F478608

General Info

Members Datasets Scaffolds Average Seq Length
741 325 733 396

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_018159|Ga0500555_018159_287_1666
Length 459
Sequence MGGESFGGNVEDCNCAGAWRVYAKKAIRSTLSKLTDIGCLQCPIPGGNMNGMTAPAASPSASVAMDEARSEPAARNLAMDAYRGVVMLLMMAEVLQLGQVASSFPGNWFWSVLAFNQTHVEWAGCSLHDMIQPSFSFLVGVALPYSIASRLAKGKTFGQLFGHALWRSLLLICLGIFLRSISRTQTNFTFEDTLTQIGLGYPFLFLLGFKQPKWQWTAFGAILFGYWLAWALYPAPGPGFDYQAVGVSADWTRNFTGFASHWNKNSNLGAAFDQWFLNLFPRSKPFIANHGGYLTLSFIPTLGTMILGLVAGRWLREAAPRIPIKRLLIAGVIGVAAGAILHFTGVCPVVKRIWTPGWTLFSGGICFLFLAAFSWIIETKGYRKWSFPLLVIGMNSIAAYLIAHLFEDFIVRAFHTHLGENVFKLFGAALEPFFAGVVVLSVYWLILFWMYRRKLFLKI

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
3 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
4 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
5 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
6 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
7 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
8 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
9 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
202 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
320 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
323 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.13
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 2.43
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000056 3300000546 Bacteria 15164
2 rootH1_10021801 3300003316 Bacteria 10044
3 rootH2_10000834 3300003320 Bacteria 40472
4 rootH2_10065350 3300003320 Bacteria 5620
5 rootL2_10040554 3300003322 Bacteria 3990
6 Ga0055536_1013742 3300003781 Bacteria 2892
7 Ga0058862_10082891 3300004803 Bacteria 1650
8 Ga0065165_1002669 3300005262 Bacteria 14411
9 Ga0065704_10126003 3300005289 Bacteria 1695
10 Ga0065712_10001332 3300005290 Bacteria 10210
11 Ga0065712_10094722 3300005290 Bacteria 2244
12 Ga0065715_10000764 3300005293 Bacteria 8500
13 Ga0065715_10114169 3300005293 Bacteria 2460
14 Ga0065707_10089478 3300005295 Bacteria 4357
15 Ga0065707_10109042 3300005295 Bacteria 2484
16 Ga0070658_10000848 3300005327 Bacteria 26068
17 Ga0070658_10014336 3300005327 Bacteria 6359
18 Ga0070676_10037906 3300005328 Bacteria 2782
19 Ga0070683_100000025 3300005329 Bacteria 173339
20 Ga0070683_100024371 3300005329 Bacteria 5419
21 Ga0070683_100097017 3300005329 Bacteria 2773
22 Ga0070683_100099260 3300005329 Bacteria 2740
23 Ga0070683_100281609 3300005329 Bacteria 1581
24 Ga0070670_100051222 3300005331 Bacteria 3546
25 Ga0070670_100104734 3300005331 Bacteria 2437
26 Ga0070670_100119660 3300005331 Bacteria 2271
27 Ga0070670_100120174 3300005331 Bacteria 2266
28 Ga0070666_10103166 3300005335 Bacteria 1967
29 Ga0070666_10109130 3300005335 Unclassified 1912
30 Ga0070680_100070350 3300005336 Bacteria 2874
31 Ga0070680_100208529 3300005336 Bacteria 1648
32 Ga0068868_100077526 3300005338 Bacteria 2659
33 Ga0068868_100108522 3300005338 Unclassified 2253
34 Ga0068868_100116323 3300005338 Bacteria 2177
35 Ga0068868_100196299 3300005338 Bacteria 1680
36 Ga0070660_100093924 3300005339 Unclassified 2369
37 Ga0070660_100155747 3300005339 Bacteria 1839
38 Ga0070660_100188992 3300005339 Bacteria 1668
39 Ga0070689_100003920 3300005340 Bacteria 9978
40 Ga0070689_100017655 3300005340 Bacteria 5245
41 Ga0070689_100127473 3300005340 Bacteria 2038
42 Ga0070689_100129025 3300005340 Bacteria 2026
43 Ga0070689_100149824 3300005340 Unclassified 1881
44 Ga0070687_100002461 3300005343 Bacteria 6958
45 Ga0070661_100013867 3300005344 Bacteria 5662
46 Ga0070668_100108577 3300005347 Unclassified 2207
47 Ga0070668_100110614 3300005347 Bacteria 2186
48 Ga0070668_100131325 3300005347 Bacteria 2010
49 Ga0070669_100019584 3300005353 Bacteria 4833
50 Ga0070669_100047310 3300005353 Bacteria 3138
51 Ga0070669_100047657 3300005353 Bacteria 3126
52 Ga0070675_100003042 3300005354 Bacteria 12665
53 Ga0070675_100014273 3300005354 Bacteria 6263
54 Ga0070675_100064238 3300005354 Bacteria 3035
55 Ga0070675_100105490 3300005354 Bacteria 2378
56 Ga0070675_100273102 3300005354 Bacteria 1484
57 Ga0070671_100028762 3300005355 Bacteria 4580
58 Ga0070671_100070003 3300005355 Bacteria 2926
59 Ga0070671_100190081 3300005355 Bacteria 1740
60 Ga0070674_100006619 3300005356 Bacteria 6774
61 Ga0070674_100007780 3300005356 Bacteria 6335
62 Ga0070673_100041061 3300005364 Bacteria 3553
63 Ga0070673_100153081 3300005364 Unclassified 1954
64 Ga0070688_100002565 3300005365 Bacteria 9204
65 Ga0070688_100007441 3300005365 Bacteria 5904
66 Ga0070659_100014105 3300005366 Bacteria 5963
67 Ga0070659_100175716 3300005366 Bacteria 1756
68 Ga0070667_100080536 3300005367 Bacteria 2785
69 Ga0070709_10052683 3300005434 Bacteria 2559
70 Ga0070713_100018432 3300005436 Bacteria 5305
71 Ga0070713_100047121 3300005436 Bacteria 3541
72 Ga0070713_100159221 3300005436 Bacteria 2014
73 Ga0070701_10004404 3300005438 Bacteria 5697
74 Ga0070711_100166271 3300005439 Unclassified 1677
75 Ga0070705_100004071 3300005440 Bacteria 7138
76 Ga0070663_100001367 3300005455 Bacteria 13359
77 Ga0070663_100075286 3300005455 Bacteria 2467
78 Ga0070663_100120270 3300005455 Bacteria 1983
79 Ga0070678_100233262 3300005456 Bacteria 1535
80 Ga0070678_100243531 3300005456 Bacteria 1505
81 Ga0070662_100042202 3300005457 Bacteria 3257
82 Ga0070662_100220768 3300005457 Bacteria 1512
83 Ga0070681_10019179 3300005458 Bacteria 6844
84 Ga0068867_100008892 3300005459 Bacteria 7086
85 Ga0068867_100035990 3300005459 Bacteria 3591
86 Ga0068867_100051771 3300005459 Bacteria 3029
87 Ga0070685_10010657 3300005466 Bacteria 4785
88 Ga0070685_10012600 3300005466 Bacteria 4445
89 Ga0070685_10110813 3300005466 Unclassified 1690
90 Ga0070706_100058873 3300005467 Bacteria 3545
91 Ga0070706_100113145 3300005467 Bacteria 2527
92 Ga0070707_100004528 3300005468 Bacteria 13017
93 Ga0070698_100002639 3300005471 Bacteria 19752
94 Ga0070698_100063132 3300005471 Bacteria 3735
95 Ga0070698_100177367 3300005471 Bacteria 2070
96 Ga0070699_100033901 3300005518 Bacteria 4411
97 Ga0070699_100181908 3300005518 Bacteria 1865
98 Ga0070699_100210879 3300005518 Bacteria 1729
99 Ga0070679_100021481 3300005530 Bacteria 6301
100 Ga0070679_100073584 3300005530 Unclassified 3408
101 Ga0070684_100000081 3300005535 Bacteria 62318
102 Ga0070684_100051298 3300005535 Bacteria 3584
103 Ga0070684_100155894 3300005535 Bacteria 2071
104 Ga0070684_100156440 3300005535 Bacteria 2067
105 Ga0070697_100019632 3300005536 Bacteria 5339
106 Ga0068853_100023789 3300005539 Bacteria 5132
107 Ga0070672_100022017 3300005543 Bacteria 4674
108 Ga0070672_100078788 3300005543 Bacteria 2636
109 Ga0070672_100377438 3300005543 Unclassified 1212
110 Ga0070686_100111565 3300005544 Unclassified 1864
111 Ga0070695_100107081 3300005545 Bacteria 1891
112 Ga0070696_100021132 3300005546 Bacteria 4413
113 Ga0070696_100051017 3300005546 Unclassified 2877
114 Ga0070696_100052322 3300005546 Bacteria 2841
115 Ga0070665_100008511 3300005548 Bacteria 10376
116 Ga0070665_100036479 3300005548 Bacteria 4945
117 Ga0070665_100195701 3300005548 Bacteria 2022
118 Ga0070665_100394970 3300005548 Unclassified 1391
119 Ga0070704_100002042 3300005549 Bacteria 11190
120 Ga0070704_100075811 3300005549 Bacteria 2458
121 Ga0070704_100133138 3300005549 Unclassified 1930
122 Ga0070704_100181602 3300005549 Bacteria 1683
123 Ga0068855_100010269 3300005563 Bacteria 11292
124 Ga0068855_100016620 3300005563 Bacteria 8848
125 Ga0068855_100027673 3300005563 Bacteria 6782
126 Ga0068855_100047054 3300005563 Bacteria 5097
127 Ga0068855_100217264 3300005563 Bacteria 2145
128 Ga0068857_100014212 3300005577 Bacteria 6934
129 Ga0068857_100094514 3300005577 Bacteria 2677
130 Ga0068854_100013772 3300005578 Bacteria 5317
131 Ga0068856_100009463 3300005614 Bacteria 9462
132 Ga0068856_100055580 3300005614 Unclassified 3907
133 Ga0068859_100005273 3300005617 Bacteria 13141
134 Ga0068859_100005827 3300005617 Bacteria 12511
135 Ga0068859_100059208 3300005617 Bacteria 3859
136 Ga0068859_100150810 3300005617 Bacteria 2400
137 Ga0068859_100196963 3300005617 Bacteria 2099
138 Ga0068859_100455743 3300005617 Unclassified 1375
139 Ga0068864_100013795 3300005618 Bacteria 6698
140 Ga0068864_100068386 3300005618 Bacteria 3086
141 Ga0068861_100045260 3300005719 Unclassified 3313
142 Ga0068861_100117718 3300005719 Bacteria 2138
143 Ga0068870_10021442 3300005840 Bacteria 3160
144 Ga0068863_100014070 3300005841 Bacteria 7710
145 Ga0068863_100020534 3300005841 Bacteria 6315
146 Ga0068858_100007346 3300005842 Bacteria 10663
147 Ga0068858_100008571 3300005842 Bacteria 9819
148 Ga0068858_100025804 3300005842 Bacteria 5466
149 Ga0068858_100065434 3300005842 Bacteria 3364
150 Ga0068858_100084463 3300005842 Unclassified 2953
151 Ga0068858_100208207 3300005842 Bacteria 1850
152 Ga0068858_100294351 3300005842 Bacteria 1548
153 Ga0068860_100007581 3300005843 Bacteria 10859
154 Ga0068862_100137245 3300005844 Bacteria 2168
155 Ga0068862_100192045 3300005844 Bacteria 1838
156 Ga0081455_10006375 3300005937 Bacteria 12663
157 Ga0081455_10009808 3300005937 Bacteria 9805
158 Ga0081540_1004612 3300005983 Bacteria 10428
159 Ga0070717_10002730 3300006028 Bacteria 12465
160 Ga0070717_10172477 3300006028 Bacteria 1882
161 Ga0070717_10283385 3300006028 Bacteria 1470
162 Ga0075368_10009032 3300006042 Bacteria 3577
163 Ga0075368_10011193 3300006042 Bacteria 3259
164 Ga0075363_100025366 3300006048 Bacteria 3023
165 Ga0075367_10030280 3300006178 Bacteria 3102
166 Ga0075367_10031757 3300006178 Bacteria 3034
167 Ga0075366_10000788 3300006195 Bacteria 15172
168 Ga0075366_10004241 3300006195 Bacteria 7686
169 Ga0097621_100012605 3300006237 Bacteria 6272
170 Ga0097621_100110952 3300006237 Bacteria 2317
171 Ga0097621_100231346 3300006237 Unclassified 1614
172 Ga0097621_100244937 3300006237 Bacteria 1568
173 Ga0068871_100006058 3300006358 Bacteria 8506
174 Ga0068871_100071452 3300006358 Bacteria 2854
175 Ga0068871_100112201 3300006358 Bacteria 2294
176 Ga0075428_100001649 3300006844 Bacteria 23746
177 Ga0075428_100012727 3300006844 Bacteria 9358
178 Ga0075428_100088636 3300006844 Bacteria 3375
179 Ga0075428_100100854 3300006844 Bacteria 3147
180 Ga0075430_100079212 3300006846 Bacteria 2754
181 Ga0075430_100103009 3300006846 Bacteria 2383
182 Ga0075431_100005399 3300006847 Bacteria 12625
183 Ga0075431_100008610 3300006847 Bacteria 10216
184 Ga0075431_100041216 3300006847 Bacteria 4760
185 Ga0075431_100066605 3300006847 Unclassified 3718
186 Ga0075431_100080394 3300006847 Bacteria 3365
187 Ga0075431_100083161 3300006847 Bacteria 3304
188 Ga0075431_100153208 3300006847 Bacteria 2373
189 Ga0075431_100235815 3300006847 Bacteria 1863
190 Ga0075433_10000557 3300006852 Bacteria 24575
191 Ga0075433_10013146 3300006852 Bacteria 6719
192 Ga0075434_100020592 3300006871 Bacteria 6400
193 Ga0075434_100184858 3300006871 Bacteria 2105
194 Ga0075429_100065325 3300006880 Bacteria 3167
195 Ga0075429_100078638 3300006880 Unclassified 2875
196 Ga0068865_100029412 3300006881 Bacteria 3645
197 Ga0068865_100077123 3300006881 Bacteria 2380
198 Ga0068865_100277603 3300006881 Unclassified 1333
199 Ga0097620_100005273 3300006931 Bacteria 13141
200 Ga0097620_100005827 3300006931 Bacteria 12511
201 Ga0097620_100059209 3300006931 Bacteria 3859
202 Ga0097620_100150806 3300006931 Bacteria 2400
203 Ga0097620_100196951 3300006931 Bacteria 2099
204 Ga0097620_100455688 3300006931 Unclassified 1375
205 Ga0105240_10000070 3300009093 Bacteria 204666
206 Ga0105240_10001027 3300009093 Bacteria 49580
207 Ga0105240_10001247 3300009093 Bacteria 44160
208 Ga0105240_10049930 3300009093 Bacteria 5277
209 Ga0105240_10060269 3300009093 Bacteria 4731
210 Ga0105240_10067231 3300009093 Bacteria 4442
211 Ga0105240_10069634 3300009093 Bacteria 4354
212 Ga0105240_10148641 3300009093 Bacteria 2792
213 Ga0111539_10000718 3300009094 Bacteria 43055
214 Ga0111539_10027884 3300009094 Bacteria 6896
215 Ga0111539_10055409 3300009094 Bacteria 4713
216 Ga0111539_10082199 3300009094 Bacteria 3788
217 Ga0111539_10176709 3300009094 Bacteria 2494
218 Ga0111539_10193724 3300009094 Bacteria 2371
219 Ga0111539_10246906 3300009094 Bacteria 2078
220 Ga0105245_10094876 3300009098 Bacteria 2751
221 Ga0105245_10152535 3300009098 Bacteria 2186
222 Ga0105247_10151208 3300009101 Bacteria 1530
223 Ga0114129_10017840 3300009147 Bacteria 10107
224 Ga0114129_10027379 3300009147 Bacteria 8071
225 Ga0114129_10027783 3300009147 Bacteria 8011
226 Ga0114129_10075528 3300009147 Bacteria 4692
227 Ga0114129_10152937 3300009147 Bacteria 3157
228 Ga0114129_10295938 3300009147 Bacteria 2159
229 Ga0114129_10330056 3300009147 Bacteria 2026
230 Ga0114129_10451261 3300009147 Bacteria 1686
231 Ga0105243_10015246 3300009148 Bacteria 5815
232 Ga0105241_10071173 3300009174 Bacteria 2699
233 Ga0105241_10282633 3300009174 Bacteria 1418
234 Ga0105242_10029841 3300009176 Bacteria 4352
235 Ga0105242_10073346 3300009176 Bacteria 2845
236 Ga0105242_10086771 3300009176 Bacteria 2627
237 Ga0105242_10102790 3300009176 Bacteria 2423
238 Ga0105248_10000006 3300009177 Bacteria 595060
239 Ga0105248_10002333 3300009177 Bacteria 21050
240 Ga0105248_10019873 3300009177 Bacteria 7439
241 Ga0105248_10027925 3300009177 Bacteria 6283
242 Ga0105248_10037941 3300009177 Bacteria 5390
243 Ga0105248_10045257 3300009177 Bacteria 4935
244 Ga0105248_10196554 3300009177 Bacteria 2272
245 Ga0105248_10378119 3300009177 Bacteria 1594
246 Ga0105248_10408245 3300009177 Bacteria 1529
247 Ga0105237_10003800 3300009545 Bacteria 17746
248 Ga0105237_10037392 3300009545 Bacteria 4907
249 Ga0105237_10052420 3300009545 Bacteria 4095
250 Ga0105237_10262061 3300009545 Bacteria 1731
251 Ga0105237_10434416 3300009545 Bacteria 1318
252 Ga0105238_10124476 3300009551 Bacteria 2557
253 Ga0105249_10038757 3300009553 Bacteria 4324
254 Ga0105249_10278689 3300009553 Bacteria 1669
255 Ga0105239_10015044 3300010375 Bacteria 8577
256 Ga0105239_10023560 3300010375 Bacteria 6780
257 Ga0105239_10033071 3300010375 Bacteria 5680
258 Ga0105239_10070244 3300010375 Unclassified 3846
259 Ga0105239_10136995 3300010375 Bacteria 2726
260 Ga0105239_10154868 3300010375 Bacteria 2559
261 Ga0105239_10191319 3300010375 Bacteria 2290
262 Ga0105239_10436691 3300010375 Bacteria 1484
263 Ga0105246_10059364 3300011119 Bacteria 2653
264 Ga0105246_10067674 3300011119 Bacteria 2503
265 Ga0157373_10143924 3300013100 Bacteria 1676
266 Ga0157371_10021140 3300013102 Bacteria 4781
267 Ga0157371_10097711 3300013102 Bacteria 2082
268 Ga0157370_10008478 3300013104 Bacteria 11089
269 Ga0157370_10015889 3300013104 Bacteria 7638
270 Ga0157370_10029360 3300013104 Bacteria 5397
271 Ga0157370_10049962 3300013104 Bacteria 3999
272 Ga0157369_10000761 3300013105 Bacteria 41595
273 Ga0157369_10006935 3300013105 Bacteria 13072
274 Ga0157369_10019836 3300013105 Bacteria 7523
275 Ga0157369_10028083 3300013105 Bacteria 6230
276 Ga0157369_10032575 3300013105 Bacteria 5731
277 Ga0157369_10047133 3300013105 Bacteria 4682
278 Ga0157369_10082376 3300013105 Bacteria 3442
279 Ga0157369_10103316 3300013105 Bacteria 3036
280 Ga0157369_10132325 3300013105 Bacteria 2642
281 Ga0157369_10257927 3300013105 Bacteria 1819
282 Ga0157369_10489170 3300013105 Bacteria 1273
283 Ga0157374_10006256 3300013296 Bacteria 10096
284 Ga0157374_10017060 3300013296 Bacteria 6392
285 Ga0157374_10216463 3300013296 Bacteria 1879
286 Ga0157374_10228291 3300013296 Bacteria 1828
287 Ga0157378_10000186 3300013297 Bacteria 59580
288 Ga0157378_10043353 3300013297 Bacteria 3995
289 Ga0157378_10051792 3300013297 Bacteria 3652
290 Ga0157378_10115255 3300013297 Bacteria 2469
291 Ga0163162_10006096 3300013306 Bacteria 11672
292 Ga0163162_10068710 3300013306 Bacteria 3595
293 Ga0163162_10077440 3300013306 Bacteria 3389
294 Ga0157372_10000267 3300013307 Bacteria 57578
295 Ga0157372_10037643 3300013307 Bacteria 5337
296 Ga0157372_10118638 3300013307 Unclassified 3036
297 Ga0157372_10194905 3300013307 Bacteria 2347
298 Ga0157372_10217297 3300013307 Bacteria 2215
299 Ga0157372_10226119 3300013307 Bacteria 2169
300 Ga0157372_10589504 3300013307 Unclassified 1296
301 Ga0157375_10000006 3300013308 Bacteria 384086
302 Ga0157375_10049425 3300013308 Bacteria 4121
303 Ga0163163_10000114 3300014325 Bacteria 86190
304 Ga0163163_10027947 3300014325 Bacteria 5410
305 Ga0163163_10150403 3300014325 Unclassified 2372
306 Ga0163163_10180857 3300014325 Bacteria 2156
307 Ga0163163_10310261 3300014325 Bacteria 1630
308 Ga0163163_10322504 3300014325 Bacteria 1598
309 Ga0157377_10031080 3300014745 Bacteria 2899
310 Ga0157379_10069441 3300014968 Bacteria 3151
311 Ga0157376_10004315 3300014969 Bacteria 9879
312 Ga0157376_10012850 3300014969 Bacteria 6228
313 Ga0157376_10123486 3300014969 Bacteria 2299
314 Ga0157376_10206763 3300014969 Bacteria 1810
315 Ga0213874_10004343 3300021377 Unclassified 3225
316 Ga0213876_10007028 3300021384 Bacteria 6135
317 Ga0213876_10023174 3300021384 Bacteria 3280
318 Ga0213875_10000004 3300021388 Bacteria 703388
319 Ga0213875_10000010 3300021388 Bacteria 370268
320 Ga0209676_1000334 3300025292 Bacteria 90392
321 Ga0207697_10022579 3300025315 Bacteria 2577
322 Ga0207653_10008387 3300025885 Bacteria 3219
323 Ga0207680_10009744 3300025903 Bacteria 4779
324 Ga0207647_10005165 3300025904 Bacteria 9600
325 Ga0207647_10013713 3300025904 Bacteria 5612
326 Ga0207647_10056866 3300025904 Unclassified 2399
327 Ga0207699_10128200 3300025906 Bacteria 1651
328 Ga0207645_10007779 3300025907 Bacteria 7544
329 Ga0207645_10075425 3300025907 Bacteria 2159
330 Ga0207705_10001870 3300025909 Bacteria 16522
331 Ga0207705_10001971 3300025909 Bacteria 15987
332 Ga0207705_10011962 3300025909 Archaea 6271
333 Ga0207684_10012510 3300025910 Bacteria 7378
334 Ga0207654_10025474 3300025911 Bacteria 3191
335 Ga0207707_10003273 3300025912 Bacteria 14387
336 Ga0207707_10081111 3300025912 Bacteria 2832
337 Ga0207695_10000155 3300025913 Bacteria 204627
338 Ga0207695_10034371 3300025913 Bacteria 5514
339 Ga0207695_10034843 3300025913 Bacteria 5468
340 Ga0207671_10031032 3300025914 Unclassified 3984
341 Ga0207671_10036179 3300025914 Bacteria 3660
342 Ga0207663_10141507 3300025916 Unclassified 1677
343 Ga0207662_10003096 3300025918 Bacteria 8495
344 Ga0207657_10001250 3300025919 Bacteria 27173
345 Ga0207657_10155743 3300025919 Unclassified 1858
346 Ga0207657_10171558 3300025919 Bacteria 1757
347 Ga0207652_10131929 3300025921 Bacteria 2229
348 Ga0207646_10007340 3300025922 Bacteria 11226
349 Ga0207681_10152080 3300025923 Bacteria 1735
350 Ga0207694_10208881 3300025924 Bacteria 1590
351 Ga0207694_10279898 3300025924 Bacteria 1370
352 Ga0207650_10040838 3300025925 Bacteria 3397
353 Ga0207659_10073194 3300025926 Bacteria 2508
354 Ga0207687_10075483 3300025927 Bacteria 2419
355 Ga0207700_10114066 3300025928 Bacteria 2180
356 Ga0207644_10057636 3300025931 Bacteria 2805
357 Ga0207644_10065084 3300025931 Bacteria 2650
358 Ga0207706_10002082 3300025933 Bacteria 19571
359 Ga0207706_10050397 3300025933 Bacteria 3679
360 Ga0207686_10080076 3300025934 Bacteria 2129
361 Ga0207670_10006169 3300025936 Bacteria 6631
362 Ga0207670_10037664 3300025936 Bacteria 3153
363 Ga0207670_10069417 3300025936 Bacteria 2431
364 Ga0207670_10087719 3300025936 Unclassified 2192
365 Ga0207669_10015523 3300025937 Bacteria 3843
366 Ga0207669_10084472 3300025937 Bacteria 2046
367 Ga0207704_10090030 3300025938 Bacteria 2012
368 Ga0207704_10216287 3300025938 Unclassified 1414
369 Ga0207665_10002112 3300025939 Bacteria 13438
370 Ga0207691_10004168 3300025940 Bacteria 14051
371 Ga0207691_10005074 3300025940 Bacteria 12709
372 Ga0207691_10042260 3300025940 Bacteria 4203
373 Ga0207691_10076821 3300025940 Bacteria 3009
374 Ga0207711_10000007 3300025941 Bacteria 759410
375 Ga0207711_10029512 3300025941 Bacteria 4627
376 Ga0207711_10037970 3300025941 Bacteria 4094
377 Ga0207711_10042834 3300025941 Bacteria 3858
378 Ga0207711_10074610 3300025941 Bacteria 2950
379 Ga0207661_10000028 3300025944 Bacteria 173347
380 Ga0207661_10021488 3300025944 Bacteria 4835
381 Ga0207661_10285941 3300025944 Bacteria 1475
382 Ga0207667_10003111 3300025949 Bacteria 20535
383 Ga0207667_10003396 3300025949 Bacteria 19648
384 Ga0207667_10006749 3300025949 Bacteria 13854
385 Ga0207667_10032734 3300025949 Bacteria 5597
386 Ga0207667_10269767 3300025949 Bacteria 1740
387 Ga0207640_10009712 3300025981 Bacteria 5393
388 Ga0207658_10049402 3300025986 Bacteria 3091
389 Ga0207677_10089427 3300026023 Bacteria 2235
390 Ga0207703_10008377 3300026035 Bacteria 8174
391 Ga0207703_10014241 3300026035 Bacteria 6203
392 Ga0207703_10021959 3300026035 Bacteria 4998
393 Ga0207703_10127776 3300026035 Bacteria 2191
394 Ga0207703_10323425 3300026035 Bacteria 1413
395 Ga0207639_10038164 3300026041 Bacteria 3571
396 Ga0207639_10167809 3300026041 Bacteria 1856
397 Ga0207678_10001220 3300026067 Bacteria 23642
398 Ga0207678_10018316 3300026067 Bacteria 6150
399 Ga0207678_10025932 3300026067 Bacteria 5115
400 Ga0207678_10033266 3300026067 Bacteria 4493
401 Ga0207678_10079776 3300026067 Unclassified 2802
402 Ga0207678_10123512 3300026067 Bacteria 2209
403 Ga0207678_10197628 3300026067 Bacteria 1719
404 Ga0207708_10012693 3300026075 Bacteria 6282
405 Ga0207702_10003888 3300026078 Bacteria 13453
406 Ga0207702_10081912 3300026078 Bacteria 2804
407 Ga0207702_10090239 3300026078 Unclassified 2681
408 Ga0207702_10122783 3300026078 Bacteria 2327
409 Ga0207641_10014293 3300026088 Bacteria 6505
410 Ga0207641_10020857 3300026088 Bacteria 5386
411 Ga0207641_10099278 3300026088 Unclassified 2561
412 Ga0207641_10131705 3300026088 Bacteria 2246
413 Ga0207648_10002638 3300026089 Bacteria 19159
414 Ga0207648_10018655 3300026089 Bacteria 6278
415 Ga0207676_10060944 3300026095 Bacteria 2986
416 Ga0207674_10010954 3300026116 Bacteria 10206
417 Ga0207674_10013089 3300026116 Bacteria 9234
418 Ga0207674_10015676 3300026116 Bacteria 8320
419 Ga0207674_10020810 3300026116 Bacteria 7080
420 Ga0207674_10131474 3300026116 Bacteria 2466
421 Ga0207675_100005876 3300026118 Bacteria 11709
422 Ga0207683_10051115 3300026121 Bacteria 3621
423 Ga0207683_10170617 3300026121 Bacteria 1970
424 Ga0207683_10253599 3300026121 Bacteria 1606
425 Ga0209813_10005301 3300027866 Bacteria 3121
426 Ga0207428_10000076 3300027907 Bacteria 137126
427 Ga0207428_10002419 3300027907 Bacteria 18628
428 Ga0268266_10004840 3300028379 Bacteria 12786
429 Ga0268266_10083577 3300028379 Unclassified 2787
430 Ga0268265_10108697 3300028380 Bacteria 2258
431 Ga0268264_10015477 3300028381 Bacteria 6253
432 Ga0268264_10026906 3300028381 Bacteria 4698
433 Ga0268264_10039520 3300028381 Bacteria 3898
434 Ga0307515_10001558 3300028794 Bacteria 51155
435 Ga0307515_10001965 3300028794 Bacteria 45521
436 Ga0307515_10081018 3300028794 Bacteria 4223
437 Ga0265338_10140036 3300028800 Bacteria 1896
438 Ga0265338_10228017 3300028800 Unclassified 1387
439 Ga0265339_10000003 3300031249 Bacteria 305994
440 Ga0265339_10000414 3300031249 Bacteria 33687
441 Ga0265331_10047387 3300031250 Bacteria 2068
442 Ga0265327_10000864 3300031251 Bacteria 44992
443 Ga0265327_10009571 3300031251 Bacteria 6966
444 Ga0265316_10005470 3300031344 Bacteria 12328
445 Ga0265313_10004999 3300031595 Bacteria 9919
446 Ga0265313_10008773 3300031595 Bacteria 6670
447 Ga0316579_10052262 3300031691 Unclassified 1913
448 Ga0265314_10009686 3300031711 Bacteria 8107
449 Ga0316578_10016988 3300031728 Bacteria 3951
450 Ga0316577_10040972 3300031733 Unclassified 2590
451 Ga0373953_0006737 3300035117 Bacteria 3805
452 Ga0373955_0034108 3300035172 Bacteria 2685
453 Ga0373955_0133965 3300035172 Bacteria 1448
454 Ga0316574_0012187 3300035398 Bacteria 4913
455 Ga0373947_0228641 3300035725 Bacteria 1225
456 Ga0373937_0073054 3300036401 Bacteria 3164
457 Ga0395905_0051753 3300037471 Bacteria 3847
458 Ga0395905_0065349 3300037471 Unclassified 3406
459 Ga0436364_0287993 3300037853 Bacteria 1390
460 Ga0436364_0748068 3300037853 Bacteria 528910
461 Ga0436364_1102173 3300037853 Bacteria 2511
462 Ga0436364_1118947 3300037853 Bacteria 12844
463 Ga0436364_1328097 3300037853 Bacteria 6210
464 Ga0436364_1380174 3300037853 Bacteria 3115
465 Ga0436364_1448179 3300037853 Bacteria 40988
466 Ga0436365_0025297 3300039437 Bacteria 5515
467 Ga0436365_0874592 3300039437 Bacteria 5211
468 Ga0436365_0940540 3300039437 Unclassified 3813
469 Ga0436360_1260787 3300039438 Bacteria 13404
470 Ga0436361_0212501 3300039447 Bacteria 5939
471 Ga0436361_0970042 3300039447 Bacteria 24944
472 Ga0436363_0466760 3300039450 Unclassified 3118
473 Ga0436363_0655318 3300039450 Bacteria 5952
474 Ga0436363_1493048 3300039450 Unclassified 1230
475 Ga0436362_0081182 3300039453 Bacteria 4786
476 Ga0450920_005319 3300042122 Bacteria 2283
477 Ga0450894_005481 3300042131 Bacteria 1642
478 Ga0451577_0000415 3300042876 Bacteria 77375
479 Ga0451577_0047666 3300042876 Bacteria 3831
480 Ga0466969_0049277 3300044656 Bacteria 2079
481 Ga0466963_0178111 3300044694 Unclassified 1484
482 Ga0453684_0012862 3300044712 Bacteria 13711
483 Ga0453684_0018147 3300044712 Bacteria 10830
484 Ga0453684_0032195 3300044712 Bacteria 7347
485 Ga0451576_0061865 3300045051 Bacteria 3904
486 Ga0451576_0126855 3300045051 Bacteria 2659
487 Ga0451576_0134030 3300045051 Bacteria 2583
488 Ga0451576_0181875 3300045051 Bacteria 2195
489 Ga0451576_0354290 3300045051 Bacteria 1537
490 Ga0466967_0042628 3300045976 Unclassified 3923
491 Ga0495603_0018137 3300046455 Bacteria 4257
492 Ga0495629_0007685 3300046459 Bacteria 7931
493 Ga0495629_0007912 3300046459 Bacteria 7821
494 Ga0495629_0040130 3300046459 Bacteria 3293
495 Ga0495629_0127382 3300046459 Bacteria 1774
496 Ga0495651_0024335 3300046462 Bacteria 4712
497 Ga0495651_0038727 3300046462 Bacteria 3712
498 Ga0495650_0000010 3300046471 Bacteria 645599
499 Ga0495650_0001937 3300046471 Bacteria 18300
500 Ga0495580_0019306 3300046472 Bacteria 5065
501 Ga0495580_0044131 3300046472 Bacteria 3172
502 Ga0495580_0060554 3300046472 Bacteria 2659
503 Ga0495580_0150849 3300046472 Bacteria 1610
504 Ga0495582_0001434 3300046473 Bacteria 13440
505 Ga0495582_0015257 3300046473 Unclassified 4223
506 Ga0495639_0012708 3300046475 Bacteria 3631
507 Ga0495639_0058652 3300046475 Unclassified 1761
508 Ga0495662_0009845 3300046476 Bacteria 4695
509 Ga0495662_0019464 3300046476 Bacteria 3283
510 Ga0495662_0033886 3300046476 Bacteria 2467
511 Ga0495664_0003914 3300046477 Bacteria 8124
512 Ga0495664_0004826 3300046477 Bacteria 7371
513 Ga0495664_0049269 3300046477 Bacteria 2501
514 Ga0495585_0050865 3300046492 Bacteria 2297
515 Ga0495594_0000839 3300046499 Bacteria 15860
516 Ga0495594_0004163 3300046499 Bacteria 7431
517 Ga0495594_0010970 3300046499 Unclassified 4704
518 Ga0495596_0023221 3300046500 Bacteria 2518
519 Ga0495583_0039052 3300046506 Bacteria 2239
520 Ga0495608_0138734 3300046511 Bacteria 1552
521 Ga0495628_0022923 3300046516 Bacteria 5125
522 Ga0495628_0026914 3300046516 Bacteria 4682
523 Ga0495628_0173664 3300046516 Bacteria 1633
524 Ga0495630_0000067 3300046517 Bacteria 84296
525 Ga0495630_0001523 3300046517 Bacteria 16055
526 Ga0495630_0002241 3300046517 Bacteria 13459
527 Ga0495630_0100265 3300046517 Bacteria 2191
528 Ga0495644_0000099 3300046523 Bacteria 42055
529 Ga0495644_0006967 3300046523 Bacteria 4375
530 Ga0495648_0009612 3300046524 Bacteria 7463
531 Ga0495666_0001694 3300046526 Bacteria 10891
532 Ga0495666_0005855 3300046526 Bacteria 6193
533 Ga0495666_0008272 3300046526 Bacteria 5213
534 Ga0495666_0014471 3300046526 Unclassified 3929
535 Ga0495642_0042291 3300046528 Bacteria 1856
536 Ga0495652_0017097 3300046529 Bacteria 6476
537 Ga0495652_0026023 3300046529 Bacteria 5171
538 Ga0495654_0049651 3300046530 Bacteria 2054
539 Ga0495665_0000838 3300046531 Bacteria 16077
540 Ga0495665_0022464 3300046531 Bacteria 3392
541 Ga0495665_0034260 3300046531 Unclassified 2715
542 Ga0495640_0010837 3300046533 Bacteria 7033
543 Ga0495640_0049488 3300046533 Bacteria 2898
544 Ga0495640_0102934 3300046533 Unclassified 1873
545 Ga0495640_0143606 3300046533 Bacteria 1537
546 Ga0495586_0000028 3300046535 Bacteria 97992
547 Ga0495586_0002759 3300046535 Bacteria 9494
548 Ga0495586_0022539 3300046535 Unclassified 3361
549 Ga0495609_0015332 3300046538 Bacteria 3589
550 Ga0495609_0021625 3300046538 Bacteria 2968
551 Ga0495609_0036528 3300046538 Bacteria 2218
552 Ga0495621_0025977 3300046539 Bacteria 1972
553 Ga0495645_0017124 3300046543 Bacteria 5191
554 Ga0495645_0021405 3300046543 Bacteria 4674
555 Ga0495645_0024032 3300046543 Bacteria 4418
556 Ga0495645_0045790 3300046543 Unclassified 3192
557 Ga0495645_0068677 3300046543 Unclassified 2558
558 Ga0495622_0050982 3300046557 Bacteria 1920
559 Ga0495633_0000012 3300046558 Bacteria 267875
560 Ga0495633_0021756 3300046558 Bacteria 3203
561 Ga0495667_0025101 3300046559 Bacteria 4018
562 Ga0495667_0135900 3300046559 Bacteria 1585
563 Ga0495668_0000055 3300046616 Bacteria 199412
564 Ga0495668_0012615 3300046616 Bacteria 5009
565 Ga0495634_0002918 3300046642 Bacteria 13996
566 Ga0495634_0032974 3300046642 Bacteria 3560
567 Ga0495625_0001326 3300046660 Bacteria 30769
568 Ga0495625_0002936 3300046660 Bacteria 17782
569 Ga0495625_0006996 3300046660 Bacteria 9940
570 Ga0495625_0029436 3300046660 Bacteria 4107
571 Ga0495625_0038125 3300046660 Bacteria 3520
572 Ga0495599_0033278 3300046678 Bacteria 3239
573 Ga0495599_0036295 3300046678 Bacteria 3095
574 Ga0495623_0063390 3300046679 Bacteria 2314
575 Ga0495623_0092199 3300046679 Bacteria 1857
576 Ga0495646_0054553 3300046680 Bacteria 2403
577 Ga0495647_0005977 3300046681 Bacteria 4011
578 Ga0495669_0023720 3300046684 Bacteria 2672
579 Ga0495613_0003192 3300046689 Bacteria 12271
580 Ga0495613_0011918 3300046689 Bacteria 6462
581 Ga0495613_0072422 3300046689 Bacteria 2512
582 Ga0495624_0031455 3300046690 Bacteria 3450
583 Ga0495670_0036058 3300046691 Bacteria 2464
584 Ga0495671_0047542 3300046692 Bacteria 2144
585 Ga0495649_0036704 3300046694 Bacteria 2692
586 Ga0495649_0039627 3300046694 Bacteria 2583
587 Ga0495600_0006321 3300046809 Bacteria 7200
588 Ga0495581_0035002 3300047315 Bacteria 2906
589 Ga0495581_0038449 3300047315 Unclassified 2769
590 Ga0495581_0051332 3300047315 Bacteria 2381
591 Ga0495604_0124166 3300047317 Bacteria 1864
592 Ga0495674_0019151 3300047319 Bacteria 6358
593 Ga0495674_0019728 3300047319 Bacteria 6253
594 Ga0495674_0032717 3300047319 Bacteria 4714
595 Ga0495674_0035797 3300047319 Bacteria 4475
596 Ga0495674_0036420 3300047319 Unclassified 4429
597 Ga0495674_0061871 3300047319 Bacteria 3261
598 Ga0495674_0119646 3300047319 Bacteria 2226
599 Ga0495672_0001950 3300047320 Bacteria 19515
600 Ga0495676_0014107 3300047321 Bacteria 7154
601 Ga0495676_0031115 3300047321 Bacteria 4518
602 Ga0495680_0157636 3300047322 Bacteria 1650
603 Ga0495680_0233288 3300047322 Unclassified 1309
604 Ga0495675_0001482 3300047444 Bacteria 14212
605 Ga0495685_088423 3300047447 Bacteria 1028
606 Ga0495681_0101411 3300047470 Bacteria 1258
607 Ga0495684_0004226 3300047471 Bacteria 11213
608 Ga0495684_0006245 3300047471 Bacteria 9261
609 Ga0495684_0026964 3300047471 Bacteria 4414
610 Ga0495684_0052750 3300047471 Bacteria 3103
611 Ga0495684_0079863 3300047471 Bacteria 2483
612 Ga0495684_0178910 3300047471 Bacteria 1573
613 Ga0495684_0215508 3300047471 Bacteria 1410
614 Ga0495686_0059577 3300047472 Bacteria 2376
615 Ga0495593_0045755 3300047673 Bacteria 2334
616 Ga0495593_0095862 3300047673 Unclassified 1525
617 Ga0495602_0101452 3300048088 Bacteria 2360
618 Ga0495614_0006837 3300048089 Bacteria 5102
619 Ga0495614_0014429 3300048089 Bacteria 3458
620 Ga0495614_0028650 3300048089 Unclassified 2398
621 Ga0496102_0003059 3300048905 Bacteria 14166
622 Ga0496102_0255617 3300048905 Unclassified 1652
623 Ga0496103_0214332 3300048906 Bacteria 1238
624 Ga0496104_0073278 3300048907 Bacteria 3258
625 Ga0496106_0015026 3300048909 Bacteria 5730
626 Ga0496106_0147543 3300048909 Bacteria 1854
627 Ga0496108_0001958 3300048911 Bacteria 16495
628 Ga0496109_0000107 3300048912 Bacteria 86168
629 Ga0496109_0003299 3300048912 Bacteria 13474
630 Ga0496110_0014310 3300048913 Bacteria 6583
631 Ga0496111_0095199 3300048914 Bacteria 2185
632 Ga0496112_0004412 3300048915 Bacteria 11909
633 Ga0496112_0011557 3300048915 Bacteria 8067
634 Ga0496112_0045411 3300048915 Bacteria 4307
635 Ga0496112_0322746 3300048915 Bacteria 1488
636 Ga0496115_0013376 3300048918 Bacteria 6207
637 Ga0496115_0049678 3300048918 Unclassified 3358
638 Ga0496115_0058603 3300048918 Bacteria 3099
639 Ga0496120_0061358 3300048923 Bacteria 2099
640 Ga0496126_0000091 3300048929 Bacteria 209427
641 Ga0496126_0000458 3300048929 Bacteria 81208
642 Ga0496126_0025286 3300048929 Bacteria 5716
643 Ga0496126_0147431 3300048929 Bacteria 2020
644 Ga0496126_0239271 3300048929 Bacteria 1517
645 Ga0501031_0000903 3300049568 Bacteria 17865
646 Ga0501032_0030421 3300049569 Bacteria 3705
647 Ga0501034_0025321 3300049571 Bacteria 6040
648 Ga0501034_0232255 3300049571 Bacteria 1793
649 Ga0501034_0241501 3300049571 Bacteria 1752
650 Ga0501036_0000193 3300049572 Bacteria 40533
651 Ga0501036_0042608 3300049572 Bacteria 3843
652 Ga0501037_0016447 3300049573 Bacteria 5445
653 Ga0501039_0031667 3300049575 Bacteria 4078
654 Ga0501043_0003157 3300049579 Bacteria 13633
655 Ga0501043_0013453 3300049579 Bacteria 6400
656 Ga0501043_0136723 3300049579 Bacteria 1919
657 Ga0501046_0001054 3300049580 Bacteria 26975
658 Ga0501046_0002330 3300049580 Bacteria 17903
659 Ga0501046_0029127 3300049580 Bacteria 4492
660 Ga0501046_0037649 3300049580 Unclassified 3887
661 Ga0501046_0197739 3300049580 Bacteria 1497
662 Ga0501047_0003896 3300049581 Bacteria 14027
663 Ga0501047_0006499 3300049581 Bacteria 11003
664 Ga0501047_0079430 3300049581 Bacteria 3154
665 Ga0501047_0134510 3300049581 Bacteria 2352
666 Ga0501068_0006974 3300049584 Bacteria 6248
667 Ga0501069_0003963 3300049585 Bacteria 7636
668 Ga0501070_0017655 3300049586 Bacteria 5989
669 Ga0501070_0144123 3300049586 Bacteria 1966
670 Ga0501070_0148025 3300049586 Unclassified 1938
671 Ga0501072_0067008 3300049588 Bacteria 2832
672 Ga0501073_0013675 3300049589 Bacteria 5904
673 Ga0501073_0082471 3300049589 Bacteria 2237
674 Ga0501076_0044919 3300049592 Bacteria 3486
675 Ga0501077_0065671 3300049593 Bacteria 2301
676 Ga0501225_0033920 3300049705 Bacteria 1405
677 Ga0501079_0048872 3300049741 Bacteria 3265
678 Ga0501079_0118675 3300049741 Bacteria 2056
679 Ga0501080_0000281 3300049742 Bacteria 38399
680 Ga0501080_0005620 3300049742 Bacteria 11204
681 Ga0501080_0012697 3300049742 Bacteria 7725
682 Ga0501080_0110965 3300049742 Bacteria 2542
683 Ga0501081_0096913 3300049743 Bacteria 2081
684 Ga0501083_0034456 3300049744 Bacteria 3461
685 Ga0501035_0014070 3300049822 Bacteria 7382
686 Ga0501035_0036014 3300049822 Bacteria 4488
687 Ga0501035_0081642 3300049822 Bacteria 2853
688 Ga0501044_0002894 3300049823 Bacteria 19548
689 Ga0501044_0050456 3300049823 Bacteria 4293
690 Ga0501044_0295637 3300049823 Bacteria 1550
691 nmdc:mga00v17_53512_c1 3300050491 Bacteria 2460
692 nmdc:mga0k408_615_c1 3300050493 Bacteria 15215
693 nmdc:mga0k408_976_c1 3300050493 Bacteria 15718
694 nmdc:mga06z11_1666_c1 3300050494 Bacteria 8322
695 nmdc:mga04h51_6359_c1 3300050495 Bacteria 3059
696 nmdc:mga05p37_115747_c1 3300050507 Bacteria 3295
697 nmdc:mga05p37_189875_c1 3300050507 Bacteria 2495
698 nmdc:mga05p37_26590_c1 3300050507 Bacteria 7037
699 nmdc:mga05p37_402942_c1 3300050507 Bacteria 1597
700 nmdc:mga09592_106924_c1 3300050508 Bacteria 2400
701 nmdc:mga09592_196755_c1 3300050508 Bacteria 1745
702 nmdc:mga09592_57850_c1 3300050508 Bacteria 3278
703 nmdc:mga06r32_225268_c1 3300050510 Bacteria 1863
704 nmdc:mga06r32_287047_c1 3300050510 Bacteria 1632
705 nmdc:mga06r32_4439_c1 3300050510 Bacteria 12558
706 nmdc:mga08y16_101843_c1 3300050511 Bacteria 2990
707 nmdc:mga08y16_133821_c1 3300050511 Bacteria 2576
708 nmdc:mga08y16_152600_c1 3300050511 Bacteria 2401
709 nmdc:mga08y16_201774_c1 3300050511 Unclassified 2061
710 nmdc:mga08y16_517_c1 3300050511 Bacteria 35666
711 nmdc:mga0n895_176735_c1 3300050512 Bacteria 2166
712 nmdc:mga0rr50_413644_c1 3300050513 Bacteria 1140
713 nmdc:mga08x19_1552_c1 3300050514 Bacteria 14249
714 nmdc:mga0a205_30924_c1 3300050515 Bacteria 5128
715 nmdc:mga0a205_33746_c1 3300050515 Bacteria 4907
716 nmdc:mga0a205_543_c1 3300050515 Bacteria 29800
717 Ga0495601_0000415 3300053077 Bacteria 22311
718 Ga0495601_0010610 3300053077 Bacteria 5490
719 Ga0500643_011532 3300053087 Bacteria 3220
720 Ga0500651_0000002 3300053093 Bacteria 476609
721 Ga0500641_0010767 3300053096 Bacteria 3312
722 Ga0500555_003786 3300053103 Bacteria 4305
723 Ga0500555_018159 3300053103 Bacteria 2027
724 Ga0500595_000023 3300053119 Bacteria 147097
725 Ga0500595_015262 3300053119 Bacteria 2887
726 Ga0500616_0000386 3300053153 Bacteria 61360
727 Ga0500616_0002082 3300053153 Bacteria 17490
728 Ga0500661_001376 3300055283 Bacteria 4536
729 Ga0590071_001796 3300059421 Bacteria 5539
730 Ga0590077_002947 3300059426 Bacteria 3565
731 Ga0501082_0000708 3300060353 Bacteria 29299
732 Ga0501082_0016770 3300060353 Bacteria 6307
733 Ga0501082_0360747 3300060353 Bacteria 1267

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047447 Ga0495685_088423 Ga0495685_088423_45_1013 321
2 3300025924 Ga0207694_10208881 Ga0207694_102088814 325
3 3300048909 Ga0496106_0015026 Ga0496106_0015026_554_1561 330
4 3300003320 rootH2_10000834 rootH2_1000083418 337
5 3300048906 Ga0496103_0214332 Ga0496103_0214332_29_1051 339
6 3300005295 Ga0065707_10109042 Ga0065707_101090421 342
7 3300005354 Ga0070675_100064238 Ga0070675_1000642382 342
8 3300005466 Ga0070685_10110813 Ga0070685_101108132 342
9 3300005543 Ga0070672_100377438 Ga0070672_1003774382 342
10 3300025926 Ga0207659_10073194 Ga0207659_100731942 342
11 3300005546 Ga0070696_100051017 Ga0070696_1000510172 349
12 3300005549 Ga0070704_100133138 Ga0070704_1001331382 349
13 3300042876 Ga0451577_0000415 Ga0451577_0000415_33259_34485 349
14 3300044712 Ga0453684_0018147 Ga0453684_0018147_9191_10417 349
15 3300005290 Ga0065712_10001332 Ga0065712_100013324 353
16 3300005293 Ga0065715_10000764 Ga0065715_100007641 353
17 3300005331 Ga0070670_100051222 Ga0070670_1000512222 353
18 3300005338 Ga0068868_100108522 Ga0068868_1001085221 353
19 3300005347 Ga0070668_100108577 Ga0070668_1001085773 353
20 3300005353 Ga0070669_100047310 Ga0070669_1000473103 353
21 3300005354 Ga0070675_100003042 Ga0070675_1000030423 353
22 3300005364 Ga0070673_100153081 Ga0070673_1001530813 353
23 3300005365 Ga0070688_100002565 Ga0070688_1000025653 353
24 3300005459 Ga0068867_100051771 Ga0068867_1000517714 353
25 3300005466 Ga0070685_10012600 Ga0070685_100126004 353
26 3300005543 Ga0070672_100022017 Ga0070672_1000220174 353
27 3300005548 Ga0070665_100008511 Ga0070665_1000085114 353
28 3300005618 Ga0068864_100013795 Ga0068864_1000137953 353
29 3300005719 Ga0068861_100045260 Ga0068861_1000452605 353
30 3300005841 Ga0068863_100020534 Ga0068863_1000205345 353
31 3300006881 Ga0068865_100277603 Ga0068865_1002776032 353
32 3300009098 Ga0105245_10094876 Ga0105245_100948762 353
33 3300009176 Ga0105242_10086771 Ga0105242_100867713 353
34 3300009177 Ga0105248_10002333 Ga0105248_1000233315 353
35 3300009553 Ga0105249_10038757 Ga0105249_100387574 353
36 3300010375 Ga0105239_10154868 Ga0105239_101548682 353
37 3300011119 Ga0105246_10067674 Ga0105246_100676742 353
38 3300013306 Ga0163162_10077440 Ga0163162_100774403 353
39 3300014325 Ga0163163_10027947 Ga0163163_100279474 353
40 3300025292 Ga0209676_1000334 Ga0209676_100033465 353
41 3300025315 Ga0207697_10022579 Ga0207697_100225791 353
42 3300025925 Ga0207650_10040838 Ga0207650_100408382 353
43 3300025927 Ga0207687_10075483 Ga0207687_100754832 353
44 3300025938 Ga0207704_10216287 Ga0207704_102162871 353
45 3300025940 Ga0207691_10076821 Ga0207691_100768212 353
46 3300025941 Ga0207711_10074610 Ga0207711_100746103 353
47 3300026088 Ga0207641_10020857 Ga0207641_100208574 353
48 3300026089 Ga0207648_10018655 Ga0207648_100186552 353
49 3300026095 Ga0207676_10060944 Ga0207676_100609442 353
50 3300026121 Ga0207683_10051115 Ga0207683_100511153 353
51 3300048911 Ga0496108_0001958 Ga0496108_0001958_391_1500 353
52 3300048912 Ga0496109_0003299 Ga0496109_0003299_4395_5504 353
53 3300048913 Ga0496110_0014310 Ga0496110_0014310_5018_6127 353
54 3300048914 Ga0496111_0095199 Ga0496111_0095199_296_1405 353
55 3300048915 Ga0496112_0004412 Ga0496112_0004412_10738_11847 353
56 3300005563 Ga0068855_100047054 Ga0068855_1000470545 355
57 3300006237 Ga0097621_100244937 Ga0097621_1002449372 355
58 3300009174 Ga0105241_10282633 Ga0105241_102826332 355
59 3300013105 Ga0157369_10006935 Ga0157369_100069357 355
60 3300013296 Ga0157374_10216463 Ga0157374_102164631 355
61 3300014969 Ga0157376_10206763 Ga0157376_102067632 355
62 3300026041 Ga0207639_10167809 Ga0207639_101678092 355
63 3300026121 Ga0207683_10253599 Ga0207683_102535992 355
64 3300048918 Ga0496115_0013376 Ga0496115_0013376_114_1202 355
65 3300010375 Ga0105239_10436691 Ga0105239_104366912 356
66 3300003781 Ga0055536_1013742 Ga0055536_10137423 357
67 3300005262 Ga0065165_1002669 Ga0065165_10026694 357
68 3300005293 Ga0065715_10114169 Ga0065715_101141692 357
69 3300005356 Ga0070674_100006619 Ga0070674_1000066192 357
70 3300025937 Ga0207669_10015523 Ga0207669_100155231 357
71 3300026067 Ga0207678_10123512 Ga0207678_101235122 357
72 3300005331 Ga0070670_100120174 Ga0070670_1001201741 360
73 3300050513 nmdc:mga0rr50_413644_c1 nmdc:mga0rr50_413644_c1_44_1129 360
74 3300013105 Ga0157369_10082376 Ga0157369_100823764 361
75 3300013307 Ga0157372_10226119 Ga0157372_102261192 361
76 3300025921 Ga0207652_10131929 Ga0207652_101319292 361
77 3300049571 Ga0501034_0025321 Ga0501034_0025321_4697_5842 361
78 3300049580 Ga0501046_0197739 Ga0501046_0197739_74_1219 361
79 3300049581 Ga0501047_0006499 Ga0501047_0006499_4810_5955 361
80 3300049586 Ga0501070_0017655 Ga0501070_0017655_4048_5193 361
81 3300049823 Ga0501044_0050456 Ga0501044_0050456_2537_3682 361
82 3300048905 Ga0496102_0255617 Ga0496102_0255617_433_1557 362
83 3300009094 Ga0111539_10027884 Ga0111539_100278842 363
84 3300050511 nmdc:mga08y16_201774_c1 nmdc:mga08y16_201774_c1_469_1698 363
85 3300047320 Ga0495672_0001950 Ga0495672_0001950_4402_5556 366
86 3300048923 Ga0496120_0061358 Ga0496120_0061358_760_1884 367
87 3300048929 Ga0496126_0000458 Ga0496126_0000458_11034_12158 367
88 3300005329 Ga0070683_100099260 Ga0070683_1000992601 369
89 3300005518 Ga0070699_100210879 Ga0070699_1002108791 369
90 3300005535 Ga0070684_100155894 Ga0070684_1001558942 369
91 3300009093 Ga0105240_10001247 Ga0105240_1000124723 369
92 3300009176 Ga0105242_10102790 Ga0105242_101027903 369
93 3300009177 Ga0105248_10037941 Ga0105248_100379412 369
94 3300013105 Ga0157369_10489170 Ga0157369_104891702 369
95 3300025913 Ga0207695_10034843 Ga0207695_100348436 369
96 3300025924 Ga0207694_10279898 Ga0207694_102798981 369
97 3300048929 Ga0496126_0147431 Ga0496126_0147431_178_1302 369
98 3300009093 Ga0105240_10069634 Ga0105240_100696343 370
99 3300009177 Ga0105248_10019873 Ga0105248_100198735 370
100 3300009545 Ga0105237_10262061 Ga0105237_102620612 370
101 3300013306 Ga0163162_10006096 Ga0163162_100060967 370
102 3300014969 Ga0157376_10012850 Ga0157376_100128503 370
103 3300046472 Ga0495580_0060554 Ga0495580_0060554_1025_2152 370
104 3300046678 Ga0495599_0033278 Ga0495599_0033278_1907_3022 370
105 3300048907 Ga0496104_0073278 Ga0496104_0073278_590_1705 370
106 3300026078 Ga0207702_10081912 Ga0207702_100819122 371
107 3300039450 Ga0436363_1493048 Ga0436363_1493048_49_1164 371
108 3300005545 Ga0070695_100107081 Ga0070695_1001070811 372
109 3300013307 Ga0157372_10118638 Ga0157372_101186383 372
110 3300048929 Ga0496126_0239271 Ga0496126_0239271_302_1444 372
111 3300004803 Ga0058862_10082891 Ga0058862_100828912 373
112 3300005329 Ga0070683_100281609 Ga0070683_1002816092 373
113 3300005336 Ga0070680_100208529 Ga0070680_1002085292 373
114 3300005339 Ga0070660_100093924 Ga0070660_1000939242 373
115 3300005366 Ga0070659_100175716 Ga0070659_1001757162 373
116 3300005436 Ga0070713_100018432 Ga0070713_1000184325 373
117 3300005439 Ga0070711_100166271 Ga0070711_1001662711 373
118 3300005544 Ga0070686_100111565 Ga0070686_1001115652 373
119 3300005548 Ga0070665_100036479 Ga0070665_1000364793 373
120 3300005617 Ga0068859_100150810 Ga0068859_1001508102 373
121 3300005617 Ga0068859_100455743 Ga0068859_1004557431 373
122 3300005843 Ga0068860_100007581 Ga0068860_10000758116 373
123 3300006931 Ga0097620_100150806 Ga0097620_1001508061 373
124 3300006931 Ga0097620_100455688 Ga0097620_1004556881 373
125 3300013102 Ga0157371_10097711 Ga0157371_100977112 373
126 3300013105 Ga0157369_10103316 Ga0157369_101033163 373
127 3300013296 Ga0157374_10017060 Ga0157374_100170604 373
128 3300025912 Ga0207707_10081111 Ga0207707_100811113 373
129 3300025916 Ga0207663_10141507 Ga0207663_101415071 373
130 3300025937 Ga0207669_10084472 Ga0207669_100844721 373
131 3300025941 Ga0207711_10037970 Ga0207711_100379705 373
132 3300026088 Ga0207641_10099278 Ga0207641_100992782 373
133 3300026121 Ga0207683_10170617 Ga0207683_101706171 373
134 3300028379 Ga0268266_10004840 Ga0268266_100048403 373
135 3300028381 Ga0268264_10015477 Ga0268264_100154772 373
136 3300031251 Ga0265327_10000864 Ga0265327_1000086426 373
137 3300031595 Ga0265313_10004999 Ga0265313_100049996 373
138 3300037853 Ga0436364_0287993 Ga0436364_0287993_138_1334 373
139 3300042876 Ga0451577_0047666 Ga0451577_0047666_33_1181 373
140 3300044694 Ga0466963_0178111 Ga0466963_0178111_71_1192 373
141 3300044712 Ga0453684_0032195 Ga0453684_0032195_2551_3675 373
142 3300045051 Ga0451576_0061865 Ga0451576_0061865_441_1562 373
143 3300046459 Ga0495629_0007912 Ga0495629_0007912_5780_6904 373
144 3300046462 Ga0495651_0038727 Ga0495651_0038727_1627_2751 373
145 3300046471 Ga0495650_0001937 Ga0495650_0001937_10015_11139 373
146 3300046472 Ga0495580_0150849 Ga0495580_0150849_295_1419 373
147 3300046473 Ga0495582_0001434 Ga0495582_0001434_12121_13245 373
148 3300046475 Ga0495639_0012708 Ga0495639_0012708_282_1406 373
149 3300046476 Ga0495662_0009845 Ga0495662_0009845_3134_4258 373
150 3300046477 Ga0495664_0003914 Ga0495664_0003914_3698_4822 373
151 3300046492 Ga0495585_0050865 Ga0495585_0050865_1132_2256 373
152 3300046499 Ga0495594_0000839 Ga0495594_0000839_5722_6846 373
153 3300046516 Ga0495628_0022923 Ga0495628_0022923_1860_2984 373
154 3300046517 Ga0495630_0100265 Ga0495630_0100265_1021_2145 373
155 3300046526 Ga0495666_0001694 Ga0495666_0001694_6704_7828 373
156 3300046529 Ga0495652_0017097 Ga0495652_0017097_192_1316 373
157 3300046531 Ga0495665_0000838 Ga0495665_0000838_4862_5986 373
158 3300046533 Ga0495640_0010837 Ga0495640_0010837_2862_3986 373
159 3300046543 Ga0495645_0017124 Ga0495645_0017124_1123_2247 373
160 3300046642 Ga0495634_0002918 Ga0495634_0002918_12681_13805 373
161 3300046660 Ga0495625_0006996 Ga0495625_0006996_6210_7334 373
162 3300046680 Ga0495646_0054553 Ga0495646_0054553_128_1252 373
163 3300046809 Ga0495600_0006321 Ga0495600_0006321_606_1730 373
164 3300047315 Ga0495581_0051332 Ga0495581_0051332_1152_2276 373
165 3300047317 Ga0495604_0124166 Ga0495604_0124166_72_1196 373
166 3300047321 Ga0495676_0014107 Ga0495676_0014107_3494_4618 373
167 3300047444 Ga0495675_0001482 Ga0495675_0001482_331_1455 373
168 3300047470 Ga0495681_0101411 Ga0495681_0101411_109_1233 373
169 3300047471 Ga0495684_0178910 Ga0495684_0178910_301_1425 373
170 3300049580 Ga0501046_0001054 Ga0501046_0001054_2055_3257 373
171 3300049741 Ga0501079_0048872 Ga0501079_0048872_193_1338 373
172 3300049743 Ga0501081_0096913 Ga0501081_0096913_752_1897 373
173 3300053093 Ga0500651_0000002 Ga0500651_0000002_282687_283808 373
174 3300060353 Ga0501082_0360747 Ga0501082_0360747_79_1224 373
175 3300005329 Ga0070683_100097017 Ga0070683_1000970175 375
176 3300006880 Ga0075429_100078638 Ga0075429_1000786382 375
177 3300025944 Ga0207661_10285941 Ga0207661_102859412 375
178 3300031250 Ga0265331_10047387 Ga0265331_100473872 375
179 3300046462 Ga0495651_0024335 Ga0495651_0024335_685_1812 375
180 3300046533 Ga0495640_0049488 Ga0495640_0049488_1077_2204 375
181 3300046559 Ga0495667_0025101 Ga0495667_0025101_1180_2307 375
182 3300046679 Ga0495623_0063390 Ga0495623_0063390_660_1787 375
183 3300047471 Ga0495684_0006245 Ga0495684_0006245_2784_3911 375
184 3300006237 Ga0097621_100231346 Ga0097621_1002313462 376
185 3300009177 Ga0105248_10027925 Ga0105248_100279256 376
186 3300009177 Ga0105248_10196554 Ga0105248_101965542 376
187 3300031711 Ga0265314_10009686 Ga0265314_100096863 376
188 3300035725 Ga0373947_0228641 Ga0373947_0228641_58_1188 376
189 3300045051 Ga0451576_0126855 Ga0451576_0126855_1422_2552 376
190 3300046516 Ga0495628_0173664 Ga0495628_0173664_156_1286 376
191 3300046531 Ga0495665_0034260 Ga0495665_0034260_1003_2133 376
192 3300046559 Ga0495667_0135900 Ga0495667_0135900_15_1190 376
193 3300046679 Ga0495623_0092199 Ga0495623_0092199_26_1156 376
194 3300047319 Ga0495674_0019151 Ga0495674_0019151_2064_3194 376
195 3300047319 Ga0495674_0035797 Ga0495674_0035797_363_1493 376
196 3300047322 Ga0495680_0157636 Ga0495680_0157636_35_1165 376
197 3300047471 Ga0495684_0026964 Ga0495684_0026964_666_1796 376
198 3300048088 Ga0495602_0101452 Ga0495602_0101452_357_1487 376
199 3300046543 Ga0495645_0021405 Ga0495645_0021405_552_1685 377
200 3300047319 Ga0495674_0119646 Ga0495674_0119646_461_1594 377
201 3300047471 Ga0495684_0215508 Ga0495684_0215508_92_1225 377
202 3300049705 Ga0501225_0033920 Ga0501225_0033920_57_1196 377
203 3300006847 Ga0075431_100083161 Ga0075431_1000831612 378
204 3300006880 Ga0075429_100065325 Ga0075429_1000653252 378
205 3300050508 nmdc:mga09592_57850_c1 nmdc:mga09592_57850_c1_1413_2642 378
206 3300005329 Ga0070683_100000025 Ga0070683_10000002576 379
207 3300005535 Ga0070684_100000081 Ga0070684_10000008128 379
208 3300025944 Ga0207661_10000028 Ga0207661_1000002868 379
209 3300045976 Ga0466967_0042628 Ga0466967_0042628_541_1740 379
210 3300005353 Ga0070669_100019584 Ga0070669_1000195845 380
211 3300005457 Ga0070662_100220768 Ga0070662_1002207681 380
212 3300006852 Ga0075433_10013146 Ga0075433_100131463 380
213 3300006871 Ga0075434_100184858 Ga0075434_1001848583 380
214 3300025923 Ga0207681_10152080 Ga0207681_101520801 380
215 3300046539 Ga0495621_0025977 Ga0495621_0025977_598_1743 380
216 3300046543 Ga0495645_0068677 Ga0495645_0068677_568_1713 380
217 3300050512 nmdc:mga0n895_176735_c1 nmdc:mga0n895_176735_c1_191_1390 380
218 3300050515 nmdc:mga0a205_30924_c1 nmdc:mga0a205_30924_c1_116_1315 380
219 3300060353 Ga0501082_0000708 Ga0501082_0000708_26724_27902 380
220 3300005844 Ga0068862_100137245 Ga0068862_1001372452 381
221 3300009094 Ga0111539_10000718 Ga0111539_100007182 381
222 3300009148 Ga0105243_10015246 Ga0105243_100152463 381
223 3300014745 Ga0157377_10031080 Ga0157377_100310802 381
224 3300014969 Ga0157376_10004315 Ga0157376_100043153 381
225 3300047315 Ga0495581_0038449 Ga0495581_0038449_473_1618 381
226 3300047319 Ga0495674_0036420 Ga0495674_0036420_2116_3261 381
227 3300048918 Ga0496115_0049678 Ga0496115_0049678_1962_3107 381
228 3300050493 nmdc:mga0k408_976_c1 nmdc:mga0k408_976_c1_4712_5860 381
229 3300050494 nmdc:mga06z11_1666_c1 nmdc:mga06z11_1666_c1_5119_6267 381
230 3300050495 nmdc:mga04h51_6359_c1 nmdc:mga04h51_6359_c1_813_1961 381
231 3300050508 nmdc:mga09592_106924_c1 nmdc:mga09592_106924_c1_130_1278 381
232 3300050511 nmdc:mga08y16_517_c1 nmdc:mga08y16_517_c1_4886_6034 381
233 3300005617 Ga0068859_100059208 Ga0068859_1000592082 382
234 3300006931 Ga0097620_100059209 Ga0097620_1000592092 382
235 3300005336 Ga0070680_100070350 Ga0070680_1000703502 383
236 3300005356 Ga0070674_100007780 Ga0070674_1000077803 383
237 3300005365 Ga0070688_100007441 Ga0070688_1000074413 383
238 3300005438 Ga0070701_10004404 Ga0070701_100044044 383
239 3300005455 Ga0070663_100075286 Ga0070663_1000752862 383
240 3300005459 Ga0068867_100008892 Ga0068867_1000088923 383
241 3300005466 Ga0070685_10010657 Ga0070685_100106573 383
242 3300005840 Ga0068870_10021442 Ga0068870_100214422 383
243 3300005842 Ga0068858_100008571 Ga0068858_1000085715 383
244 3300006847 Ga0075431_100008610 Ga0075431_1000086108 383
245 3300013105 Ga0157369_10047133 Ga0157369_100471332 383
246 3300014968 Ga0157379_10069441 Ga0157379_100694412 383
247 3300025941 Ga0207711_10042834 Ga0207711_100428342 383
248 3300026089 Ga0207648_10002638 Ga0207648_100026385 383
249 3300046473 Ga0495582_0015257 Ga0495582_0015257_425_1576 383
250 3300046475 Ga0495639_0058652 Ga0495639_0058652_476_1627 383
251 3300046477 Ga0495664_0049269 Ga0495664_0049269_1147_2298 383
252 3300046499 Ga0495594_0010970 Ga0495594_0010970_1998_3149 383
253 3300046526 Ga0495666_0014471 Ga0495666_0014471_354_1505 383
254 3300046533 Ga0495640_0102934 Ga0495640_0102934_645_1796 383
255 3300046535 Ga0495586_0022539 Ga0495586_0022539_227_1378 383
256 3300046681 Ga0495647_0005977 Ga0495647_0005977_2370_3521 383
257 3300046689 Ga0495613_0011918 Ga0495613_0011918_2765_3916 383
258 3300047322 Ga0495680_0233288 Ga0495680_0233288_64_1215 383
259 3300047673 Ga0495593_0095862 Ga0495593_0095862_191_1342 383
260 3300049742 Ga0501080_0005620 Ga0501080_0005620_356_1549 383
261 iso_pu_bacteria 2687453341 2688392174 383
262 3300005289 Ga0065704_10126003 Ga0065704_101260031 384
263 3300005295 Ga0065707_10089478 Ga0065707_100894782 384
264 3300005617 Ga0068859_100196963 Ga0068859_1001969632 384
265 3300006178 Ga0075367_10030280 Ga0075367_100302803 384
266 3300006931 Ga0097620_100196951 Ga0097620_1001969512 384
267 iso_pu_bacteria 2671180531 2673162103 384
268 3300005331 Ga0070670_100119660 Ga0070670_1001196601 385
269 3300005456 Ga0070678_100233262 Ga0070678_1002332622 385
270 3300005456 Ga0070678_100243531 Ga0070678_1002435311 385
271 3300005539 Ga0068853_100023789 Ga0068853_1000237895 385
272 3300005543 Ga0070672_100078788 Ga0070672_1000787881 385
273 3300005618 Ga0068864_100068386 Ga0068864_1000683862 385
274 3300009177 Ga0105248_10378119 Ga0105248_103781192 385
275 3300025931 Ga0207644_10065084 Ga0207644_100650842 385
276 3300025940 Ga0207691_10042260 Ga0207691_100422603 385
277 3300025949 Ga0207667_10269767 Ga0207667_102697672 385
278 3300026067 Ga0207678_10033266 Ga0207678_100332665 385
279 3300046472 Ga0495580_0044131 Ga0495580_0044131_879_2105 385
280 3300006178 Ga0075367_10031757 Ga0075367_100317572 386
281 3300009174 Ga0105241_10071173 Ga0105241_100711731 386
282 3300013307 Ga0157372_10037643 Ga0157372_100376432 386
283 3300028794 Ga0307515_10081018 Ga0307515_100810184 386
284 3300047472 Ga0495686_0059577 Ga0495686_0059577_447_1646 386
285 3300005364 Ga0070673_100041061 Ga0070673_1000410612 387
286 3300009147 Ga0114129_10017840 Ga0114129_100178405 387
287 3300009147 Ga0114129_10330056 Ga0114129_103300562 387
288 3300014325 Ga0163163_10150403 Ga0163163_101504033 387
289 3300025906 Ga0207699_10128200 Ga0207699_101282001 387
290 3300026116 Ga0207674_10013089 Ga0207674_100130892 387
291 3300046476 Ga0495662_0019464 Ga0495662_0019464_34_1206 387
292 3300046477 Ga0495664_0004826 Ga0495664_0004826_6126_7298 387
293 3300046529 Ga0495652_0026023 Ga0495652_0026023_1634_2806 387
294 3300047471 Ga0495684_0079863 Ga0495684_0079863_719_1891 387
295 3300005563 Ga0068855_100010269 Ga0068855_1000102695 388
296 3300006844 Ga0075428_100012727 Ga0075428_1000127275 388
297 3300006847 Ga0075431_100153208 Ga0075431_1001532082 388
298 3300009094 Ga0111539_10193724 Ga0111539_101937242 388
299 3300009147 Ga0114129_10295938 Ga0114129_102959382 388
300 3300025949 Ga0207667_10003396 Ga0207667_100033969 388
301 3300028800 Ga0265338_10228017 Ga0265338_102280172 388
302 3300042122 Ga0450920_005319 Ga0450920_005319_285_1499 388
303 3300047319 Ga0495674_0019728 Ga0495674_0019728_3023_4297 388
304 3300048915 Ga0496112_0045411 Ga0496112_0045411_1555_2799 388
305 3300050507 nmdc:mga05p37_115747_c1 nmdc:mga05p37_115747_c1_183_1409 388
306 3300006844 Ga0075428_100100854 Ga0075428_1001008543 389
307 3300010375 Ga0105239_10070244 Ga0105239_100702442 389
308 3300046511 Ga0495608_0138734 Ga0495608_0138734_275_1522 389
309 3300046538 Ga0495609_0036528 Ga0495609_0036528_270_1442 389
310 3300049822 Ga0501035_0036014 Ga0501035_0036014_1787_2983 389
311 3300053077 Ga0495601_0000415 Ga0495601_0000415_4550_5803 389
312 iso_pu_bacteria 2884215851 2884219277 389
313 3300006028 Ga0070717_10172477 Ga0070717_101724771 390
314 3300009551 Ga0105238_10124476 Ga0105238_101244763 390
315 3300026067 Ga0207678_10079776 Ga0207678_100797762 390
316 3300028794 Ga0307515_10001965 Ga0307515_1000196520 390
317 3300036401 Ga0373937_0073054 Ga0373937_0073054_239_1420 390
318 3300003322 rootL2_10040554 rootL2_100405542 391
319 3300005340 Ga0070689_100149824 Ga0070689_1001498241 391
320 3300005518 Ga0070699_100181908 Ga0070699_1001819081 391
321 3300006847 Ga0075431_100235815 Ga0075431_1002358152 391
322 3300013102 Ga0157371_10021140 Ga0157371_100211405 391
323 3300013306 Ga0163162_10068710 Ga0163162_100687104 391
324 3300025936 Ga0207670_10006169 Ga0207670_100061693 391
325 3300035117 Ga0373953_0006737 Ga0373953_0006737_1540_2766 391
326 3300035172 Ga0373955_0034108 Ga0373955_0034108_553_1779 391
327 3300044712 Ga0453684_0012862 Ga0453684_0012862_5836_7086 391
328 3300046689 Ga0495613_0072422 Ga0495613_0072422_835_2022 391
329 3300049571 Ga0501034_0232255 Ga0501034_0232255_424_1617 391
330 3300049571 Ga0501034_0241501 Ga0501034_0241501_415_1632 391
331 3300049572 Ga0501036_0042608 Ga0501036_0042608_113_1330 391
332 3300049573 Ga0501037_0016447 Ga0501037_0016447_994_2211 391
333 3300049581 Ga0501047_0079430 Ga0501047_0079430_1263_2480 391
334 3300049822 Ga0501035_0014070 Ga0501035_0014070_3911_5128 391
335 3300053153 Ga0500616_0002082 Ga0500616_0002082_15580_16779 391
336 iso_pu_bacteria 2522125168 2522548464 391
337 3300005290 Ga0065712_10094722 Ga0065712_100947221 392
338 3300005340 Ga0070689_100127473 Ga0070689_1001274731 392
339 3300005440 Ga0070705_100004071 Ga0070705_1000040713 392
340 3300005467 Ga0070706_100113145 Ga0070706_1001131452 392
341 3300005471 Ga0070698_100177367 Ga0070698_1001773672 392
342 3300005546 Ga0070696_100052322 Ga0070696_1000523223 392
343 3300005549 Ga0070704_100002042 Ga0070704_1000020424 392
344 3300006846 Ga0075430_100079212 Ga0075430_1000792121 392
345 3300009094 Ga0111539_10055409 Ga0111539_100554093 392
346 3300009094 Ga0111539_10082199 Ga0111539_100821993 392
347 3300009147 Ga0114129_10027783 Ga0114129_100277832 392
348 3300025885 Ga0207653_10008387 Ga0207653_100083872 392
349 3300025936 Ga0207670_10069417 Ga0207670_100694172 392
350 3300031691 Ga0316579_10052262 Ga0316579_100522622 392
351 3300031728 Ga0316578_10016988 Ga0316578_100169882 392
352 3300031733 Ga0316577_10040972 Ga0316577_100409722 392
353 3300042131 Ga0450894_005481 Ga0450894_005481_100_1278 392
354 3300045051 Ga0451576_0354290 Ga0451576_0354290_231_1424 392
355 3300046459 Ga0495629_0007685 Ga0495629_0007685_2836_4020 392
356 3300046472 Ga0495580_0019306 Ga0495580_0019306_1672_2856 392
357 3300046499 Ga0495594_0004163 Ga0495594_0004163_4507_5691 392
358 3300046557 Ga0495622_0050982 Ga0495622_0050982_58_1242 392
359 3300046689 Ga0495613_0003192 Ga0495613_0003192_1841_3025 392
360 3300047471 Ga0495684_0052750 Ga0495684_0052750_717_1901 392
361 3300047673 Ga0495593_0045755 Ga0495593_0045755_161_1345 392
362 3300048089 Ga0495614_0006837 Ga0495614_0006837_2354_3538 392
363 3300050507 nmdc:mga05p37_402942_c1 nmdc:mga05p37_402942_c1_288_1523 392
364 3300050511 nmdc:mga08y16_152600_c1 nmdc:mga08y16_152600_c1_84_1274 392
365 3300050515 nmdc:mga0a205_33746_c1 nmdc:mga0a205_33746_c1_36_1226 392
366 3300053096 Ga0500641_0010767 Ga0500641_0010767_1873_3081 392
367 iso_pu_bacteria 2889415604 2889421006 392
368 3300005536 Ga0070697_100019632 Ga0070697_1000196322 393
369 3300005549 Ga0070704_100181602 Ga0070704_1001816022 393
370 3300006042 Ga0075368_10011193 Ga0075368_100111932 393
371 3300013100 Ga0157373_10143924 Ga0157373_101439241 393
372 3300013105 Ga0157369_10032575 Ga0157369_100325756 393
373 3300013296 Ga0157374_10006256 Ga0157374_100062568 393
374 3300013307 Ga0157372_10217297 Ga0157372_102172972 393
375 3300025919 Ga0207657_10155743 Ga0207657_101557432 393
376 3300026078 Ga0207702_10090239 Ga0207702_100902392 393
377 3300046523 Ga0495644_0006967 Ga0495644_0006967_388_1575 393
378 3300049592 Ga0501076_0044919 Ga0501076_0044919_2021_3214 393
379 3300049742 Ga0501080_0110965 Ga0501080_0110965_478_1671 393
380 iso_pu_bacteria 2911138879 2911140320 393
381 3300005340 Ga0070689_100003920 Ga0070689_1000039209 394
382 3300005354 Ga0070675_100273102 Ga0070675_1002731021 394
383 3300005614 Ga0068856_100009463 Ga0068856_1000094632 394
384 3300005842 Ga0068858_100025804 Ga0068858_1000258043 394
385 3300013297 Ga0157378_10043353 Ga0157378_100433533 394
386 3300026035 Ga0207703_10014241 Ga0207703_100142413 394
387 3300026078 Ga0207702_10003888 Ga0207702_100038883 394
388 3300026116 Ga0207674_10131474 Ga0207674_101314741 394
389 3300046476 Ga0495662_0033886 Ga0495662_0033886_851_2062 394
390 3300046517 Ga0495630_0001523 Ga0495630_0001523_11294_12505 394
391 3300046531 Ga0495665_0022464 Ga0495665_0022464_1740_2951 394
392 3300046690 Ga0495624_0031455 Ga0495624_0031455_1162_2373 394
393 3300047315 Ga0495581_0035002 Ga0495581_0035002_1208_2419 394
394 3300047471 Ga0495684_0004226 Ga0495684_0004226_5602_6813 394
395 3300049579 Ga0501043_0003157 Ga0501043_0003157_5121_6353 394
396 3300050491 nmdc:mga00v17_53512_c1 nmdc:mga00v17_53512_c1_440_1639 394
397 3300050511 nmdc:mga08y16_133821_c1 nmdc:mga08y16_133821_c1_268_1521 394
398 3300053119 Ga0500595_000023 Ga0500595_000023_10140_11327 394
399 3300005328 Ga0070676_10037906 Ga0070676_100379063 395
400 3300005338 Ga0068868_100116323 Ga0068868_1001163232 395
401 3300005340 Ga0070689_100017655 Ga0070689_1000176552 395
402 3300005343 Ga0070687_100002461 Ga0070687_1000024615 395
403 3300005347 Ga0070668_100110614 Ga0070668_1001106142 395
404 3300005353 Ga0070669_100047657 Ga0070669_1000476572 395
405 3300005354 Ga0070675_100014273 Ga0070675_1000142733 395
406 3300005459 Ga0068867_100035990 Ga0068867_1000359902 395
407 3300005549 Ga0070704_100075811 Ga0070704_1000758111 395
408 3300005617 Ga0068859_100005827 Ga0068859_1000058277 395
409 3300005719 Ga0068861_100117718 Ga0068861_1001177182 395
410 3300005842 Ga0068858_100007346 Ga0068858_1000073462 395
411 3300005844 Ga0068862_100192045 Ga0068862_1001920452 395
412 3300006042 Ga0075368_10009032 Ga0075368_100090322 395
413 3300006048 Ga0075363_100025366 Ga0075363_1000253662 395
414 3300006195 Ga0075366_10004241 Ga0075366_100042416 395
415 3300006358 Ga0068871_100112201 Ga0068871_1001122012 395
416 3300006844 Ga0075428_100088636 Ga0075428_1000886362 395
417 3300006847 Ga0075431_100005399 Ga0075431_1000053998 395
418 3300006881 Ga0068865_100077123 Ga0068865_1000771232 395
419 3300006931 Ga0097620_100005827 Ga0097620_1000058277 395
420 3300009147 Ga0114129_10027379 Ga0114129_100273793 395
421 3300025907 Ga0207645_10075425 Ga0207645_100754252 395
422 3300025918 Ga0207662_10003096 Ga0207662_100030965 395
423 3300025933 Ga0207706_10050397 Ga0207706_100503973 395
424 3300025936 Ga0207670_10037664 Ga0207670_100376642 395
425 3300025940 Ga0207691_10005074 Ga0207691_100050745 395
426 3300026035 Ga0207703_10008377 Ga0207703_100083774 395
427 3300026075 Ga0207708_10012693 Ga0207708_100126933 395
428 3300026116 Ga0207674_10015676 Ga0207674_100156761 395
429 3300026118 Ga0207675_100005876 Ga0207675_1000058766 395
430 3300027866 Ga0209813_10005301 Ga0209813_100053012 395
431 3300027907 Ga0207428_10000076 Ga0207428_1000007633 395
432 3300028380 Ga0268265_10108697 Ga0268265_101086972 395
433 3300028381 Ga0268264_10026906 Ga0268264_100269062 395
434 3300037853 Ga0436364_1328097 Ga0436364_1328097_196_1578 395
435 3300046684 Ga0495669_0023720 Ga0495669_0023720_597_1796 395
436 3300050510 nmdc:mga06r32_4439_c1 nmdc:mga06r32_4439_c1_9805_11037 395
437 3300005354 Ga0070675_100105490 Ga0070675_1001054902 396
438 3300005937 Ga0081455_10009808 Ga0081455_100098085 396
439 3300006852 Ga0075433_10000557 Ga0075433_100005571 396
440 3300006871 Ga0075434_100020592 Ga0075434_1000205924 396
441 3300009147 Ga0114129_10075528 Ga0114129_100755284 396
442 3300025949 Ga0207667_10032734 Ga0207667_100327347 396
443 3300046517 Ga0495630_0002241 Ga0495630_0002241_7322_8530 396
444 3300046526 Ga0495666_0008272 Ga0495666_0008272_839_2047 396
445 3300046535 Ga0495586_0002759 Ga0495586_0002759_1448_2656 396
446 3300047321 Ga0495676_0031115 Ga0495676_0031115_917_2125 396
447 3300048929 Ga0496126_0000091 Ga0496126_0000091_154887_156095 396
448 3300049823 Ga0501044_0295637 Ga0501044_0295637_232_1452 396
449 3300050515 nmdc:mga0a205_543_c1 nmdc:mga0a205_543_c1_22677_23921 396
450 3300005327 Ga0070658_10014336 Ga0070658_100143362 397
451 3300005467 Ga0070706_100058873 Ga0070706_1000588733 397
452 3300005468 Ga0070707_100004528 Ga0070707_1000045286 397
453 3300005471 Ga0070698_100002639 Ga0070698_1000026395 397
454 3300005518 Ga0070699_100033901 Ga0070699_1000339011 397
455 3300005614 Ga0068856_100055580 Ga0068856_1000555804 397
456 3300005842 Ga0068858_100084463 Ga0068858_1000844632 397
457 3300009094 Ga0111539_10246906 Ga0111539_102469061 397
458 3300009545 Ga0105237_10003800 Ga0105237_100038001 397
459 3300010375 Ga0105239_10033071 Ga0105239_100330712 397
460 3300025909 Ga0207705_10011962 Ga0207705_100119622 397
461 3300025910 Ga0207684_10012510 Ga0207684_100125105 397
462 3300025914 Ga0207671_10031032 Ga0207671_100310322 397
463 3300025922 Ga0207646_10007340 Ga0207646_100073405 397
464 3300026035 Ga0207703_10021959 Ga0207703_100219593 397
465 3300026078 Ga0207702_10122783 Ga0207702_101227832 397
466 3300005617 Ga0068859_100005273 Ga0068859_1000052739 398
467 3300006931 Ga0097620_100005273 Ga0097620_1000052739 398
468 3300013104 Ga0157370_10049962 Ga0157370_100499625 398
469 3300026067 Ga0207678_10025932 Ga0207678_100259324 398
470 3300031251 Ga0265327_10009571 Ga0265327_100095713 398
471 iso_pu_bacteria 2687453257 2688067266 398
472 3300005436 Ga0070713_100047121 Ga0070713_1000471212 399
473 3300009176 Ga0105242_10073346 Ga0105242_100733462 399
474 3300010375 Ga0105239_10015044 Ga0105239_100150446 399
475 3300013297 Ga0157378_10000186 Ga0157378_100001863 399
476 3300021384 Ga0213876_10007028 Ga0213876_100070282 399
477 3300025928 Ga0207700_10114066 Ga0207700_101140662 399
478 3300025934 Ga0207686_10080076 Ga0207686_100800762 399
479 3300035398 Ga0316574_0012187 Ga0316574_0012187_2731_3987 399
480 3300039437 Ga0436365_0874592 Ga0436365_0874592_2035_3249 399
481 3300039453 Ga0436362_0081182 Ga0436362_0081182_1537_2751 399
482 3300046455 Ga0495603_0018137 Ga0495603_0018137_2105_3310 399
483 3300046500 Ga0495596_0023221 Ga0495596_0023221_657_1862 399
484 3300046523 Ga0495644_0000099 Ga0495644_0000099_4975_6180 399
485 3300046538 Ga0495609_0015332 Ga0495609_0015332_596_1801 399
486 3300046558 Ga0495633_0021756 Ga0495633_0021756_1296_2501 399
487 3300046616 Ga0495668_0012615 Ga0495668_0012615_2584_3789 399
488 3300046660 Ga0495625_0038125 Ga0495625_0038125_1707_2912 399
489 3300046691 Ga0495670_0036058 Ga0495670_0036058_1178_2383 399
490 3300048089 Ga0495614_0028650 Ga0495614_0028650_487_1689 399
491 3300048915 Ga0496112_0322746 Ga0496112_0322746_92_1294 399
492 3300059421 Ga0590071_001796 Ga0590071_001796_4148_5374 399
493 3300059426 Ga0590077_002947 Ga0590077_002947_1652_2878 399
494 3300005471 Ga0070698_100063132 Ga0070698_1000631322 400
495 3300005563 Ga0068855_100016620 Ga0068855_1000166201 400
496 3300005577 Ga0068857_100014212 Ga0068857_1000142124 400
497 3300006195 Ga0075366_10000788 Ga0075366_100007883 400
498 3300009093 Ga0105240_10000070 Ga0105240_1000007012 400
499 3300010375 Ga0105239_10023560 Ga0105239_100235603 400
500 3300025909 Ga0207705_10001971 Ga0207705_1000197111 400
501 3300025913 Ga0207695_10000155 Ga0207695_10000155132 400
502 3300025949 Ga0207667_10003111 Ga0207667_100031115 400
503 3300026116 Ga0207674_10020810 Ga0207674_100208104 400
504 3300028794 Ga0307515_10001558 Ga0307515_1000155837 400
505 3300046459 Ga0495629_0127382 Ga0495629_0127382_164_1372 400
506 3300046506 Ga0495583_0039052 Ga0495583_0039052_14_1252 400
507 3300046524 Ga0495648_0009612 Ga0495648_0009612_4078_5286 400
508 3300046528 Ga0495642_0042291 Ga0495642_0042291_606_1844 400
509 3300046530 Ga0495654_0049651 Ga0495654_0049651_826_2034 400
510 3300046538 Ga0495609_0021625 Ga0495609_0021625_891_2099 400
511 3300046558 Ga0495633_0000012 Ga0495633_0000012_80574_81782 400
512 3300046616 Ga0495668_0000055 Ga0495668_0000055_62755_64080 400
513 3300046660 Ga0495625_0001326 Ga0495625_0001326_15864_17072 400
514 3300046660 Ga0495625_0002936 Ga0495625_0002936_14852_16060 400
515 3300046660 Ga0495625_0029436 Ga0495625_0029436_340_1578 400
516 3300046678 Ga0495599_0036295 Ga0495599_0036295_582_1802 400
517 3300046692 Ga0495671_0047542 Ga0495671_0047542_96_1334 400
518 3300046694 Ga0495649_0039627 Ga0495649_0039627_979_2217 400
519 3300048089 Ga0495614_0014429 Ga0495614_0014429_2045_3253 400
520 3300050493 nmdc:mga0k408_615_c1 nmdc:mga0k408_615_c1_11148_12356 400
521 3300006844 Ga0075428_100001649 Ga0075428_1000016499 401
522 3300037853 Ga0436364_1102173 Ga0436364_1102173_160_1389 401
523 3300049742 Ga0501080_0012697 Ga0501080_0012697_3270_4508 401
524 3300005530 Ga0070679_100073584 Ga0070679_1000735844 402
525 3300009093 Ga0105240_10001027 Ga0105240_100010274 402
526 3300009094 Ga0111539_10176709 Ga0111539_101767092 402
527 3300009177 Ga0105248_10408245 Ga0105248_104082452 402
528 3300014325 Ga0163163_10310261 Ga0163163_103102611 402
529 3300025936 Ga0207670_10087719 Ga0207670_100877192 402
530 3300039450 Ga0436363_0466760 Ga0436363_0466760_96_1319 402
531 3300050510 nmdc:mga06r32_225268_c1 nmdc:mga06r32_225268_c1_334_1569 402
532 3300053153 Ga0500616_0000386 Ga0500616_0000386_33766_35031 402
533 iso_pu_bacteria 2920107658 2920114070 402
534 3300006846 Ga0075430_100103009 Ga0075430_1001030092 403
535 3300006847 Ga0075431_100066605 Ga0075431_1000666054 403
536 3300037853 Ga0436364_1118947 Ga0436364_1118947_10551_11786 403
537 3300046517 Ga0495630_0000067 Ga0495630_0000067_46110_47339 403
538 3300046526 Ga0495666_0005855 Ga0495666_0005855_4795_6024 403
539 3300046533 Ga0495640_0143606 Ga0495640_0143606_232_1461 403
540 3300046535 Ga0495586_0000028 Ga0495586_0000028_59820_61049 403
541 3300046642 Ga0495634_0032974 Ga0495634_0032974_1519_2748 403
542 3300047319 Ga0495674_0032717 Ga0495674_0032717_408_1637 403
543 3300049568 Ga0501031_0000903 Ga0501031_0000903_1259_2482 403
544 3300049569 Ga0501032_0030421 Ga0501032_0030421_1203_2426 403
545 3300049572 Ga0501036_0000193 Ga0501036_0000193_32648_33871 403
546 3300049575 Ga0501039_0031667 Ga0501039_0031667_1576_2799 403
547 3300049579 Ga0501043_0136723 Ga0501043_0136723_598_1821 403
548 3300049580 Ga0501046_0002330 Ga0501046_0002330_1213_2436 403
549 3300049581 Ga0501047_0134510 Ga0501047_0134510_211_1434 403
550 3300049584 Ga0501068_0006974 Ga0501068_0006974_3745_4968 403
551 3300049585 Ga0501069_0003963 Ga0501069_0003963_2637_3860 403
552 3300049586 Ga0501070_0144123 Ga0501070_0144123_18_1241 403
553 3300049588 Ga0501072_0067008 Ga0501072_0067008_329_1552 403
554 3300049589 Ga0501073_0013675 Ga0501073_0013675_3763_4986 403
555 3300049593 Ga0501077_0065671 Ga0501077_0065671_868_2091 403
556 3300049741 Ga0501079_0118675 Ga0501079_0118675_791_2014 403
557 3300049742 Ga0501080_0000281 Ga0501080_0000281_726_1949 403
558 3300049744 Ga0501083_0034456 Ga0501083_0034456_1086_2309 403
559 3300060353 Ga0501082_0016770 Ga0501082_0016770_1029_2252 403
560 3300005340 Ga0070689_100129025 Ga0070689_1001290251 404
561 3300005535 Ga0070684_100051298 Ga0070684_1000512983 404
562 3300005546 Ga0070696_100021132 Ga0070696_1000211323 404
563 3300006028 Ga0070717_10283385 Ga0070717_102833852 404
564 3300009545 Ga0105237_10434416 Ga0105237_104344161 404
565 3300013104 Ga0157370_10029360 Ga0157370_100293602 404
566 3300014325 Ga0163163_10000114 Ga0163163_1000011428 404
567 3300028381 Ga0268264_10039520 Ga0268264_100395201 404
568 3300037471 Ga0395905_0051753 Ga0395905_0051753_312_1556 404
569 3300045051 Ga0451576_0181875 Ga0451576_0181875_891_2123 404
570 3300048905 Ga0496102_0003059 Ga0496102_0003059_6229_7458 404
571 3300048909 Ga0496106_0147543 Ga0496106_0147543_100_1329 404
572 3300049580 Ga0501046_0029127 Ga0501046_0029127_629_1888 404
573 3300049581 Ga0501047_0003896 Ga0501047_0003896_8587_9846 404
574 3300050514 nmdc:mga08x19_1552_c1 nmdc:mga08x19_1552_c1_1693_2922 404
575 3300005327 Ga0070658_10000848 Ga0070658_1000084821 405
576 3300005436 Ga0070713_100159221 Ga0070713_1001592212 405
577 3300005548 Ga0070665_100195701 Ga0070665_1001957011 405
578 3300005548 Ga0070665_100394970 Ga0070665_1003949702 405
579 3300005841 Ga0068863_100014070 Ga0068863_1000140705 405
580 3300005842 Ga0068858_100065434 Ga0068858_1000654342 405
581 3300005842 Ga0068858_100294351 Ga0068858_1002943511 405
582 3300009553 Ga0105249_10278689 Ga0105249_102786892 405
583 3300010375 Ga0105239_10191319 Ga0105239_101913192 405
584 3300013104 Ga0157370_10008478 Ga0157370_100084784 405
585 3300013105 Ga0157369_10000761 Ga0157369_1000076126 405
586 3300013297 Ga0157378_10051792 Ga0157378_100517922 405
587 3300013307 Ga0157372_10000267 Ga0157372_1000026727 405
588 3300014325 Ga0163163_10180857 Ga0163163_101808572 405
589 3300026035 Ga0207703_10127776 Ga0207703_101277762 405
590 3300026035 Ga0207703_10323425 Ga0207703_103234252 405
591 3300026088 Ga0207641_10014293 Ga0207641_100142933 405
592 3300028379 Ga0268266_10083577 Ga0268266_100835772 405
593 3300045051 Ga0451576_0134030 Ga0451576_0134030_1019_2251 405
594 3300047319 Ga0495674_0061871 Ga0495674_0061871_679_1902 405
595 3300049823 Ga0501044_0002894 Ga0501044_0002894_474_1709 405
596 3300050510 nmdc:mga06r32_287047_c1 nmdc:mga06r32_287047_c1_136_1374 405
597 3300053103 Ga0500555_003786 Ga0500555_003786_1401_2651 405
598 3300005335 Ga0070666_10109130 Ga0070666_101091302 406
599 3300009147 Ga0114129_10152937 Ga0114129_101529373 406
600 3300009177 Ga0105248_10000006 Ga0105248_10000006379 406
601 3300013308 Ga0157375_10000006 Ga0157375_10000006343 406
602 3300021377 Ga0213874_10004343 Ga0213874_100043432 406
603 3300025903 Ga0207680_10009744 Ga0207680_100097444 406
604 3300025941 Ga0207711_10000007 Ga0207711_10000007210 406
605 3300037853 Ga0436364_1380174 Ga0436364_1380174_1191_2450 406
606 3300039437 Ga0436365_0940540 Ga0436365_0940540_978_2213 406
607 3300039450 Ga0436363_0655318 Ga0436363_0655318_3399_4634 406
608 3300048912 Ga0496109_0000107 Ga0496109_0000107_34867_36102 406
609 3300050508 nmdc:mga09592_196755_c1 nmdc:mga09592_196755_c1_366_1595 406
610 3300006847 Ga0075431_100041216 Ga0075431_1000412162 407
611 3300009147 Ga0114129_10451261 Ga0114129_104512611 407
612 3300021388 Ga0213875_10000004 Ga0213875_10000004444 407
613 3300037853 Ga0436364_0748068 Ga0436364_0748068_115817_117064 407
614 3300050507 nmdc:mga05p37_189875_c1 nmdc:mga05p37_189875_c1_901_2169 407
615 3300053087 Ga0500643_011532 Ga0500643_011532_234_1457 407
616 3300005339 Ga0070660_100188992 Ga0070660_1001889922 408
617 3300005842 Ga0068858_100208207 Ga0068858_1002082071 408
618 3300005937 Ga0081455_10006375 Ga0081455_1000637511 408
619 3300006847 Ga0075431_100080394 Ga0075431_1000803943 408
620 3300027907 Ga0207428_10002419 Ga0207428_100024198 408
621 3300039447 Ga0436361_0970042 Ga0436361_0970042_12187_13422 408
622 3300046459 Ga0495629_0040130 Ga0495629_0040130_1870_3108 408
623 3300050507 nmdc:mga05p37_26590_c1 nmdc:mga05p37_26590_c1_807_2078 408
624 3300050511 nmdc:mga08y16_101843_c1 nmdc:mga08y16_101843_c1_54_1325 408
625 3300003320 rootH2_10065350 rootH2_100653502 409
626 3300005434 Ga0070709_10052683 Ga0070709_100526833 409
627 3300009093 Ga0105240_10049930 Ga0105240_100499304 409
628 3300013307 Ga0157372_10194905 Ga0157372_101949051 409
629 3300025914 Ga0207671_10036179 Ga0207671_100361792 409
630 3300049579 Ga0501043_0013453 Ga0501043_0013453_2777_4024 409
631 3300049580 Ga0501046_0037649 Ga0501046_0037649_29_1276 409
632 3300049589 Ga0501073_0082471 Ga0501073_0082471_927_2174 409
633 3300049822 Ga0501035_0081642 Ga0501035_0081642_1564_2811 409
634 3300009093 Ga0105240_10148641 Ga0105240_101486412 410
635 3300013105 Ga0157369_10019836 Ga0157369_100198361 410
636 3300025939 Ga0207665_10002112 Ga0207665_100021126 410
637 3300031249 Ga0265339_10000414 Ga0265339_100004148 410
638 3300031344 Ga0265316_10005470 Ga0265316_100054708 410
639 3300046471 Ga0495650_0000010 Ga0495650_0000010_300472_301704 410
640 3300046516 Ga0495628_0026914 Ga0495628_0026914_378_1637 410
641 3300053077 Ga0495601_0010610 Ga0495601_0010610_1393_2652 410
642 3300005329 Ga0070683_100024371 Ga0070683_1000243714 411
643 3300005331 Ga0070670_100104734 Ga0070670_1001047342 411
644 3300005339 Ga0070660_100155747 Ga0070660_1001557472 411
645 3300005344 Ga0070661_100013867 Ga0070661_1000138671 411
646 3300005355 Ga0070671_100028762 Ga0070671_1000287622 411
647 3300005366 Ga0070659_100014105 Ga0070659_1000141055 411
648 3300005455 Ga0070663_100001367 Ga0070663_1000013676 411
649 3300005458 Ga0070681_10019179 Ga0070681_100191794 411
650 3300005530 Ga0070679_100021481 Ga0070679_1000214815 411
651 3300005535 Ga0070684_100156440 Ga0070684_1001564402 411
652 3300005563 Ga0068855_100027673 Ga0068855_1000276732 411
653 3300005577 Ga0068857_100094514 Ga0068857_1000945142 411
654 3300005578 Ga0068854_100013772 Ga0068854_1000137725 411
655 3300006028 Ga0070717_10002730 Ga0070717_100027307 411
656 3300009093 Ga0105240_10060269 Ga0105240_100602692 411
657 3300009093 Ga0105240_10067231 Ga0105240_100672312 411
658 3300009545 Ga0105237_10052420 Ga0105237_100524202 411
659 3300013104 Ga0157370_10015889 Ga0157370_100158893 411
660 3300013105 Ga0157369_10028083 Ga0157369_100280832 411
661 3300013105 Ga0157369_10132325 Ga0157369_101323253 411
662 3300013105 Ga0157369_10257927 Ga0157369_102579272 411
663 3300025904 Ga0207647_10013713 Ga0207647_100137133 411
664 3300025909 Ga0207705_10001870 Ga0207705_1000187013 411
665 3300025912 Ga0207707_10003273 Ga0207707_1000327312 411
666 3300025913 Ga0207695_10034371 Ga0207695_100343713 411
667 3300025919 Ga0207657_10001250 Ga0207657_100012503 411
668 3300025919 Ga0207657_10171558 Ga0207657_101715581 411
669 3300025931 Ga0207644_10057636 Ga0207644_100576362 411
670 3300025944 Ga0207661_10021488 Ga0207661_100214884 411
671 3300025949 Ga0207667_10006749 Ga0207667_100067498 411
672 3300025981 Ga0207640_10009712 Ga0207640_100097124 411
673 3300026041 Ga0207639_10038164 Ga0207639_100381642 411
674 3300026067 Ga0207678_10001220 Ga0207678_1000122014 411
675 3300026067 Ga0207678_10018316 Ga0207678_100183162 411
676 3300026116 Ga0207674_10010954 Ga0207674_100109547 411
677 3300044656 Ga0466969_0049277 Ga0466969_0049277_591_1904 411
678 3300049586 Ga0501070_0148025 Ga0501070_0148025_191_1426 411
679 3300053103 Ga0500555_018159 Ga0500555_018159_287_1666 411
680 3300005335 Ga0070666_10103166 Ga0070666_101031662 412
681 3300005338 Ga0068868_100196299 Ga0068868_1001962991 412
682 3300005347 Ga0070668_100131325 Ga0070668_1001313252 412
683 3300005355 Ga0070671_100070003 Ga0070671_1000700032 412
684 3300005367 Ga0070667_100080536 Ga0070667_1000805362 412
685 3300005457 Ga0070662_100042202 Ga0070662_1000422022 412
686 3300005563 Ga0068855_100217264 Ga0068855_1002172642 412
687 3300005983 Ga0081540_1004612 Ga0081540_10046125 412
688 3300006237 Ga0097621_100110952 Ga0097621_1001109522 412
689 3300006358 Ga0068871_100071452 Ga0068871_1000714522 412
690 3300006881 Ga0068865_100029412 Ga0068865_1000294122 412
691 3300009101 Ga0105247_10151208 Ga0105247_101512081 412
692 3300011119 Ga0105246_10059364 Ga0105246_100593642 412
693 3300013296 Ga0157374_10228291 Ga0157374_102282912 412
694 3300013308 Ga0157375_10049425 Ga0157375_100494253 412
695 3300014325 Ga0163163_10322504 Ga0163163_103225042 412
696 3300014969 Ga0157376_10123486 Ga0157376_101234862 412
697 3300021388 Ga0213875_10000010 Ga0213875_10000010309 412
698 3300025904 Ga0207647_10005165 Ga0207647_100051651 412
699 3300025907 Ga0207645_10007779 Ga0207645_100077794 412
700 3300025911 Ga0207654_10025474 Ga0207654_100254742 412
701 3300025933 Ga0207706_10002082 Ga0207706_100020827 412
702 3300025938 Ga0207704_10090030 Ga0207704_100900302 412
703 3300025940 Ga0207691_10004168 Ga0207691_100041682 412
704 3300025986 Ga0207658_10049402 Ga0207658_100494022 412
705 3300026023 Ga0207677_10089427 Ga0207677_100894272 412
706 3300026088 Ga0207641_10131705 Ga0207641_101317052 412
707 3300031249 Ga0265339_10000003 Ga0265339_10000003122 412
708 3300031595 Ga0265313_10008773 Ga0265313_100087732 412
709 3300035172 Ga0373955_0133965 Ga0373955_0133965_56_1321 412
710 3300037853 Ga0436364_1448179 Ga0436364_1448179_31740_32987 412
711 3300039438 Ga0436360_1260787 Ga0436360_1260787_4866_6104 412
712 3300039447 Ga0436361_0212501 Ga0436361_0212501_4118_5356 412
713 3300046543 Ga0495645_0024032 Ga0495645_0024032_1230_2516 412
714 3300055283 Ga0500661_001376 Ga0500661_001376_851_2095 412
715 3300005455 Ga0070663_100120270 Ga0070663_1001202702 413
716 3300026067 Ga0207678_10197628 Ga0207678_101976281 413
717 3300037471 Ga0395905_0065349 Ga0395905_0065349_1282_2727 413
718 3300005338 Ga0068868_100077526 Ga0068868_1000775263 414
719 3300006237 Ga0097621_100012605 Ga0097621_1000126053 414
720 3300006358 Ga0068871_100006058 Ga0068871_1000060584 414
721 3300009098 Ga0105245_10152535 Ga0105245_101525352 414
722 3300009176 Ga0105242_10029841 Ga0105242_100298412 414
723 3300009177 Ga0105248_10045257 Ga0105248_100452572 414
724 3300009545 Ga0105237_10037392 Ga0105237_100373924 414
725 3300013297 Ga0157378_10115255 Ga0157378_101152551 414
726 3300021384 Ga0213876_10023174 Ga0213876_100231743 414
727 3300025941 Ga0207711_10029512 Ga0207711_100295122 414
728 3300039437 Ga0436365_0025297 Ga0436365_0025297_1224_2504 414
729 3300046694 Ga0495649_0036704 Ga0495649_0036704_1081_2328 414
730 3300048918 Ga0496115_0058603 Ga0496115_0058603_754_2034 414
731 3300048929 Ga0496126_0025286 Ga0496126_0025286_3642_4886 414
732 3300000546 LJNas_1000056 LJNas_10000562 415
733 3300003316 rootH1_10021801 rootH1_100218016 415
734 3300005355 Ga0070671_100190081 Ga0070671_1001900812 415
735 3300010375 Ga0105239_10136995 Ga0105239_101369953 415
736 3300013307 Ga0157372_10589504 Ga0157372_105895041 415
737 3300025904 Ga0207647_10056866 Ga0207647_100568662 415
738 3300028800 Ga0265338_10140036 Ga0265338_101400362 415
739 3300046543 Ga0495645_0045790 Ga0495645_0045790_1680_2927 415
740 3300048915 Ga0496112_0011557 Ga0496112_0011557_3449_4696 415
741 3300053119 Ga0500595_015262 Ga0500595_015262_1332_2582 415

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wva-assembly1.cif.gz_A takifugu rubripes vkor-like with vitamin k1 epoxide at non-catalytic state 0.3545 167 339
3v5r-assembly1.cif.gz_A crystal structure of the unliganded form of gal3p 0.2937 124 298
3v5r-assembly1.cif.gz_B crystal structure of the unliganded form of gal3p 0.2407 124 298
7b9s-assembly1.cif.gz_S structure of the mycobacterial esx-5 type vii secretion system hexameric pore complex 0.2349 13 400
6i1r-assembly1.cif.gz_B crystal structure of cmp bound cst in an outward facing conformation 0.2343 31 406
ID Description Score Start End Superfamily
af_D6RYD7_309_451_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4553 253 366 1.10.287.70
af_D3Z9X5_173_361_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4038 263 404 1.20.1250.20
af_D6RYD7_309_451_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3945 253 366 1.10.287.70
af_O94607_64_272_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3835 252 410 1.20.1250.20
af_Q23063_235_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.383 256 400 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7S7NY27-F1-model_v4 DUF5009 domain-containing protein 0.9954 36 415 GO:0016020
AF-A0A7S7NY27-F1-model_v4 DUF5009 domain-containing protein 0.9902 36 415 GO:0016020
AF-A0A3D8Y541-F1-model_v4 DUF5009 domain-containing protein 0.9893 44 415 GO:0016020
AF-A0A7X2PK69-F1-model_v4 DUF5009 domain-containing protein 0.9891 36 312 GO:0016020
AF-A0A1Q3WWR6-F1-model_v4 DUF5009 domain-containing protein 0.983 36 415 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.84 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map