F478608
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 741 | 325 | 733 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300053103|Ga0500555_018159|Ga0500555_018159_287_1666 |
| Length | 459 |
| Sequence | MGGESFGGNVEDCNCAGAWRVYAKKAIRSTLSKLTDIGCLQCPIPGGNMNGMTAPAASPSASVAMDEARSEPAARNLAMDAYRGVVMLLMMAEVLQLGQVASSFPGNWFWSVLAFNQTHVEWAGCSLHDMIQPSFSFLVGVALPYSIASRLAKGKTFGQLFGHALWRSLLLICLGIFLRSISRTQTNFTFEDTLTQIGLGYPFLFLLGFKQPKWQWTAFGAILFGYWLAWALYPAPGPGFDYQAVGVSADWTRNFTGFASHWNKNSNLGAAFDQWFLNLFPRSKPFIANHGGYLTLSFIPTLGTMILGLVAGRWLREAAPRIPIKRLLIAGVIGVAAGAILHFTGVCPVVKRIWTPGWTLFSGGICFLFLAAFSWIIETKGYRKWSFPLLVIGMNSIAAYLIAHLFEDFIVRAFHTHLGENVFKLFGAALEPFFAGVVVLSVYWLILFWMYRRKLFLKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 3 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 4 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 5 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 6 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 7 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 8 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 9 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 202 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 305 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 317 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 318 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 320 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 323 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.79 |
| Metatranscriptomes | 0.13 |
| Isolates | 1.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.51 |
| Nodule | 0 |
| Rhizoplane | 2.43 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000056 | 3300000546 | Bacteria | 15164 |
| 2 | rootH1_10021801 | 3300003316 | Bacteria | 10044 |
| 3 | rootH2_10000834 | 3300003320 | Bacteria | 40472 |
| 4 | rootH2_10065350 | 3300003320 | Bacteria | 5620 |
| 5 | rootL2_10040554 | 3300003322 | Bacteria | 3990 |
| 6 | Ga0055536_1013742 | 3300003781 | Bacteria | 2892 |
| 7 | Ga0058862_10082891 | 3300004803 | Bacteria | 1650 |
| 8 | Ga0065165_1002669 | 3300005262 | Bacteria | 14411 |
| 9 | Ga0065704_10126003 | 3300005289 | Bacteria | 1695 |
| 10 | Ga0065712_10001332 | 3300005290 | Bacteria | 10210 |
| 11 | Ga0065712_10094722 | 3300005290 | Bacteria | 2244 |
| 12 | Ga0065715_10000764 | 3300005293 | Bacteria | 8500 |
| 13 | Ga0065715_10114169 | 3300005293 | Bacteria | 2460 |
| 14 | Ga0065707_10089478 | 3300005295 | Bacteria | 4357 |
| 15 | Ga0065707_10109042 | 3300005295 | Bacteria | 2484 |
| 16 | Ga0070658_10000848 | 3300005327 | Bacteria | 26068 |
| 17 | Ga0070658_10014336 | 3300005327 | Bacteria | 6359 |
| 18 | Ga0070676_10037906 | 3300005328 | Bacteria | 2782 |
| 19 | Ga0070683_100000025 | 3300005329 | Bacteria | 173339 |
| 20 | Ga0070683_100024371 | 3300005329 | Bacteria | 5419 |
| 21 | Ga0070683_100097017 | 3300005329 | Bacteria | 2773 |
| 22 | Ga0070683_100099260 | 3300005329 | Bacteria | 2740 |
| 23 | Ga0070683_100281609 | 3300005329 | Bacteria | 1581 |
| 24 | Ga0070670_100051222 | 3300005331 | Bacteria | 3546 |
| 25 | Ga0070670_100104734 | 3300005331 | Bacteria | 2437 |
| 26 | Ga0070670_100119660 | 3300005331 | Bacteria | 2271 |
| 27 | Ga0070670_100120174 | 3300005331 | Bacteria | 2266 |
| 28 | Ga0070666_10103166 | 3300005335 | Bacteria | 1967 |
| 29 | Ga0070666_10109130 | 3300005335 | Unclassified | 1912 |
| 30 | Ga0070680_100070350 | 3300005336 | Bacteria | 2874 |
| 31 | Ga0070680_100208529 | 3300005336 | Bacteria | 1648 |
| 32 | Ga0068868_100077526 | 3300005338 | Bacteria | 2659 |
| 33 | Ga0068868_100108522 | 3300005338 | Unclassified | 2253 |
| 34 | Ga0068868_100116323 | 3300005338 | Bacteria | 2177 |
| 35 | Ga0068868_100196299 | 3300005338 | Bacteria | 1680 |
| 36 | Ga0070660_100093924 | 3300005339 | Unclassified | 2369 |
| 37 | Ga0070660_100155747 | 3300005339 | Bacteria | 1839 |
| 38 | Ga0070660_100188992 | 3300005339 | Bacteria | 1668 |
| 39 | Ga0070689_100003920 | 3300005340 | Bacteria | 9978 |
| 40 | Ga0070689_100017655 | 3300005340 | Bacteria | 5245 |
| 41 | Ga0070689_100127473 | 3300005340 | Bacteria | 2038 |
| 42 | Ga0070689_100129025 | 3300005340 | Bacteria | 2026 |
| 43 | Ga0070689_100149824 | 3300005340 | Unclassified | 1881 |
| 44 | Ga0070687_100002461 | 3300005343 | Bacteria | 6958 |
| 45 | Ga0070661_100013867 | 3300005344 | Bacteria | 5662 |
| 46 | Ga0070668_100108577 | 3300005347 | Unclassified | 2207 |
| 47 | Ga0070668_100110614 | 3300005347 | Bacteria | 2186 |
| 48 | Ga0070668_100131325 | 3300005347 | Bacteria | 2010 |
| 49 | Ga0070669_100019584 | 3300005353 | Bacteria | 4833 |
| 50 | Ga0070669_100047310 | 3300005353 | Bacteria | 3138 |
| 51 | Ga0070669_100047657 | 3300005353 | Bacteria | 3126 |
| 52 | Ga0070675_100003042 | 3300005354 | Bacteria | 12665 |
| 53 | Ga0070675_100014273 | 3300005354 | Bacteria | 6263 |
| 54 | Ga0070675_100064238 | 3300005354 | Bacteria | 3035 |
| 55 | Ga0070675_100105490 | 3300005354 | Bacteria | 2378 |
| 56 | Ga0070675_100273102 | 3300005354 | Bacteria | 1484 |
| 57 | Ga0070671_100028762 | 3300005355 | Bacteria | 4580 |
| 58 | Ga0070671_100070003 | 3300005355 | Bacteria | 2926 |
| 59 | Ga0070671_100190081 | 3300005355 | Bacteria | 1740 |
| 60 | Ga0070674_100006619 | 3300005356 | Bacteria | 6774 |
| 61 | Ga0070674_100007780 | 3300005356 | Bacteria | 6335 |
| 62 | Ga0070673_100041061 | 3300005364 | Bacteria | 3553 |
| 63 | Ga0070673_100153081 | 3300005364 | Unclassified | 1954 |
| 64 | Ga0070688_100002565 | 3300005365 | Bacteria | 9204 |
| 65 | Ga0070688_100007441 | 3300005365 | Bacteria | 5904 |
| 66 | Ga0070659_100014105 | 3300005366 | Bacteria | 5963 |
| 67 | Ga0070659_100175716 | 3300005366 | Bacteria | 1756 |
| 68 | Ga0070667_100080536 | 3300005367 | Bacteria | 2785 |
| 69 | Ga0070709_10052683 | 3300005434 | Bacteria | 2559 |
| 70 | Ga0070713_100018432 | 3300005436 | Bacteria | 5305 |
| 71 | Ga0070713_100047121 | 3300005436 | Bacteria | 3541 |
| 72 | Ga0070713_100159221 | 3300005436 | Bacteria | 2014 |
| 73 | Ga0070701_10004404 | 3300005438 | Bacteria | 5697 |
| 74 | Ga0070711_100166271 | 3300005439 | Unclassified | 1677 |
| 75 | Ga0070705_100004071 | 3300005440 | Bacteria | 7138 |
| 76 | Ga0070663_100001367 | 3300005455 | Bacteria | 13359 |
| 77 | Ga0070663_100075286 | 3300005455 | Bacteria | 2467 |
| 78 | Ga0070663_100120270 | 3300005455 | Bacteria | 1983 |
| 79 | Ga0070678_100233262 | 3300005456 | Bacteria | 1535 |
| 80 | Ga0070678_100243531 | 3300005456 | Bacteria | 1505 |
| 81 | Ga0070662_100042202 | 3300005457 | Bacteria | 3257 |
| 82 | Ga0070662_100220768 | 3300005457 | Bacteria | 1512 |
| 83 | Ga0070681_10019179 | 3300005458 | Bacteria | 6844 |
| 84 | Ga0068867_100008892 | 3300005459 | Bacteria | 7086 |
| 85 | Ga0068867_100035990 | 3300005459 | Bacteria | 3591 |
| 86 | Ga0068867_100051771 | 3300005459 | Bacteria | 3029 |
| 87 | Ga0070685_10010657 | 3300005466 | Bacteria | 4785 |
| 88 | Ga0070685_10012600 | 3300005466 | Bacteria | 4445 |
| 89 | Ga0070685_10110813 | 3300005466 | Unclassified | 1690 |
| 90 | Ga0070706_100058873 | 3300005467 | Bacteria | 3545 |
| 91 | Ga0070706_100113145 | 3300005467 | Bacteria | 2527 |
| 92 | Ga0070707_100004528 | 3300005468 | Bacteria | 13017 |
| 93 | Ga0070698_100002639 | 3300005471 | Bacteria | 19752 |
| 94 | Ga0070698_100063132 | 3300005471 | Bacteria | 3735 |
| 95 | Ga0070698_100177367 | 3300005471 | Bacteria | 2070 |
| 96 | Ga0070699_100033901 | 3300005518 | Bacteria | 4411 |
| 97 | Ga0070699_100181908 | 3300005518 | Bacteria | 1865 |
| 98 | Ga0070699_100210879 | 3300005518 | Bacteria | 1729 |
| 99 | Ga0070679_100021481 | 3300005530 | Bacteria | 6301 |
| 100 | Ga0070679_100073584 | 3300005530 | Unclassified | 3408 |
| 101 | Ga0070684_100000081 | 3300005535 | Bacteria | 62318 |
| 102 | Ga0070684_100051298 | 3300005535 | Bacteria | 3584 |
| 103 | Ga0070684_100155894 | 3300005535 | Bacteria | 2071 |
| 104 | Ga0070684_100156440 | 3300005535 | Bacteria | 2067 |
| 105 | Ga0070697_100019632 | 3300005536 | Bacteria | 5339 |
| 106 | Ga0068853_100023789 | 3300005539 | Bacteria | 5132 |
| 107 | Ga0070672_100022017 | 3300005543 | Bacteria | 4674 |
| 108 | Ga0070672_100078788 | 3300005543 | Bacteria | 2636 |
| 109 | Ga0070672_100377438 | 3300005543 | Unclassified | 1212 |
| 110 | Ga0070686_100111565 | 3300005544 | Unclassified | 1864 |
| 111 | Ga0070695_100107081 | 3300005545 | Bacteria | 1891 |
| 112 | Ga0070696_100021132 | 3300005546 | Bacteria | 4413 |
| 113 | Ga0070696_100051017 | 3300005546 | Unclassified | 2877 |
| 114 | Ga0070696_100052322 | 3300005546 | Bacteria | 2841 |
| 115 | Ga0070665_100008511 | 3300005548 | Bacteria | 10376 |
| 116 | Ga0070665_100036479 | 3300005548 | Bacteria | 4945 |
| 117 | Ga0070665_100195701 | 3300005548 | Bacteria | 2022 |
| 118 | Ga0070665_100394970 | 3300005548 | Unclassified | 1391 |
| 119 | Ga0070704_100002042 | 3300005549 | Bacteria | 11190 |
| 120 | Ga0070704_100075811 | 3300005549 | Bacteria | 2458 |
| 121 | Ga0070704_100133138 | 3300005549 | Unclassified | 1930 |
| 122 | Ga0070704_100181602 | 3300005549 | Bacteria | 1683 |
| 123 | Ga0068855_100010269 | 3300005563 | Bacteria | 11292 |
| 124 | Ga0068855_100016620 | 3300005563 | Bacteria | 8848 |
| 125 | Ga0068855_100027673 | 3300005563 | Bacteria | 6782 |
| 126 | Ga0068855_100047054 | 3300005563 | Bacteria | 5097 |
| 127 | Ga0068855_100217264 | 3300005563 | Bacteria | 2145 |
| 128 | Ga0068857_100014212 | 3300005577 | Bacteria | 6934 |
| 129 | Ga0068857_100094514 | 3300005577 | Bacteria | 2677 |
| 130 | Ga0068854_100013772 | 3300005578 | Bacteria | 5317 |
| 131 | Ga0068856_100009463 | 3300005614 | Bacteria | 9462 |
| 132 | Ga0068856_100055580 | 3300005614 | Unclassified | 3907 |
| 133 | Ga0068859_100005273 | 3300005617 | Bacteria | 13141 |
| 134 | Ga0068859_100005827 | 3300005617 | Bacteria | 12511 |
| 135 | Ga0068859_100059208 | 3300005617 | Bacteria | 3859 |
| 136 | Ga0068859_100150810 | 3300005617 | Bacteria | 2400 |
| 137 | Ga0068859_100196963 | 3300005617 | Bacteria | 2099 |
| 138 | Ga0068859_100455743 | 3300005617 | Unclassified | 1375 |
| 139 | Ga0068864_100013795 | 3300005618 | Bacteria | 6698 |
| 140 | Ga0068864_100068386 | 3300005618 | Bacteria | 3086 |
| 141 | Ga0068861_100045260 | 3300005719 | Unclassified | 3313 |
| 142 | Ga0068861_100117718 | 3300005719 | Bacteria | 2138 |
| 143 | Ga0068870_10021442 | 3300005840 | Bacteria | 3160 |
| 144 | Ga0068863_100014070 | 3300005841 | Bacteria | 7710 |
| 145 | Ga0068863_100020534 | 3300005841 | Bacteria | 6315 |
| 146 | Ga0068858_100007346 | 3300005842 | Bacteria | 10663 |
| 147 | Ga0068858_100008571 | 3300005842 | Bacteria | 9819 |
| 148 | Ga0068858_100025804 | 3300005842 | Bacteria | 5466 |
| 149 | Ga0068858_100065434 | 3300005842 | Bacteria | 3364 |
| 150 | Ga0068858_100084463 | 3300005842 | Unclassified | 2953 |
| 151 | Ga0068858_100208207 | 3300005842 | Bacteria | 1850 |
| 152 | Ga0068858_100294351 | 3300005842 | Bacteria | 1548 |
| 153 | Ga0068860_100007581 | 3300005843 | Bacteria | 10859 |
| 154 | Ga0068862_100137245 | 3300005844 | Bacteria | 2168 |
| 155 | Ga0068862_100192045 | 3300005844 | Bacteria | 1838 |
| 156 | Ga0081455_10006375 | 3300005937 | Bacteria | 12663 |
| 157 | Ga0081455_10009808 | 3300005937 | Bacteria | 9805 |
| 158 | Ga0081540_1004612 | 3300005983 | Bacteria | 10428 |
| 159 | Ga0070717_10002730 | 3300006028 | Bacteria | 12465 |
| 160 | Ga0070717_10172477 | 3300006028 | Bacteria | 1882 |
| 161 | Ga0070717_10283385 | 3300006028 | Bacteria | 1470 |
| 162 | Ga0075368_10009032 | 3300006042 | Bacteria | 3577 |
| 163 | Ga0075368_10011193 | 3300006042 | Bacteria | 3259 |
| 164 | Ga0075363_100025366 | 3300006048 | Bacteria | 3023 |
| 165 | Ga0075367_10030280 | 3300006178 | Bacteria | 3102 |
| 166 | Ga0075367_10031757 | 3300006178 | Bacteria | 3034 |
| 167 | Ga0075366_10000788 | 3300006195 | Bacteria | 15172 |
| 168 | Ga0075366_10004241 | 3300006195 | Bacteria | 7686 |
| 169 | Ga0097621_100012605 | 3300006237 | Bacteria | 6272 |
| 170 | Ga0097621_100110952 | 3300006237 | Bacteria | 2317 |
| 171 | Ga0097621_100231346 | 3300006237 | Unclassified | 1614 |
| 172 | Ga0097621_100244937 | 3300006237 | Bacteria | 1568 |
| 173 | Ga0068871_100006058 | 3300006358 | Bacteria | 8506 |
| 174 | Ga0068871_100071452 | 3300006358 | Bacteria | 2854 |
| 175 | Ga0068871_100112201 | 3300006358 | Bacteria | 2294 |
| 176 | Ga0075428_100001649 | 3300006844 | Bacteria | 23746 |
| 177 | Ga0075428_100012727 | 3300006844 | Bacteria | 9358 |
| 178 | Ga0075428_100088636 | 3300006844 | Bacteria | 3375 |
| 179 | Ga0075428_100100854 | 3300006844 | Bacteria | 3147 |
| 180 | Ga0075430_100079212 | 3300006846 | Bacteria | 2754 |
| 181 | Ga0075430_100103009 | 3300006846 | Bacteria | 2383 |
| 182 | Ga0075431_100005399 | 3300006847 | Bacteria | 12625 |
| 183 | Ga0075431_100008610 | 3300006847 | Bacteria | 10216 |
| 184 | Ga0075431_100041216 | 3300006847 | Bacteria | 4760 |
| 185 | Ga0075431_100066605 | 3300006847 | Unclassified | 3718 |
| 186 | Ga0075431_100080394 | 3300006847 | Bacteria | 3365 |
| 187 | Ga0075431_100083161 | 3300006847 | Bacteria | 3304 |
| 188 | Ga0075431_100153208 | 3300006847 | Bacteria | 2373 |
| 189 | Ga0075431_100235815 | 3300006847 | Bacteria | 1863 |
| 190 | Ga0075433_10000557 | 3300006852 | Bacteria | 24575 |
| 191 | Ga0075433_10013146 | 3300006852 | Bacteria | 6719 |
| 192 | Ga0075434_100020592 | 3300006871 | Bacteria | 6400 |
| 193 | Ga0075434_100184858 | 3300006871 | Bacteria | 2105 |
| 194 | Ga0075429_100065325 | 3300006880 | Bacteria | 3167 |
| 195 | Ga0075429_100078638 | 3300006880 | Unclassified | 2875 |
| 196 | Ga0068865_100029412 | 3300006881 | Bacteria | 3645 |
| 197 | Ga0068865_100077123 | 3300006881 | Bacteria | 2380 |
| 198 | Ga0068865_100277603 | 3300006881 | Unclassified | 1333 |
| 199 | Ga0097620_100005273 | 3300006931 | Bacteria | 13141 |
| 200 | Ga0097620_100005827 | 3300006931 | Bacteria | 12511 |
| 201 | Ga0097620_100059209 | 3300006931 | Bacteria | 3859 |
| 202 | Ga0097620_100150806 | 3300006931 | Bacteria | 2400 |
| 203 | Ga0097620_100196951 | 3300006931 | Bacteria | 2099 |
| 204 | Ga0097620_100455688 | 3300006931 | Unclassified | 1375 |
| 205 | Ga0105240_10000070 | 3300009093 | Bacteria | 204666 |
| 206 | Ga0105240_10001027 | 3300009093 | Bacteria | 49580 |
| 207 | Ga0105240_10001247 | 3300009093 | Bacteria | 44160 |
| 208 | Ga0105240_10049930 | 3300009093 | Bacteria | 5277 |
| 209 | Ga0105240_10060269 | 3300009093 | Bacteria | 4731 |
| 210 | Ga0105240_10067231 | 3300009093 | Bacteria | 4442 |
| 211 | Ga0105240_10069634 | 3300009093 | Bacteria | 4354 |
| 212 | Ga0105240_10148641 | 3300009093 | Bacteria | 2792 |
| 213 | Ga0111539_10000718 | 3300009094 | Bacteria | 43055 |
| 214 | Ga0111539_10027884 | 3300009094 | Bacteria | 6896 |
| 215 | Ga0111539_10055409 | 3300009094 | Bacteria | 4713 |
| 216 | Ga0111539_10082199 | 3300009094 | Bacteria | 3788 |
| 217 | Ga0111539_10176709 | 3300009094 | Bacteria | 2494 |
| 218 | Ga0111539_10193724 | 3300009094 | Bacteria | 2371 |
| 219 | Ga0111539_10246906 | 3300009094 | Bacteria | 2078 |
| 220 | Ga0105245_10094876 | 3300009098 | Bacteria | 2751 |
| 221 | Ga0105245_10152535 | 3300009098 | Bacteria | 2186 |
| 222 | Ga0105247_10151208 | 3300009101 | Bacteria | 1530 |
| 223 | Ga0114129_10017840 | 3300009147 | Bacteria | 10107 |
| 224 | Ga0114129_10027379 | 3300009147 | Bacteria | 8071 |
| 225 | Ga0114129_10027783 | 3300009147 | Bacteria | 8011 |
| 226 | Ga0114129_10075528 | 3300009147 | Bacteria | 4692 |
| 227 | Ga0114129_10152937 | 3300009147 | Bacteria | 3157 |
| 228 | Ga0114129_10295938 | 3300009147 | Bacteria | 2159 |
| 229 | Ga0114129_10330056 | 3300009147 | Bacteria | 2026 |
| 230 | Ga0114129_10451261 | 3300009147 | Bacteria | 1686 |
| 231 | Ga0105243_10015246 | 3300009148 | Bacteria | 5815 |
| 232 | Ga0105241_10071173 | 3300009174 | Bacteria | 2699 |
| 233 | Ga0105241_10282633 | 3300009174 | Bacteria | 1418 |
| 234 | Ga0105242_10029841 | 3300009176 | Bacteria | 4352 |
| 235 | Ga0105242_10073346 | 3300009176 | Bacteria | 2845 |
| 236 | Ga0105242_10086771 | 3300009176 | Bacteria | 2627 |
| 237 | Ga0105242_10102790 | 3300009176 | Bacteria | 2423 |
| 238 | Ga0105248_10000006 | 3300009177 | Bacteria | 595060 |
| 239 | Ga0105248_10002333 | 3300009177 | Bacteria | 21050 |
| 240 | Ga0105248_10019873 | 3300009177 | Bacteria | 7439 |
| 241 | Ga0105248_10027925 | 3300009177 | Bacteria | 6283 |
| 242 | Ga0105248_10037941 | 3300009177 | Bacteria | 5390 |
| 243 | Ga0105248_10045257 | 3300009177 | Bacteria | 4935 |
| 244 | Ga0105248_10196554 | 3300009177 | Bacteria | 2272 |
| 245 | Ga0105248_10378119 | 3300009177 | Bacteria | 1594 |
| 246 | Ga0105248_10408245 | 3300009177 | Bacteria | 1529 |
| 247 | Ga0105237_10003800 | 3300009545 | Bacteria | 17746 |
| 248 | Ga0105237_10037392 | 3300009545 | Bacteria | 4907 |
| 249 | Ga0105237_10052420 | 3300009545 | Bacteria | 4095 |
| 250 | Ga0105237_10262061 | 3300009545 | Bacteria | 1731 |
| 251 | Ga0105237_10434416 | 3300009545 | Bacteria | 1318 |
| 252 | Ga0105238_10124476 | 3300009551 | Bacteria | 2557 |
| 253 | Ga0105249_10038757 | 3300009553 | Bacteria | 4324 |
| 254 | Ga0105249_10278689 | 3300009553 | Bacteria | 1669 |
| 255 | Ga0105239_10015044 | 3300010375 | Bacteria | 8577 |
| 256 | Ga0105239_10023560 | 3300010375 | Bacteria | 6780 |
| 257 | Ga0105239_10033071 | 3300010375 | Bacteria | 5680 |
| 258 | Ga0105239_10070244 | 3300010375 | Unclassified | 3846 |
| 259 | Ga0105239_10136995 | 3300010375 | Bacteria | 2726 |
| 260 | Ga0105239_10154868 | 3300010375 | Bacteria | 2559 |
| 261 | Ga0105239_10191319 | 3300010375 | Bacteria | 2290 |
| 262 | Ga0105239_10436691 | 3300010375 | Bacteria | 1484 |
| 263 | Ga0105246_10059364 | 3300011119 | Bacteria | 2653 |
| 264 | Ga0105246_10067674 | 3300011119 | Bacteria | 2503 |
| 265 | Ga0157373_10143924 | 3300013100 | Bacteria | 1676 |
| 266 | Ga0157371_10021140 | 3300013102 | Bacteria | 4781 |
| 267 | Ga0157371_10097711 | 3300013102 | Bacteria | 2082 |
| 268 | Ga0157370_10008478 | 3300013104 | Bacteria | 11089 |
| 269 | Ga0157370_10015889 | 3300013104 | Bacteria | 7638 |
| 270 | Ga0157370_10029360 | 3300013104 | Bacteria | 5397 |
| 271 | Ga0157370_10049962 | 3300013104 | Bacteria | 3999 |
| 272 | Ga0157369_10000761 | 3300013105 | Bacteria | 41595 |
| 273 | Ga0157369_10006935 | 3300013105 | Bacteria | 13072 |
| 274 | Ga0157369_10019836 | 3300013105 | Bacteria | 7523 |
| 275 | Ga0157369_10028083 | 3300013105 | Bacteria | 6230 |
| 276 | Ga0157369_10032575 | 3300013105 | Bacteria | 5731 |
| 277 | Ga0157369_10047133 | 3300013105 | Bacteria | 4682 |
| 278 | Ga0157369_10082376 | 3300013105 | Bacteria | 3442 |
| 279 | Ga0157369_10103316 | 3300013105 | Bacteria | 3036 |
| 280 | Ga0157369_10132325 | 3300013105 | Bacteria | 2642 |
| 281 | Ga0157369_10257927 | 3300013105 | Bacteria | 1819 |
| 282 | Ga0157369_10489170 | 3300013105 | Bacteria | 1273 |
| 283 | Ga0157374_10006256 | 3300013296 | Bacteria | 10096 |
| 284 | Ga0157374_10017060 | 3300013296 | Bacteria | 6392 |
| 285 | Ga0157374_10216463 | 3300013296 | Bacteria | 1879 |
| 286 | Ga0157374_10228291 | 3300013296 | Bacteria | 1828 |
| 287 | Ga0157378_10000186 | 3300013297 | Bacteria | 59580 |
| 288 | Ga0157378_10043353 | 3300013297 | Bacteria | 3995 |
| 289 | Ga0157378_10051792 | 3300013297 | Bacteria | 3652 |
| 290 | Ga0157378_10115255 | 3300013297 | Bacteria | 2469 |
| 291 | Ga0163162_10006096 | 3300013306 | Bacteria | 11672 |
| 292 | Ga0163162_10068710 | 3300013306 | Bacteria | 3595 |
| 293 | Ga0163162_10077440 | 3300013306 | Bacteria | 3389 |
| 294 | Ga0157372_10000267 | 3300013307 | Bacteria | 57578 |
| 295 | Ga0157372_10037643 | 3300013307 | Bacteria | 5337 |
| 296 | Ga0157372_10118638 | 3300013307 | Unclassified | 3036 |
| 297 | Ga0157372_10194905 | 3300013307 | Bacteria | 2347 |
| 298 | Ga0157372_10217297 | 3300013307 | Bacteria | 2215 |
| 299 | Ga0157372_10226119 | 3300013307 | Bacteria | 2169 |
| 300 | Ga0157372_10589504 | 3300013307 | Unclassified | 1296 |
| 301 | Ga0157375_10000006 | 3300013308 | Bacteria | 384086 |
| 302 | Ga0157375_10049425 | 3300013308 | Bacteria | 4121 |
| 303 | Ga0163163_10000114 | 3300014325 | Bacteria | 86190 |
| 304 | Ga0163163_10027947 | 3300014325 | Bacteria | 5410 |
| 305 | Ga0163163_10150403 | 3300014325 | Unclassified | 2372 |
| 306 | Ga0163163_10180857 | 3300014325 | Bacteria | 2156 |
| 307 | Ga0163163_10310261 | 3300014325 | Bacteria | 1630 |
| 308 | Ga0163163_10322504 | 3300014325 | Bacteria | 1598 |
| 309 | Ga0157377_10031080 | 3300014745 | Bacteria | 2899 |
| 310 | Ga0157379_10069441 | 3300014968 | Bacteria | 3151 |
| 311 | Ga0157376_10004315 | 3300014969 | Bacteria | 9879 |
| 312 | Ga0157376_10012850 | 3300014969 | Bacteria | 6228 |
| 313 | Ga0157376_10123486 | 3300014969 | Bacteria | 2299 |
| 314 | Ga0157376_10206763 | 3300014969 | Bacteria | 1810 |
| 315 | Ga0213874_10004343 | 3300021377 | Unclassified | 3225 |
| 316 | Ga0213876_10007028 | 3300021384 | Bacteria | 6135 |
| 317 | Ga0213876_10023174 | 3300021384 | Bacteria | 3280 |
| 318 | Ga0213875_10000004 | 3300021388 | Bacteria | 703388 |
| 319 | Ga0213875_10000010 | 3300021388 | Bacteria | 370268 |
| 320 | Ga0209676_1000334 | 3300025292 | Bacteria | 90392 |
| 321 | Ga0207697_10022579 | 3300025315 | Bacteria | 2577 |
| 322 | Ga0207653_10008387 | 3300025885 | Bacteria | 3219 |
| 323 | Ga0207680_10009744 | 3300025903 | Bacteria | 4779 |
| 324 | Ga0207647_10005165 | 3300025904 | Bacteria | 9600 |
| 325 | Ga0207647_10013713 | 3300025904 | Bacteria | 5612 |
| 326 | Ga0207647_10056866 | 3300025904 | Unclassified | 2399 |
| 327 | Ga0207699_10128200 | 3300025906 | Bacteria | 1651 |
| 328 | Ga0207645_10007779 | 3300025907 | Bacteria | 7544 |
| 329 | Ga0207645_10075425 | 3300025907 | Bacteria | 2159 |
| 330 | Ga0207705_10001870 | 3300025909 | Bacteria | 16522 |
| 331 | Ga0207705_10001971 | 3300025909 | Bacteria | 15987 |
| 332 | Ga0207705_10011962 | 3300025909 | Archaea | 6271 |
| 333 | Ga0207684_10012510 | 3300025910 | Bacteria | 7378 |
| 334 | Ga0207654_10025474 | 3300025911 | Bacteria | 3191 |
| 335 | Ga0207707_10003273 | 3300025912 | Bacteria | 14387 |
| 336 | Ga0207707_10081111 | 3300025912 | Bacteria | 2832 |
| 337 | Ga0207695_10000155 | 3300025913 | Bacteria | 204627 |
| 338 | Ga0207695_10034371 | 3300025913 | Bacteria | 5514 |
| 339 | Ga0207695_10034843 | 3300025913 | Bacteria | 5468 |
| 340 | Ga0207671_10031032 | 3300025914 | Unclassified | 3984 |
| 341 | Ga0207671_10036179 | 3300025914 | Bacteria | 3660 |
| 342 | Ga0207663_10141507 | 3300025916 | Unclassified | 1677 |
| 343 | Ga0207662_10003096 | 3300025918 | Bacteria | 8495 |
| 344 | Ga0207657_10001250 | 3300025919 | Bacteria | 27173 |
| 345 | Ga0207657_10155743 | 3300025919 | Unclassified | 1858 |
| 346 | Ga0207657_10171558 | 3300025919 | Bacteria | 1757 |
| 347 | Ga0207652_10131929 | 3300025921 | Bacteria | 2229 |
| 348 | Ga0207646_10007340 | 3300025922 | Bacteria | 11226 |
| 349 | Ga0207681_10152080 | 3300025923 | Bacteria | 1735 |
| 350 | Ga0207694_10208881 | 3300025924 | Bacteria | 1590 |
| 351 | Ga0207694_10279898 | 3300025924 | Bacteria | 1370 |
| 352 | Ga0207650_10040838 | 3300025925 | Bacteria | 3397 |
| 353 | Ga0207659_10073194 | 3300025926 | Bacteria | 2508 |
| 354 | Ga0207687_10075483 | 3300025927 | Bacteria | 2419 |
| 355 | Ga0207700_10114066 | 3300025928 | Bacteria | 2180 |
| 356 | Ga0207644_10057636 | 3300025931 | Bacteria | 2805 |
| 357 | Ga0207644_10065084 | 3300025931 | Bacteria | 2650 |
| 358 | Ga0207706_10002082 | 3300025933 | Bacteria | 19571 |
| 359 | Ga0207706_10050397 | 3300025933 | Bacteria | 3679 |
| 360 | Ga0207686_10080076 | 3300025934 | Bacteria | 2129 |
| 361 | Ga0207670_10006169 | 3300025936 | Bacteria | 6631 |
| 362 | Ga0207670_10037664 | 3300025936 | Bacteria | 3153 |
| 363 | Ga0207670_10069417 | 3300025936 | Bacteria | 2431 |
| 364 | Ga0207670_10087719 | 3300025936 | Unclassified | 2192 |
| 365 | Ga0207669_10015523 | 3300025937 | Bacteria | 3843 |
| 366 | Ga0207669_10084472 | 3300025937 | Bacteria | 2046 |
| 367 | Ga0207704_10090030 | 3300025938 | Bacteria | 2012 |
| 368 | Ga0207704_10216287 | 3300025938 | Unclassified | 1414 |
| 369 | Ga0207665_10002112 | 3300025939 | Bacteria | 13438 |
| 370 | Ga0207691_10004168 | 3300025940 | Bacteria | 14051 |
| 371 | Ga0207691_10005074 | 3300025940 | Bacteria | 12709 |
| 372 | Ga0207691_10042260 | 3300025940 | Bacteria | 4203 |
| 373 | Ga0207691_10076821 | 3300025940 | Bacteria | 3009 |
| 374 | Ga0207711_10000007 | 3300025941 | Bacteria | 759410 |
| 375 | Ga0207711_10029512 | 3300025941 | Bacteria | 4627 |
| 376 | Ga0207711_10037970 | 3300025941 | Bacteria | 4094 |
| 377 | Ga0207711_10042834 | 3300025941 | Bacteria | 3858 |
| 378 | Ga0207711_10074610 | 3300025941 | Bacteria | 2950 |
| 379 | Ga0207661_10000028 | 3300025944 | Bacteria | 173347 |
| 380 | Ga0207661_10021488 | 3300025944 | Bacteria | 4835 |
| 381 | Ga0207661_10285941 | 3300025944 | Bacteria | 1475 |
| 382 | Ga0207667_10003111 | 3300025949 | Bacteria | 20535 |
| 383 | Ga0207667_10003396 | 3300025949 | Bacteria | 19648 |
| 384 | Ga0207667_10006749 | 3300025949 | Bacteria | 13854 |
| 385 | Ga0207667_10032734 | 3300025949 | Bacteria | 5597 |
| 386 | Ga0207667_10269767 | 3300025949 | Bacteria | 1740 |
| 387 | Ga0207640_10009712 | 3300025981 | Bacteria | 5393 |
| 388 | Ga0207658_10049402 | 3300025986 | Bacteria | 3091 |
| 389 | Ga0207677_10089427 | 3300026023 | Bacteria | 2235 |
| 390 | Ga0207703_10008377 | 3300026035 | Bacteria | 8174 |
| 391 | Ga0207703_10014241 | 3300026035 | Bacteria | 6203 |
| 392 | Ga0207703_10021959 | 3300026035 | Bacteria | 4998 |
| 393 | Ga0207703_10127776 | 3300026035 | Bacteria | 2191 |
| 394 | Ga0207703_10323425 | 3300026035 | Bacteria | 1413 |
| 395 | Ga0207639_10038164 | 3300026041 | Bacteria | 3571 |
| 396 | Ga0207639_10167809 | 3300026041 | Bacteria | 1856 |
| 397 | Ga0207678_10001220 | 3300026067 | Bacteria | 23642 |
| 398 | Ga0207678_10018316 | 3300026067 | Bacteria | 6150 |
| 399 | Ga0207678_10025932 | 3300026067 | Bacteria | 5115 |
| 400 | Ga0207678_10033266 | 3300026067 | Bacteria | 4493 |
| 401 | Ga0207678_10079776 | 3300026067 | Unclassified | 2802 |
| 402 | Ga0207678_10123512 | 3300026067 | Bacteria | 2209 |
| 403 | Ga0207678_10197628 | 3300026067 | Bacteria | 1719 |
| 404 | Ga0207708_10012693 | 3300026075 | Bacteria | 6282 |
| 405 | Ga0207702_10003888 | 3300026078 | Bacteria | 13453 |
| 406 | Ga0207702_10081912 | 3300026078 | Bacteria | 2804 |
| 407 | Ga0207702_10090239 | 3300026078 | Unclassified | 2681 |
| 408 | Ga0207702_10122783 | 3300026078 | Bacteria | 2327 |
| 409 | Ga0207641_10014293 | 3300026088 | Bacteria | 6505 |
| 410 | Ga0207641_10020857 | 3300026088 | Bacteria | 5386 |
| 411 | Ga0207641_10099278 | 3300026088 | Unclassified | 2561 |
| 412 | Ga0207641_10131705 | 3300026088 | Bacteria | 2246 |
| 413 | Ga0207648_10002638 | 3300026089 | Bacteria | 19159 |
| 414 | Ga0207648_10018655 | 3300026089 | Bacteria | 6278 |
| 415 | Ga0207676_10060944 | 3300026095 | Bacteria | 2986 |
| 416 | Ga0207674_10010954 | 3300026116 | Bacteria | 10206 |
| 417 | Ga0207674_10013089 | 3300026116 | Bacteria | 9234 |
| 418 | Ga0207674_10015676 | 3300026116 | Bacteria | 8320 |
| 419 | Ga0207674_10020810 | 3300026116 | Bacteria | 7080 |
| 420 | Ga0207674_10131474 | 3300026116 | Bacteria | 2466 |
| 421 | Ga0207675_100005876 | 3300026118 | Bacteria | 11709 |
| 422 | Ga0207683_10051115 | 3300026121 | Bacteria | 3621 |
| 423 | Ga0207683_10170617 | 3300026121 | Bacteria | 1970 |
| 424 | Ga0207683_10253599 | 3300026121 | Bacteria | 1606 |
| 425 | Ga0209813_10005301 | 3300027866 | Bacteria | 3121 |
| 426 | Ga0207428_10000076 | 3300027907 | Bacteria | 137126 |
| 427 | Ga0207428_10002419 | 3300027907 | Bacteria | 18628 |
| 428 | Ga0268266_10004840 | 3300028379 | Bacteria | 12786 |
| 429 | Ga0268266_10083577 | 3300028379 | Unclassified | 2787 |
| 430 | Ga0268265_10108697 | 3300028380 | Bacteria | 2258 |
| 431 | Ga0268264_10015477 | 3300028381 | Bacteria | 6253 |
| 432 | Ga0268264_10026906 | 3300028381 | Bacteria | 4698 |
| 433 | Ga0268264_10039520 | 3300028381 | Bacteria | 3898 |
| 434 | Ga0307515_10001558 | 3300028794 | Bacteria | 51155 |
| 435 | Ga0307515_10001965 | 3300028794 | Bacteria | 45521 |
| 436 | Ga0307515_10081018 | 3300028794 | Bacteria | 4223 |
| 437 | Ga0265338_10140036 | 3300028800 | Bacteria | 1896 |
| 438 | Ga0265338_10228017 | 3300028800 | Unclassified | 1387 |
| 439 | Ga0265339_10000003 | 3300031249 | Bacteria | 305994 |
| 440 | Ga0265339_10000414 | 3300031249 | Bacteria | 33687 |
| 441 | Ga0265331_10047387 | 3300031250 | Bacteria | 2068 |
| 442 | Ga0265327_10000864 | 3300031251 | Bacteria | 44992 |
| 443 | Ga0265327_10009571 | 3300031251 | Bacteria | 6966 |
| 444 | Ga0265316_10005470 | 3300031344 | Bacteria | 12328 |
| 445 | Ga0265313_10004999 | 3300031595 | Bacteria | 9919 |
| 446 | Ga0265313_10008773 | 3300031595 | Bacteria | 6670 |
| 447 | Ga0316579_10052262 | 3300031691 | Unclassified | 1913 |
| 448 | Ga0265314_10009686 | 3300031711 | Bacteria | 8107 |
| 449 | Ga0316578_10016988 | 3300031728 | Bacteria | 3951 |
| 450 | Ga0316577_10040972 | 3300031733 | Unclassified | 2590 |
| 451 | Ga0373953_0006737 | 3300035117 | Bacteria | 3805 |
| 452 | Ga0373955_0034108 | 3300035172 | Bacteria | 2685 |
| 453 | Ga0373955_0133965 | 3300035172 | Bacteria | 1448 |
| 454 | Ga0316574_0012187 | 3300035398 | Bacteria | 4913 |
| 455 | Ga0373947_0228641 | 3300035725 | Bacteria | 1225 |
| 456 | Ga0373937_0073054 | 3300036401 | Bacteria | 3164 |
| 457 | Ga0395905_0051753 | 3300037471 | Bacteria | 3847 |
| 458 | Ga0395905_0065349 | 3300037471 | Unclassified | 3406 |
| 459 | Ga0436364_0287993 | 3300037853 | Bacteria | 1390 |
| 460 | Ga0436364_0748068 | 3300037853 | Bacteria | 528910 |
| 461 | Ga0436364_1102173 | 3300037853 | Bacteria | 2511 |
| 462 | Ga0436364_1118947 | 3300037853 | Bacteria | 12844 |
| 463 | Ga0436364_1328097 | 3300037853 | Bacteria | 6210 |
| 464 | Ga0436364_1380174 | 3300037853 | Bacteria | 3115 |
| 465 | Ga0436364_1448179 | 3300037853 | Bacteria | 40988 |
| 466 | Ga0436365_0025297 | 3300039437 | Bacteria | 5515 |
| 467 | Ga0436365_0874592 | 3300039437 | Bacteria | 5211 |
| 468 | Ga0436365_0940540 | 3300039437 | Unclassified | 3813 |
| 469 | Ga0436360_1260787 | 3300039438 | Bacteria | 13404 |
| 470 | Ga0436361_0212501 | 3300039447 | Bacteria | 5939 |
| 471 | Ga0436361_0970042 | 3300039447 | Bacteria | 24944 |
| 472 | Ga0436363_0466760 | 3300039450 | Unclassified | 3118 |
| 473 | Ga0436363_0655318 | 3300039450 | Bacteria | 5952 |
| 474 | Ga0436363_1493048 | 3300039450 | Unclassified | 1230 |
| 475 | Ga0436362_0081182 | 3300039453 | Bacteria | 4786 |
| 476 | Ga0450920_005319 | 3300042122 | Bacteria | 2283 |
| 477 | Ga0450894_005481 | 3300042131 | Bacteria | 1642 |
| 478 | Ga0451577_0000415 | 3300042876 | Bacteria | 77375 |
| 479 | Ga0451577_0047666 | 3300042876 | Bacteria | 3831 |
| 480 | Ga0466969_0049277 | 3300044656 | Bacteria | 2079 |
| 481 | Ga0466963_0178111 | 3300044694 | Unclassified | 1484 |
| 482 | Ga0453684_0012862 | 3300044712 | Bacteria | 13711 |
| 483 | Ga0453684_0018147 | 3300044712 | Bacteria | 10830 |
| 484 | Ga0453684_0032195 | 3300044712 | Bacteria | 7347 |
| 485 | Ga0451576_0061865 | 3300045051 | Bacteria | 3904 |
| 486 | Ga0451576_0126855 | 3300045051 | Bacteria | 2659 |
| 487 | Ga0451576_0134030 | 3300045051 | Bacteria | 2583 |
| 488 | Ga0451576_0181875 | 3300045051 | Bacteria | 2195 |
| 489 | Ga0451576_0354290 | 3300045051 | Bacteria | 1537 |
| 490 | Ga0466967_0042628 | 3300045976 | Unclassified | 3923 |
| 491 | Ga0495603_0018137 | 3300046455 | Bacteria | 4257 |
| 492 | Ga0495629_0007685 | 3300046459 | Bacteria | 7931 |
| 493 | Ga0495629_0007912 | 3300046459 | Bacteria | 7821 |
| 494 | Ga0495629_0040130 | 3300046459 | Bacteria | 3293 |
| 495 | Ga0495629_0127382 | 3300046459 | Bacteria | 1774 |
| 496 | Ga0495651_0024335 | 3300046462 | Bacteria | 4712 |
| 497 | Ga0495651_0038727 | 3300046462 | Bacteria | 3712 |
| 498 | Ga0495650_0000010 | 3300046471 | Bacteria | 645599 |
| 499 | Ga0495650_0001937 | 3300046471 | Bacteria | 18300 |
| 500 | Ga0495580_0019306 | 3300046472 | Bacteria | 5065 |
| 501 | Ga0495580_0044131 | 3300046472 | Bacteria | 3172 |
| 502 | Ga0495580_0060554 | 3300046472 | Bacteria | 2659 |
| 503 | Ga0495580_0150849 | 3300046472 | Bacteria | 1610 |
| 504 | Ga0495582_0001434 | 3300046473 | Bacteria | 13440 |
| 505 | Ga0495582_0015257 | 3300046473 | Unclassified | 4223 |
| 506 | Ga0495639_0012708 | 3300046475 | Bacteria | 3631 |
| 507 | Ga0495639_0058652 | 3300046475 | Unclassified | 1761 |
| 508 | Ga0495662_0009845 | 3300046476 | Bacteria | 4695 |
| 509 | Ga0495662_0019464 | 3300046476 | Bacteria | 3283 |
| 510 | Ga0495662_0033886 | 3300046476 | Bacteria | 2467 |
| 511 | Ga0495664_0003914 | 3300046477 | Bacteria | 8124 |
| 512 | Ga0495664_0004826 | 3300046477 | Bacteria | 7371 |
| 513 | Ga0495664_0049269 | 3300046477 | Bacteria | 2501 |
| 514 | Ga0495585_0050865 | 3300046492 | Bacteria | 2297 |
| 515 | Ga0495594_0000839 | 3300046499 | Bacteria | 15860 |
| 516 | Ga0495594_0004163 | 3300046499 | Bacteria | 7431 |
| 517 | Ga0495594_0010970 | 3300046499 | Unclassified | 4704 |
| 518 | Ga0495596_0023221 | 3300046500 | Bacteria | 2518 |
| 519 | Ga0495583_0039052 | 3300046506 | Bacteria | 2239 |
| 520 | Ga0495608_0138734 | 3300046511 | Bacteria | 1552 |
| 521 | Ga0495628_0022923 | 3300046516 | Bacteria | 5125 |
| 522 | Ga0495628_0026914 | 3300046516 | Bacteria | 4682 |
| 523 | Ga0495628_0173664 | 3300046516 | Bacteria | 1633 |
| 524 | Ga0495630_0000067 | 3300046517 | Bacteria | 84296 |
| 525 | Ga0495630_0001523 | 3300046517 | Bacteria | 16055 |
| 526 | Ga0495630_0002241 | 3300046517 | Bacteria | 13459 |
| 527 | Ga0495630_0100265 | 3300046517 | Bacteria | 2191 |
| 528 | Ga0495644_0000099 | 3300046523 | Bacteria | 42055 |
| 529 | Ga0495644_0006967 | 3300046523 | Bacteria | 4375 |
| 530 | Ga0495648_0009612 | 3300046524 | Bacteria | 7463 |
| 531 | Ga0495666_0001694 | 3300046526 | Bacteria | 10891 |
| 532 | Ga0495666_0005855 | 3300046526 | Bacteria | 6193 |
| 533 | Ga0495666_0008272 | 3300046526 | Bacteria | 5213 |
| 534 | Ga0495666_0014471 | 3300046526 | Unclassified | 3929 |
| 535 | Ga0495642_0042291 | 3300046528 | Bacteria | 1856 |
| 536 | Ga0495652_0017097 | 3300046529 | Bacteria | 6476 |
| 537 | Ga0495652_0026023 | 3300046529 | Bacteria | 5171 |
| 538 | Ga0495654_0049651 | 3300046530 | Bacteria | 2054 |
| 539 | Ga0495665_0000838 | 3300046531 | Bacteria | 16077 |
| 540 | Ga0495665_0022464 | 3300046531 | Bacteria | 3392 |
| 541 | Ga0495665_0034260 | 3300046531 | Unclassified | 2715 |
| 542 | Ga0495640_0010837 | 3300046533 | Bacteria | 7033 |
| 543 | Ga0495640_0049488 | 3300046533 | Bacteria | 2898 |
| 544 | Ga0495640_0102934 | 3300046533 | Unclassified | 1873 |
| 545 | Ga0495640_0143606 | 3300046533 | Bacteria | 1537 |
| 546 | Ga0495586_0000028 | 3300046535 | Bacteria | 97992 |
| 547 | Ga0495586_0002759 | 3300046535 | Bacteria | 9494 |
| 548 | Ga0495586_0022539 | 3300046535 | Unclassified | 3361 |
| 549 | Ga0495609_0015332 | 3300046538 | Bacteria | 3589 |
| 550 | Ga0495609_0021625 | 3300046538 | Bacteria | 2968 |
| 551 | Ga0495609_0036528 | 3300046538 | Bacteria | 2218 |
| 552 | Ga0495621_0025977 | 3300046539 | Bacteria | 1972 |
| 553 | Ga0495645_0017124 | 3300046543 | Bacteria | 5191 |
| 554 | Ga0495645_0021405 | 3300046543 | Bacteria | 4674 |
| 555 | Ga0495645_0024032 | 3300046543 | Bacteria | 4418 |
| 556 | Ga0495645_0045790 | 3300046543 | Unclassified | 3192 |
| 557 | Ga0495645_0068677 | 3300046543 | Unclassified | 2558 |
| 558 | Ga0495622_0050982 | 3300046557 | Bacteria | 1920 |
| 559 | Ga0495633_0000012 | 3300046558 | Bacteria | 267875 |
| 560 | Ga0495633_0021756 | 3300046558 | Bacteria | 3203 |
| 561 | Ga0495667_0025101 | 3300046559 | Bacteria | 4018 |
| 562 | Ga0495667_0135900 | 3300046559 | Bacteria | 1585 |
| 563 | Ga0495668_0000055 | 3300046616 | Bacteria | 199412 |
| 564 | Ga0495668_0012615 | 3300046616 | Bacteria | 5009 |
| 565 | Ga0495634_0002918 | 3300046642 | Bacteria | 13996 |
| 566 | Ga0495634_0032974 | 3300046642 | Bacteria | 3560 |
| 567 | Ga0495625_0001326 | 3300046660 | Bacteria | 30769 |
| 568 | Ga0495625_0002936 | 3300046660 | Bacteria | 17782 |
| 569 | Ga0495625_0006996 | 3300046660 | Bacteria | 9940 |
| 570 | Ga0495625_0029436 | 3300046660 | Bacteria | 4107 |
| 571 | Ga0495625_0038125 | 3300046660 | Bacteria | 3520 |
| 572 | Ga0495599_0033278 | 3300046678 | Bacteria | 3239 |
| 573 | Ga0495599_0036295 | 3300046678 | Bacteria | 3095 |
| 574 | Ga0495623_0063390 | 3300046679 | Bacteria | 2314 |
| 575 | Ga0495623_0092199 | 3300046679 | Bacteria | 1857 |
| 576 | Ga0495646_0054553 | 3300046680 | Bacteria | 2403 |
| 577 | Ga0495647_0005977 | 3300046681 | Bacteria | 4011 |
| 578 | Ga0495669_0023720 | 3300046684 | Bacteria | 2672 |
| 579 | Ga0495613_0003192 | 3300046689 | Bacteria | 12271 |
| 580 | Ga0495613_0011918 | 3300046689 | Bacteria | 6462 |
| 581 | Ga0495613_0072422 | 3300046689 | Bacteria | 2512 |
| 582 | Ga0495624_0031455 | 3300046690 | Bacteria | 3450 |
| 583 | Ga0495670_0036058 | 3300046691 | Bacteria | 2464 |
| 584 | Ga0495671_0047542 | 3300046692 | Bacteria | 2144 |
| 585 | Ga0495649_0036704 | 3300046694 | Bacteria | 2692 |
| 586 | Ga0495649_0039627 | 3300046694 | Bacteria | 2583 |
| 587 | Ga0495600_0006321 | 3300046809 | Bacteria | 7200 |
| 588 | Ga0495581_0035002 | 3300047315 | Bacteria | 2906 |
| 589 | Ga0495581_0038449 | 3300047315 | Unclassified | 2769 |
| 590 | Ga0495581_0051332 | 3300047315 | Bacteria | 2381 |
| 591 | Ga0495604_0124166 | 3300047317 | Bacteria | 1864 |
| 592 | Ga0495674_0019151 | 3300047319 | Bacteria | 6358 |
| 593 | Ga0495674_0019728 | 3300047319 | Bacteria | 6253 |
| 594 | Ga0495674_0032717 | 3300047319 | Bacteria | 4714 |
| 595 | Ga0495674_0035797 | 3300047319 | Bacteria | 4475 |
| 596 | Ga0495674_0036420 | 3300047319 | Unclassified | 4429 |
| 597 | Ga0495674_0061871 | 3300047319 | Bacteria | 3261 |
| 598 | Ga0495674_0119646 | 3300047319 | Bacteria | 2226 |
| 599 | Ga0495672_0001950 | 3300047320 | Bacteria | 19515 |
| 600 | Ga0495676_0014107 | 3300047321 | Bacteria | 7154 |
| 601 | Ga0495676_0031115 | 3300047321 | Bacteria | 4518 |
| 602 | Ga0495680_0157636 | 3300047322 | Bacteria | 1650 |
| 603 | Ga0495680_0233288 | 3300047322 | Unclassified | 1309 |
| 604 | Ga0495675_0001482 | 3300047444 | Bacteria | 14212 |
| 605 | Ga0495685_088423 | 3300047447 | Bacteria | 1028 |
| 606 | Ga0495681_0101411 | 3300047470 | Bacteria | 1258 |
| 607 | Ga0495684_0004226 | 3300047471 | Bacteria | 11213 |
| 608 | Ga0495684_0006245 | 3300047471 | Bacteria | 9261 |
| 609 | Ga0495684_0026964 | 3300047471 | Bacteria | 4414 |
| 610 | Ga0495684_0052750 | 3300047471 | Bacteria | 3103 |
| 611 | Ga0495684_0079863 | 3300047471 | Bacteria | 2483 |
| 612 | Ga0495684_0178910 | 3300047471 | Bacteria | 1573 |
| 613 | Ga0495684_0215508 | 3300047471 | Bacteria | 1410 |
| 614 | Ga0495686_0059577 | 3300047472 | Bacteria | 2376 |
| 615 | Ga0495593_0045755 | 3300047673 | Bacteria | 2334 |
| 616 | Ga0495593_0095862 | 3300047673 | Unclassified | 1525 |
| 617 | Ga0495602_0101452 | 3300048088 | Bacteria | 2360 |
| 618 | Ga0495614_0006837 | 3300048089 | Bacteria | 5102 |
| 619 | Ga0495614_0014429 | 3300048089 | Bacteria | 3458 |
| 620 | Ga0495614_0028650 | 3300048089 | Unclassified | 2398 |
| 621 | Ga0496102_0003059 | 3300048905 | Bacteria | 14166 |
| 622 | Ga0496102_0255617 | 3300048905 | Unclassified | 1652 |
| 623 | Ga0496103_0214332 | 3300048906 | Bacteria | 1238 |
| 624 | Ga0496104_0073278 | 3300048907 | Bacteria | 3258 |
| 625 | Ga0496106_0015026 | 3300048909 | Bacteria | 5730 |
| 626 | Ga0496106_0147543 | 3300048909 | Bacteria | 1854 |
| 627 | Ga0496108_0001958 | 3300048911 | Bacteria | 16495 |
| 628 | Ga0496109_0000107 | 3300048912 | Bacteria | 86168 |
| 629 | Ga0496109_0003299 | 3300048912 | Bacteria | 13474 |
| 630 | Ga0496110_0014310 | 3300048913 | Bacteria | 6583 |
| 631 | Ga0496111_0095199 | 3300048914 | Bacteria | 2185 |
| 632 | Ga0496112_0004412 | 3300048915 | Bacteria | 11909 |
| 633 | Ga0496112_0011557 | 3300048915 | Bacteria | 8067 |
| 634 | Ga0496112_0045411 | 3300048915 | Bacteria | 4307 |
| 635 | Ga0496112_0322746 | 3300048915 | Bacteria | 1488 |
| 636 | Ga0496115_0013376 | 3300048918 | Bacteria | 6207 |
| 637 | Ga0496115_0049678 | 3300048918 | Unclassified | 3358 |
| 638 | Ga0496115_0058603 | 3300048918 | Bacteria | 3099 |
| 639 | Ga0496120_0061358 | 3300048923 | Bacteria | 2099 |
| 640 | Ga0496126_0000091 | 3300048929 | Bacteria | 209427 |
| 641 | Ga0496126_0000458 | 3300048929 | Bacteria | 81208 |
| 642 | Ga0496126_0025286 | 3300048929 | Bacteria | 5716 |
| 643 | Ga0496126_0147431 | 3300048929 | Bacteria | 2020 |
| 644 | Ga0496126_0239271 | 3300048929 | Bacteria | 1517 |
| 645 | Ga0501031_0000903 | 3300049568 | Bacteria | 17865 |
| 646 | Ga0501032_0030421 | 3300049569 | Bacteria | 3705 |
| 647 | Ga0501034_0025321 | 3300049571 | Bacteria | 6040 |
| 648 | Ga0501034_0232255 | 3300049571 | Bacteria | 1793 |
| 649 | Ga0501034_0241501 | 3300049571 | Bacteria | 1752 |
| 650 | Ga0501036_0000193 | 3300049572 | Bacteria | 40533 |
| 651 | Ga0501036_0042608 | 3300049572 | Bacteria | 3843 |
| 652 | Ga0501037_0016447 | 3300049573 | Bacteria | 5445 |
| 653 | Ga0501039_0031667 | 3300049575 | Bacteria | 4078 |
| 654 | Ga0501043_0003157 | 3300049579 | Bacteria | 13633 |
| 655 | Ga0501043_0013453 | 3300049579 | Bacteria | 6400 |
| 656 | Ga0501043_0136723 | 3300049579 | Bacteria | 1919 |
| 657 | Ga0501046_0001054 | 3300049580 | Bacteria | 26975 |
| 658 | Ga0501046_0002330 | 3300049580 | Bacteria | 17903 |
| 659 | Ga0501046_0029127 | 3300049580 | Bacteria | 4492 |
| 660 | Ga0501046_0037649 | 3300049580 | Unclassified | 3887 |
| 661 | Ga0501046_0197739 | 3300049580 | Bacteria | 1497 |
| 662 | Ga0501047_0003896 | 3300049581 | Bacteria | 14027 |
| 663 | Ga0501047_0006499 | 3300049581 | Bacteria | 11003 |
| 664 | Ga0501047_0079430 | 3300049581 | Bacteria | 3154 |
| 665 | Ga0501047_0134510 | 3300049581 | Bacteria | 2352 |
| 666 | Ga0501068_0006974 | 3300049584 | Bacteria | 6248 |
| 667 | Ga0501069_0003963 | 3300049585 | Bacteria | 7636 |
| 668 | Ga0501070_0017655 | 3300049586 | Bacteria | 5989 |
| 669 | Ga0501070_0144123 | 3300049586 | Bacteria | 1966 |
| 670 | Ga0501070_0148025 | 3300049586 | Unclassified | 1938 |
| 671 | Ga0501072_0067008 | 3300049588 | Bacteria | 2832 |
| 672 | Ga0501073_0013675 | 3300049589 | Bacteria | 5904 |
| 673 | Ga0501073_0082471 | 3300049589 | Bacteria | 2237 |
| 674 | Ga0501076_0044919 | 3300049592 | Bacteria | 3486 |
| 675 | Ga0501077_0065671 | 3300049593 | Bacteria | 2301 |
| 676 | Ga0501225_0033920 | 3300049705 | Bacteria | 1405 |
| 677 | Ga0501079_0048872 | 3300049741 | Bacteria | 3265 |
| 678 | Ga0501079_0118675 | 3300049741 | Bacteria | 2056 |
| 679 | Ga0501080_0000281 | 3300049742 | Bacteria | 38399 |
| 680 | Ga0501080_0005620 | 3300049742 | Bacteria | 11204 |
| 681 | Ga0501080_0012697 | 3300049742 | Bacteria | 7725 |
| 682 | Ga0501080_0110965 | 3300049742 | Bacteria | 2542 |
| 683 | Ga0501081_0096913 | 3300049743 | Bacteria | 2081 |
| 684 | Ga0501083_0034456 | 3300049744 | Bacteria | 3461 |
| 685 | Ga0501035_0014070 | 3300049822 | Bacteria | 7382 |
| 686 | Ga0501035_0036014 | 3300049822 | Bacteria | 4488 |
| 687 | Ga0501035_0081642 | 3300049822 | Bacteria | 2853 |
| 688 | Ga0501044_0002894 | 3300049823 | Bacteria | 19548 |
| 689 | Ga0501044_0050456 | 3300049823 | Bacteria | 4293 |
| 690 | Ga0501044_0295637 | 3300049823 | Bacteria | 1550 |
| 691 | nmdc:mga00v17_53512_c1 | 3300050491 | Bacteria | 2460 |
| 692 | nmdc:mga0k408_615_c1 | 3300050493 | Bacteria | 15215 |
| 693 | nmdc:mga0k408_976_c1 | 3300050493 | Bacteria | 15718 |
| 694 | nmdc:mga06z11_1666_c1 | 3300050494 | Bacteria | 8322 |
| 695 | nmdc:mga04h51_6359_c1 | 3300050495 | Bacteria | 3059 |
| 696 | nmdc:mga05p37_115747_c1 | 3300050507 | Bacteria | 3295 |
| 697 | nmdc:mga05p37_189875_c1 | 3300050507 | Bacteria | 2495 |
| 698 | nmdc:mga05p37_26590_c1 | 3300050507 | Bacteria | 7037 |
| 699 | nmdc:mga05p37_402942_c1 | 3300050507 | Bacteria | 1597 |
| 700 | nmdc:mga09592_106924_c1 | 3300050508 | Bacteria | 2400 |
| 701 | nmdc:mga09592_196755_c1 | 3300050508 | Bacteria | 1745 |
| 702 | nmdc:mga09592_57850_c1 | 3300050508 | Bacteria | 3278 |
| 703 | nmdc:mga06r32_225268_c1 | 3300050510 | Bacteria | 1863 |
| 704 | nmdc:mga06r32_287047_c1 | 3300050510 | Bacteria | 1632 |
| 705 | nmdc:mga06r32_4439_c1 | 3300050510 | Bacteria | 12558 |
| 706 | nmdc:mga08y16_101843_c1 | 3300050511 | Bacteria | 2990 |
| 707 | nmdc:mga08y16_133821_c1 | 3300050511 | Bacteria | 2576 |
| 708 | nmdc:mga08y16_152600_c1 | 3300050511 | Bacteria | 2401 |
| 709 | nmdc:mga08y16_201774_c1 | 3300050511 | Unclassified | 2061 |
| 710 | nmdc:mga08y16_517_c1 | 3300050511 | Bacteria | 35666 |
| 711 | nmdc:mga0n895_176735_c1 | 3300050512 | Bacteria | 2166 |
| 712 | nmdc:mga0rr50_413644_c1 | 3300050513 | Bacteria | 1140 |
| 713 | nmdc:mga08x19_1552_c1 | 3300050514 | Bacteria | 14249 |
| 714 | nmdc:mga0a205_30924_c1 | 3300050515 | Bacteria | 5128 |
| 715 | nmdc:mga0a205_33746_c1 | 3300050515 | Bacteria | 4907 |
| 716 | nmdc:mga0a205_543_c1 | 3300050515 | Bacteria | 29800 |
| 717 | Ga0495601_0000415 | 3300053077 | Bacteria | 22311 |
| 718 | Ga0495601_0010610 | 3300053077 | Bacteria | 5490 |
| 719 | Ga0500643_011532 | 3300053087 | Bacteria | 3220 |
| 720 | Ga0500651_0000002 | 3300053093 | Bacteria | 476609 |
| 721 | Ga0500641_0010767 | 3300053096 | Bacteria | 3312 |
| 722 | Ga0500555_003786 | 3300053103 | Bacteria | 4305 |
| 723 | Ga0500555_018159 | 3300053103 | Bacteria | 2027 |
| 724 | Ga0500595_000023 | 3300053119 | Bacteria | 147097 |
| 725 | Ga0500595_015262 | 3300053119 | Bacteria | 2887 |
| 726 | Ga0500616_0000386 | 3300053153 | Bacteria | 61360 |
| 727 | Ga0500616_0002082 | 3300053153 | Bacteria | 17490 |
| 728 | Ga0500661_001376 | 3300055283 | Bacteria | 4536 |
| 729 | Ga0590071_001796 | 3300059421 | Bacteria | 5539 |
| 730 | Ga0590077_002947 | 3300059426 | Bacteria | 3565 |
| 731 | Ga0501082_0000708 | 3300060353 | Bacteria | 29299 |
| 732 | Ga0501082_0016770 | 3300060353 | Bacteria | 6307 |
| 733 | Ga0501082_0360747 | 3300060353 | Bacteria | 1267 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047447 | Ga0495685_088423 | Ga0495685_088423_45_1013 | 321 |
| 2 | 3300025924 | Ga0207694_10208881 | Ga0207694_102088814 | 325 |
| 3 | 3300048909 | Ga0496106_0015026 | Ga0496106_0015026_554_1561 | 330 |
| 4 | 3300003320 | rootH2_10000834 | rootH2_1000083418 | 337 |
| 5 | 3300048906 | Ga0496103_0214332 | Ga0496103_0214332_29_1051 | 339 |
| 6 | 3300005295 | Ga0065707_10109042 | Ga0065707_101090421 | 342 |
| 7 | 3300005354 | Ga0070675_100064238 | Ga0070675_1000642382 | 342 |
| 8 | 3300005466 | Ga0070685_10110813 | Ga0070685_101108132 | 342 |
| 9 | 3300005543 | Ga0070672_100377438 | Ga0070672_1003774382 | 342 |
| 10 | 3300025926 | Ga0207659_10073194 | Ga0207659_100731942 | 342 |
| 11 | 3300005546 | Ga0070696_100051017 | Ga0070696_1000510172 | 349 |
| 12 | 3300005549 | Ga0070704_100133138 | Ga0070704_1001331382 | 349 |
| 13 | 3300042876 | Ga0451577_0000415 | Ga0451577_0000415_33259_34485 | 349 |
| 14 | 3300044712 | Ga0453684_0018147 | Ga0453684_0018147_9191_10417 | 349 |
| 15 | 3300005290 | Ga0065712_10001332 | Ga0065712_100013324 | 353 |
| 16 | 3300005293 | Ga0065715_10000764 | Ga0065715_100007641 | 353 |
| 17 | 3300005331 | Ga0070670_100051222 | Ga0070670_1000512222 | 353 |
| 18 | 3300005338 | Ga0068868_100108522 | Ga0068868_1001085221 | 353 |
| 19 | 3300005347 | Ga0070668_100108577 | Ga0070668_1001085773 | 353 |
| 20 | 3300005353 | Ga0070669_100047310 | Ga0070669_1000473103 | 353 |
| 21 | 3300005354 | Ga0070675_100003042 | Ga0070675_1000030423 | 353 |
| 22 | 3300005364 | Ga0070673_100153081 | Ga0070673_1001530813 | 353 |
| 23 | 3300005365 | Ga0070688_100002565 | Ga0070688_1000025653 | 353 |
| 24 | 3300005459 | Ga0068867_100051771 | Ga0068867_1000517714 | 353 |
| 25 | 3300005466 | Ga0070685_10012600 | Ga0070685_100126004 | 353 |
| 26 | 3300005543 | Ga0070672_100022017 | Ga0070672_1000220174 | 353 |
| 27 | 3300005548 | Ga0070665_100008511 | Ga0070665_1000085114 | 353 |
| 28 | 3300005618 | Ga0068864_100013795 | Ga0068864_1000137953 | 353 |
| 29 | 3300005719 | Ga0068861_100045260 | Ga0068861_1000452605 | 353 |
| 30 | 3300005841 | Ga0068863_100020534 | Ga0068863_1000205345 | 353 |
| 31 | 3300006881 | Ga0068865_100277603 | Ga0068865_1002776032 | 353 |
| 32 | 3300009098 | Ga0105245_10094876 | Ga0105245_100948762 | 353 |
| 33 | 3300009176 | Ga0105242_10086771 | Ga0105242_100867713 | 353 |
| 34 | 3300009177 | Ga0105248_10002333 | Ga0105248_1000233315 | 353 |
| 35 | 3300009553 | Ga0105249_10038757 | Ga0105249_100387574 | 353 |
| 36 | 3300010375 | Ga0105239_10154868 | Ga0105239_101548682 | 353 |
| 37 | 3300011119 | Ga0105246_10067674 | Ga0105246_100676742 | 353 |
| 38 | 3300013306 | Ga0163162_10077440 | Ga0163162_100774403 | 353 |
| 39 | 3300014325 | Ga0163163_10027947 | Ga0163163_100279474 | 353 |
| 40 | 3300025292 | Ga0209676_1000334 | Ga0209676_100033465 | 353 |
| 41 | 3300025315 | Ga0207697_10022579 | Ga0207697_100225791 | 353 |
| 42 | 3300025925 | Ga0207650_10040838 | Ga0207650_100408382 | 353 |
| 43 | 3300025927 | Ga0207687_10075483 | Ga0207687_100754832 | 353 |
| 44 | 3300025938 | Ga0207704_10216287 | Ga0207704_102162871 | 353 |
| 45 | 3300025940 | Ga0207691_10076821 | Ga0207691_100768212 | 353 |
| 46 | 3300025941 | Ga0207711_10074610 | Ga0207711_100746103 | 353 |
| 47 | 3300026088 | Ga0207641_10020857 | Ga0207641_100208574 | 353 |
| 48 | 3300026089 | Ga0207648_10018655 | Ga0207648_100186552 | 353 |
| 49 | 3300026095 | Ga0207676_10060944 | Ga0207676_100609442 | 353 |
| 50 | 3300026121 | Ga0207683_10051115 | Ga0207683_100511153 | 353 |
| 51 | 3300048911 | Ga0496108_0001958 | Ga0496108_0001958_391_1500 | 353 |
| 52 | 3300048912 | Ga0496109_0003299 | Ga0496109_0003299_4395_5504 | 353 |
| 53 | 3300048913 | Ga0496110_0014310 | Ga0496110_0014310_5018_6127 | 353 |
| 54 | 3300048914 | Ga0496111_0095199 | Ga0496111_0095199_296_1405 | 353 |
| 55 | 3300048915 | Ga0496112_0004412 | Ga0496112_0004412_10738_11847 | 353 |
| 56 | 3300005563 | Ga0068855_100047054 | Ga0068855_1000470545 | 355 |
| 57 | 3300006237 | Ga0097621_100244937 | Ga0097621_1002449372 | 355 |
| 58 | 3300009174 | Ga0105241_10282633 | Ga0105241_102826332 | 355 |
| 59 | 3300013105 | Ga0157369_10006935 | Ga0157369_100069357 | 355 |
| 60 | 3300013296 | Ga0157374_10216463 | Ga0157374_102164631 | 355 |
| 61 | 3300014969 | Ga0157376_10206763 | Ga0157376_102067632 | 355 |
| 62 | 3300026041 | Ga0207639_10167809 | Ga0207639_101678092 | 355 |
| 63 | 3300026121 | Ga0207683_10253599 | Ga0207683_102535992 | 355 |
| 64 | 3300048918 | Ga0496115_0013376 | Ga0496115_0013376_114_1202 | 355 |
| 65 | 3300010375 | Ga0105239_10436691 | Ga0105239_104366912 | 356 |
| 66 | 3300003781 | Ga0055536_1013742 | Ga0055536_10137423 | 357 |
| 67 | 3300005262 | Ga0065165_1002669 | Ga0065165_10026694 | 357 |
| 68 | 3300005293 | Ga0065715_10114169 | Ga0065715_101141692 | 357 |
| 69 | 3300005356 | Ga0070674_100006619 | Ga0070674_1000066192 | 357 |
| 70 | 3300025937 | Ga0207669_10015523 | Ga0207669_100155231 | 357 |
| 71 | 3300026067 | Ga0207678_10123512 | Ga0207678_101235122 | 357 |
| 72 | 3300005331 | Ga0070670_100120174 | Ga0070670_1001201741 | 360 |
| 73 | 3300050513 | nmdc:mga0rr50_413644_c1 | nmdc:mga0rr50_413644_c1_44_1129 | 360 |
| 74 | 3300013105 | Ga0157369_10082376 | Ga0157369_100823764 | 361 |
| 75 | 3300013307 | Ga0157372_10226119 | Ga0157372_102261192 | 361 |
| 76 | 3300025921 | Ga0207652_10131929 | Ga0207652_101319292 | 361 |
| 77 | 3300049571 | Ga0501034_0025321 | Ga0501034_0025321_4697_5842 | 361 |
| 78 | 3300049580 | Ga0501046_0197739 | Ga0501046_0197739_74_1219 | 361 |
| 79 | 3300049581 | Ga0501047_0006499 | Ga0501047_0006499_4810_5955 | 361 |
| 80 | 3300049586 | Ga0501070_0017655 | Ga0501070_0017655_4048_5193 | 361 |
| 81 | 3300049823 | Ga0501044_0050456 | Ga0501044_0050456_2537_3682 | 361 |
| 82 | 3300048905 | Ga0496102_0255617 | Ga0496102_0255617_433_1557 | 362 |
| 83 | 3300009094 | Ga0111539_10027884 | Ga0111539_100278842 | 363 |
| 84 | 3300050511 | nmdc:mga08y16_201774_c1 | nmdc:mga08y16_201774_c1_469_1698 | 363 |
| 85 | 3300047320 | Ga0495672_0001950 | Ga0495672_0001950_4402_5556 | 366 |
| 86 | 3300048923 | Ga0496120_0061358 | Ga0496120_0061358_760_1884 | 367 |
| 87 | 3300048929 | Ga0496126_0000458 | Ga0496126_0000458_11034_12158 | 367 |
| 88 | 3300005329 | Ga0070683_100099260 | Ga0070683_1000992601 | 369 |
| 89 | 3300005518 | Ga0070699_100210879 | Ga0070699_1002108791 | 369 |
| 90 | 3300005535 | Ga0070684_100155894 | Ga0070684_1001558942 | 369 |
| 91 | 3300009093 | Ga0105240_10001247 | Ga0105240_1000124723 | 369 |
| 92 | 3300009176 | Ga0105242_10102790 | Ga0105242_101027903 | 369 |
| 93 | 3300009177 | Ga0105248_10037941 | Ga0105248_100379412 | 369 |
| 94 | 3300013105 | Ga0157369_10489170 | Ga0157369_104891702 | 369 |
| 95 | 3300025913 | Ga0207695_10034843 | Ga0207695_100348436 | 369 |
| 96 | 3300025924 | Ga0207694_10279898 | Ga0207694_102798981 | 369 |
| 97 | 3300048929 | Ga0496126_0147431 | Ga0496126_0147431_178_1302 | 369 |
| 98 | 3300009093 | Ga0105240_10069634 | Ga0105240_100696343 | 370 |
| 99 | 3300009177 | Ga0105248_10019873 | Ga0105248_100198735 | 370 |
| 100 | 3300009545 | Ga0105237_10262061 | Ga0105237_102620612 | 370 |
| 101 | 3300013306 | Ga0163162_10006096 | Ga0163162_100060967 | 370 |
| 102 | 3300014969 | Ga0157376_10012850 | Ga0157376_100128503 | 370 |
| 103 | 3300046472 | Ga0495580_0060554 | Ga0495580_0060554_1025_2152 | 370 |
| 104 | 3300046678 | Ga0495599_0033278 | Ga0495599_0033278_1907_3022 | 370 |
| 105 | 3300048907 | Ga0496104_0073278 | Ga0496104_0073278_590_1705 | 370 |
| 106 | 3300026078 | Ga0207702_10081912 | Ga0207702_100819122 | 371 |
| 107 | 3300039450 | Ga0436363_1493048 | Ga0436363_1493048_49_1164 | 371 |
| 108 | 3300005545 | Ga0070695_100107081 | Ga0070695_1001070811 | 372 |
| 109 | 3300013307 | Ga0157372_10118638 | Ga0157372_101186383 | 372 |
| 110 | 3300048929 | Ga0496126_0239271 | Ga0496126_0239271_302_1444 | 372 |
| 111 | 3300004803 | Ga0058862_10082891 | Ga0058862_100828912 | 373 |
| 112 | 3300005329 | Ga0070683_100281609 | Ga0070683_1002816092 | 373 |
| 113 | 3300005336 | Ga0070680_100208529 | Ga0070680_1002085292 | 373 |
| 114 | 3300005339 | Ga0070660_100093924 | Ga0070660_1000939242 | 373 |
| 115 | 3300005366 | Ga0070659_100175716 | Ga0070659_1001757162 | 373 |
| 116 | 3300005436 | Ga0070713_100018432 | Ga0070713_1000184325 | 373 |
| 117 | 3300005439 | Ga0070711_100166271 | Ga0070711_1001662711 | 373 |
| 118 | 3300005544 | Ga0070686_100111565 | Ga0070686_1001115652 | 373 |
| 119 | 3300005548 | Ga0070665_100036479 | Ga0070665_1000364793 | 373 |
| 120 | 3300005617 | Ga0068859_100150810 | Ga0068859_1001508102 | 373 |
| 121 | 3300005617 | Ga0068859_100455743 | Ga0068859_1004557431 | 373 |
| 122 | 3300005843 | Ga0068860_100007581 | Ga0068860_10000758116 | 373 |
| 123 | 3300006931 | Ga0097620_100150806 | Ga0097620_1001508061 | 373 |
| 124 | 3300006931 | Ga0097620_100455688 | Ga0097620_1004556881 | 373 |
| 125 | 3300013102 | Ga0157371_10097711 | Ga0157371_100977112 | 373 |
| 126 | 3300013105 | Ga0157369_10103316 | Ga0157369_101033163 | 373 |
| 127 | 3300013296 | Ga0157374_10017060 | Ga0157374_100170604 | 373 |
| 128 | 3300025912 | Ga0207707_10081111 | Ga0207707_100811113 | 373 |
| 129 | 3300025916 | Ga0207663_10141507 | Ga0207663_101415071 | 373 |
| 130 | 3300025937 | Ga0207669_10084472 | Ga0207669_100844721 | 373 |
| 131 | 3300025941 | Ga0207711_10037970 | Ga0207711_100379705 | 373 |
| 132 | 3300026088 | Ga0207641_10099278 | Ga0207641_100992782 | 373 |
| 133 | 3300026121 | Ga0207683_10170617 | Ga0207683_101706171 | 373 |
| 134 | 3300028379 | Ga0268266_10004840 | Ga0268266_100048403 | 373 |
| 135 | 3300028381 | Ga0268264_10015477 | Ga0268264_100154772 | 373 |
| 136 | 3300031251 | Ga0265327_10000864 | Ga0265327_1000086426 | 373 |
| 137 | 3300031595 | Ga0265313_10004999 | Ga0265313_100049996 | 373 |
| 138 | 3300037853 | Ga0436364_0287993 | Ga0436364_0287993_138_1334 | 373 |
| 139 | 3300042876 | Ga0451577_0047666 | Ga0451577_0047666_33_1181 | 373 |
| 140 | 3300044694 | Ga0466963_0178111 | Ga0466963_0178111_71_1192 | 373 |
| 141 | 3300044712 | Ga0453684_0032195 | Ga0453684_0032195_2551_3675 | 373 |
| 142 | 3300045051 | Ga0451576_0061865 | Ga0451576_0061865_441_1562 | 373 |
| 143 | 3300046459 | Ga0495629_0007912 | Ga0495629_0007912_5780_6904 | 373 |
| 144 | 3300046462 | Ga0495651_0038727 | Ga0495651_0038727_1627_2751 | 373 |
| 145 | 3300046471 | Ga0495650_0001937 | Ga0495650_0001937_10015_11139 | 373 |
| 146 | 3300046472 | Ga0495580_0150849 | Ga0495580_0150849_295_1419 | 373 |
| 147 | 3300046473 | Ga0495582_0001434 | Ga0495582_0001434_12121_13245 | 373 |
| 148 | 3300046475 | Ga0495639_0012708 | Ga0495639_0012708_282_1406 | 373 |
| 149 | 3300046476 | Ga0495662_0009845 | Ga0495662_0009845_3134_4258 | 373 |
| 150 | 3300046477 | Ga0495664_0003914 | Ga0495664_0003914_3698_4822 | 373 |
| 151 | 3300046492 | Ga0495585_0050865 | Ga0495585_0050865_1132_2256 | 373 |
| 152 | 3300046499 | Ga0495594_0000839 | Ga0495594_0000839_5722_6846 | 373 |
| 153 | 3300046516 | Ga0495628_0022923 | Ga0495628_0022923_1860_2984 | 373 |
| 154 | 3300046517 | Ga0495630_0100265 | Ga0495630_0100265_1021_2145 | 373 |
| 155 | 3300046526 | Ga0495666_0001694 | Ga0495666_0001694_6704_7828 | 373 |
| 156 | 3300046529 | Ga0495652_0017097 | Ga0495652_0017097_192_1316 | 373 |
| 157 | 3300046531 | Ga0495665_0000838 | Ga0495665_0000838_4862_5986 | 373 |
| 158 | 3300046533 | Ga0495640_0010837 | Ga0495640_0010837_2862_3986 | 373 |
| 159 | 3300046543 | Ga0495645_0017124 | Ga0495645_0017124_1123_2247 | 373 |
| 160 | 3300046642 | Ga0495634_0002918 | Ga0495634_0002918_12681_13805 | 373 |
| 161 | 3300046660 | Ga0495625_0006996 | Ga0495625_0006996_6210_7334 | 373 |
| 162 | 3300046680 | Ga0495646_0054553 | Ga0495646_0054553_128_1252 | 373 |
| 163 | 3300046809 | Ga0495600_0006321 | Ga0495600_0006321_606_1730 | 373 |
| 164 | 3300047315 | Ga0495581_0051332 | Ga0495581_0051332_1152_2276 | 373 |
| 165 | 3300047317 | Ga0495604_0124166 | Ga0495604_0124166_72_1196 | 373 |
| 166 | 3300047321 | Ga0495676_0014107 | Ga0495676_0014107_3494_4618 | 373 |
| 167 | 3300047444 | Ga0495675_0001482 | Ga0495675_0001482_331_1455 | 373 |
| 168 | 3300047470 | Ga0495681_0101411 | Ga0495681_0101411_109_1233 | 373 |
| 169 | 3300047471 | Ga0495684_0178910 | Ga0495684_0178910_301_1425 | 373 |
| 170 | 3300049580 | Ga0501046_0001054 | Ga0501046_0001054_2055_3257 | 373 |
| 171 | 3300049741 | Ga0501079_0048872 | Ga0501079_0048872_193_1338 | 373 |
| 172 | 3300049743 | Ga0501081_0096913 | Ga0501081_0096913_752_1897 | 373 |
| 173 | 3300053093 | Ga0500651_0000002 | Ga0500651_0000002_282687_283808 | 373 |
| 174 | 3300060353 | Ga0501082_0360747 | Ga0501082_0360747_79_1224 | 373 |
| 175 | 3300005329 | Ga0070683_100097017 | Ga0070683_1000970175 | 375 |
| 176 | 3300006880 | Ga0075429_100078638 | Ga0075429_1000786382 | 375 |
| 177 | 3300025944 | Ga0207661_10285941 | Ga0207661_102859412 | 375 |
| 178 | 3300031250 | Ga0265331_10047387 | Ga0265331_100473872 | 375 |
| 179 | 3300046462 | Ga0495651_0024335 | Ga0495651_0024335_685_1812 | 375 |
| 180 | 3300046533 | Ga0495640_0049488 | Ga0495640_0049488_1077_2204 | 375 |
| 181 | 3300046559 | Ga0495667_0025101 | Ga0495667_0025101_1180_2307 | 375 |
| 182 | 3300046679 | Ga0495623_0063390 | Ga0495623_0063390_660_1787 | 375 |
| 183 | 3300047471 | Ga0495684_0006245 | Ga0495684_0006245_2784_3911 | 375 |
| 184 | 3300006237 | Ga0097621_100231346 | Ga0097621_1002313462 | 376 |
| 185 | 3300009177 | Ga0105248_10027925 | Ga0105248_100279256 | 376 |
| 186 | 3300009177 | Ga0105248_10196554 | Ga0105248_101965542 | 376 |
| 187 | 3300031711 | Ga0265314_10009686 | Ga0265314_100096863 | 376 |
| 188 | 3300035725 | Ga0373947_0228641 | Ga0373947_0228641_58_1188 | 376 |
| 189 | 3300045051 | Ga0451576_0126855 | Ga0451576_0126855_1422_2552 | 376 |
| 190 | 3300046516 | Ga0495628_0173664 | Ga0495628_0173664_156_1286 | 376 |
| 191 | 3300046531 | Ga0495665_0034260 | Ga0495665_0034260_1003_2133 | 376 |
| 192 | 3300046559 | Ga0495667_0135900 | Ga0495667_0135900_15_1190 | 376 |
| 193 | 3300046679 | Ga0495623_0092199 | Ga0495623_0092199_26_1156 | 376 |
| 194 | 3300047319 | Ga0495674_0019151 | Ga0495674_0019151_2064_3194 | 376 |
| 195 | 3300047319 | Ga0495674_0035797 | Ga0495674_0035797_363_1493 | 376 |
| 196 | 3300047322 | Ga0495680_0157636 | Ga0495680_0157636_35_1165 | 376 |
| 197 | 3300047471 | Ga0495684_0026964 | Ga0495684_0026964_666_1796 | 376 |
| 198 | 3300048088 | Ga0495602_0101452 | Ga0495602_0101452_357_1487 | 376 |
| 199 | 3300046543 | Ga0495645_0021405 | Ga0495645_0021405_552_1685 | 377 |
| 200 | 3300047319 | Ga0495674_0119646 | Ga0495674_0119646_461_1594 | 377 |
| 201 | 3300047471 | Ga0495684_0215508 | Ga0495684_0215508_92_1225 | 377 |
| 202 | 3300049705 | Ga0501225_0033920 | Ga0501225_0033920_57_1196 | 377 |
| 203 | 3300006847 | Ga0075431_100083161 | Ga0075431_1000831612 | 378 |
| 204 | 3300006880 | Ga0075429_100065325 | Ga0075429_1000653252 | 378 |
| 205 | 3300050508 | nmdc:mga09592_57850_c1 | nmdc:mga09592_57850_c1_1413_2642 | 378 |
| 206 | 3300005329 | Ga0070683_100000025 | Ga0070683_10000002576 | 379 |
| 207 | 3300005535 | Ga0070684_100000081 | Ga0070684_10000008128 | 379 |
| 208 | 3300025944 | Ga0207661_10000028 | Ga0207661_1000002868 | 379 |
| 209 | 3300045976 | Ga0466967_0042628 | Ga0466967_0042628_541_1740 | 379 |
| 210 | 3300005353 | Ga0070669_100019584 | Ga0070669_1000195845 | 380 |
| 211 | 3300005457 | Ga0070662_100220768 | Ga0070662_1002207681 | 380 |
| 212 | 3300006852 | Ga0075433_10013146 | Ga0075433_100131463 | 380 |
| 213 | 3300006871 | Ga0075434_100184858 | Ga0075434_1001848583 | 380 |
| 214 | 3300025923 | Ga0207681_10152080 | Ga0207681_101520801 | 380 |
| 215 | 3300046539 | Ga0495621_0025977 | Ga0495621_0025977_598_1743 | 380 |
| 216 | 3300046543 | Ga0495645_0068677 | Ga0495645_0068677_568_1713 | 380 |
| 217 | 3300050512 | nmdc:mga0n895_176735_c1 | nmdc:mga0n895_176735_c1_191_1390 | 380 |
| 218 | 3300050515 | nmdc:mga0a205_30924_c1 | nmdc:mga0a205_30924_c1_116_1315 | 380 |
| 219 | 3300060353 | Ga0501082_0000708 | Ga0501082_0000708_26724_27902 | 380 |
| 220 | 3300005844 | Ga0068862_100137245 | Ga0068862_1001372452 | 381 |
| 221 | 3300009094 | Ga0111539_10000718 | Ga0111539_100007182 | 381 |
| 222 | 3300009148 | Ga0105243_10015246 | Ga0105243_100152463 | 381 |
| 223 | 3300014745 | Ga0157377_10031080 | Ga0157377_100310802 | 381 |
| 224 | 3300014969 | Ga0157376_10004315 | Ga0157376_100043153 | 381 |
| 225 | 3300047315 | Ga0495581_0038449 | Ga0495581_0038449_473_1618 | 381 |
| 226 | 3300047319 | Ga0495674_0036420 | Ga0495674_0036420_2116_3261 | 381 |
| 227 | 3300048918 | Ga0496115_0049678 | Ga0496115_0049678_1962_3107 | 381 |
| 228 | 3300050493 | nmdc:mga0k408_976_c1 | nmdc:mga0k408_976_c1_4712_5860 | 381 |
| 229 | 3300050494 | nmdc:mga06z11_1666_c1 | nmdc:mga06z11_1666_c1_5119_6267 | 381 |
| 230 | 3300050495 | nmdc:mga04h51_6359_c1 | nmdc:mga04h51_6359_c1_813_1961 | 381 |
| 231 | 3300050508 | nmdc:mga09592_106924_c1 | nmdc:mga09592_106924_c1_130_1278 | 381 |
| 232 | 3300050511 | nmdc:mga08y16_517_c1 | nmdc:mga08y16_517_c1_4886_6034 | 381 |
| 233 | 3300005617 | Ga0068859_100059208 | Ga0068859_1000592082 | 382 |
| 234 | 3300006931 | Ga0097620_100059209 | Ga0097620_1000592092 | 382 |
| 235 | 3300005336 | Ga0070680_100070350 | Ga0070680_1000703502 | 383 |
| 236 | 3300005356 | Ga0070674_100007780 | Ga0070674_1000077803 | 383 |
| 237 | 3300005365 | Ga0070688_100007441 | Ga0070688_1000074413 | 383 |
| 238 | 3300005438 | Ga0070701_10004404 | Ga0070701_100044044 | 383 |
| 239 | 3300005455 | Ga0070663_100075286 | Ga0070663_1000752862 | 383 |
| 240 | 3300005459 | Ga0068867_100008892 | Ga0068867_1000088923 | 383 |
| 241 | 3300005466 | Ga0070685_10010657 | Ga0070685_100106573 | 383 |
| 242 | 3300005840 | Ga0068870_10021442 | Ga0068870_100214422 | 383 |
| 243 | 3300005842 | Ga0068858_100008571 | Ga0068858_1000085715 | 383 |
| 244 | 3300006847 | Ga0075431_100008610 | Ga0075431_1000086108 | 383 |
| 245 | 3300013105 | Ga0157369_10047133 | Ga0157369_100471332 | 383 |
| 246 | 3300014968 | Ga0157379_10069441 | Ga0157379_100694412 | 383 |
| 247 | 3300025941 | Ga0207711_10042834 | Ga0207711_100428342 | 383 |
| 248 | 3300026089 | Ga0207648_10002638 | Ga0207648_100026385 | 383 |
| 249 | 3300046473 | Ga0495582_0015257 | Ga0495582_0015257_425_1576 | 383 |
| 250 | 3300046475 | Ga0495639_0058652 | Ga0495639_0058652_476_1627 | 383 |
| 251 | 3300046477 | Ga0495664_0049269 | Ga0495664_0049269_1147_2298 | 383 |
| 252 | 3300046499 | Ga0495594_0010970 | Ga0495594_0010970_1998_3149 | 383 |
| 253 | 3300046526 | Ga0495666_0014471 | Ga0495666_0014471_354_1505 | 383 |
| 254 | 3300046533 | Ga0495640_0102934 | Ga0495640_0102934_645_1796 | 383 |
| 255 | 3300046535 | Ga0495586_0022539 | Ga0495586_0022539_227_1378 | 383 |
| 256 | 3300046681 | Ga0495647_0005977 | Ga0495647_0005977_2370_3521 | 383 |
| 257 | 3300046689 | Ga0495613_0011918 | Ga0495613_0011918_2765_3916 | 383 |
| 258 | 3300047322 | Ga0495680_0233288 | Ga0495680_0233288_64_1215 | 383 |
| 259 | 3300047673 | Ga0495593_0095862 | Ga0495593_0095862_191_1342 | 383 |
| 260 | 3300049742 | Ga0501080_0005620 | Ga0501080_0005620_356_1549 | 383 |
| 261 | iso_pu_bacteria | 2687453341 | 2688392174 | 383 |
| 262 | 3300005289 | Ga0065704_10126003 | Ga0065704_101260031 | 384 |
| 263 | 3300005295 | Ga0065707_10089478 | Ga0065707_100894782 | 384 |
| 264 | 3300005617 | Ga0068859_100196963 | Ga0068859_1001969632 | 384 |
| 265 | 3300006178 | Ga0075367_10030280 | Ga0075367_100302803 | 384 |
| 266 | 3300006931 | Ga0097620_100196951 | Ga0097620_1001969512 | 384 |
| 267 | iso_pu_bacteria | 2671180531 | 2673162103 | 384 |
| 268 | 3300005331 | Ga0070670_100119660 | Ga0070670_1001196601 | 385 |
| 269 | 3300005456 | Ga0070678_100233262 | Ga0070678_1002332622 | 385 |
| 270 | 3300005456 | Ga0070678_100243531 | Ga0070678_1002435311 | 385 |
| 271 | 3300005539 | Ga0068853_100023789 | Ga0068853_1000237895 | 385 |
| 272 | 3300005543 | Ga0070672_100078788 | Ga0070672_1000787881 | 385 |
| 273 | 3300005618 | Ga0068864_100068386 | Ga0068864_1000683862 | 385 |
| 274 | 3300009177 | Ga0105248_10378119 | Ga0105248_103781192 | 385 |
| 275 | 3300025931 | Ga0207644_10065084 | Ga0207644_100650842 | 385 |
| 276 | 3300025940 | Ga0207691_10042260 | Ga0207691_100422603 | 385 |
| 277 | 3300025949 | Ga0207667_10269767 | Ga0207667_102697672 | 385 |
| 278 | 3300026067 | Ga0207678_10033266 | Ga0207678_100332665 | 385 |
| 279 | 3300046472 | Ga0495580_0044131 | Ga0495580_0044131_879_2105 | 385 |
| 280 | 3300006178 | Ga0075367_10031757 | Ga0075367_100317572 | 386 |
| 281 | 3300009174 | Ga0105241_10071173 | Ga0105241_100711731 | 386 |
| 282 | 3300013307 | Ga0157372_10037643 | Ga0157372_100376432 | 386 |
| 283 | 3300028794 | Ga0307515_10081018 | Ga0307515_100810184 | 386 |
| 284 | 3300047472 | Ga0495686_0059577 | Ga0495686_0059577_447_1646 | 386 |
| 285 | 3300005364 | Ga0070673_100041061 | Ga0070673_1000410612 | 387 |
| 286 | 3300009147 | Ga0114129_10017840 | Ga0114129_100178405 | 387 |
| 287 | 3300009147 | Ga0114129_10330056 | Ga0114129_103300562 | 387 |
| 288 | 3300014325 | Ga0163163_10150403 | Ga0163163_101504033 | 387 |
| 289 | 3300025906 | Ga0207699_10128200 | Ga0207699_101282001 | 387 |
| 290 | 3300026116 | Ga0207674_10013089 | Ga0207674_100130892 | 387 |
| 291 | 3300046476 | Ga0495662_0019464 | Ga0495662_0019464_34_1206 | 387 |
| 292 | 3300046477 | Ga0495664_0004826 | Ga0495664_0004826_6126_7298 | 387 |
| 293 | 3300046529 | Ga0495652_0026023 | Ga0495652_0026023_1634_2806 | 387 |
| 294 | 3300047471 | Ga0495684_0079863 | Ga0495684_0079863_719_1891 | 387 |
| 295 | 3300005563 | Ga0068855_100010269 | Ga0068855_1000102695 | 388 |
| 296 | 3300006844 | Ga0075428_100012727 | Ga0075428_1000127275 | 388 |
| 297 | 3300006847 | Ga0075431_100153208 | Ga0075431_1001532082 | 388 |
| 298 | 3300009094 | Ga0111539_10193724 | Ga0111539_101937242 | 388 |
| 299 | 3300009147 | Ga0114129_10295938 | Ga0114129_102959382 | 388 |
| 300 | 3300025949 | Ga0207667_10003396 | Ga0207667_100033969 | 388 |
| 301 | 3300028800 | Ga0265338_10228017 | Ga0265338_102280172 | 388 |
| 302 | 3300042122 | Ga0450920_005319 | Ga0450920_005319_285_1499 | 388 |
| 303 | 3300047319 | Ga0495674_0019728 | Ga0495674_0019728_3023_4297 | 388 |
| 304 | 3300048915 | Ga0496112_0045411 | Ga0496112_0045411_1555_2799 | 388 |
| 305 | 3300050507 | nmdc:mga05p37_115747_c1 | nmdc:mga05p37_115747_c1_183_1409 | 388 |
| 306 | 3300006844 | Ga0075428_100100854 | Ga0075428_1001008543 | 389 |
| 307 | 3300010375 | Ga0105239_10070244 | Ga0105239_100702442 | 389 |
| 308 | 3300046511 | Ga0495608_0138734 | Ga0495608_0138734_275_1522 | 389 |
| 309 | 3300046538 | Ga0495609_0036528 | Ga0495609_0036528_270_1442 | 389 |
| 310 | 3300049822 | Ga0501035_0036014 | Ga0501035_0036014_1787_2983 | 389 |
| 311 | 3300053077 | Ga0495601_0000415 | Ga0495601_0000415_4550_5803 | 389 |
| 312 | iso_pu_bacteria | 2884215851 | 2884219277 | 389 |
| 313 | 3300006028 | Ga0070717_10172477 | Ga0070717_101724771 | 390 |
| 314 | 3300009551 | Ga0105238_10124476 | Ga0105238_101244763 | 390 |
| 315 | 3300026067 | Ga0207678_10079776 | Ga0207678_100797762 | 390 |
| 316 | 3300028794 | Ga0307515_10001965 | Ga0307515_1000196520 | 390 |
| 317 | 3300036401 | Ga0373937_0073054 | Ga0373937_0073054_239_1420 | 390 |
| 318 | 3300003322 | rootL2_10040554 | rootL2_100405542 | 391 |
| 319 | 3300005340 | Ga0070689_100149824 | Ga0070689_1001498241 | 391 |
| 320 | 3300005518 | Ga0070699_100181908 | Ga0070699_1001819081 | 391 |
| 321 | 3300006847 | Ga0075431_100235815 | Ga0075431_1002358152 | 391 |
| 322 | 3300013102 | Ga0157371_10021140 | Ga0157371_100211405 | 391 |
| 323 | 3300013306 | Ga0163162_10068710 | Ga0163162_100687104 | 391 |
| 324 | 3300025936 | Ga0207670_10006169 | Ga0207670_100061693 | 391 |
| 325 | 3300035117 | Ga0373953_0006737 | Ga0373953_0006737_1540_2766 | 391 |
| 326 | 3300035172 | Ga0373955_0034108 | Ga0373955_0034108_553_1779 | 391 |
| 327 | 3300044712 | Ga0453684_0012862 | Ga0453684_0012862_5836_7086 | 391 |
| 328 | 3300046689 | Ga0495613_0072422 | Ga0495613_0072422_835_2022 | 391 |
| 329 | 3300049571 | Ga0501034_0232255 | Ga0501034_0232255_424_1617 | 391 |
| 330 | 3300049571 | Ga0501034_0241501 | Ga0501034_0241501_415_1632 | 391 |
| 331 | 3300049572 | Ga0501036_0042608 | Ga0501036_0042608_113_1330 | 391 |
| 332 | 3300049573 | Ga0501037_0016447 | Ga0501037_0016447_994_2211 | 391 |
| 333 | 3300049581 | Ga0501047_0079430 | Ga0501047_0079430_1263_2480 | 391 |
| 334 | 3300049822 | Ga0501035_0014070 | Ga0501035_0014070_3911_5128 | 391 |
| 335 | 3300053153 | Ga0500616_0002082 | Ga0500616_0002082_15580_16779 | 391 |
| 336 | iso_pu_bacteria | 2522125168 | 2522548464 | 391 |
| 337 | 3300005290 | Ga0065712_10094722 | Ga0065712_100947221 | 392 |
| 338 | 3300005340 | Ga0070689_100127473 | Ga0070689_1001274731 | 392 |
| 339 | 3300005440 | Ga0070705_100004071 | Ga0070705_1000040713 | 392 |
| 340 | 3300005467 | Ga0070706_100113145 | Ga0070706_1001131452 | 392 |
| 341 | 3300005471 | Ga0070698_100177367 | Ga0070698_1001773672 | 392 |
| 342 | 3300005546 | Ga0070696_100052322 | Ga0070696_1000523223 | 392 |
| 343 | 3300005549 | Ga0070704_100002042 | Ga0070704_1000020424 | 392 |
| 344 | 3300006846 | Ga0075430_100079212 | Ga0075430_1000792121 | 392 |
| 345 | 3300009094 | Ga0111539_10055409 | Ga0111539_100554093 | 392 |
| 346 | 3300009094 | Ga0111539_10082199 | Ga0111539_100821993 | 392 |
| 347 | 3300009147 | Ga0114129_10027783 | Ga0114129_100277832 | 392 |
| 348 | 3300025885 | Ga0207653_10008387 | Ga0207653_100083872 | 392 |
| 349 | 3300025936 | Ga0207670_10069417 | Ga0207670_100694172 | 392 |
| 350 | 3300031691 | Ga0316579_10052262 | Ga0316579_100522622 | 392 |
| 351 | 3300031728 | Ga0316578_10016988 | Ga0316578_100169882 | 392 |
| 352 | 3300031733 | Ga0316577_10040972 | Ga0316577_100409722 | 392 |
| 353 | 3300042131 | Ga0450894_005481 | Ga0450894_005481_100_1278 | 392 |
| 354 | 3300045051 | Ga0451576_0354290 | Ga0451576_0354290_231_1424 | 392 |
| 355 | 3300046459 | Ga0495629_0007685 | Ga0495629_0007685_2836_4020 | 392 |
| 356 | 3300046472 | Ga0495580_0019306 | Ga0495580_0019306_1672_2856 | 392 |
| 357 | 3300046499 | Ga0495594_0004163 | Ga0495594_0004163_4507_5691 | 392 |
| 358 | 3300046557 | Ga0495622_0050982 | Ga0495622_0050982_58_1242 | 392 |
| 359 | 3300046689 | Ga0495613_0003192 | Ga0495613_0003192_1841_3025 | 392 |
| 360 | 3300047471 | Ga0495684_0052750 | Ga0495684_0052750_717_1901 | 392 |
| 361 | 3300047673 | Ga0495593_0045755 | Ga0495593_0045755_161_1345 | 392 |
| 362 | 3300048089 | Ga0495614_0006837 | Ga0495614_0006837_2354_3538 | 392 |
| 363 | 3300050507 | nmdc:mga05p37_402942_c1 | nmdc:mga05p37_402942_c1_288_1523 | 392 |
| 364 | 3300050511 | nmdc:mga08y16_152600_c1 | nmdc:mga08y16_152600_c1_84_1274 | 392 |
| 365 | 3300050515 | nmdc:mga0a205_33746_c1 | nmdc:mga0a205_33746_c1_36_1226 | 392 |
| 366 | 3300053096 | Ga0500641_0010767 | Ga0500641_0010767_1873_3081 | 392 |
| 367 | iso_pu_bacteria | 2889415604 | 2889421006 | 392 |
| 368 | 3300005536 | Ga0070697_100019632 | Ga0070697_1000196322 | 393 |
| 369 | 3300005549 | Ga0070704_100181602 | Ga0070704_1001816022 | 393 |
| 370 | 3300006042 | Ga0075368_10011193 | Ga0075368_100111932 | 393 |
| 371 | 3300013100 | Ga0157373_10143924 | Ga0157373_101439241 | 393 |
| 372 | 3300013105 | Ga0157369_10032575 | Ga0157369_100325756 | 393 |
| 373 | 3300013296 | Ga0157374_10006256 | Ga0157374_100062568 | 393 |
| 374 | 3300013307 | Ga0157372_10217297 | Ga0157372_102172972 | 393 |
| 375 | 3300025919 | Ga0207657_10155743 | Ga0207657_101557432 | 393 |
| 376 | 3300026078 | Ga0207702_10090239 | Ga0207702_100902392 | 393 |
| 377 | 3300046523 | Ga0495644_0006967 | Ga0495644_0006967_388_1575 | 393 |
| 378 | 3300049592 | Ga0501076_0044919 | Ga0501076_0044919_2021_3214 | 393 |
| 379 | 3300049742 | Ga0501080_0110965 | Ga0501080_0110965_478_1671 | 393 |
| 380 | iso_pu_bacteria | 2911138879 | 2911140320 | 393 |
| 381 | 3300005340 | Ga0070689_100003920 | Ga0070689_1000039209 | 394 |
| 382 | 3300005354 | Ga0070675_100273102 | Ga0070675_1002731021 | 394 |
| 383 | 3300005614 | Ga0068856_100009463 | Ga0068856_1000094632 | 394 |
| 384 | 3300005842 | Ga0068858_100025804 | Ga0068858_1000258043 | 394 |
| 385 | 3300013297 | Ga0157378_10043353 | Ga0157378_100433533 | 394 |
| 386 | 3300026035 | Ga0207703_10014241 | Ga0207703_100142413 | 394 |
| 387 | 3300026078 | Ga0207702_10003888 | Ga0207702_100038883 | 394 |
| 388 | 3300026116 | Ga0207674_10131474 | Ga0207674_101314741 | 394 |
| 389 | 3300046476 | Ga0495662_0033886 | Ga0495662_0033886_851_2062 | 394 |
| 390 | 3300046517 | Ga0495630_0001523 | Ga0495630_0001523_11294_12505 | 394 |
| 391 | 3300046531 | Ga0495665_0022464 | Ga0495665_0022464_1740_2951 | 394 |
| 392 | 3300046690 | Ga0495624_0031455 | Ga0495624_0031455_1162_2373 | 394 |
| 393 | 3300047315 | Ga0495581_0035002 | Ga0495581_0035002_1208_2419 | 394 |
| 394 | 3300047471 | Ga0495684_0004226 | Ga0495684_0004226_5602_6813 | 394 |
| 395 | 3300049579 | Ga0501043_0003157 | Ga0501043_0003157_5121_6353 | 394 |
| 396 | 3300050491 | nmdc:mga00v17_53512_c1 | nmdc:mga00v17_53512_c1_440_1639 | 394 |
| 397 | 3300050511 | nmdc:mga08y16_133821_c1 | nmdc:mga08y16_133821_c1_268_1521 | 394 |
| 398 | 3300053119 | Ga0500595_000023 | Ga0500595_000023_10140_11327 | 394 |
| 399 | 3300005328 | Ga0070676_10037906 | Ga0070676_100379063 | 395 |
| 400 | 3300005338 | Ga0068868_100116323 | Ga0068868_1001163232 | 395 |
| 401 | 3300005340 | Ga0070689_100017655 | Ga0070689_1000176552 | 395 |
| 402 | 3300005343 | Ga0070687_100002461 | Ga0070687_1000024615 | 395 |
| 403 | 3300005347 | Ga0070668_100110614 | Ga0070668_1001106142 | 395 |
| 404 | 3300005353 | Ga0070669_100047657 | Ga0070669_1000476572 | 395 |
| 405 | 3300005354 | Ga0070675_100014273 | Ga0070675_1000142733 | 395 |
| 406 | 3300005459 | Ga0068867_100035990 | Ga0068867_1000359902 | 395 |
| 407 | 3300005549 | Ga0070704_100075811 | Ga0070704_1000758111 | 395 |
| 408 | 3300005617 | Ga0068859_100005827 | Ga0068859_1000058277 | 395 |
| 409 | 3300005719 | Ga0068861_100117718 | Ga0068861_1001177182 | 395 |
| 410 | 3300005842 | Ga0068858_100007346 | Ga0068858_1000073462 | 395 |
| 411 | 3300005844 | Ga0068862_100192045 | Ga0068862_1001920452 | 395 |
| 412 | 3300006042 | Ga0075368_10009032 | Ga0075368_100090322 | 395 |
| 413 | 3300006048 | Ga0075363_100025366 | Ga0075363_1000253662 | 395 |
| 414 | 3300006195 | Ga0075366_10004241 | Ga0075366_100042416 | 395 |
| 415 | 3300006358 | Ga0068871_100112201 | Ga0068871_1001122012 | 395 |
| 416 | 3300006844 | Ga0075428_100088636 | Ga0075428_1000886362 | 395 |
| 417 | 3300006847 | Ga0075431_100005399 | Ga0075431_1000053998 | 395 |
| 418 | 3300006881 | Ga0068865_100077123 | Ga0068865_1000771232 | 395 |
| 419 | 3300006931 | Ga0097620_100005827 | Ga0097620_1000058277 | 395 |
| 420 | 3300009147 | Ga0114129_10027379 | Ga0114129_100273793 | 395 |
| 421 | 3300025907 | Ga0207645_10075425 | Ga0207645_100754252 | 395 |
| 422 | 3300025918 | Ga0207662_10003096 | Ga0207662_100030965 | 395 |
| 423 | 3300025933 | Ga0207706_10050397 | Ga0207706_100503973 | 395 |
| 424 | 3300025936 | Ga0207670_10037664 | Ga0207670_100376642 | 395 |
| 425 | 3300025940 | Ga0207691_10005074 | Ga0207691_100050745 | 395 |
| 426 | 3300026035 | Ga0207703_10008377 | Ga0207703_100083774 | 395 |
| 427 | 3300026075 | Ga0207708_10012693 | Ga0207708_100126933 | 395 |
| 428 | 3300026116 | Ga0207674_10015676 | Ga0207674_100156761 | 395 |
| 429 | 3300026118 | Ga0207675_100005876 | Ga0207675_1000058766 | 395 |
| 430 | 3300027866 | Ga0209813_10005301 | Ga0209813_100053012 | 395 |
| 431 | 3300027907 | Ga0207428_10000076 | Ga0207428_1000007633 | 395 |
| 432 | 3300028380 | Ga0268265_10108697 | Ga0268265_101086972 | 395 |
| 433 | 3300028381 | Ga0268264_10026906 | Ga0268264_100269062 | 395 |
| 434 | 3300037853 | Ga0436364_1328097 | Ga0436364_1328097_196_1578 | 395 |
| 435 | 3300046684 | Ga0495669_0023720 | Ga0495669_0023720_597_1796 | 395 |
| 436 | 3300050510 | nmdc:mga06r32_4439_c1 | nmdc:mga06r32_4439_c1_9805_11037 | 395 |
| 437 | 3300005354 | Ga0070675_100105490 | Ga0070675_1001054902 | 396 |
| 438 | 3300005937 | Ga0081455_10009808 | Ga0081455_100098085 | 396 |
| 439 | 3300006852 | Ga0075433_10000557 | Ga0075433_100005571 | 396 |
| 440 | 3300006871 | Ga0075434_100020592 | Ga0075434_1000205924 | 396 |
| 441 | 3300009147 | Ga0114129_10075528 | Ga0114129_100755284 | 396 |
| 442 | 3300025949 | Ga0207667_10032734 | Ga0207667_100327347 | 396 |
| 443 | 3300046517 | Ga0495630_0002241 | Ga0495630_0002241_7322_8530 | 396 |
| 444 | 3300046526 | Ga0495666_0008272 | Ga0495666_0008272_839_2047 | 396 |
| 445 | 3300046535 | Ga0495586_0002759 | Ga0495586_0002759_1448_2656 | 396 |
| 446 | 3300047321 | Ga0495676_0031115 | Ga0495676_0031115_917_2125 | 396 |
| 447 | 3300048929 | Ga0496126_0000091 | Ga0496126_0000091_154887_156095 | 396 |
| 448 | 3300049823 | Ga0501044_0295637 | Ga0501044_0295637_232_1452 | 396 |
| 449 | 3300050515 | nmdc:mga0a205_543_c1 | nmdc:mga0a205_543_c1_22677_23921 | 396 |
| 450 | 3300005327 | Ga0070658_10014336 | Ga0070658_100143362 | 397 |
| 451 | 3300005467 | Ga0070706_100058873 | Ga0070706_1000588733 | 397 |
| 452 | 3300005468 | Ga0070707_100004528 | Ga0070707_1000045286 | 397 |
| 453 | 3300005471 | Ga0070698_100002639 | Ga0070698_1000026395 | 397 |
| 454 | 3300005518 | Ga0070699_100033901 | Ga0070699_1000339011 | 397 |
| 455 | 3300005614 | Ga0068856_100055580 | Ga0068856_1000555804 | 397 |
| 456 | 3300005842 | Ga0068858_100084463 | Ga0068858_1000844632 | 397 |
| 457 | 3300009094 | Ga0111539_10246906 | Ga0111539_102469061 | 397 |
| 458 | 3300009545 | Ga0105237_10003800 | Ga0105237_100038001 | 397 |
| 459 | 3300010375 | Ga0105239_10033071 | Ga0105239_100330712 | 397 |
| 460 | 3300025909 | Ga0207705_10011962 | Ga0207705_100119622 | 397 |
| 461 | 3300025910 | Ga0207684_10012510 | Ga0207684_100125105 | 397 |
| 462 | 3300025914 | Ga0207671_10031032 | Ga0207671_100310322 | 397 |
| 463 | 3300025922 | Ga0207646_10007340 | Ga0207646_100073405 | 397 |
| 464 | 3300026035 | Ga0207703_10021959 | Ga0207703_100219593 | 397 |
| 465 | 3300026078 | Ga0207702_10122783 | Ga0207702_101227832 | 397 |
| 466 | 3300005617 | Ga0068859_100005273 | Ga0068859_1000052739 | 398 |
| 467 | 3300006931 | Ga0097620_100005273 | Ga0097620_1000052739 | 398 |
| 468 | 3300013104 | Ga0157370_10049962 | Ga0157370_100499625 | 398 |
| 469 | 3300026067 | Ga0207678_10025932 | Ga0207678_100259324 | 398 |
| 470 | 3300031251 | Ga0265327_10009571 | Ga0265327_100095713 | 398 |
| 471 | iso_pu_bacteria | 2687453257 | 2688067266 | 398 |
| 472 | 3300005436 | Ga0070713_100047121 | Ga0070713_1000471212 | 399 |
| 473 | 3300009176 | Ga0105242_10073346 | Ga0105242_100733462 | 399 |
| 474 | 3300010375 | Ga0105239_10015044 | Ga0105239_100150446 | 399 |
| 475 | 3300013297 | Ga0157378_10000186 | Ga0157378_100001863 | 399 |
| 476 | 3300021384 | Ga0213876_10007028 | Ga0213876_100070282 | 399 |
| 477 | 3300025928 | Ga0207700_10114066 | Ga0207700_101140662 | 399 |
| 478 | 3300025934 | Ga0207686_10080076 | Ga0207686_100800762 | 399 |
| 479 | 3300035398 | Ga0316574_0012187 | Ga0316574_0012187_2731_3987 | 399 |
| 480 | 3300039437 | Ga0436365_0874592 | Ga0436365_0874592_2035_3249 | 399 |
| 481 | 3300039453 | Ga0436362_0081182 | Ga0436362_0081182_1537_2751 | 399 |
| 482 | 3300046455 | Ga0495603_0018137 | Ga0495603_0018137_2105_3310 | 399 |
| 483 | 3300046500 | Ga0495596_0023221 | Ga0495596_0023221_657_1862 | 399 |
| 484 | 3300046523 | Ga0495644_0000099 | Ga0495644_0000099_4975_6180 | 399 |
| 485 | 3300046538 | Ga0495609_0015332 | Ga0495609_0015332_596_1801 | 399 |
| 486 | 3300046558 | Ga0495633_0021756 | Ga0495633_0021756_1296_2501 | 399 |
| 487 | 3300046616 | Ga0495668_0012615 | Ga0495668_0012615_2584_3789 | 399 |
| 488 | 3300046660 | Ga0495625_0038125 | Ga0495625_0038125_1707_2912 | 399 |
| 489 | 3300046691 | Ga0495670_0036058 | Ga0495670_0036058_1178_2383 | 399 |
| 490 | 3300048089 | Ga0495614_0028650 | Ga0495614_0028650_487_1689 | 399 |
| 491 | 3300048915 | Ga0496112_0322746 | Ga0496112_0322746_92_1294 | 399 |
| 492 | 3300059421 | Ga0590071_001796 | Ga0590071_001796_4148_5374 | 399 |
| 493 | 3300059426 | Ga0590077_002947 | Ga0590077_002947_1652_2878 | 399 |
| 494 | 3300005471 | Ga0070698_100063132 | Ga0070698_1000631322 | 400 |
| 495 | 3300005563 | Ga0068855_100016620 | Ga0068855_1000166201 | 400 |
| 496 | 3300005577 | Ga0068857_100014212 | Ga0068857_1000142124 | 400 |
| 497 | 3300006195 | Ga0075366_10000788 | Ga0075366_100007883 | 400 |
| 498 | 3300009093 | Ga0105240_10000070 | Ga0105240_1000007012 | 400 |
| 499 | 3300010375 | Ga0105239_10023560 | Ga0105239_100235603 | 400 |
| 500 | 3300025909 | Ga0207705_10001971 | Ga0207705_1000197111 | 400 |
| 501 | 3300025913 | Ga0207695_10000155 | Ga0207695_10000155132 | 400 |
| 502 | 3300025949 | Ga0207667_10003111 | Ga0207667_100031115 | 400 |
| 503 | 3300026116 | Ga0207674_10020810 | Ga0207674_100208104 | 400 |
| 504 | 3300028794 | Ga0307515_10001558 | Ga0307515_1000155837 | 400 |
| 505 | 3300046459 | Ga0495629_0127382 | Ga0495629_0127382_164_1372 | 400 |
| 506 | 3300046506 | Ga0495583_0039052 | Ga0495583_0039052_14_1252 | 400 |
| 507 | 3300046524 | Ga0495648_0009612 | Ga0495648_0009612_4078_5286 | 400 |
| 508 | 3300046528 | Ga0495642_0042291 | Ga0495642_0042291_606_1844 | 400 |
| 509 | 3300046530 | Ga0495654_0049651 | Ga0495654_0049651_826_2034 | 400 |
| 510 | 3300046538 | Ga0495609_0021625 | Ga0495609_0021625_891_2099 | 400 |
| 511 | 3300046558 | Ga0495633_0000012 | Ga0495633_0000012_80574_81782 | 400 |
| 512 | 3300046616 | Ga0495668_0000055 | Ga0495668_0000055_62755_64080 | 400 |
| 513 | 3300046660 | Ga0495625_0001326 | Ga0495625_0001326_15864_17072 | 400 |
| 514 | 3300046660 | Ga0495625_0002936 | Ga0495625_0002936_14852_16060 | 400 |
| 515 | 3300046660 | Ga0495625_0029436 | Ga0495625_0029436_340_1578 | 400 |
| 516 | 3300046678 | Ga0495599_0036295 | Ga0495599_0036295_582_1802 | 400 |
| 517 | 3300046692 | Ga0495671_0047542 | Ga0495671_0047542_96_1334 | 400 |
| 518 | 3300046694 | Ga0495649_0039627 | Ga0495649_0039627_979_2217 | 400 |
| 519 | 3300048089 | Ga0495614_0014429 | Ga0495614_0014429_2045_3253 | 400 |
| 520 | 3300050493 | nmdc:mga0k408_615_c1 | nmdc:mga0k408_615_c1_11148_12356 | 400 |
| 521 | 3300006844 | Ga0075428_100001649 | Ga0075428_1000016499 | 401 |
| 522 | 3300037853 | Ga0436364_1102173 | Ga0436364_1102173_160_1389 | 401 |
| 523 | 3300049742 | Ga0501080_0012697 | Ga0501080_0012697_3270_4508 | 401 |
| 524 | 3300005530 | Ga0070679_100073584 | Ga0070679_1000735844 | 402 |
| 525 | 3300009093 | Ga0105240_10001027 | Ga0105240_100010274 | 402 |
| 526 | 3300009094 | Ga0111539_10176709 | Ga0111539_101767092 | 402 |
| 527 | 3300009177 | Ga0105248_10408245 | Ga0105248_104082452 | 402 |
| 528 | 3300014325 | Ga0163163_10310261 | Ga0163163_103102611 | 402 |
| 529 | 3300025936 | Ga0207670_10087719 | Ga0207670_100877192 | 402 |
| 530 | 3300039450 | Ga0436363_0466760 | Ga0436363_0466760_96_1319 | 402 |
| 531 | 3300050510 | nmdc:mga06r32_225268_c1 | nmdc:mga06r32_225268_c1_334_1569 | 402 |
| 532 | 3300053153 | Ga0500616_0000386 | Ga0500616_0000386_33766_35031 | 402 |
| 533 | iso_pu_bacteria | 2920107658 | 2920114070 | 402 |
| 534 | 3300006846 | Ga0075430_100103009 | Ga0075430_1001030092 | 403 |
| 535 | 3300006847 | Ga0075431_100066605 | Ga0075431_1000666054 | 403 |
| 536 | 3300037853 | Ga0436364_1118947 | Ga0436364_1118947_10551_11786 | 403 |
| 537 | 3300046517 | Ga0495630_0000067 | Ga0495630_0000067_46110_47339 | 403 |
| 538 | 3300046526 | Ga0495666_0005855 | Ga0495666_0005855_4795_6024 | 403 |
| 539 | 3300046533 | Ga0495640_0143606 | Ga0495640_0143606_232_1461 | 403 |
| 540 | 3300046535 | Ga0495586_0000028 | Ga0495586_0000028_59820_61049 | 403 |
| 541 | 3300046642 | Ga0495634_0032974 | Ga0495634_0032974_1519_2748 | 403 |
| 542 | 3300047319 | Ga0495674_0032717 | Ga0495674_0032717_408_1637 | 403 |
| 543 | 3300049568 | Ga0501031_0000903 | Ga0501031_0000903_1259_2482 | 403 |
| 544 | 3300049569 | Ga0501032_0030421 | Ga0501032_0030421_1203_2426 | 403 |
| 545 | 3300049572 | Ga0501036_0000193 | Ga0501036_0000193_32648_33871 | 403 |
| 546 | 3300049575 | Ga0501039_0031667 | Ga0501039_0031667_1576_2799 | 403 |
| 547 | 3300049579 | Ga0501043_0136723 | Ga0501043_0136723_598_1821 | 403 |
| 548 | 3300049580 | Ga0501046_0002330 | Ga0501046_0002330_1213_2436 | 403 |
| 549 | 3300049581 | Ga0501047_0134510 | Ga0501047_0134510_211_1434 | 403 |
| 550 | 3300049584 | Ga0501068_0006974 | Ga0501068_0006974_3745_4968 | 403 |
| 551 | 3300049585 | Ga0501069_0003963 | Ga0501069_0003963_2637_3860 | 403 |
| 552 | 3300049586 | Ga0501070_0144123 | Ga0501070_0144123_18_1241 | 403 |
| 553 | 3300049588 | Ga0501072_0067008 | Ga0501072_0067008_329_1552 | 403 |
| 554 | 3300049589 | Ga0501073_0013675 | Ga0501073_0013675_3763_4986 | 403 |
| 555 | 3300049593 | Ga0501077_0065671 | Ga0501077_0065671_868_2091 | 403 |
| 556 | 3300049741 | Ga0501079_0118675 | Ga0501079_0118675_791_2014 | 403 |
| 557 | 3300049742 | Ga0501080_0000281 | Ga0501080_0000281_726_1949 | 403 |
| 558 | 3300049744 | Ga0501083_0034456 | Ga0501083_0034456_1086_2309 | 403 |
| 559 | 3300060353 | Ga0501082_0016770 | Ga0501082_0016770_1029_2252 | 403 |
| 560 | 3300005340 | Ga0070689_100129025 | Ga0070689_1001290251 | 404 |
| 561 | 3300005535 | Ga0070684_100051298 | Ga0070684_1000512983 | 404 |
| 562 | 3300005546 | Ga0070696_100021132 | Ga0070696_1000211323 | 404 |
| 563 | 3300006028 | Ga0070717_10283385 | Ga0070717_102833852 | 404 |
| 564 | 3300009545 | Ga0105237_10434416 | Ga0105237_104344161 | 404 |
| 565 | 3300013104 | Ga0157370_10029360 | Ga0157370_100293602 | 404 |
| 566 | 3300014325 | Ga0163163_10000114 | Ga0163163_1000011428 | 404 |
| 567 | 3300028381 | Ga0268264_10039520 | Ga0268264_100395201 | 404 |
| 568 | 3300037471 | Ga0395905_0051753 | Ga0395905_0051753_312_1556 | 404 |
| 569 | 3300045051 | Ga0451576_0181875 | Ga0451576_0181875_891_2123 | 404 |
| 570 | 3300048905 | Ga0496102_0003059 | Ga0496102_0003059_6229_7458 | 404 |
| 571 | 3300048909 | Ga0496106_0147543 | Ga0496106_0147543_100_1329 | 404 |
| 572 | 3300049580 | Ga0501046_0029127 | Ga0501046_0029127_629_1888 | 404 |
| 573 | 3300049581 | Ga0501047_0003896 | Ga0501047_0003896_8587_9846 | 404 |
| 574 | 3300050514 | nmdc:mga08x19_1552_c1 | nmdc:mga08x19_1552_c1_1693_2922 | 404 |
| 575 | 3300005327 | Ga0070658_10000848 | Ga0070658_1000084821 | 405 |
| 576 | 3300005436 | Ga0070713_100159221 | Ga0070713_1001592212 | 405 |
| 577 | 3300005548 | Ga0070665_100195701 | Ga0070665_1001957011 | 405 |
| 578 | 3300005548 | Ga0070665_100394970 | Ga0070665_1003949702 | 405 |
| 579 | 3300005841 | Ga0068863_100014070 | Ga0068863_1000140705 | 405 |
| 580 | 3300005842 | Ga0068858_100065434 | Ga0068858_1000654342 | 405 |
| 581 | 3300005842 | Ga0068858_100294351 | Ga0068858_1002943511 | 405 |
| 582 | 3300009553 | Ga0105249_10278689 | Ga0105249_102786892 | 405 |
| 583 | 3300010375 | Ga0105239_10191319 | Ga0105239_101913192 | 405 |
| 584 | 3300013104 | Ga0157370_10008478 | Ga0157370_100084784 | 405 |
| 585 | 3300013105 | Ga0157369_10000761 | Ga0157369_1000076126 | 405 |
| 586 | 3300013297 | Ga0157378_10051792 | Ga0157378_100517922 | 405 |
| 587 | 3300013307 | Ga0157372_10000267 | Ga0157372_1000026727 | 405 |
| 588 | 3300014325 | Ga0163163_10180857 | Ga0163163_101808572 | 405 |
| 589 | 3300026035 | Ga0207703_10127776 | Ga0207703_101277762 | 405 |
| 590 | 3300026035 | Ga0207703_10323425 | Ga0207703_103234252 | 405 |
| 591 | 3300026088 | Ga0207641_10014293 | Ga0207641_100142933 | 405 |
| 592 | 3300028379 | Ga0268266_10083577 | Ga0268266_100835772 | 405 |
| 593 | 3300045051 | Ga0451576_0134030 | Ga0451576_0134030_1019_2251 | 405 |
| 594 | 3300047319 | Ga0495674_0061871 | Ga0495674_0061871_679_1902 | 405 |
| 595 | 3300049823 | Ga0501044_0002894 | Ga0501044_0002894_474_1709 | 405 |
| 596 | 3300050510 | nmdc:mga06r32_287047_c1 | nmdc:mga06r32_287047_c1_136_1374 | 405 |
| 597 | 3300053103 | Ga0500555_003786 | Ga0500555_003786_1401_2651 | 405 |
| 598 | 3300005335 | Ga0070666_10109130 | Ga0070666_101091302 | 406 |
| 599 | 3300009147 | Ga0114129_10152937 | Ga0114129_101529373 | 406 |
| 600 | 3300009177 | Ga0105248_10000006 | Ga0105248_10000006379 | 406 |
| 601 | 3300013308 | Ga0157375_10000006 | Ga0157375_10000006343 | 406 |
| 602 | 3300021377 | Ga0213874_10004343 | Ga0213874_100043432 | 406 |
| 603 | 3300025903 | Ga0207680_10009744 | Ga0207680_100097444 | 406 |
| 604 | 3300025941 | Ga0207711_10000007 | Ga0207711_10000007210 | 406 |
| 605 | 3300037853 | Ga0436364_1380174 | Ga0436364_1380174_1191_2450 | 406 |
| 606 | 3300039437 | Ga0436365_0940540 | Ga0436365_0940540_978_2213 | 406 |
| 607 | 3300039450 | Ga0436363_0655318 | Ga0436363_0655318_3399_4634 | 406 |
| 608 | 3300048912 | Ga0496109_0000107 | Ga0496109_0000107_34867_36102 | 406 |
| 609 | 3300050508 | nmdc:mga09592_196755_c1 | nmdc:mga09592_196755_c1_366_1595 | 406 |
| 610 | 3300006847 | Ga0075431_100041216 | Ga0075431_1000412162 | 407 |
| 611 | 3300009147 | Ga0114129_10451261 | Ga0114129_104512611 | 407 |
| 612 | 3300021388 | Ga0213875_10000004 | Ga0213875_10000004444 | 407 |
| 613 | 3300037853 | Ga0436364_0748068 | Ga0436364_0748068_115817_117064 | 407 |
| 614 | 3300050507 | nmdc:mga05p37_189875_c1 | nmdc:mga05p37_189875_c1_901_2169 | 407 |
| 615 | 3300053087 | Ga0500643_011532 | Ga0500643_011532_234_1457 | 407 |
| 616 | 3300005339 | Ga0070660_100188992 | Ga0070660_1001889922 | 408 |
| 617 | 3300005842 | Ga0068858_100208207 | Ga0068858_1002082071 | 408 |
| 618 | 3300005937 | Ga0081455_10006375 | Ga0081455_1000637511 | 408 |
| 619 | 3300006847 | Ga0075431_100080394 | Ga0075431_1000803943 | 408 |
| 620 | 3300027907 | Ga0207428_10002419 | Ga0207428_100024198 | 408 |
| 621 | 3300039447 | Ga0436361_0970042 | Ga0436361_0970042_12187_13422 | 408 |
| 622 | 3300046459 | Ga0495629_0040130 | Ga0495629_0040130_1870_3108 | 408 |
| 623 | 3300050507 | nmdc:mga05p37_26590_c1 | nmdc:mga05p37_26590_c1_807_2078 | 408 |
| 624 | 3300050511 | nmdc:mga08y16_101843_c1 | nmdc:mga08y16_101843_c1_54_1325 | 408 |
| 625 | 3300003320 | rootH2_10065350 | rootH2_100653502 | 409 |
| 626 | 3300005434 | Ga0070709_10052683 | Ga0070709_100526833 | 409 |
| 627 | 3300009093 | Ga0105240_10049930 | Ga0105240_100499304 | 409 |
| 628 | 3300013307 | Ga0157372_10194905 | Ga0157372_101949051 | 409 |
| 629 | 3300025914 | Ga0207671_10036179 | Ga0207671_100361792 | 409 |
| 630 | 3300049579 | Ga0501043_0013453 | Ga0501043_0013453_2777_4024 | 409 |
| 631 | 3300049580 | Ga0501046_0037649 | Ga0501046_0037649_29_1276 | 409 |
| 632 | 3300049589 | Ga0501073_0082471 | Ga0501073_0082471_927_2174 | 409 |
| 633 | 3300049822 | Ga0501035_0081642 | Ga0501035_0081642_1564_2811 | 409 |
| 634 | 3300009093 | Ga0105240_10148641 | Ga0105240_101486412 | 410 |
| 635 | 3300013105 | Ga0157369_10019836 | Ga0157369_100198361 | 410 |
| 636 | 3300025939 | Ga0207665_10002112 | Ga0207665_100021126 | 410 |
| 637 | 3300031249 | Ga0265339_10000414 | Ga0265339_100004148 | 410 |
| 638 | 3300031344 | Ga0265316_10005470 | Ga0265316_100054708 | 410 |
| 639 | 3300046471 | Ga0495650_0000010 | Ga0495650_0000010_300472_301704 | 410 |
| 640 | 3300046516 | Ga0495628_0026914 | Ga0495628_0026914_378_1637 | 410 |
| 641 | 3300053077 | Ga0495601_0010610 | Ga0495601_0010610_1393_2652 | 410 |
| 642 | 3300005329 | Ga0070683_100024371 | Ga0070683_1000243714 | 411 |
| 643 | 3300005331 | Ga0070670_100104734 | Ga0070670_1001047342 | 411 |
| 644 | 3300005339 | Ga0070660_100155747 | Ga0070660_1001557472 | 411 |
| 645 | 3300005344 | Ga0070661_100013867 | Ga0070661_1000138671 | 411 |
| 646 | 3300005355 | Ga0070671_100028762 | Ga0070671_1000287622 | 411 |
| 647 | 3300005366 | Ga0070659_100014105 | Ga0070659_1000141055 | 411 |
| 648 | 3300005455 | Ga0070663_100001367 | Ga0070663_1000013676 | 411 |
| 649 | 3300005458 | Ga0070681_10019179 | Ga0070681_100191794 | 411 |
| 650 | 3300005530 | Ga0070679_100021481 | Ga0070679_1000214815 | 411 |
| 651 | 3300005535 | Ga0070684_100156440 | Ga0070684_1001564402 | 411 |
| 652 | 3300005563 | Ga0068855_100027673 | Ga0068855_1000276732 | 411 |
| 653 | 3300005577 | Ga0068857_100094514 | Ga0068857_1000945142 | 411 |
| 654 | 3300005578 | Ga0068854_100013772 | Ga0068854_1000137725 | 411 |
| 655 | 3300006028 | Ga0070717_10002730 | Ga0070717_100027307 | 411 |
| 656 | 3300009093 | Ga0105240_10060269 | Ga0105240_100602692 | 411 |
| 657 | 3300009093 | Ga0105240_10067231 | Ga0105240_100672312 | 411 |
| 658 | 3300009545 | Ga0105237_10052420 | Ga0105237_100524202 | 411 |
| 659 | 3300013104 | Ga0157370_10015889 | Ga0157370_100158893 | 411 |
| 660 | 3300013105 | Ga0157369_10028083 | Ga0157369_100280832 | 411 |
| 661 | 3300013105 | Ga0157369_10132325 | Ga0157369_101323253 | 411 |
| 662 | 3300013105 | Ga0157369_10257927 | Ga0157369_102579272 | 411 |
| 663 | 3300025904 | Ga0207647_10013713 | Ga0207647_100137133 | 411 |
| 664 | 3300025909 | Ga0207705_10001870 | Ga0207705_1000187013 | 411 |
| 665 | 3300025912 | Ga0207707_10003273 | Ga0207707_1000327312 | 411 |
| 666 | 3300025913 | Ga0207695_10034371 | Ga0207695_100343713 | 411 |
| 667 | 3300025919 | Ga0207657_10001250 | Ga0207657_100012503 | 411 |
| 668 | 3300025919 | Ga0207657_10171558 | Ga0207657_101715581 | 411 |
| 669 | 3300025931 | Ga0207644_10057636 | Ga0207644_100576362 | 411 |
| 670 | 3300025944 | Ga0207661_10021488 | Ga0207661_100214884 | 411 |
| 671 | 3300025949 | Ga0207667_10006749 | Ga0207667_100067498 | 411 |
| 672 | 3300025981 | Ga0207640_10009712 | Ga0207640_100097124 | 411 |
| 673 | 3300026041 | Ga0207639_10038164 | Ga0207639_100381642 | 411 |
| 674 | 3300026067 | Ga0207678_10001220 | Ga0207678_1000122014 | 411 |
| 675 | 3300026067 | Ga0207678_10018316 | Ga0207678_100183162 | 411 |
| 676 | 3300026116 | Ga0207674_10010954 | Ga0207674_100109547 | 411 |
| 677 | 3300044656 | Ga0466969_0049277 | Ga0466969_0049277_591_1904 | 411 |
| 678 | 3300049586 | Ga0501070_0148025 | Ga0501070_0148025_191_1426 | 411 |
| 679 | 3300053103 | Ga0500555_018159 | Ga0500555_018159_287_1666 | 411 |
| 680 | 3300005335 | Ga0070666_10103166 | Ga0070666_101031662 | 412 |
| 681 | 3300005338 | Ga0068868_100196299 | Ga0068868_1001962991 | 412 |
| 682 | 3300005347 | Ga0070668_100131325 | Ga0070668_1001313252 | 412 |
| 683 | 3300005355 | Ga0070671_100070003 | Ga0070671_1000700032 | 412 |
| 684 | 3300005367 | Ga0070667_100080536 | Ga0070667_1000805362 | 412 |
| 685 | 3300005457 | Ga0070662_100042202 | Ga0070662_1000422022 | 412 |
| 686 | 3300005563 | Ga0068855_100217264 | Ga0068855_1002172642 | 412 |
| 687 | 3300005983 | Ga0081540_1004612 | Ga0081540_10046125 | 412 |
| 688 | 3300006237 | Ga0097621_100110952 | Ga0097621_1001109522 | 412 |
| 689 | 3300006358 | Ga0068871_100071452 | Ga0068871_1000714522 | 412 |
| 690 | 3300006881 | Ga0068865_100029412 | Ga0068865_1000294122 | 412 |
| 691 | 3300009101 | Ga0105247_10151208 | Ga0105247_101512081 | 412 |
| 692 | 3300011119 | Ga0105246_10059364 | Ga0105246_100593642 | 412 |
| 693 | 3300013296 | Ga0157374_10228291 | Ga0157374_102282912 | 412 |
| 694 | 3300013308 | Ga0157375_10049425 | Ga0157375_100494253 | 412 |
| 695 | 3300014325 | Ga0163163_10322504 | Ga0163163_103225042 | 412 |
| 696 | 3300014969 | Ga0157376_10123486 | Ga0157376_101234862 | 412 |
| 697 | 3300021388 | Ga0213875_10000010 | Ga0213875_10000010309 | 412 |
| 698 | 3300025904 | Ga0207647_10005165 | Ga0207647_100051651 | 412 |
| 699 | 3300025907 | Ga0207645_10007779 | Ga0207645_100077794 | 412 |
| 700 | 3300025911 | Ga0207654_10025474 | Ga0207654_100254742 | 412 |
| 701 | 3300025933 | Ga0207706_10002082 | Ga0207706_100020827 | 412 |
| 702 | 3300025938 | Ga0207704_10090030 | Ga0207704_100900302 | 412 |
| 703 | 3300025940 | Ga0207691_10004168 | Ga0207691_100041682 | 412 |
| 704 | 3300025986 | Ga0207658_10049402 | Ga0207658_100494022 | 412 |
| 705 | 3300026023 | Ga0207677_10089427 | Ga0207677_100894272 | 412 |
| 706 | 3300026088 | Ga0207641_10131705 | Ga0207641_101317052 | 412 |
| 707 | 3300031249 | Ga0265339_10000003 | Ga0265339_10000003122 | 412 |
| 708 | 3300031595 | Ga0265313_10008773 | Ga0265313_100087732 | 412 |
| 709 | 3300035172 | Ga0373955_0133965 | Ga0373955_0133965_56_1321 | 412 |
| 710 | 3300037853 | Ga0436364_1448179 | Ga0436364_1448179_31740_32987 | 412 |
| 711 | 3300039438 | Ga0436360_1260787 | Ga0436360_1260787_4866_6104 | 412 |
| 712 | 3300039447 | Ga0436361_0212501 | Ga0436361_0212501_4118_5356 | 412 |
| 713 | 3300046543 | Ga0495645_0024032 | Ga0495645_0024032_1230_2516 | 412 |
| 714 | 3300055283 | Ga0500661_001376 | Ga0500661_001376_851_2095 | 412 |
| 715 | 3300005455 | Ga0070663_100120270 | Ga0070663_1001202702 | 413 |
| 716 | 3300026067 | Ga0207678_10197628 | Ga0207678_101976281 | 413 |
| 717 | 3300037471 | Ga0395905_0065349 | Ga0395905_0065349_1282_2727 | 413 |
| 718 | 3300005338 | Ga0068868_100077526 | Ga0068868_1000775263 | 414 |
| 719 | 3300006237 | Ga0097621_100012605 | Ga0097621_1000126053 | 414 |
| 720 | 3300006358 | Ga0068871_100006058 | Ga0068871_1000060584 | 414 |
| 721 | 3300009098 | Ga0105245_10152535 | Ga0105245_101525352 | 414 |
| 722 | 3300009176 | Ga0105242_10029841 | Ga0105242_100298412 | 414 |
| 723 | 3300009177 | Ga0105248_10045257 | Ga0105248_100452572 | 414 |
| 724 | 3300009545 | Ga0105237_10037392 | Ga0105237_100373924 | 414 |
| 725 | 3300013297 | Ga0157378_10115255 | Ga0157378_101152551 | 414 |
| 726 | 3300021384 | Ga0213876_10023174 | Ga0213876_100231743 | 414 |
| 727 | 3300025941 | Ga0207711_10029512 | Ga0207711_100295122 | 414 |
| 728 | 3300039437 | Ga0436365_0025297 | Ga0436365_0025297_1224_2504 | 414 |
| 729 | 3300046694 | Ga0495649_0036704 | Ga0495649_0036704_1081_2328 | 414 |
| 730 | 3300048918 | Ga0496115_0058603 | Ga0496115_0058603_754_2034 | 414 |
| 731 | 3300048929 | Ga0496126_0025286 | Ga0496126_0025286_3642_4886 | 414 |
| 732 | 3300000546 | LJNas_1000056 | LJNas_10000562 | 415 |
| 733 | 3300003316 | rootH1_10021801 | rootH1_100218016 | 415 |
| 734 | 3300005355 | Ga0070671_100190081 | Ga0070671_1001900812 | 415 |
| 735 | 3300010375 | Ga0105239_10136995 | Ga0105239_101369953 | 415 |
| 736 | 3300013307 | Ga0157372_10589504 | Ga0157372_105895041 | 415 |
| 737 | 3300025904 | Ga0207647_10056866 | Ga0207647_100568662 | 415 |
| 738 | 3300028800 | Ga0265338_10140036 | Ga0265338_101400362 | 415 |
| 739 | 3300046543 | Ga0495645_0045790 | Ga0495645_0045790_1680_2927 | 415 |
| 740 | 3300048915 | Ga0496112_0011557 | Ga0496112_0011557_3449_4696 | 415 |
| 741 | 3300053119 | Ga0500595_015262 | Ga0500595_015262_1332_2582 | 415 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wva-assembly1.cif.gz_A | takifugu rubripes vkor-like with vitamin k1 epoxide at non-catalytic state | 0.3545 | 167 | 339 |
| 3v5r-assembly1.cif.gz_A | crystal structure of the unliganded form of gal3p | 0.2937 | 124 | 298 |
| 3v5r-assembly1.cif.gz_B | crystal structure of the unliganded form of gal3p | 0.2407 | 124 | 298 |
| 7b9s-assembly1.cif.gz_S | structure of the mycobacterial esx-5 type vii secretion system hexameric pore complex | 0.2349 | 13 | 400 |
| 6i1r-assembly1.cif.gz_B | crystal structure of cmp bound cst in an outward facing conformation | 0.2343 | 31 | 406 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D6RYD7_309_451_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4553 | 253 | 366 | 1.10.287.70 |
| af_D3Z9X5_173_361_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4038 | 263 | 404 | 1.20.1250.20 |
| af_D6RYD7_309_451_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3945 | 253 | 366 | 1.10.287.70 |
| af_O94607_64_272_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3835 | 252 | 410 | 1.20.1250.20 |
| af_Q23063_235_438_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.383 | 256 | 400 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S7NY27-F1-model_v4 | DUF5009 domain-containing protein | 0.9954 | 36 | 415 |
GO:0016020
|
| AF-A0A7S7NY27-F1-model_v4 | DUF5009 domain-containing protein | 0.9902 | 36 | 415 |
GO:0016020
|
| AF-A0A3D8Y541-F1-model_v4 | DUF5009 domain-containing protein | 0.9893 | 44 | 415 |
GO:0016020
|
| AF-A0A7X2PK69-F1-model_v4 | DUF5009 domain-containing protein | 0.9891 | 36 | 312 |
GO:0016020
|
| AF-A0A1Q3WWR6-F1-model_v4 | DUF5009 domain-containing protein | 0.983 | 36 | 415 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar