pu_bacteria 2690315906 2691514339 330
139 iso_pu_bacteria 2721755702 2723642186 330
140 iso_pu_bacteria 2751185788 2753301752 330
141 iso_pu_bacteria 2757320536 2758226122 330
142 iso_pu_bacteria 2773857758 2774380392 330
143 iso_pu_bacteria 2775506735 2775655333 330
144 iso_pu_bacteria 2808606357 2808827423 330
145 iso_pu_bacteria 2808606360 2808852788 330
146 iso_pu_bacteria 2808606366 2808878957 330
147 iso_pu_bacteria 2808606370 2808891657 330
148 iso_pu_bacteria 2808606371 2808896788 330
149 iso_pu_bacteria 2808606372 2808902264 330
150 iso_pu_bacteria 2811994871 2812320792 330
151 iso_pu_bacteria 2844841374 2844842401 330
152 iso_pu_bacteria 2844849076 2844849251 330
153 iso_pu_bacteria 2852643534 2852645636 330
154 iso_pu_bacteria 2857729791 2857729976 330
155 iso_pu_bacteria 2857740372 2857741602 330
156 iso_pu_bacteria 2862993130 2862996038 330
157 iso_pu_bacteria 2870622029 2870623711 330
158 iso_pu_bacteria 2884763398 2884765354 330
159 iso_pu_bacteria 2895660088 2895661483 330
160 iso_pu_bacteria 2897561785 2897563229 330
161 iso_pu_bacteria 2904497146 2904500133 330
162 iso_pu_bacteria 2904509784 2904512011 330
163 iso_pu_bacteria 2904776348 2904776351 330
164 iso_pu_bacteria 2905926851 2905927288 330
165 iso_pu_bacteria 2908678064 2908680928 330
166 iso_pu_bacteria 2910809715 2910811096 330
167 iso_pu_bacteria 2919034639 2919037482 330
168 iso_pu_bacteria 2919051321 2919054636 330
169 iso_pu_bacteria 2919055335 2919058050 330
170 iso_pu_bacteria 2919059106 2919063345 330
171 iso_pu_bacteria 2919069694 2919072602 330
172 iso_pu_bacteria 2919391150 2919391153 330
173 iso_pu_bacteria 2919443155 2919446054 330
174 iso_pu_bacteria 2919523602 2919524443 330
175 iso_pu_bacteria 2919538618 2919541869 330
176 iso_pu_bacteria 2928104781 2928106530 330
177 iso_pu_bacteria 2928121344 2928123198 330
178 iso_pu_bacteria 2928153084 2928155935 330
179 iso_pu_bacteria 2932426870 2932428970 330
180 iso_pu_bacteria 2933418574 2933421284 330
181 iso_pu_bacteria 2935409751 2935411555 330
182 iso_pu_bacteria 2939598168 2939598396 330
183 iso_pu_bacteria 2939647034 2939649155 330
184 iso_pu_bacteria 2939657138 2939658147 330
185 iso_pu_bacteria 2939660829 2939661216 330
186 iso_pu_bacteria 2939674588 2939676335 330
187 iso_pu_bacteria 2945916053 2945918553 330
188 iso_pu_bacteria 2945920336 2945921167 330
189 iso_pu_bacteria 2945941187 2945942702 330
190 iso_pu_bacteria 2945956166 2945959568 330
191 iso_pu_bacteria 2946037020 2946038590 330
192 iso_pu_bacteria 2946059875 2946062415 330
193 iso_pu_bacteria 2953998280 2953999865 330
194 iso_pu_bacteria 2966921586 2966922303 330
195 iso_pu_bacteria 2966924647 2966924992 330
196 iso_pu_bacteria 2974294766 2974297181 330
197 iso_pu_bacteria 2974302888 2974306582 330
198 iso_pu_bacteria 2974324384 2974326586 330
199 iso_pu_bacteria 2977236895 2977240177 330
200 iso_pu_bacteria 2977264416 2977266623 330
201 iso_pu_bacteria 8004021418 8004023248 330
202 iso_pu_bacteria 8004025490 8004029291 330
203 iso_pu_bacteria 8016254467 8016257553 330
204 iso_pu_bacteria 8046352972 8046356265 330
205 iso_pu_bacteria 8054107350 8054107934 330
206 3300003762 Ga0055542_1002506 Ga0055542_10025065 331
207 3300005327 Ga0070658_10022612 Ga0070658_100226124 331
208 3300005327 Ga0070658_10039005 Ga0070658_100390053 331
209 3300005327 Ga0070658_10074571 Ga0070658_100745712 331
210 3300005335 Ga0070666_10118330 Ga0070666_101183303 331
211 3300005338 Ga0068868_100070367 Ga0068868_1000703672 331
212 3300005355 Ga0070671_100157352 Ga0070671_1001573522 331
213 3300005366 Ga0070659_100001568 Ga0070659_1000015684 331
214 3300005367 Ga0070667_100018034 Ga0070667_1000180343 331
215 3300005466 Ga0070685_10015029 Ga0070685_100150292 331
216 3300005539 Ga0068853_100100228 Ga0068853_1001002282 331
217 3300005563 Ga0068855_100025111 Ga0068855_1000251115 331
218 3300005563 Ga0068855_100610323 Ga0068855_1006103231 331
219 3300005578 Ga0068854_100040007 Ga0068854_1000400072 331
220 3300005616 Ga0068852_100002346 Ga0068852_1000023469 331
221 3300005834 Ga0068851_10000003 Ga0068851_10000003117 331
222 3300005842 Ga0068858_100000114 Ga0068858_1000001146 331
223 3300009093 Ga0105240_10001674 Ga0105240_1000167434 331
224 3300009098 Ga0105245_10020927 Ga0105245_100209274 331
225 3300009177 Ga0105248_10059248 Ga0105248_100592482 331
226 3300009545 Ga0105237_10334434 Ga0105237_103344341 331
227 3300009551 Ga0105238_10003197 Ga0105238_100031974 331
228 3300010375 Ga0105239_10462870 Ga0105239_104628702 331
229 3300013296 Ga0157374_10574006 Ga0157374_105740062 331
230 3300014968 Ga0157379_10003445 Ga0157379_100034454 331
231 3300025254 Ga0209148_1003448 Ga0209148_10034484 331
232 3300025321 Ga0207656_10000002 Ga0207656_10000002120 331
233 3300025898 Ga0207692_10054020 Ga0207692_100540202 331
234 3300025903 Ga0207680_10100177 Ga0207680_101001773 331
235 3300025909 Ga0207705_10124801 Ga0207705_101248012 331
236 3300025911 Ga0207654_10000001 Ga0207654_100000011735 331
237 3300025913 Ga0207695_10002367 Ga0207695_100023676 331
238 3300025913 Ga0207695_10038666 Ga0207695_100386663 331
239 3300025914 Ga0207671_10000002 Ga0207671_10000002414 331
240 3300025919 Ga0207657_10008307 Ga0207657_100083079 331
241 3300025924 Ga0207694_10000092 Ga0207694_1000009218 331
242 3300025927 Ga0207687_10009754 Ga0207687_100097544 331
243 3300025931 Ga0207644_10236090 Ga0207644_102360902 331
244 3300025932 Ga0207690_10000972 Ga0207690_1000097214 331
245 3300025941 Ga0207711_10000354 Ga0207711_1000035416 331
246 3300025949 Ga0207667_10005363 Ga0207667_1000536311 331
247 3300025949 Ga0207667_10006093 Ga0207667_100060932 331
248 3300025949 Ga0207667_10007363 Ga0207667_100073639 331
249 3300025949 Ga0207667_10098097 Ga0207667_100980972 331
250 3300025981 Ga0207640_10361171 Ga0207640_103611712 331
251 3300025986 Ga0207658_10004577 Ga0207658_100045779 331
252 3300026035 Ga0207703_10000315 Ga0207703_1000031517 331
253 3300026041 Ga0207639_10074184 Ga0207639_100741843 331
254 3300026078 Ga0207702_10012308 Ga0207702_100123084 331
255 3300026142 Ga0207698_10000255 Ga0207698_1000025510 331
256 3300026142 Ga0207698_10003348 Ga0207698_100033482 331
257 3300028794 Ga0307515_10185737 Ga0307515_101857371 331
258 3300031456 Ga0307513_10218588 Ga0307513_102185883 331
259 3300031649 Ga0307514_10053074 Ga0307514_100530743 331
260 3300031852 Ga0307410_10071860 Ga0307410_100718603 331
261 3300031995 Ga0307409_100016562 Ga0307409_1000165624 331
262 3300041452 Ga0451793_0754086 Ga0451793_0754086_258_1256 331
263 3300044683 Ga0466965_0000007 Ga0466965_0000007_105302_106303 331
264 3300044683 Ga0466965_0003157 Ga0466965_0003157_2588_3586 331
265 3300044683 Ga0466965_0009366 Ga0466965_0009366_2057_3061 331
266 3300044735 Ga0466968_0020748 Ga0466968_0020748_1456_2493 331
267 3300044765 Ga0466970_0001712 Ga0466970_0001712_8845_9900 331
268 3300044765 Ga0466970_0040060 Ga0466970_0040060_110_1108 331
269 3300044842 Ga0466957_0112793 Ga0466957_0112793_298_1296 331
270 3300044901 Ga0466960_0024507 Ga0466960_0024507_579_1577 331
271 3300045049 Ga0466959_0092344 Ga0466959_0092344_1064_2068 331
272 3300045049 Ga0466959_0291011 Ga0466959_0291011_34_1038 331
273 3300046457 Ga0495590_0000848 Ga0495590_0000848_524_1552 331
274 3300046471 Ga0495650_0003319 Ga0495650_0003319_5754_6752 331
275 3300046471 Ga0495650_0049953 Ga0495650_0049953_477_1514 331
276 3300046538 Ga0495609_0043403 Ga0495609_0043403_1001_2005 331
277 3300047320 Ga0495672_0109477 Ga0495672_0109477_263_1264 331
278 3300047472 Ga0495686_0079643 Ga0495686_0079643_46_1044 331
279 3300048917 Ga0496114_0275540 Ga0496114_0275540_138_1145 331
280 3300048920 Ga0496117_0001359 Ga0496117_0001359_32826_33830 331
281 3300048920 Ga0496117_0004371 Ga0496117_0004371_4254_5258 331
282 3300048920 Ga0496117_0082936 Ga0496117_0082936_84_1082 331
283 3300048921 Ga0496118_0000601 Ga0496118_0000601_32246_33250 331
284 3300048922 Ga0496119_0000750 Ga0496119_0000750_41325_42326 331
285 3300048922 Ga0496119_0080111 Ga0496119_0080111_396_1451 331
286 3300048923 Ga0496120_0005582 Ga0496120_0005582_4555_5553 331
287 3300048924 Ga0496121_0131214 Ga0496121_0131214_607_1605 331
288 3300048925 Ga0496122_0007238 Ga0496122_0007238_887_1891 331
289 3300048925 Ga0496122_0014337 Ga0496122_0014337_810_1808 331
290 3300048925 Ga0496122_0060649 Ga0496122_0060649_765_1820 331
291 3300048926 Ga0496123_0003288 Ga0496123_0003288_15647_16645 331
292 3300048926 Ga0496123_0008629 Ga0496123_0008629_5964_6968 331
293 3300048927 Ga0496124_0002211 Ga0496124_0002211_20073_21077 331
294 3300048927 Ga0496124_0029747 Ga0496124_0029747_1573_2628 331
295 3300048927 Ga0496124_0073160 Ga0496124_0073160_1093_2097 331
296 3300048927 Ga0496124_0114336 Ga0496124_0114336_259_1263 331
297 3300048929 Ga0496126_0198272 Ga0496126_0198272_28_1035 331
298 3300049532 Ga0501316_001994 Ga0501316_001994_118_1134 331
299 3300049568 Ga0501031_0065489 Ga0501031_0065489_229_1230 331
300 3300049569 Ga0501032_0010009 Ga0501032_0010009_4805_5806 331
301 3300049569 Ga0501032_0014897 Ga0501032_0014897_1199_2200 331
302 3300049569 Ga0501032_0133486 Ga0501032_0133486_32_1030 331
303 3300049570 Ga0501033_0019892 Ga0501033_0019892_3492_4493 331
304 3300049570 Ga0501033_0022845 Ga0501033_0022845_734_1732 331
305 3300049570 Ga0501033_0035479 Ga0501033_0035479_988_1986 331
306 3300049571 Ga0501034_0055291 Ga0501034_0055291_95_1093 331
307 3300049571 Ga0501034_0061453 Ga0501034_0061453_465_1466 331
308 3300049571 Ga0501034_0120554 Ga0501034_0120554_1069_2067 331
309 3300049571 Ga0501034_0127990 Ga0501034_0127990_893_1894 331
310 3300049571 Ga0501034_0142327 Ga0501034_0142327_322_1320 331
311 3300049571 Ga0501034_0201301 Ga0501034_0201301_923_1921 331
312 3300049572 Ga0501036_0134412 Ga0501036_0134412_741_1742 331
313 3300049572 Ga0501036_0297792 Ga0501036_0297792_46_1044 331
314 3300049574 Ga0501038_0046457 Ga0501038_0046457_1947_2948 331
315 3300049574 Ga0501038_0147757 Ga0501038_0147757_800_1801 331
316 3300049575 Ga0501039_0095725 Ga0501039_0095725_599_1600 331
317 3300049578 Ga0501042_0003755 Ga0501042_0003755_1600_2598 331
318 3300049579 Ga0501043_0001520 Ga0501043_0001520_7458_8456 331
319 3300049579 Ga0501043_0119777 Ga0501043_0119777_349_1347 331
320 3300049581 Ga0501047_0014376 Ga0501047_0014376_2773_3771 331
321 3300049581 Ga0501047_0047156 Ga0501047_0047156_1421_2419 331
322 3300049584 Ga0501068_0075052 Ga0501068_0075052_956_1957 331
323 3300049586 Ga0501070_0002274 Ga0501070_0002274_14649_15647 331
324 3300049586 Ga0501070_0081047 Ga0501070_0081047_698_1699 331
325 3300049742 Ga0501080_0000271 Ga0501080_0000271_19821_20819 331
326 3300049744 Ga0501083_0000003 Ga0501083_0000003_24026_25024 331
327 3300049744 Ga0501083_0019410 Ga0501083_0019410_1960_2958 331
328 3300049822 Ga0501035_0098416 Ga0501035_0098416_39_1037 331
329 3300049822 Ga0501035_0317007 Ga0501035_0317007_254_1252 331
330 3300049823 Ga0501044_0410812 Ga0501044_0410812_100_1098 331
331 3300053080 Ga0500635_0005457 Ga0500635_0005457_515_1513 331
332 3300053093 Ga0500651_0000791 Ga0500651_0000791_1280_2278 331
333 3300053108 Ga0500562_001760 Ga0500562_001760_3435_4433 331
334 3300053136 Ga0500559_0000115 Ga0500559_0000115_33388_34386 331
335 3300053139 Ga0500568_0000026 Ga0500568_0000026_128085_129083 331
336 3300053139 Ga0500568_0000172 Ga0500568_0000172_6359_7360 331
337 3300053140 Ga0500573_0000013 Ga0500573_0000013_66046_67044 331
338 3300053146 Ga0500588_0000654 Ga0500588_0000654_1125_2123 331
339 3300053148 Ga0500590_000536 Ga0500590_000536_2323_3321 331
340 3300053153 Ga0500616_0000734 Ga0500616_0000734_19741_20745 331
341 3300053153 Ga0500616_0001005 Ga0500616_0001005_11568_12572 331
342 3300053155 Ga0500620_000246 Ga0500620_000246_1674_2672 331
343 3300060353 Ga0501082_0159704 Ga0501082_0159704_108_1109 331
344 iso_pu_bacteria 2904430863 2904433099 331
345 iso_pu_bacteria 2904501621 2904502780 331
346 iso_pu_bacteria 2908674828 2908677537 331
347 iso_pu_bacteria 2909074476 2909075105 331
348 iso_pu_bacteria 2919039151 2919040518 331
349 iso_pu_bacteria 2919042368 2919043695 331
350 iso_pu_bacteria 2928500415 2928501653 331
351 iso_pu_bacteria 2984551494 2984553915 331
352 3300001979 JGI24740J21852_10019274 JGI24740J21852_100192741 332
353 3300002772 JGI25164J39214_1001094 JGI25164J39214_10010942 332
354 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002646 332
355 3300003568 Ga0006781J51513_1016252 Ga0006781J51513_10162522 332
356 3300003578 Ga0006562J51391_1010318 Ga0006562J51391_10103184 332
357 3300003578 Ga0006562J51391_1010319 Ga0006562J51391_10103192 332
358 3300003578 Ga0006562J51391_1043582 Ga0006562J51391_10435824 332
359 3300003752 Ga0055539_1000008 Ga0055539_1000008336 332
360 3300003756 Ga0055533_1000001 Ga0055533_1000001735 332
361 3300003759 Ga0055525_1001682 Ga0055525_10016822 332
362 3300003760 Ga0055527_1000001 Ga0055527_1000001149 332
363 3300003763 Ga0055529_1000065 Ga0055529_1000065150 332
364 3300003841 Ga0055541_1001922 Ga0055541_10019223 332
365 3300005339 Ga0070660_100052441 Ga0070660_1000524412 332
366 3300005353 Ga0070669_100107544 Ga0070669_1001075442 332
367 3300005366 Ga0070659_100029781 Ga0070659_1000297814 332
368 3300005455 Ga0070663_100346367 Ga0070663_1003463671 332
369 3300005563 Ga0068855_100141129 Ga0068855_1001411293 332
370 3300005577 Ga0068857_100179652 Ga0068857_1001796522 332
371 3300006038 Ga0075365_10007174 Ga0075365_100071746 332
372 3300006051 Ga0075364_10038271 Ga0075364_100382712 332
373 3300006058 Ga0075432_10002026 Ga0075432_100020264 332
374 3300006178 Ga0075367_10049284 Ga0075367_100492842 332
375 3300006186 Ga0075369_10013652 Ga0075369_100136524 332
376 3300009036 Ga0105244_10004742 Ga0105244_100047424 332
377 3300009036 Ga0105244_10019348 Ga0105244_100193484 332
378 3300009094 Ga0111539_10696939 Ga0111539_106969391 332
379 3300009148 Ga0105243_10028060 Ga0105243_100280604 332
380 3300009148 Ga0105243_10088709 Ga0105243_100887091 332
381 3300009148 Ga0105243_10155422 Ga0105243_101554223 332
382 3300009553 Ga0105249_10302755 Ga0105249_103027552 332
383 3300011119 Ga0105246_10000351 Ga0105246_1000035124 332
384 3300011119 Ga0105246_10002288 Ga0105246_1000228813 332
385 3300011119 Ga0105246_10171443 Ga0105246_101714431 332
386 3300011119 Ga0105246_10299568 Ga0105246_102995681 332
387 3300013100 Ga0157373_10006949 Ga0157373_100069494 332
388 3300013104 Ga0157370_10005607 Ga0157370_100056074 332
389 3300013104 Ga0157370_10008506 Ga0157370_100085063 332
390 3300013104 Ga0157370_10231816 Ga0157370_102318162 332
391 3300013105 Ga0157369_10001845 Ga0157369_1000184511 332
392 3300013105 Ga0157369_10087698 Ga0157369_100876983 332
393 3300013250 Ga0171462_1003 Ga0171462_1003395 332
394 3300013306 Ga0163162_10145288 Ga0163162_101452883 332
395 3300013306 Ga0163162_10212625 Ga0163162_102126253 332
396 3300013306 Ga0163162_10245124 Ga0163162_102451242 332
397 3300013307 Ga0157372_10017895 Ga0157372_100178954 332
398 3300013307 Ga0157372_10637049 Ga0157372_106370491 332
399 3300013308 Ga0157375_10362126 Ga0157375_103621262 332
400 3300014326 Ga0157380_10009134 Ga0157380_100091342 332
401 3300020069 Ga0197907_10640432 Ga0197907_106404324 332
402 3300020082 Ga0206353_10586218 Ga0206353_105862187 332
403 3300020082 Ga0206353_10968007 Ga0206353_109680073 332
404 3300025225 Ga0209566_100455 Ga0209566_10045512 332
405 3300025226 Ga0209674_100001 Ga0209674_100001735 332
406 3300025228 Ga0209672_100006 Ga0209672_100006827 332
407 3300025229 Ga0209147_100505 Ga0209147_10050524 332
408 3300025230 Ga0209563_100001 Ga0209563_100001735 332
409 3300025230 Ga0209563_105455 Ga0209563_1054551 332
410 3300025231 Ga0207427_100052 Ga0207427_100052213 332
411 3300025233 Ga0209437_100816 Ga0209437_1008166 332
412 3300025245 Ga0207425_1003428 Ga0207425_10034283 332
413 3300025246 Ga0209646_1000167 Ga0209646_10001674 332
414 3300025253 Ga0209677_100001 Ga0209677_100001735 332
415 3300025254 Ga0209148_1000015 Ga0209148_1000015671 332
416 3300025258 Ga0209129_1000028 Ga0209129_100002823 332
417 3300025261 Ga0209233_1000001 Ga0209233_10000012161 332
418 3300025272 Ga0209455_1000013 Ga0209455_1000013671 332
419 3300025294 Ga0209025_1000428 Ga0209025_100042822 332
420 3300025303 Ga0209051_1005262 Ga0209051_10052627 332
421 3300025303 Ga0209051_1010966 Ga0209051_10109665 332
422 3300025315 Ga0207697_10016651 Ga0207697_100166513 332
423 3300025728 Ga0207655_1003680 Ga0207655_100368010 332
424 3300025728 Ga0207655_1004759 Ga0207655_100475910 332
425 3300025901 Ga0207688_10076748 Ga0207688_100767482 332
426 3300025903 Ga0207680_10088610 Ga0207680_100886101 332
427 3300025907 Ga0207645_10043147 Ga0207645_100431473 332
428 3300025908 Ga0207643_10020442 Ga0207643_100204423 332
429 3300025909 Ga0207705_10000006 Ga0207705_10000006261 332
430 3300025923 Ga0207681_10066294 Ga0207681_100662941 332
431 3300025935 Ga0207709_10012186 Ga0207709_100121863 332
432 3300025937 Ga0207669_10127085 Ga0207669_101270852 332
433 3300025940 Ga0207691_10002070 Ga0207691_1000207021 332
434 3300025949 Ga0207667_10226368 Ga0207667_102263682 332
435 3300025972 Ga0207668_10256352 Ga0207668_102563521 332
436 3300026067 Ga0207678_10018693 Ga0207678_100186934 332
437 3300026067 Ga0207678_10123930 Ga0207678_101239303 332
438 3300026116 Ga0207674_10116206 Ga0207674_101162062 332
439 3300026118 Ga0207675_100137987 Ga0207675_1001379872 332
440 3300026121 Ga0207683_10047950 Ga0207683_100479502 332
441 3300027907 Ga0207428_10019201 Ga0207428_100192014 332
442 3300031548 Ga0307408_100009334 Ga0307408_1000093345 332
443 3300031548 Ga0307408_100055671 Ga0307408_1000556711 332
444 3300031548 Ga0307408_100058972 Ga0307408_1000589723 332
445 3300031548 Ga0307408_100079005 Ga0307408_1000790051 332
446 3300031548 Ga0307408_100115111 Ga0307408_1001151112 332
447 3300031548 Ga0307408_100133340 Ga0307408_1001333402 332
448 3300031548 Ga0307408_100168538 Ga0307408_1001685381 332
449 3300031731 Ga0307405_10010498 Ga0307405_100104986 332
450 3300031731 Ga0307405_10011400 Ga0307405_100114003 332
451 3300031731 Ga0307405_10034210 Ga0307405_100342102 332
452 3300031731 Ga0307405_10119561 Ga0307405_101195612 332
453 3300031731 Ga0307405_10190162 Ga0307405_101901622 332
454 3300031731 Ga0307405_10265623 Ga0307405_102656232 332
455 3300031824 Ga0307413_10040512 Ga0307413_100405122 332
456 3300031824 Ga0307413_10124419 Ga0307413_101244192 332
457 3300031824 Ga0307413_10163054 Ga0307413_101630542 332
458 3300031852 Ga0307410_10000483 Ga0307410_1000048319 332
459 3300031852 Ga0307410_10007830 Ga0307410_100078303 332
460 3300031852 Ga0307410_10011356 Ga0307410_100113563 332
461 3300031852 Ga0307410_10014438 Ga0307410_100144383 332
462 3300031852 Ga0307410_10069048 Ga0307410_100690483 332
463 3300031852 Ga0307410_10227054 Ga0307410_102270542 332
464 3300031901 Ga0307406_10000123 Ga0307406_1000012324 332
465 3300031901 Ga0307406_10000602 Ga0307406_1000060210 332
466 3300031901 Ga0307406_10111773 Ga0307406_101117731 332
467 3300031903 Ga0307407_10033482 Ga0307407_100334822 332
468 3300031903 Ga0307407_10054479 Ga0307407_100544792 332
469 3300031903 Ga0307407_10063154 Ga0307407_100631542 332
470 3300031903 Ga0307407_10091901 Ga0307407_100919012 332
471 3300031903 Ga0307407_10130134 Ga0307407_101301341 332
472 3300031911 Ga0307412_10004963 Ga0307412_100049633 332
473 3300031911 Ga0307412_10006489 Ga0307412_100064896 332
474 3300031911 Ga0307412_10017086 Ga0307412_100170863 332
475 3300031911 Ga0307412_10024794 Ga0307412_100247943 332
476 3300031911 Ga0307412_10030909 Ga0307412_100309092 332
477 3300031911 Ga0307412_10142146 Ga0307412_101421462 332
478 3300031911 Ga0307412_10176691 Ga0307412_101766912 332
479 3300031911 Ga0307412_10383330 Ga0307412_103833301 332
480 3300031995 Ga0307409_100017020 Ga0307409_1000170202 332
481 3300031995 Ga0307409_100018981 Ga0307409_1000189812 332
482 3300031995 Ga0307409_100096756 Ga0307409_1000967562 332
483 3300031995 Ga0307409_100198952 Ga0307409_1001989522 332
484 3300031995 Ga0307409_100240160 Ga0307409_1002401601 332
485 3300032002 Ga0307416_100007835 Ga0307416_1000078354 332
486 3300032002 Ga0307416_100025951 Ga0307416_1000259512 332
487 3300032002 Ga0307416_100027551 Ga0307416_1000275514 332
488 3300032002 Ga0307416_100055902 Ga0307416_1000559023 332
489 3300032002 Ga0307416_100250300 Ga0307416_1002503002 332
490 3300032002 Ga0307416_100448103 Ga0307416_1004481032 332
491 3300032004 Ga0307414_10011634 Ga0307414_100116343 332
492 3300032004 Ga0307414_10152357 Ga0307414_101523572 332
493 3300032004 Ga0307414_10199891 Ga0307414_101998912 332
494 3300032004 Ga0307414_10228588 Ga0307414_102285881 332
495 3300032004 Ga0307414_10416969 Ga0307414_104169691 332
496 3300032005 Ga0307411_10191066 Ga0307411_101910662 332
497 3300032005 Ga0307411_10217366 Ga0307411_102173661 332
498 3300032126 Ga0307415_100018338 Ga0307415_1000183383 332
499 3300032126 Ga0307415_100022659 Ga0307415_1000226593 332
500 3300032126 Ga0307415_100348896 Ga0307415_1003488961 332
501 3300037312 Ga0395899_0002648 Ga0395899_0002648_10923_11984 332
502 3300037312 Ga0395899_0026613 Ga0395899_0026613_506_1567 332
503 3300037312 Ga0395899_0039738 Ga0395899_0039738_1351_2355 332
504 3300037312 Ga0395899_0175911 Ga0395899_0175911_74_1135 332
505 3300037418 Ga0395900_0019759 Ga0395900_0019759_809_1813 332
506 3300037418 Ga0395900_0035603 Ga0395900_0035603_205_1266 332
507 3300037418 Ga0395900_0036339 Ga0395900_0036339_3164_4168 332
508 3300037418 Ga0395900_0039159 Ga0395900_0039159_2520_3581 332
509 3300037418 Ga0395900_0054802 Ga0395900_0054802_366_1427 332
510 3300037418 Ga0395900_0147520 Ga0395900_0147520_802_1863 332
511 3300037418 Ga0395900_0198705 Ga0395900_0198705_920_1981 332
512 3300037466 Ga0395898_0000677 Ga0395898_0000677_3005_4009 332
513 3300037466 Ga0395898_0019181 Ga0395898_0019181_5720_6781 332
514 3300037466 Ga0395898_0101543 Ga0395898_0101543_1511_2572 332
515 3300037466 Ga0395898_0127254 Ga0395898_0127254_391_1452 332
516 3300037466 Ga0395898_0262563 Ga0395898_0262563_234_1295 332
517 3300037466 Ga0395898_0529163 Ga0395898_0529163_22_1083 332
518 3300037471 Ga0395905_0072103 Ga0395905_0072103_391_1452 332
519 3300038443 Ga0395901_0003516 Ga0395901_0003516_11513_12574 332
520 3300038443 Ga0395901_0057360 Ga0395901_0057360_378_1439 332
521 3300038443 Ga0395901_0065598 Ga0395901_0065598_1108_2169 332
522 3300038443 Ga0395901_0126489 Ga0395901_0126489_81_1142 332
523 3300038443 Ga0395901_0160290 Ga0395901_0160290_365_1426 332
524 3300038443 Ga0395901_0170549 Ga0395901_0170549_1007_2068 332
525 3300038443 Ga0395901_0208600 Ga0395901_0208600_235_1239 332
526 3300038443 Ga0395901_0327908 Ga0395901_0327908_179_1183 332
527 3300038443 Ga0395901_0421668 Ga0395901_0421668_73_1134 332
528 3300041404 Ga0439436_0002956 Ga0439436_0002956_2499_3560 332
529 3300041407 Ga0439447_009652 Ga0439447_009652_456_1505 332
530 3300041410 Ga0439461_0001316 Ga0439461_0001316_473_1522 332
531 3300041411 Ga0439466_0005317 Ga0439466_0005317_962_2011 332
532 3300041411 Ga0439466_0007923 Ga0439466_0007923_193_1254 332
533 3300041413 Ga0439465_0014410 Ga0439465_0014410_1161_2222 332
534 3300041452 Ga0451793_0828623 Ga0451793_0828623_722_1726 332
535 3300041999 Ga0439433_0000490 Ga0439433_0000490_5595_6656 332
536 3300041999 Ga0439433_0009092 Ga0439433_0009092_246_1295 332
537 3300041999 Ga0439433_0013464 Ga0439433_0013464_274_1335 332
538 3300042002 Ga0439442_000003 Ga0439442_000003_33003_34064 332
539 3300042002 Ga0439442_000415 Ga0439442_000415_1336_2436 332
540 3300042002 Ga0439442_000785 Ga0439442_000785_2709_3770 332
541 3300042006 Ga0439432_000482 Ga0439432_000482_6589_7638 332
542 3300042007 Ga0439449_0004415 Ga0439449_0004415_1127_2188 332
543 3300042007 Ga0439449_0005537 Ga0439449_0005537_2962_4050 332
544 3300042010 Ga0439452_001631 Ga0439452_001631_3031_4080 332
545 3300042014 Ga0439457_011477 Ga0439457_011477_250_1311 332
546 3300042015 Ga0439462_0002134 Ga0439462_0002134_868_1917 332
547 3300042121 Ga0450919_000178 Ga0450919_000178_1692_2741 332
548 3300042122 Ga0450920_000449 Ga0450920_000449_101_1162 332
549 3300042122 Ga0450920_001395 Ga0450920_001395_1380_2429 332
550 3300042122 Ga0450920_006052 Ga0450920_006052_202_1263 332
551 3300042146 Ga0450907_000170 Ga0450907_000170_19523_20584 332
552 3300042146 Ga0450907_004717 Ga0450907_004717_491_1540 332
553 3300042184 Ga0450908_006286 Ga0450908_006286_959_2008 332
554 3300042185 Ga0450909_003189 Ga0450909_003189_1242_2291 332
555 3300042435 Ga0439434_0000044 Ga0439434_0000044_3284_4345 332
556 3300042435 Ga0439434_0000575 Ga0439434_0000575_6784_7833 332
557 3300042435 Ga0439434_0028115 Ga0439434_0028115_622_1683 332
558 3300044658 Ga0466972_0007166 Ga0466972_0007166_3203_4207 332
559 3300044658 Ga0466972_0056087 Ga0466972_0056087_253_1257 332
560 3300044684 Ga0466966_0073197 Ga0466966_0073197_808_1869 332
561 3300044684 Ga0466966_0221371 Ga0466966_0221371_20_1024 332
562 3300044693 Ga0466961_0011738 Ga0466961_0011738_3658_4662 332
563 3300044693 Ga0466961_0052131 Ga0466961_0052131_302_1306 332
564 3300044719 Ga0466971_0068131 Ga0466971_0068131_228_1232 332
565 3300044765 Ga0466970_0000428 Ga0466970_0000428_1904_2902 332
566 3300044765 Ga0466970_0012059 Ga0466970_0012059_243_1247 332
567 3300044765 Ga0466970_0080751 Ga0466970_0080751_70_1074 332
568 3300044842 Ga0466957_0106894 Ga0466957_0106894_594_1592 332
569 3300044901 Ga0466960_0011585 Ga0466960_0011585_1965_2969 332
570 3300045049 Ga0466959_0006255 Ga0466959_0006255_4229_5233 332
571 3300045836 Ga0466958_0211021 Ga0466958_0211021_213_1217 332
572 3300046453 Ga0495627_000742 Ga0495627_000742_2267_3268 332
573 3300046460 Ga0495638_0062310 Ga0495638_0062310_420_1481 332
574 3300046463 Ga0495653_0037682 Ga0495653_0037682_1678_2739 332
575 3300046472 Ga0495580_0009570 Ga0495580_0009570_3521_4582 332
576 3300046472 Ga0495580_0261159 Ga0495580_0261159_50_1111 332
577 3300046473 Ga0495582_0143422 Ga0495582_0143422_122_1183 332
578 3300046475 Ga0495639_0002665 Ga0495639_0002665_889_1950 332
579 3300046531 Ga0495665_0005279 Ga0495665_0005279_4460_5521 332
580 3300046535 Ga0495586_0016303 Ga0495586_0016303_1486_2547 332
581 3300046535 Ga0495586_0040427 Ga0495586_0040427_398_1459 332
582 3300046536 Ga0495587_0055060 Ga0495587_0055060_1202_2263 332
583 3300046543 Ga0495645_0007535 Ga0495645_0007535_2490_3491 332
584 3300046543 Ga0495645_0011335 Ga0495645_0011335_2082_3143 332
585 3300046615 Ga0495656_0042341 Ga0495656_0042341_198_1202 332
586 3300046616 Ga0495668_0031038 Ga0495668_0031038_343_1404 332
587 3300046663 Ga0495635_0186783 Ga0495635_0186783_146_1207 332
588 3300046674 Ga0495588_0003154 Ga0495588_0003154_839_1900 332
589 3300046674 Ga0495588_0007845 Ga0495588_0007845_2517_3578 332
590 3300046674 Ga0495588_0035567 Ga0495588_0035567_441_1502 332
591 3300046674 Ga0495588_0076342 Ga0495588_0076342_413_1474 332
592 3300046689 Ga0495613_0328529 Ga0495613_0328529_36_1040 332
593 3300046691 Ga0495670_0080676 Ga0495670_0080676_558_1619 332
594 3300046809 Ga0495600_0020743 Ga0495600_0020743_214_1275 332
595 3300047315 Ga0495581_0010232 Ga0495581_0010232_881_1942 332
596 3300047445 Ga0495677_0012700 Ga0495677_0012700_1498_2559 332
597 3300047673 Ga0495593_0056575 Ga0495593_0056575_247_1308 332
598 3300048903 Ga0496100_0056030 Ga0496100_0056030_933_1934 332
599 3300048904 Ga0496101_0041350 Ga0496101_0041350_850_1851 332
600 3300048904 Ga0496101_0229495 Ga0496101_0229495_280_1341 332
601 3300048905 Ga0496102_0036332 Ga0496102_0036332_3049_4110 332
602 3300048905 Ga0496102_0056538 Ga0496102_0056538_1844_2905 332
603 3300048905 Ga0496102_0072042 Ga0496102_0072042_1693_2754 332
604 3300048905 Ga0496102_0102125 Ga0496102_0102125_841_1842 332
605 3300048906 Ga0496103_0028464 Ga0496103_0028464_1311_2312 332
606 3300048906 Ga0496103_0098687 Ga0496103_0098687_319_1323 332
607 3300048907 Ga0496104_0009242 Ga0496104_0009242_6655_7659 332
608 3300048908 Ga0496105_0032715 Ga0496105_0032715_2101_3105 332
609 3300048908 Ga0496105_0037902 Ga0496105_0037902_2500_3501 332
610 3300048908 Ga0496105_0090706 Ga0496105_0090706_416_1417 332
611 3300048908 Ga0496105_0122125 Ga0496105_0122125_534_1538 332
612 3300048909 Ga0496106_0070007 Ga0496106_0070007_182_1243 332
613 3300048909 Ga0496106_0150347 Ga0496106_0150347_300_1361 332
614 3300048910 Ga0496107_0007307 Ga0496107_0007307_1025_2026 332
615 3300048910 Ga0496107_0017706 Ga0496107_0017706_980_1984 332
616 3300048911 Ga0496108_0133989 Ga0496108_0133989_1008_2009 332
617 3300048912 Ga0496109_0031753 Ga0496109_0031753_3135_4136 332
618 3300048912 Ga0496109_0132466 Ga0496109_0132466_269_1330 332
619 3300048913 Ga0496110_0179996 Ga0496110_0179996_541_1602 332
620 3300048913 Ga0496110_0316467 Ga0496110_0316467_34_1095 332
621 3300048914 Ga0496111_0008731 Ga0496111_0008731_3567_4628 332
622 3300048914 Ga0496111_0032912 Ga0496111_0032912_1832_2833 332
623 3300048915 Ga0496112_0013055 Ga0496112_0013055_1600_2661 332
624 3300048915 Ga0496112_0027521 Ga0496112_0027521_2631_3632 332
625 3300048915 Ga0496112_0216124 Ga0496112_0216124_650_1711 332
626 3300048916 Ga0496113_0017866 Ga0496113_0017866_2940_3941 332
627 3300048916 Ga0496113_0149114 Ga0496113_0149114_681_1742 332
628 3300048917 Ga0496114_0007014 Ga0496114_0007014_3929_4930 332
629 3300048917 Ga0496114_0011754 Ga0496114_0011754_5919_6920 332
630 3300048917 Ga0496114_0035901 Ga0496114_0035901_634_1695 332
631 3300048917 Ga0496114_0040298 Ga0496114_0040298_1998_3002 332
632 3300048917 Ga0496114_0040447 Ga0496114_0040447_2746_3747 332
633 3300048917 Ga0496114_0041980 Ga0496114_0041980_1242_2246 332
634 3300048917 Ga0496114_0179026 Ga0496114_0179026_565_1566 332
635 3300048917 Ga0496114_0244733 Ga0496114_0244733_92_1093 332
636 3300048917 Ga0496114_0340252 Ga0496114_0340252_161_1222 332
637 3300048918 Ga0496115_0044786 Ga0496115_0044786_1528_2532 332
638 3300048918 Ga0496115_0060424 Ga0496115_0060424_936_1937 332
639 3300048918 Ga0496115_0067417 Ga0496115_0067417_961_1962 332
640 3300048918 Ga0496115_0235528 Ga0496115_0235528_273_1334 332
641 3300048918 Ga0496115_0393878 Ga0496115_0393878_42_1046 332
642 3300048920 Ga0496117_0000053 Ga0496117_0000053_267070_268074 332
643 3300048920 Ga0496117_0002845 Ga0496117_0002845_482_1483 332
644 3300048920 Ga0496117_0027117 Ga0496117_0027117_989_1993 332
645 3300048921 Ga0496118_0019871 Ga0496118_0019871_2984_3985 332
646 3300048921 Ga0496118_0186754 Ga0496118_0186754_170_1174 332
647 3300048922 Ga0496119_0001919 Ga0496119_0001919_517_1521 332
648 3300048922 Ga0496119_0002232 Ga0496119_0002232_2526_3527 332
649 3300048922 Ga0496119_0008189 Ga0496119_0008189_6429_7433 332
650 3300048922 Ga0496119_0129139 Ga0496119_0129139_135_1136 332
651 3300048923 Ga0496120_0000567 Ga0496120_0000567_30500_31504 332
652 3300048924 Ga0496121_0000076 Ga0496121_0000076_128966_129997 332
653 3300048924 Ga0496121_0019958 Ga0496121_0019958_3092_4096 332
654 3300048924 Ga0496121_0136827 Ga0496121_0136827_220_1221 332
655 3300048925 Ga0496122_0014414 Ga0496122_0014414_4140_5144 332
656 3300048925 Ga0496122_0017802 Ga0496122_0017802_3729_4730 332
657 3300048925 Ga0496122_0026081 Ga0496122_0026081_2527_3528 332
658 3300048925 Ga0496122_0062031 Ga0496122_0062031_142_1143 332
659 3300048925 Ga0496122_0106325 Ga0496122_0106325_255_1259 332
660 3300048925 Ga0496122_0143875 Ga0496122_0143875_244_1248 332
661 3300048926 Ga0496123_0004463 Ga0496123_0004463_8674_9678 332
662 3300048927 Ga0496124_0007376 Ga0496124_0007376_2180_3184 332
663 3300048927 Ga0496124_0053605 Ga0496124_0053605_1060_2121 332
664 3300048927 Ga0496124_0071521 Ga0496124_0071521_611_1612 332
665 3300048927 Ga0496124_0117814 Ga0496124_0117814_1092_2093 332
666 3300048928 Ga0496125_0000061 Ga0496125_0000061_185390_186391 332
667 3300048928 Ga0496125_0003349 Ga0496125_0003349_10235_11236 332
668 3300048928 Ga0496125_0004791 Ga0496125_0004791_12209_13213 332
669 3300048928 Ga0496125_0021752 Ga0496125_0021752_1145_2146 332
670 3300048928 Ga0496125_0041712 Ga0496125_0041712_2592_3593 332
671 3300048928 Ga0496125_0080008 Ga0496125_0080008_424_1425 332
672 3300048929 Ga0496126_0004531 Ga0496126_0004531_4187_5191 332
673 3300048929 Ga0496126_0103876 Ga0496126_0103876_637_1638 332
674 3300048929 Ga0496126_0121254 Ga0496126_0121254_327_1328 332
675 3300048929 Ga0496126_0224979 Ga0496126_0224979_144_1145 332
676 3300048929 Ga0496126_0253788 Ga0496126_0253788_16_1017 332
677 3300049537 Ga0501321_000365 Ga0501321_000365_1482_2570 332
678 3300049537 Ga0501321_005457 Ga0501321_005457_51_1112 332
679 3300049568 Ga0501031_0008742 Ga0501031_0008742_5003_6007 332
680 3300049569 Ga0501032_0000691 Ga0501032_0000691_150_1211 332
681 3300049570 Ga0501033_0006508 Ga0501033_0006508_7328_8332 332
682 3300049570 Ga0501033_0007517 Ga0501033_0007517_5003_6007 332
683 3300049571 Ga0501034_0000123 Ga0501034_0000123_139924_140985 332
684 3300049571 Ga0501034_0006950 Ga0501034_0006950_3070_4071 332
685 3300049571 Ga0501034_0025898 Ga0501034_0025898_195_1199 332
686 3300049571 Ga0501034_0035910 Ga0501034_0035910_3928_4926 332
687 3300049571 Ga0501034_0039896 Ga0501034_0039896_2452_3453 332
688 3300049572 Ga0501036_0024497 Ga0501036_0024497_3507_4511 332
689 3300049573 Ga0501037_0009537 Ga0501037_0009537_3168_4229 332
690 3300049573 Ga0501037_0037164 Ga0501037_0037164_962_2023 332
691 3300049573 Ga0501037_0144161 Ga0501037_0144161_407_1408 332
692 3300049574 Ga0501038_0005618 Ga0501038_0005618_2348_3346 332
693 3300049574 Ga0501038_0029074 Ga0501038_0029074_3362_4423 332
694 3300049574 Ga0501038_0095873 Ga0501038_0095873_951_2012 332
695 3300049574 Ga0501038_0160592 Ga0501038_0160592_255_1259 332
696 3300049575 Ga0501039_0009494 Ga0501039_0009494_3727_4731 332
697 3300049575 Ga0501039_0155369 Ga0501039_0155369_531_1532 332
698 3300049578 Ga0501042_0028951 Ga0501042_0028951_852_1856 332
699 3300049579 Ga0501043_0022104 Ga0501043_0022104_802_1863 332
700 3300049579 Ga0501043_0062026 Ga0501043_0062026_1897_2901 332
701 3300049579 Ga0501043_0276008 Ga0501043_0276008_111_1115 332
702 3300049579 Ga0501043_0282871 Ga0501043_0282871_112_1113 332
703 3300049580 Ga0501046_0030096 Ga0501046_0030096_880_1896 332
704 3300049581 Ga0501047_0003895 Ga0501047_0003895_961_1965 332
705 3300049581 Ga0501047_0081513 Ga0501047_0081513_316_1332 332
706 3300049582 Ga0501048_0001989 Ga0501048_0001989_30_1034 332
707 3300049583 Ga0501067_0071637 Ga0501067_0071637_81_1085 332
708 3300049586 Ga0501070_0000088 Ga0501070_0000088_5577_6581 332
709 3300049586 Ga0501070_0015424 Ga0501070_0015424_2877_3878 332
710 3300049586 Ga0501070_0022690 Ga0501070_0022690_3849_4853 332
711 3300049589 Ga0501073_0026258 Ga0501073_0026258_792_1796 332
712 3300049590 Ga0501074_0033589 Ga0501074_0033589_1164_2168 332
713 3300049742 Ga0501080_0081761 Ga0501080_0081761_874_1878 332
714 3300049822 Ga0501035_0010037 Ga0501035_0010037_4873_5877 332
715 3300049822 Ga0501035_0061517 Ga0501035_0061517_2286_3290 332
716 3300049823 Ga0501044_0017210 Ga0501044_0017210_1121_2125 332
717 3300049823 Ga0501044_0050928 Ga0501044_0050928_2640_3644 332
718 3300049823 Ga0501044_0086590 Ga0501044_0086590_1812_2873 332
719 3300049824 Ga0501045_0042263 Ga0501045_0042263_1390_2394 332
720 3300050491 nmdc:mga00v17_47213_c1 nmdc:mga00v17_47213_c1_465_1466 332
721 3300050492 nmdc:mga0yw44_2472_c1 nmdc:mga0yw44_2472_c1_4510_5511 332
722 3300050494 nmdc:mga06z11_26546_c1 nmdc:mga06z11_26546_c1_1251_2252 332
723 3300050516 nmdc:mga0sz30_55015_c1 nmdc:mga0sz30_55015_c1_481_1482 332
724 3300053080 Ga0500635_0000013 Ga0500635_0000013_118443_119447 332
725 3300053087 Ga0500643_000275 Ga0500643_000275_13783_14784 332
726 3300053104 Ga0500556_0000001 Ga0500556_0000001_419978_420979 332
727 3300053136 Ga0500559_0002603 Ga0500559_0002603_305_1309 332
728 3300053136 Ga0500559_0015737 Ga0500559_0015737_1813_2817 332
729 3300053136 Ga0500559_0027667 Ga0500559_0027667_249_1253 332
730 3300053139 Ga0500568_0000006 Ga0500568_0000006_286607_287608 332
731 3300053140 Ga0500573_0004755 Ga0500573_0004755_1680_2684 332
732 3300053140 Ga0500573_0042418 Ga0500573_0042418_507_1508 332
733 3300053140 Ga0500573_0061830 Ga0500573_0061830_208_1212 332
734 3300053140 Ga0500573_0082125 Ga0500573_0082125_491_1495 332
735 3300053140 Ga0500573_0101561 Ga0500573_0101561_291_1295 332
736 3300053140 Ga0500573_0109466 Ga0500573_0109466_520_1524 332
737 3300053140 Ga0500573_0195401 Ga0500573_0195401_47_1054 332
738 3300059510 Ga0587090_000501 Ga0587090_000501_469_1530 332
739 3300060353 Ga0501082_0146675 Ga0501082_0146675_303_1304 332
740 3300061719 Ga0466962_0028064 Ga0466962_0028064_231_1235 332
741 iso_pu_bacteria 2821268502 2821270014 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

260

350

0.98

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

136

213

0.98

PF00108

Thiolase_N

Thiolase, N-terminal domain

64

196

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewp-assembly3.cif.gz_F crystal structure of fabh from micrococcus luteus 0.9868 1 332
4ewp-assembly3.cif.gz_F crystal structure of fabh from micrococcus luteus 0.9839 1 332
2ahb-assembly1.cif.gz_A x-ray crystal structure of r46a,r161a mutant of mycobacterium tuberculosis fabh 0.9768 1 332
1hzp-assembly1.cif.gz_A crystal structure of the myobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii 0.9764 1 332
1u6s-assembly1.cif.gz_A crystal structure of the complex between mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase iii and lauroyl coenzyme a 0.9763 1 332
ID Description Score Start End Superfamily
4ewpF01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9852 1 182 3.40.47.10
4ewpF01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9799 1 182 3.40.47.10
4ewpC02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9754 183 331 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9677 12 180 3.40.47.10
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9673 12 180 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A3D5CHN8-F1-model_v4 3-oxoacyl-ACP synthase 0.9974 1 251 GO:0004315
GO:0006633
GO:0044550
AF-P64117-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9943 12 332 GO:0004315
GO:0005737
GO:0006633
GO:0033818
AF-A0A1H1YAX5-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase-3 0.9932 1 332 GO:0004315
GO:0005737
GO:0006633
GO:0044550
AF-A0A1H1YAX5-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase-3 0.9903 1 332 GO:0004315
GO:0005737
GO:0006633
GO:0044550
AF-A0A3D5CHN8-F1-model_v4 3-oxoacyl-ACP synthase 0.9895 1 251 GO:0004315
GO:0006633
GO:0044550

Feature Viewer

pLDDT pTM Quality
95.75 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map