F478644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 371 | 1485 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300031616|Ga0307508_10001328|Ga0307508_1000132819 |
| Length | 274 |
| Sequence | MGRADEARAGASRGILDSRLRGNDGYTEHTMDRMIYLSMSGAKAMMQRQDTLANNLANVSTPGFRAELQAFRAVPVQGSGASTRVYSLETTPGYSAAPGVVSETGRNLDVAVKGNAWLSVQALDGTEAYTRGGALDINSEGALTTLSGLPVMGDGGPIQVPPQTEVSIGGDGTITGKAITGKISVIGKLKLVTPTADTPLERGEDGLFRGADGAELPADPTARVQDGALEGSNVSPVETMVSMITAARQFEAQMKMLQTAEGDEKAAAQLLSMS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 200 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 228 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 229 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 230 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 231 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 232 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 233 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 234 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 235 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 236 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 237 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 238 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 325 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 326 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 327 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 329 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 331 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 333 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 344 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 346 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 347 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 348 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 349 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 350 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 354 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 357 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 358 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 359 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 360 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 361 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 362 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 363 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 364 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 365 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 366 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 367 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 368 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 369 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 370 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 371 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.9 |
| Metatranscriptomes | 1.35 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.23 |
| Nodule | 0.54 |
| Rhizoplane | 3.1 |
| Rhizosphere | 73.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307508_10001328 | 3300031616 | Bacteria | 27985 |
| 2 | JGI25156J39149_1000819 | 3300002705 | Bacteria | 15840 |
| 3 | JGI25156J39149_1008311 | 3300002705 | Bacteria | 2628 |
| 4 | JGI25154J39366_1000824 | 3300002738 | Bacteria | 13459 |
| 5 | JGI25157J39369_1000027 | 3300002741 | Bacteria | 147448 |
| 6 | JGI25164J39214_1003672 | 3300002772 | Bacteria | 1891 |
| 7 | JGI25152J39213_1001390 | 3300002773 | Bacteria | 10482 |
| 8 | JGI25150J39212_1012465 | 3300002774 | Bacteria | 1505 |
| 9 | JGI25153J46596_10003685 | 3300003215 | Bacteria | 8471 |
| 10 | rootH1_10004916 | 3300003316 | Bacteria | 1512 |
| 11 | rootH1_10004916 | 3300003323 | Bacteria | 4708 |
| 12 | rootH1_10006365 | 3300003316 | Bacteria | 19108 |
| 13 | rootH2_10047071 | 3300003320 | Bacteria | 3455 |
| 14 | rootL2_10003861 | 3300003322 | Bacteria | 52646 |
| 15 | rootL2_10009273 | 3300003322 | Bacteria | 31971 |
| 16 | rootH1_10006621 | 3300003323 | Bacteria | 4004 |
| 17 | rootH1_10019349 | 3300003323 | Bacteria | 13289 |
| 18 | rootH1_10027533 | 3300003323 | Bacteria | 3244 |
| 19 | rootH1_10031598 | 3300003323 | Bacteria | 3903 |
| 20 | Ga0055539_1004569 | 3300003752 | Bacteria | 1838 |
| 21 | Ga0055539_1004861 | 3300003752 | Bacteria | 1771 |
| 22 | Ga0055533_1000073 | 3300003756 | Bacteria | 142476 |
| 23 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 24 | Ga0055525_1000687 | 3300003759 | Bacteria | 12627 |
| 25 | Ga0055535_1000229 | 3300003761 | Bacteria | 58945 |
| 26 | Ga0055529_1000064 | 3300003763 | Bacteria | 178831 |
| 27 | Ga0055526_1002388 | 3300003771 | Bacteria | 12716 |
| 28 | Ga0055530_10029662 | 3300003791 | Bacteria | 1460 |
| 29 | Ga0055540_1009954 | 3300003792 | Bacteria | 3213 |
| 30 | Ga0055540_1024456 | 3300003792 | Bacteria | 1498 |
| 31 | Ga0055531_10003179 | 3300003794 | Bacteria | 10559 |
| 32 | Ga0055531_10028054 | 3300003794 | Bacteria | 1953 |
| 33 | Ga0055543_1002234 | 3300004625 | Bacteria | 6575 |
| 34 | Ga0055543_1013363 | 3300004625 | Bacteria | 1625 |
| 35 | Ga0065165_1000283 | 3300005262 | Bacteria | 86141 |
| 36 | Ga0070658_10112110 | 3300005327 | Bacteria | 2261 |
| 37 | Ga0070658_10162910 | 3300005327 | Bacteria | 1871 |
| 38 | Ga0070658_10186426 | 3300005327 | Bacteria | 1747 |
| 39 | Ga0070658_10336633 | 3300005327 | Bacteria | 1290 |
| 40 | Ga0070658_10386740 | 3300005327 | Bacteria | 1201 |
| 41 | Ga0070676_10001564 | 3300005328 | Bacteria | 11610 |
| 42 | Ga0070676_10008248 | 3300005328 | Bacteria | 5609 |
| 43 | Ga0070676_10021053 | 3300005328 | Bacteria | 3648 |
| 44 | Ga0070676_10203141 | 3300005328 | Bacteria | 1300 |
| 45 | Ga0070683_100049545 | 3300005329 | Bacteria | 3885 |
| 46 | Ga0070670_100058457 | 3300005331 | Bacteria | 3310 |
| 47 | Ga0070670_100078920 | 3300005331 | Bacteria | 2828 |
| 48 | Ga0070670_100164150 | 3300005331 | Bacteria | 1925 |
| 49 | Ga0068869_100006946 | 3300005334 | Bacteria | 7204 |
| 50 | Ga0068869_100032102 | 3300005334 | Bacteria | 3698 |
| 51 | Ga0070666_10010360 | 3300005335 | Bacteria | 5829 |
| 52 | Ga0070682_100011477 | 3300005337 | Bacteria | 5064 |
| 53 | Ga0068868_100015353 | 3300005338 | Bacteria | 5663 |
| 54 | Ga0068868_100150412 | 3300005338 | Bacteria | 1917 |
| 55 | Ga0070691_10093657 | 3300005341 | Bacteria | 1484 |
| 56 | Ga0070661_100000220 | 3300005344 | Bacteria | 47213 |
| 57 | Ga0070661_100122816 | 3300005344 | Bacteria | 1946 |
| 58 | Ga0070661_100471212 | 3300005344 | Bacteria | 1001 |
| 59 | Ga0070668_100017395 | 3300005347 | Bacteria | 5386 |
| 60 | Ga0070668_100404298 | 3300005347 | Bacteria | 1166 |
| 61 | Ga0070669_100009995 | 3300005353 | Bacteria | 6745 |
| 62 | Ga0070669_100012537 | 3300005353 | Bacteria | 6011 |
| 63 | Ga0070675_100005126 | 3300005354 | Bacteria | 9998 |
| 64 | Ga0070675_100018606 | 3300005354 | Bacteria | 5530 |
| 65 | Ga0070675_100065579 | 3300005354 | Bacteria | 3003 |
| 66 | Ga0070675_100067887 | 3300005354 | Bacteria | 2951 |
| 67 | Ga0070675_100085117 | 3300005354 | Bacteria | 2641 |
| 68 | Ga0070675_100235705 | 3300005354 | Bacteria | 1598 |
| 69 | Ga0070671_100027816 | 3300005355 | Bacteria | 4655 |
| 70 | Ga0070671_100164531 | 3300005355 | Bacteria | 1875 |
| 71 | Ga0070674_100010227 | 3300005356 | Bacteria | 5660 |
| 72 | Ga0070674_100015369 | 3300005356 | Bacteria | 4778 |
| 73 | Ga0070674_100034505 | 3300005356 | Bacteria | 3380 |
| 74 | Ga0070673_100007297 | 3300005364 | Bacteria | 7276 |
| 75 | Ga0070673_100018847 | 3300005364 | Bacteria | 4944 |
| 76 | Ga0070673_100027663 | 3300005364 | Bacteria | 4206 |
| 77 | Ga0070688_100323478 | 3300005365 | Bacteria | 1121 |
| 78 | Ga0070659_100011721 | 3300005366 | Bacteria | 6490 |
| 79 | Ga0070659_100279317 | 3300005366 | Bacteria | 1389 |
| 80 | Ga0070659_100541699 | 3300005366 | Bacteria | 996 |
| 81 | Ga0070667_100015900 | 3300005367 | Bacteria | 6225 |
| 82 | Ga0070667_100413156 | 3300005367 | Bacteria | 1229 |
| 83 | Ga0070667_100644164 | 3300005367 | Bacteria | 978 |
| 84 | Ga0070700_100072194 | 3300005441 | Bacteria | 2206 |
| 85 | Ga0070708_100224098 | 3300005445 | Bacteria | 1764 |
| 86 | Ga0070663_100000511 | 3300005455 | Bacteria | 20575 |
| 87 | Ga0070663_100040338 | 3300005455 | Bacteria | 3267 |
| 88 | Ga0070663_100047246 | 3300005455 | Bacteria | 3049 |
| 89 | Ga0070663_100147313 | 3300005455 | Bacteria | 1802 |
| 90 | Ga0070678_100094551 | 3300005456 | Bacteria | 2301 |
| 91 | Ga0070678_100299788 | 3300005456 | Bacteria | 1365 |
| 92 | Ga0070678_100383983 | 3300005456 | Bacteria | 1216 |
| 93 | Ga0070662_100011606 | 3300005457 | Bacteria | 5814 |
| 94 | Ga0070662_100025773 | 3300005457 | Bacteria | 4064 |
| 95 | Ga0070662_100059050 | 3300005457 | Bacteria | 2793 |
| 96 | Ga0070662_100075848 | 3300005457 | Bacteria | 2491 |
| 97 | Ga0070662_100162304 | 3300005457 | Bacteria | 1749 |
| 98 | Ga0070662_100179951 | 3300005457 | Bacteria | 1666 |
| 99 | Ga0070662_100182899 | 3300005457 | Bacteria | 1653 |
| 100 | Ga0070681_10803284 | 3300005458 | Bacteria | 858 |
| 101 | Ga0068867_100000790 | 3300005459 | Bacteria | 21397 |
| 102 | Ga0068867_100013500 | 3300005459 | Bacteria | 5785 |
| 103 | Ga0068867_100026443 | 3300005459 | Bacteria | 4167 |
| 104 | Ga0068867_100036682 | 3300005459 | Bacteria | 3561 |
| 105 | Ga0068867_100052050 | 3300005459 | Bacteria | 3021 |
| 106 | Ga0068867_100159120 | 3300005459 | Bacteria | 1780 |
| 107 | Ga0070706_100006257 | 3300005467 | Bacteria | 11259 |
| 108 | Ga0070706_100091805 | 3300005467 | Bacteria | 2817 |
| 109 | Ga0070698_100147344 | 3300005471 | Bacteria | 2302 |
| 110 | Ga0070699_100039909 | 3300005518 | Bacteria | 4065 |
| 111 | Ga0070684_100184945 | 3300005535 | Bacteria | 1895 |
| 112 | Ga0070684_100431796 | 3300005535 | Bacteria | 1216 |
| 113 | Ga0068853_100054053 | 3300005539 | Bacteria | 3460 |
| 114 | Ga0070672_100007320 | 3300005543 | Bacteria | 7483 |
| 115 | Ga0070672_100025782 | 3300005543 | Bacteria | 4367 |
| 116 | Ga0070672_100077068 | 3300005543 | Bacteria | 2665 |
| 117 | Ga0070672_100201268 | 3300005543 | Bacteria | 1665 |
| 118 | Ga0070672_100248257 | 3300005543 | Bacteria | 1498 |
| 119 | Ga0070665_100235654 | 3300005548 | Bacteria | 1831 |
| 120 | Ga0070665_100340176 | 3300005548 | Bacteria | 1505 |
| 121 | Ga0070665_100593165 | 3300005548 | Bacteria | 1121 |
| 122 | Ga0070704_100738292 | 3300005549 | Bacteria | 876 |
| 123 | Ga0068855_100036949 | 3300005563 | Bacteria | 5811 |
| 124 | Ga0068855_100232839 | 3300005563 | Bacteria | 2061 |
| 125 | Ga0068855_100234373 | 3300005563 | Bacteria | 2053 |
| 126 | Ga0068855_100804494 | 3300005563 | Bacteria | 999 |
| 127 | Ga0070664_100000267 | 3300005564 | Bacteria | 37668 |
| 128 | Ga0068857_100029449 | 3300005577 | Bacteria | 4845 |
| 129 | Ga0068857_100095589 | 3300005577 | Bacteria | 2662 |
| 130 | Ga0068857_100445996 | 3300005577 | Bacteria | 1209 |
| 131 | Ga0068854_100022875 | 3300005578 | Bacteria | 4264 |
| 132 | Ga0068854_100024167 | 3300005578 | Bacteria | 4158 |
| 133 | Ga0068856_100002053 | 3300005614 | Bacteria | 20877 |
| 134 | Ga0068856_100024851 | 3300005614 | Bacteria | 5835 |
| 135 | Ga0068856_100341809 | 3300005614 | Bacteria | 1515 |
| 136 | Ga0068852_100043701 | 3300005616 | Bacteria | 3801 |
| 137 | Ga0068852_100056636 | 3300005616 | Bacteria | 3389 |
| 138 | Ga0068852_100093722 | 3300005616 | Bacteria | 2692 |
| 139 | Ga0068852_100142284 | 3300005616 | Bacteria | 2221 |
| 140 | Ga0068852_100216417 | 3300005616 | Bacteria | 1820 |
| 141 | Ga0068852_100356599 | 3300005616 | Bacteria | 1429 |
| 142 | Ga0068852_100679484 | 3300005616 | Bacteria | 1039 |
| 143 | Ga0068859_100106772 | 3300005617 | Bacteria | 2859 |
| 144 | Ga0068859_100108883 | 3300005617 | Bacteria | 2832 |
| 145 | Ga0068864_100060031 | 3300005618 | Bacteria | 3292 |
| 146 | Ga0068864_100219491 | 3300005618 | Bacteria | 1754 |
| 147 | Ga0068864_100421101 | 3300005618 | Bacteria | 1272 |
| 148 | Ga0068864_100710494 | 3300005618 | Bacteria | 982 |
| 149 | Ga0068866_10110123 | 3300005718 | Bacteria | 1535 |
| 150 | Ga0068861_100015673 | 3300005719 | Bacteria | 5348 |
| 151 | Ga0068861_100022104 | 3300005719 | Bacteria | 4578 |
| 152 | Ga0068861_100022301 | 3300005719 | Bacteria | 4560 |
| 153 | Ga0068851_10037386 | 3300005834 | Bacteria | 2433 |
| 154 | Ga0068851_10100469 | 3300005834 | Bacteria | 1534 |
| 155 | Ga0068870_10267380 | 3300005840 | Bacteria | 1067 |
| 156 | Ga0068863_100049597 | 3300005841 | Bacteria | 3980 |
| 157 | Ga0068858_100006620 | 3300005842 | Bacteria | 11273 |
| 158 | Ga0068858_100120280 | 3300005842 | Bacteria | 2455 |
| 159 | Ga0068860_100097662 | 3300005843 | Bacteria | 2800 |
| 160 | Ga0068860_100172086 | 3300005843 | Bacteria | 2092 |
| 161 | Ga0068862_100063807 | 3300005844 | Bacteria | 3170 |
| 162 | Ga0068862_100228663 | 3300005844 | Bacteria | 1686 |
| 163 | Ga0075363_100038359 | 3300006048 | Bacteria | 2519 |
| 164 | Ga0075364_10053170 | 3300006051 | Bacteria | 2647 |
| 165 | Ga0075362_10012284 | 3300006177 | Bacteria | 3399 |
| 166 | Ga0075362_10028110 | 3300006177 | Bacteria | 2413 |
| 167 | Ga0075367_10002209 | 3300006178 | Bacteria | 8782 |
| 168 | Ga0075367_10088704 | 3300006178 | Bacteria | 1880 |
| 169 | Ga0075369_10023004 | 3300006186 | Bacteria | 2573 |
| 170 | Ga0075366_10007775 | 3300006195 | Bacteria | 5935 |
| 171 | Ga0075366_10013362 | 3300006195 | Bacteria | 4672 |
| 172 | Ga0075366_10029844 | 3300006195 | Bacteria | 3204 |
| 173 | Ga0075366_10078048 | 3300006195 | Bacteria | 1976 |
| 174 | Ga0075366_10086045 | 3300006195 | Bacteria | 1881 |
| 175 | Ga0075366_10134156 | 3300006195 | Bacteria | 1495 |
| 176 | Ga0075366_10356339 | 3300006195 | Bacteria | 898 |
| 177 | Ga0097621_100168995 | 3300006237 | Bacteria | 1884 |
| 178 | Ga0075370_10000201 | 3300006353 | Bacteria | 21046 |
| 179 | Ga0075370_10001234 | 3300006353 | Bacteria | 10856 |
| 180 | Ga0075370_10003435 | 3300006353 | Bacteria | 7541 |
| 181 | Ga0075370_10009591 | 3300006353 | Bacteria | 5033 |
| 182 | Ga0075370_10010256 | 3300006353 | Bacteria | 4892 |
| 183 | Ga0075370_10029300 | 3300006353 | Bacteria | 3066 |
| 184 | Ga0075370_10034024 | 3300006353 | Bacteria | 2856 |
| 185 | Ga0075370_10044650 | 3300006353 | Bacteria | 2505 |
| 186 | Ga0075370_10044825 | 3300006353 | Bacteria | 2500 |
| 187 | Ga0068871_100020051 | 3300006358 | Bacteria | 5117 |
| 188 | Ga0068871_100081992 | 3300006358 | Bacteria | 2674 |
| 189 | Ga0068865_100014886 | 3300006881 | Bacteria | 4951 |
| 190 | Ga0068865_100221348 | 3300006881 | Bacteria | 1480 |
| 191 | Ga0097620_100106761 | 3300006931 | Bacteria | 2859 |
| 192 | Ga0097620_100108885 | 3300006931 | Bacteria | 2832 |
| 193 | Ga0099823_1000083 | 3300006944 | Bacteria | 44975 |
| 194 | Ga0079104_1000013 | 3300006946 | Bacteria | 349477 |
| 195 | Ga0105240_10015301 | 3300009093 | Bacteria | 10439 |
| 196 | Ga0105240_10118894 | 3300009093 | Bacteria | 3184 |
| 197 | Ga0105240_10524014 | 3300009093 | Bacteria | 1315 |
| 198 | Ga0105245_10013187 | 3300009098 | Bacteria | 7201 |
| 199 | Ga0105245_10228508 | 3300009098 | Bacteria | 1799 |
| 200 | Ga0105245_10470397 | 3300009098 | Bacteria | 1269 |
| 201 | Ga0114129_10241375 | 3300009147 | Bacteria | 2429 |
| 202 | Ga0105243_10002845 | 3300009148 | Bacteria | 14364 |
| 203 | Ga0105243_10004374 | 3300009148 | Bacteria | 11179 |
| 204 | Ga0105243_10010965 | 3300009148 | Bacteria | 6853 |
| 205 | Ga0105243_10078629 | 3300009148 | Bacteria | 2686 |
| 206 | Ga0105243_10091822 | 3300009148 | Bacteria | 2501 |
| 207 | Ga0105243_10120701 | 3300009148 | Bacteria | 2209 |
| 208 | Ga0105243_10124756 | 3300009148 | Bacteria | 2176 |
| 209 | Ga0105242_10313640 | 3300009176 | Bacteria | 1436 |
| 210 | Ga0105242_10351715 | 3300009176 | Bacteria | 1361 |
| 211 | Ga0105242_10726124 | 3300009176 | Bacteria | 975 |
| 212 | Ga0105248_10022270 | 3300009177 | Bacteria | 7025 |
| 213 | Ga0105248_10095190 | 3300009177 | Bacteria | 3353 |
| 214 | Ga0105248_10124017 | 3300009177 | Bacteria | 2914 |
| 215 | Ga0105237_10000441 | 3300009545 | Bacteria | 59156 |
| 216 | Ga0105237_10005851 | 3300009545 | Bacteria | 13795 |
| 217 | Ga0105238_10009732 | 3300009551 | Bacteria | 9625 |
| 218 | Ga0105238_10070600 | 3300009551 | Bacteria | 3491 |
| 219 | Ga0105238_10171909 | 3300009551 | Bacteria | 2143 |
| 220 | Ga0105249_10029198 | 3300009553 | Bacteria | 4980 |
| 221 | Ga0105239_10000417 | 3300010375 | Bacteria | 62040 |
| 222 | Ga0105239_10037957 | 3300010375 | Bacteria | 5279 |
| 223 | Ga0105239_10081431 | 3300010375 | Bacteria | 3563 |
| 224 | Ga0105239_10083030 | 3300010375 | Bacteria | 3528 |
| 225 | Ga0105239_10239407 | 3300010375 | Bacteria | 2037 |
| 226 | Ga0105246_10115928 | 3300011119 | Bacteria | 1976 |
| 227 | Ga0157319_1000037 | 3300012497 | Bacteria | 39883 |
| 228 | Ga0157371_10167673 | 3300013102 | Bacteria | 1569 |
| 229 | Ga0157369_10028648 | 3300013105 | Bacteria | 6163 |
| 230 | Ga0157369_10842038 | 3300013105 | Bacteria | 942 |
| 231 | Ga0157374_10029986 | 3300013296 | Bacteria | 4935 |
| 232 | Ga0157374_10524788 | 3300013296 | Bacteria | 1190 |
| 233 | Ga0157374_10707214 | 3300013296 | Bacteria | 1021 |
| 234 | Ga0157378_10095407 | 3300013297 | Bacteria | 2709 |
| 235 | Ga0157378_10208963 | 3300013297 | Bacteria | 1850 |
| 236 | Ga0157378_10501530 | 3300013297 | Bacteria | 1212 |
| 237 | Ga0163162_10025537 | 3300013306 | Bacteria | 5838 |
| 238 | Ga0163162_10065803 | 3300013306 | Bacteria | 3673 |
| 239 | Ga0163162_10939741 | 3300013306 | Bacteria | 976 |
| 240 | Ga0157372_10033672 | 3300013307 | Bacteria | 5630 |
| 241 | Ga0157375_10196704 | 3300013308 | Bacteria | 2171 |
| 242 | Ga0157375_10226234 | 3300013308 | Bacteria | 2029 |
| 243 | Ga0157375_11210744 | 3300013308 | Bacteria | 886 |
| 244 | Ga0163163_11011645 | 3300014325 | Bacteria | 894 |
| 245 | Ga0157380_10269980 | 3300014326 | Bacteria | 1550 |
| 246 | Ga0157377_10000091 | 3300014745 | Bacteria | 66087 |
| 247 | Ga0157377_10016804 | 3300014745 | Bacteria | 3771 |
| 248 | Ga0157377_10198369 | 3300014745 | Bacteria | 1273 |
| 249 | Ga0157379_10019670 | 3300014968 | Bacteria | 5964 |
| 250 | Ga0157379_10048077 | 3300014968 | Bacteria | 3808 |
| 251 | Ga0157379_10257130 | 3300014968 | Bacteria | 1586 |
| 252 | Ga0157379_10446633 | 3300014968 | Bacteria | 1193 |
| 253 | Ga0157376_10014494 | 3300014969 | Bacteria | 5920 |
| 254 | Ga0157376_10325280 | 3300014969 | Bacteria | 1463 |
| 255 | Ga0157376_10494306 | 3300014969 | Bacteria | 1201 |
| 256 | Ga0163161_10019047 | 3300017792 | Bacteria | 4812 |
| 257 | Ga0163161_10031397 | 3300017792 | Bacteria | 3784 |
| 258 | Ga0213872_10000018 | 3300021361 | Bacteria | 175951 |
| 259 | Ga0213872_10000070 | 3300021361 | Bacteria | 91519 |
| 260 | Ga0213872_10000417 | 3300021361 | Bacteria | 34831 |
| 261 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 262 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 263 | Ga0209563_100110 | 3300025230 | Bacteria | 142518 |
| 264 | Ga0207427_101215 | 3300025231 | Bacteria | 9962 |
| 265 | Ga0209258_100124 | 3300025242 | Bacteria | 178883 |
| 266 | Ga0209258_105648 | 3300025242 | Bacteria | 2081 |
| 267 | Ga0207425_1000333 | 3300025245 | Bacteria | 33033 |
| 268 | Ga0209646_1000196 | 3300025246 | Bacteria | 72959 |
| 269 | Ga0209646_1016918 | 3300025246 | Bacteria | 1079 |
| 270 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 271 | Ga0209677_100151 | 3300025253 | Bacteria | 63642 |
| 272 | Ga0209677_100488 | 3300025253 | Bacteria | 22414 |
| 273 | Ga0209677_100877 | 3300025253 | Bacteria | 14760 |
| 274 | Ga0209759_1000107 | 3300025256 | Bacteria | 147025 |
| 275 | Ga0209759_1000652 | 3300025256 | Bacteria | 32306 |
| 276 | Ga0209759_1000898 | 3300025256 | Bacteria | 22252 |
| 277 | Ga0209759_1019767 | 3300025256 | Bacteria | 1586 |
| 278 | Ga0209759_1037097 | 3300025256 | Bacteria | 880 |
| 279 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 280 | Ga0209455_1000114 | 3300025272 | Bacteria | 178883 |
| 281 | Ga0209673_1009846 | 3300025273 | Bacteria | 4092 |
| 282 | Ga0209675_1019509 | 3300025291 | Bacteria | 1864 |
| 283 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 284 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 285 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 286 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 287 | Ga0209050_1008652 | 3300025298 | Bacteria | 5382 |
| 288 | Ga0209256_1000130 | 3300025299 | Bacteria | 163227 |
| 289 | Ga0209256_1000471 | 3300025299 | Bacteria | 60530 |
| 290 | Ga0209051_1001932 | 3300025303 | Bacteria | 16014 |
| 291 | Ga0209051_1002398 | 3300025303 | Bacteria | 13498 |
| 292 | Ga0209051_1006338 | 3300025303 | Bacteria | 6695 |
| 293 | Ga0209051_1009233 | 3300025303 | Bacteria | 5103 |
| 294 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 295 | Ga0209257_1001013 | 3300025304 | Bacteria | 37837 |
| 296 | Ga0209257_1001664 | 3300025304 | Bacteria | 25177 |
| 297 | Ga0209257_1060265 | 3300025304 | Bacteria | 1033 |
| 298 | Ga0207697_10024132 | 3300025315 | Bacteria | 2491 |
| 299 | Ga0207697_10029145 | 3300025315 | Bacteria | 2258 |
| 300 | Ga0207697_10101257 | 3300025315 | Bacteria | 1228 |
| 301 | Ga0207656_10088785 | 3300025321 | Bacteria | 1400 |
| 302 | Ga0207656_10115967 | 3300025321 | Bacteria | 1242 |
| 303 | Ga0207682_10022146 | 3300025893 | Bacteria | 2502 |
| 304 | Ga0207682_10026607 | 3300025893 | Bacteria | 2300 |
| 305 | Ga0207682_10081982 | 3300025893 | Bacteria | 1384 |
| 306 | Ga0207688_10030413 | 3300025901 | Bacteria | 2977 |
| 307 | Ga0207688_10036249 | 3300025901 | Bacteria | 2734 |
| 308 | Ga0207688_10095062 | 3300025901 | Bacteria | 1715 |
| 309 | Ga0207680_10456126 | 3300025903 | Bacteria | 908 |
| 310 | Ga0207645_10001787 | 3300025907 | Bacteria | 17388 |
| 311 | Ga0207645_10008457 | 3300025907 | Bacteria | 7178 |
| 312 | Ga0207645_10014732 | 3300025907 | Bacteria | 5221 |
| 313 | Ga0207645_10110772 | 3300025907 | Bacteria | 1777 |
| 314 | Ga0207643_10082044 | 3300025908 | Bacteria | 1869 |
| 315 | Ga0207643_10335907 | 3300025908 | Bacteria | 946 |
| 316 | Ga0207643_10492395 | 3300025908 | Bacteria | 783 |
| 317 | Ga0207705_10126816 | 3300025909 | Bacteria | 1897 |
| 318 | Ga0207705_10134771 | 3300025909 | Bacteria | 1840 |
| 319 | Ga0207705_10174068 | 3300025909 | Bacteria | 1622 |
| 320 | Ga0207705_10439247 | 3300025909 | Bacteria | 1011 |
| 321 | Ga0207684_10041453 | 3300025910 | Bacteria | 3903 |
| 322 | Ga0207654_10019687 | 3300025911 | Bacteria | 3567 |
| 323 | Ga0207695_10023628 | 3300025913 | Bacteria | 6937 |
| 324 | Ga0207695_10024383 | 3300025913 | Bacteria | 6809 |
| 325 | Ga0207695_10731186 | 3300025913 | Bacteria | 870 |
| 326 | Ga0207671_10001929 | 3300025914 | Bacteria | 22998 |
| 327 | Ga0207671_10045543 | 3300025914 | Bacteria | 3244 |
| 328 | Ga0207657_10044064 | 3300025919 | Bacteria | 3925 |
| 329 | Ga0207657_10127028 | 3300025919 | Bacteria | 2093 |
| 330 | Ga0207657_10342328 | 3300025919 | Bacteria | 1180 |
| 331 | Ga0207649_10001581 | 3300025920 | Bacteria | 13262 |
| 332 | Ga0207649_10079481 | 3300025920 | Bacteria | 2119 |
| 333 | Ga0207649_10112887 | 3300025920 | Bacteria | 1819 |
| 334 | Ga0207681_10000974 | 3300025923 | Bacteria | 18695 |
| 335 | Ga0207681_10035283 | 3300025923 | Bacteria | 3294 |
| 336 | Ga0207681_10062794 | 3300025923 | Bacteria | 2559 |
| 337 | Ga0207694_10062742 | 3300025924 | Bacteria | 2894 |
| 338 | Ga0207694_10106435 | 3300025924 | Bacteria | 2228 |
| 339 | Ga0207650_10060020 | 3300025925 | Bacteria | 2837 |
| 340 | Ga0207650_10072212 | 3300025925 | Bacteria | 2597 |
| 341 | Ga0207650_10093142 | 3300025925 | Bacteria | 2306 |
| 342 | Ga0207650_10191466 | 3300025925 | Bacteria | 1634 |
| 343 | Ga0207659_10020790 | 3300025926 | Bacteria | 4345 |
| 344 | Ga0207659_10042645 | 3300025926 | Bacteria | 3182 |
| 345 | Ga0207659_10086103 | 3300025926 | Bacteria | 2336 |
| 346 | Ga0207659_10090565 | 3300025926 | Bacteria | 2283 |
| 347 | Ga0207659_10197159 | 3300025926 | Bacteria | 1606 |
| 348 | Ga0207687_10082878 | 3300025927 | Bacteria | 2321 |
| 349 | Ga0207687_10289598 | 3300025927 | Bacteria | 1316 |
| 350 | Ga0207644_10016843 | 3300025931 | Bacteria | 4924 |
| 351 | Ga0207644_10024152 | 3300025931 | Bacteria | 4171 |
| 352 | Ga0207644_10368925 | 3300025931 | Bacteria | 1169 |
| 353 | Ga0207690_10147841 | 3300025932 | Bacteria | 1739 |
| 354 | Ga0207690_10154917 | 3300025932 | Bacteria | 1702 |
| 355 | Ga0207690_10434774 | 3300025932 | Bacteria | 1052 |
| 356 | Ga0207706_10000993 | 3300025933 | Bacteria | 28866 |
| 357 | Ga0207706_10001576 | 3300025933 | Bacteria | 22614 |
| 358 | Ga0207706_10091398 | 3300025933 | Bacteria | 2676 |
| 359 | Ga0207706_10129692 | 3300025933 | Bacteria | 2218 |
| 360 | Ga0207706_10182261 | 3300025933 | Bacteria | 1844 |
| 361 | Ga0207706_10184163 | 3300025933 | Bacteria | 1834 |
| 362 | Ga0207686_10192095 | 3300025934 | Bacteria | 1456 |
| 363 | Ga0207709_10004566 | 3300025935 | Bacteria | 7972 |
| 364 | Ga0207709_10026089 | 3300025935 | Bacteria | 3353 |
| 365 | Ga0207709_10035015 | 3300025935 | Bacteria | 2965 |
| 366 | Ga0207709_10084466 | 3300025935 | Bacteria | 2055 |
| 367 | Ga0207669_10019498 | 3300025937 | Bacteria | 3533 |
| 368 | Ga0207669_10027345 | 3300025937 | Bacteria | 3121 |
| 369 | Ga0207704_10056029 | 3300025938 | Bacteria | 2412 |
| 370 | Ga0207704_10205333 | 3300025938 | Bacteria | 1445 |
| 371 | Ga0207704_10450450 | 3300025938 | Bacteria | 1027 |
| 372 | Ga0207704_10715257 | 3300025938 | Bacteria | 830 |
| 373 | Ga0207665_10239116 | 3300025939 | Bacteria | 1337 |
| 374 | Ga0207691_10006575 | 3300025940 | Bacteria | 11227 |
| 375 | Ga0207691_10042436 | 3300025940 | Bacteria | 4193 |
| 376 | Ga0207691_10115314 | 3300025940 | Bacteria | 2386 |
| 377 | Ga0207691_10469389 | 3300025940 | Bacteria | 1070 |
| 378 | Ga0207711_10005046 | 3300025941 | Bacteria | 11194 |
| 379 | Ga0207711_10015814 | 3300025941 | Bacteria | 6260 |
| 380 | Ga0207689_10000855 | 3300025942 | Bacteria | 29354 |
| 381 | Ga0207689_10003648 | 3300025942 | Bacteria | 14048 |
| 382 | Ga0207689_10009091 | 3300025942 | Bacteria | 8601 |
| 383 | Ga0207689_10113469 | 3300025942 | Bacteria | 2227 |
| 384 | Ga0207679_10000486 | 3300025945 | Bacteria | 27449 |
| 385 | Ga0207679_10256730 | 3300025945 | Bacteria | 1489 |
| 386 | Ga0207679_10365409 | 3300025945 | Bacteria | 1261 |
| 387 | Ga0207679_10453235 | 3300025945 | Bacteria | 1138 |
| 388 | Ga0207679_10782839 | 3300025945 | Bacteria | 869 |
| 389 | Ga0207667_10099975 | 3300025949 | Bacteria | 2992 |
| 390 | Ga0207667_10159584 | 3300025949 | Bacteria | 2320 |
| 391 | Ga0207667_10360759 | 3300025949 | Bacteria | 1482 |
| 392 | Ga0207651_10002160 | 3300025960 | Bacteria | 9302 |
| 393 | Ga0207651_10243179 | 3300025960 | Bacteria | 1468 |
| 394 | Ga0207712_10106021 | 3300025961 | Bacteria | 2099 |
| 395 | Ga0207668_10129350 | 3300025972 | Bacteria | 1925 |
| 396 | Ga0207640_10011945 | 3300025981 | Bacteria | 4932 |
| 397 | Ga0207640_10058408 | 3300025981 | Bacteria | 2541 |
| 398 | Ga0207640_10496267 | 3300025981 | Bacteria | 1016 |
| 399 | Ga0207658_10005961 | 3300025986 | Bacteria | 8325 |
| 400 | Ga0207658_10168912 | 3300025986 | Bacteria | 1800 |
| 401 | Ga0207658_10599759 | 3300025986 | Bacteria | 989 |
| 402 | Ga0207677_10017341 | 3300026023 | Bacteria | 4290 |
| 403 | Ga0207677_10158644 | 3300026023 | Bacteria | 1755 |
| 404 | Ga0207677_10168103 | 3300026023 | Bacteria | 1711 |
| 405 | Ga0207703_10065050 | 3300026035 | Bacteria | 2995 |
| 406 | Ga0207703_10246180 | 3300026035 | Bacteria | 1609 |
| 407 | Ga0207703_10436691 | 3300026035 | Bacteria | 1221 |
| 408 | Ga0207639_10015071 | 3300026041 | Bacteria | 5444 |
| 409 | Ga0207639_10680217 | 3300026041 | Bacteria | 953 |
| 410 | Ga0207678_10005512 | 3300026067 | Bacteria | 11313 |
| 411 | Ga0207678_10023385 | 3300026067 | Bacteria | 5404 |
| 412 | Ga0207678_10166497 | 3300026067 | Bacteria | 1882 |
| 413 | Ga0207678_10236701 | 3300026067 | Bacteria | 1564 |
| 414 | Ga0207678_10319869 | 3300026067 | Bacteria | 1335 |
| 415 | Ga0207708_10041755 | 3300026075 | Bacteria | 3496 |
| 416 | Ga0207702_10000356 | 3300026078 | Bacteria | 52498 |
| 417 | Ga0207702_10047997 | 3300026078 | Bacteria | 3600 |
| 418 | Ga0207702_10183623 | 3300026078 | Bacteria | 1928 |
| 419 | Ga0207702_10190137 | 3300026078 | Bacteria | 1896 |
| 420 | Ga0207641_10001680 | 3300026088 | Bacteria | 21541 |
| 421 | Ga0207641_10559869 | 3300026088 | Bacteria | 1116 |
| 422 | Ga0207648_10002162 | 3300026089 | Bacteria | 21355 |
| 423 | Ga0207648_10010360 | 3300026089 | Bacteria | 8842 |
| 424 | Ga0207648_10040097 | 3300026089 | Bacteria | 4115 |
| 425 | Ga0207648_10058384 | 3300026089 | Bacteria | 3364 |
| 426 | Ga0207648_10410318 | 3300026089 | Bacteria | 1228 |
| 427 | Ga0207676_10200144 | 3300026095 | Bacteria | 1764 |
| 428 | Ga0207676_10476828 | 3300026095 | Bacteria | 1181 |
| 429 | Ga0207674_10026355 | 3300026116 | Bacteria | 6176 |
| 430 | Ga0207674_10054067 | 3300026116 | Bacteria | 4090 |
| 431 | Ga0207674_10112313 | 3300026116 | Bacteria | 2698 |
| 432 | Ga0207674_10122177 | 3300026116 | Bacteria | 2570 |
| 433 | Ga0207675_100000911 | 3300026118 | Bacteria | 29492 |
| 434 | Ga0207675_100025343 | 3300026118 | Bacteria | 5518 |
| 435 | Ga0207675_100112287 | 3300026118 | Bacteria | 2572 |
| 436 | Ga0207683_10025099 | 3300026121 | Bacteria | 5139 |
| 437 | Ga0207683_10067518 | 3300026121 | Bacteria | 3154 |
| 438 | Ga0207683_10247414 | 3300026121 | Bacteria | 1627 |
| 439 | Ga0207683_10280562 | 3300026121 | Bacteria | 1522 |
| 440 | Ga0207683_10734175 | 3300026121 | Bacteria | 916 |
| 441 | Ga0207683_10861978 | 3300026121 | Bacteria | 841 |
| 442 | Ga0207698_10006990 | 3300026142 | Bacteria | 7064 |
| 443 | Ga0207698_10043539 | 3300026142 | Bacteria | 3364 |
| 444 | Ga0207698_10128705 | 3300026142 | Bacteria | 2159 |
| 445 | Ga0207698_10171264 | 3300026142 | Bacteria | 1912 |
| 446 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 447 | Ga0209996_1004814 | 3300027395 | Bacteria | 1724 |
| 448 | Ga0268266_10259244 | 3300028379 | Bacteria | 1611 |
| 449 | Ga0268266_10555972 | 3300028379 | Bacteria | 1100 |
| 450 | Ga0268265_10016231 | 3300028380 | Bacteria | 5112 |
| 451 | Ga0268265_10158640 | 3300028380 | Bacteria | 1918 |
| 452 | Ga0268265_10843370 | 3300028380 | Bacteria | 896 |
| 453 | Ga0268264_10052692 | 3300028381 | Bacteria | 3393 |
| 454 | Ga0268264_10223286 | 3300028381 | Bacteria | 1735 |
| 455 | Ga0265334_10067856 | 3300028573 | Bacteria | 1332 |
| 456 | Ga0265336_10000022 | 3300028666 | Bacteria | 192716 |
| 457 | Ga0307517_10335046 | 3300028786 | Bacteria | 829 |
| 458 | Ga0307515_10000131 | 3300028794 | Bacteria | 178919 |
| 459 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 460 | Ga0307515_10000232 | 3300028794 | Bacteria | 137778 |
| 461 | Ga0307515_10001456 | 3300028794 | Bacteria | 53165 |
| 462 | Ga0307515_10003007 | 3300028794 | Bacteria | 35804 |
| 463 | Ga0307515_10027050 | 3300028794 | Bacteria | 9832 |
| 464 | Ga0307515_10101925 | 3300028794 | Bacteria | 3459 |
| 465 | Ga0265324_10002326 | 3300029957 | Bacteria | 9841 |
| 466 | Ga0268256_1021399 | 3300030500 | Bacteria | 1721 |
| 467 | Ga0265328_10027240 | 3300031239 | Bacteria | 2143 |
| 468 | Ga0265331_10091700 | 3300031250 | Bacteria | 1404 |
| 469 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 470 | Ga0307513_10001541 | 3300031456 | Bacteria | 33038 |
| 471 | Ga0307509_10246280 | 3300031507 | Bacteria | 1575 |
| 472 | Ga0307408_100000160 | 3300031548 | Bacteria | 74342 |
| 473 | Ga0307408_100039869 | 3300031548 | Bacteria | 3323 |
| 474 | Ga0307408_100064966 | 3300031548 | Bacteria | 2675 |
| 475 | Ga0307408_100096425 | 3300031548 | Bacteria | 2244 |
| 476 | Ga0307408_100216238 | 3300031548 | Bacteria | 1561 |
| 477 | Ga0307514_10001289 | 3300031649 | Bacteria | 32516 |
| 478 | Ga0307516_10002032 | 3300031730 | Bacteria | 27587 |
| 479 | Ga0307516_10002726 | 3300031730 | Bacteria | 23277 |
| 480 | Ga0307516_10015871 | 3300031730 | Bacteria | 7903 |
| 481 | Ga0307516_10051235 | 3300031730 | Bacteria | 4047 |
| 482 | Ga0307516_10276676 | 3300031730 | Bacteria | 1362 |
| 483 | Ga0307409_100464726 | 3300031995 | Bacteria | 1224 |
| 484 | Ga0307416_100078114 | 3300032002 | Bacteria | 2783 |
| 485 | Ga0307416_100942918 | 3300032002 | Bacteria | 965 |
| 486 | Ga0307414_10005757 | 3300032004 | Bacteria | 6848 |
| 487 | Ga0307414_10777095 | 3300032004 | Bacteria | 872 |
| 488 | Ga0307411_10009492 | 3300032005 | Bacteria | 5119 |
| 489 | Ga0307411_10212005 | 3300032005 | Bacteria | 1496 |
| 490 | Ga0307411_10392620 | 3300032005 | Bacteria | 1145 |
| 491 | Ga0307510_10007541 | 3300033180 | Bacteria | 12959 |
| 492 | Ga0373959_0040877 | 3300034820 | Bacteria | 972 |
| 493 | Ga0373940_0096976 | 3300035088 | Bacteria | 890 |
| 494 | Ga0373949_0022695 | 3300035090 | Bacteria | 1449 |
| 495 | Ga0373932_0116696 | 3300035112 | Bacteria | 886 |
| 496 | Ga0373939_0001481 | 3300035114 | Bacteria | 5688 |
| 497 | Ga0373956_0228389 | 3300035119 | Bacteria | 884 |
| 498 | Ga0373960_0012261 | 3300035121 | Bacteria | 2127 |
| 499 | Ga0373960_0072452 | 3300035121 | Bacteria | 1068 |
| 500 | Ga0373943_0256544 | 3300035170 | Bacteria | 983 |
| 501 | Ga0373962_0010650 | 3300035242 | Bacteria | 2297 |
| 502 | Ga0373962_0034740 | 3300035242 | Bacteria | 1397 |
| 503 | Ga0373931_0000429 | 3300035691 | Bacteria | 17104 |
| 504 | Ga0373931_0001168 | 3300035691 | Bacteria | 11183 |
| 505 | Ga0373931_0001365 | 3300035691 | Bacteria | 10433 |
| 506 | Ga0373927_0164516 | 3300035695 | Bacteria | 1454 |
| 507 | Ga0373937_0201608 | 3300036401 | Bacteria | 1870 |
| 508 | Ga0373925_0046695 | 3300037068 | Bacteria | 3221 |
| 509 | Ga0395905_0008848 | 3300037471 | Bacteria | 9894 |
| 510 | Ga0395905_0015785 | 3300037471 | Bacteria | 7174 |
| 511 | Ga0395905_0242112 | 3300037471 | Bacteria | 1685 |
| 512 | Ga0395901_0004869 | 3300038443 | Bacteria | 13555 |
| 513 | Ga0436365_0394409 | 3300039437 | Bacteria | 916 |
| 514 | Ga0436361_0275830 | 3300039447 | Bacteria | 6564 |
| 515 | Ga0436361_0677882 | 3300039447 | Bacteria | 228834 |
| 516 | Ga0436361_0763381 | 3300039447 | Bacteria | 4734 |
| 517 | Ga0436361_0812713 | 3300039447 | Bacteria | 39089 |
| 518 | Ga0439461_0046392 | 3300041410 | Bacteria | 952 |
| 519 | Ga0451793_1137656 | 3300041452 | Bacteria | 1029 |
| 520 | Ga0451795_0619171 | 3300041456 | Bacteria | 1810 |
| 521 | Ga0451807_2445078 | 3300041486 | Bacteria | 1540 |
| 522 | Ga0451833_0114255 | 3300041491 | Bacteria | 1260 |
| 523 | Ga0451853_3442311 | 3300041512 | Bacteria | 2408 |
| 524 | Ga0439454_003233 | 3300042011 | Bacteria | 1796 |
| 525 | Ga0450917_000073 | 3300042120 | Bacteria | 5647 |
| 526 | Ga0450919_007815 | 3300042121 | Bacteria | 1245 |
| 527 | Ga0450923_013417 | 3300042125 | Bacteria | 1506 |
| 528 | Ga0450890_001264 | 3300042127 | Bacteria | 3662 |
| 529 | Ga0450890_003134 | 3300042127 | Bacteria | 2214 |
| 530 | Ga0450891_000191 | 3300042129 | Bacteria | 5995 |
| 531 | Ga0450889_000610 | 3300042144 | Bacteria | 3971 |
| 532 | Ga0439458_0020111 | 3300042157 | Bacteria | 1541 |
| 533 | Ga0439458_0027396 | 3300042157 | Bacteria | 1344 |
| 534 | Ga0439459_0001224 | 3300042438 | Bacteria | 3755 |
| 535 | Ga0439459_0011217 | 3300042438 | Bacteria | 1577 |
| 536 | Ga0450918_000573 | 3300042531 | Bacteria | 7828 |
| 537 | Ga0451577_0000152 | 3300042876 | Bacteria | 153284 |
| 538 | Ga0451577_0007214 | 3300042876 | Bacteria | 10951 |
| 539 | Ga0451577_0021763 | 3300042876 | Bacteria | 5863 |
| 540 | Ga0466969_0002697 | 3300044656 | Bacteria | 9478 |
| 541 | Ga0466969_0019974 | 3300044656 | Bacteria | 3472 |
| 542 | Ga0466969_0048861 | 3300044656 | Bacteria | 2089 |
| 543 | Ga0466972_0000265 | 3300044658 | Bacteria | 33659 |
| 544 | Ga0466977_0000007 | 3300044666 | Bacteria | 32886 |
| 545 | Ga0466965_0000290 | 3300044683 | Bacteria | 16664 |
| 546 | Ga0466966_0001287 | 3300044684 | Bacteria | 16051 |
| 547 | Ga0466966_0084879 | 3300044684 | Bacteria | 1968 |
| 548 | Ga0466963_0018757 | 3300044694 | Bacteria | 4330 |
| 549 | Ga0466963_0171347 | 3300044694 | Bacteria | 1513 |
| 550 | Ga0466964_0000836 | 3300044706 | Bacteria | 10083 |
| 551 | Ga0466964_0293918 | 3300044706 | Bacteria | 816 |
| 552 | Ga0453684_0000122 | 3300044712 | Bacteria | 340529 |
| 553 | Ga0453684_0064995 | 3300044712 | Bacteria | 4655 |
| 554 | Ga0453684_0074293 | 3300044712 | Bacteria | 4281 |
| 555 | Ga0453684_0198585 | 3300044712 | Bacteria | 2340 |
| 556 | Ga0466971_0000304 | 3300044719 | Bacteria | 18934 |
| 557 | Ga0466968_0006186 | 3300044735 | Bacteria | 4501 |
| 558 | Ga0466968_0009938 | 3300044735 | Bacteria | 3673 |
| 559 | Ga0466970_0000659 | 3300044765 | Bacteria | 16979 |
| 560 | Ga0466970_0008455 | 3300044765 | Bacteria | 5181 |
| 561 | Ga0466957_0001020 | 3300044842 | Bacteria | 14442 |
| 562 | Ga0466959_0001171 | 3300045049 | Bacteria | 15784 |
| 563 | Ga0466959_0002228 | 3300045049 | Bacteria | 12350 |
| 564 | Ga0451576_0000559 | 3300045051 | Bacteria | 79734 |
| 565 | Ga0451576_0074522 | 3300045051 | Bacteria | 3532 |
| 566 | Ga0451576_0103352 | 3300045051 | Bacteria | 2964 |
| 567 | Ga0451576_0126788 | 3300045051 | Bacteria | 2659 |
| 568 | Ga0451576_0333617 | 3300045051 | Bacteria | 1587 |
| 569 | Ga0451576_0483882 | 3300045051 | Bacteria | 1300 |
| 570 | Ga0466958_0015806 | 3300045836 | Bacteria | 4334 |
| 571 | Ga0466958_0157085 | 3300045836 | Bacteria | 1435 |
| 572 | Ga0466967_0033285 | 3300045976 | Bacteria | 4361 |
| 573 | Ga0495629_0007894 | 3300046459 | Bacteria | 7829 |
| 574 | Ga0495638_0087017 | 3300046460 | Bacteria | 1888 |
| 575 | Ga0495650_0000002 | 3300046471 | Bacteria | 1057165 |
| 576 | Ga0495650_0000478 | 3300046471 | Bacteria | 61296 |
| 577 | Ga0495650_0042201 | 3300046471 | Bacteria | 1944 |
| 578 | Ga0495605_0004250 | 3300046474 | Bacteria | 8440 |
| 579 | Ga0495639_0018631 | 3300046475 | Bacteria | 3025 |
| 580 | Ga0495585_0230808 | 3300046492 | Bacteria | 930 |
| 581 | Ga0495594_0007426 | 3300046499 | Bacteria | 5639 |
| 582 | Ga0495596_0000001 | 3300046500 | Bacteria | 501331 |
| 583 | Ga0495607_0000175 | 3300046501 | Bacteria | 68131 |
| 584 | Ga0495583_0000123 | 3300046506 | Bacteria | 131122 |
| 585 | Ga0495606_0001921 | 3300046507 | Bacteria | 25804 |
| 586 | Ga0495606_0216870 | 3300046507 | Bacteria | 1081 |
| 587 | Ga0495610_0000002 | 3300046512 | Bacteria | 1282131 |
| 588 | Ga0495610_0090865 | 3300046512 | Bacteria | 1384 |
| 589 | Ga0495620_0103979 | 3300046515 | Bacteria | 1130 |
| 590 | Ga0495632_0011879 | 3300046519 | Bacteria | 5059 |
| 591 | Ga0495632_0014006 | 3300046519 | Bacteria | 4551 |
| 592 | Ga0495632_0016647 | 3300046519 | Bacteria | 4082 |
| 593 | Ga0495637_0000005 | 3300046520 | Bacteria | 447799 |
| 594 | Ga0495643_0000002 | 3300046522 | Bacteria | 1131278 |
| 595 | Ga0495643_0012023 | 3300046522 | Bacteria | 5238 |
| 596 | Ga0495666_0010876 | 3300046526 | Bacteria | 4537 |
| 597 | Ga0495654_0091466 | 3300046530 | Bacteria | 1411 |
| 598 | Ga0495598_0015441 | 3300046537 | Bacteria | 1929 |
| 599 | Ga0495598_0045602 | 3300046537 | Bacteria | 1300 |
| 600 | Ga0495621_0002970 | 3300046539 | Bacteria | 4625 |
| 601 | Ga0495621_0085259 | 3300046539 | Bacteria | 1183 |
| 602 | Ga0495597_0000015 | 3300046542 | Bacteria | 172952 |
| 603 | Ga0495597_0001359 | 3300046542 | Bacteria | 17738 |
| 604 | Ga0495597_0042619 | 3300046542 | Bacteria | 2023 |
| 605 | Ga0495645_0170854 | 3300046543 | Bacteria | 1497 |
| 606 | Ga0495622_0150409 | 3300046557 | Bacteria | 1053 |
| 607 | Ga0495668_0084528 | 3300046616 | Bacteria | 1740 |
| 608 | Ga0495625_0001732 | 3300046660 | Bacteria | 25240 |
| 609 | Ga0495625_0003731 | 3300046660 | Bacteria | 14831 |
| 610 | Ga0495625_0004458 | 3300046660 | Bacteria | 13233 |
| 611 | Ga0495625_0441550 | 3300046660 | Bacteria | 805 |
| 612 | Ga0495625_0456567 | 3300046660 | Bacteria | 788 |
| 613 | Ga0495658_0080334 | 3300046683 | Bacteria | 1912 |
| 614 | Ga0495670_0214521 | 3300046691 | Bacteria | 1021 |
| 615 | Ga0495671_0001269 | 3300046692 | Bacteria | 17216 |
| 616 | Ga0495671_0280824 | 3300046692 | Bacteria | 802 |
| 617 | Ga0495649_0005186 | 3300046694 | Bacteria | 8347 |
| 618 | Ga0495649_0006920 | 3300046694 | Bacteria | 7013 |
| 619 | Ga0495589_0002708 | 3300046794 | Bacteria | 9794 |
| 620 | Ga0495672_0182064 | 3300047320 | Bacteria | 1063 |
| 621 | Ga0495676_0236226 | 3300047321 | Bacteria | 1253 |
| 622 | Ga0495680_0416232 | 3300047322 | Bacteria | 925 |
| 623 | Ga0495687_002069 | 3300047443 | Bacteria | 16865 |
| 624 | Ga0495673_0094227 | 3300047469 | Bacteria | 1219 |
| 625 | Ga0495681_0000088 | 3300047470 | Bacteria | 79878 |
| 626 | Ga0495681_0000426 | 3300047470 | Bacteria | 32387 |
| 627 | Ga0495686_0000641 | 3300047472 | Bacteria | 48207 |
| 628 | Ga0495686_0065561 | 3300047472 | Bacteria | 2245 |
| 629 | Ga0495686_0138772 | 3300047472 | Bacteria | 1436 |
| 630 | Ga0495593_0079323 | 3300047673 | Bacteria | 1699 |
| 631 | Ga0495626_0000001 | 3300048091 | Bacteria | 1077129 |
| 632 | Ga0495626_0156711 | 3300048091 | Bacteria | 957 |
| 633 | Ga0496101_0072926 | 3300048904 | Bacteria | 2521 |
| 634 | Ga0496102_0015830 | 3300048905 | Bacteria | 6575 |
| 635 | Ga0496103_0150067 | 3300048906 | Bacteria | 1493 |
| 636 | Ga0496104_0071764 | 3300048907 | Bacteria | 3292 |
| 637 | Ga0496107_0004920 | 3300048910 | Bacteria | 9086 |
| 638 | Ga0496108_0028353 | 3300048911 | Bacteria | 4632 |
| 639 | Ga0496108_0065613 | 3300048911 | Bacteria | 3060 |
| 640 | Ga0496108_0075008 | 3300048911 | Bacteria | 2857 |
| 641 | Ga0496108_0358728 | 3300048911 | Bacteria | 1272 |
| 642 | Ga0496109_0184833 | 3300048912 | Bacteria | 1958 |
| 643 | Ga0496109_0185790 | 3300048912 | Bacteria | 1953 |
| 644 | Ga0496109_0235792 | 3300048912 | Bacteria | 1722 |
| 645 | Ga0496110_0008007 | 3300048913 | Bacteria | 8469 |
| 646 | Ga0496110_0697743 | 3300048913 | Bacteria | 916 |
| 647 | Ga0496111_0053758 | 3300048914 | Bacteria | 2910 |
| 648 | Ga0496112_0277599 | 3300048915 | Bacteria | 1623 |
| 649 | Ga0496114_0012468 | 3300048917 | Bacteria | 6804 |
| 650 | Ga0496114_0047847 | 3300048917 | Bacteria | 3557 |
| 651 | Ga0496114_0121229 | 3300048917 | Bacteria | 2249 |
| 652 | Ga0496115_0036144 | 3300048918 | Bacteria | 3910 |
| 653 | Ga0496121_0008194 | 3300048924 | Bacteria | 12405 |
| 654 | Ga0496124_0000344 | 3300048927 | Bacteria | 85082 |
| 655 | Ga0496124_0015117 | 3300048927 | Bacteria | 7419 |
| 656 | Ga0496124_0188253 | 3300048927 | Bacteria | 1582 |
| 657 | Ga0496125_0028418 | 3300048928 | Bacteria | 5052 |
| 658 | Ga0496125_0387021 | 3300048928 | Bacteria | 822 |
| 659 | Ga0501306_010277 | 3300049127 | Bacteria | 1175 |
| 660 | Ga0501308_000125 | 3300049128 | Bacteria | 3817 |
| 661 | Ga0501309_000072 | 3300049129 | Bacteria | 5562 |
| 662 | Ga0501309_002714 | 3300049129 | Bacteria | 1939 |
| 663 | Ga0501310_000166 | 3300049130 | Bacteria | 6374 |
| 664 | Ga0501304_000040 | 3300049160 | Bacteria | 4578 |
| 665 | Ga0495678_002620 | 3300049459 | Bacteria | 11999 |
| 666 | Ga0495682_0077610 | 3300049460 | Bacteria | 1195 |
| 667 | Ga0501312_000083 | 3300049528 | Bacteria | 5552 |
| 668 | Ga0501312_000733 | 3300049528 | Bacteria | 2835 |
| 669 | Ga0501314_004425 | 3300049530 | Bacteria | 1165 |
| 670 | Ga0501320_000886 | 3300049536 | Bacteria | 1965 |
| 671 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 672 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 673 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 674 | Ga0501048_0000091 | 3300049582 | Bacteria | 48347 |
| 675 | Ga0501206_016782 | 3300049653 | Bacteria | 1021 |
| 676 | Ga0501211_000060 | 3300049658 | Bacteria | 7394 |
| 677 | Ga0501222_000573 | 3300049662 | Bacteria | 5416 |
| 678 | Ga0501233_001248 | 3300049668 | Bacteria | 4336 |
| 679 | Ga0501235_005384 | 3300049669 | Bacteria | 2786 |
| 680 | Ga0501236_007587 | 3300049670 | Bacteria | 1360 |
| 681 | Ga0501249_019913 | 3300049679 | Bacteria | 1458 |
| 682 | Ga0501258_000044 | 3300049687 | Bacteria | 6690 |
| 683 | Ga0501229_000386 | 3300049706 | Bacteria | 4951 |
| 684 | Ga0501262_000731 | 3300049759 | Bacteria | 3797 |
| 685 | Ga0501271_002647 | 3300049768 | Bacteria | 1611 |
| 686 | Ga0501272_002879 | 3300049769 | Bacteria | 1724 |
| 687 | Ga0501045_0013429 | 3300049824 | Bacteria | 5786 |
| 688 | nmdc:mga03683_11795_c1 | 3300050489 | Bacteria | 3176 |
| 689 | nmdc:mga03683_26488_c1 | 3300050489 | Bacteria | 2288 |
| 690 | nmdc:mga03n38_10564_c1 | 3300050490 | Bacteria | 3404 |
| 691 | nmdc:mga0k408_18851_c1 | 3300050493 | Bacteria | 3852 |
| 692 | nmdc:mga0k408_251935_c1 | 3300050493 | Bacteria | 1054 |
| 693 | nmdc:mga0k408_2669_c1 | 3300050493 | Bacteria | 9460 |
| 694 | nmdc:mga0k408_2914_c1 | 3300050493 | Bacteria | 9064 |
| 695 | nmdc:mga0k408_309_c2 | 3300050493 | Bacteria | 14319 |
| 696 | nmdc:mga0k408_3267_c1 | 3300050493 | Bacteria | 8579 |
| 697 | nmdc:mga0k408_404264_c1 | 3300050493 | Bacteria | 813 |
| 698 | nmdc:mga0k408_540_c1 | 3300050493 | Bacteria | 20847 |
| 699 | nmdc:mga0k408_79520_c1 | 3300050493 | Bacteria | 1918 |
| 700 | nmdc:mga06z11_22603_c1 | 3300050494 | Bacteria | 2940 |
| 701 | nmdc:mga06z11_335668_c1 | 3300050494 | Bacteria | 903 |
| 702 | nmdc:mga06z11_60609_c1 | 3300050494 | Bacteria | 1971 |
| 703 | nmdc:mga07m45_12293_c1 | 3300050496 | Bacteria | 4521 |
| 704 | nmdc:mga07m45_12332_c1 | 3300050496 | Bacteria | 4515 |
| 705 | nmdc:mga07m45_16204_c1 | 3300050496 | Bacteria | 3990 |
| 706 | nmdc:mga07m45_239_c1 | 3300050496 | Bacteria | 22183 |
| 707 | nmdc:mga07m45_32789_c1 | 3300050496 | Bacteria | 2881 |
| 708 | nmdc:mga07m45_3604_c1 | 3300050496 | Bacteria | 7477 |
| 709 | nmdc:mga07m45_370_c1 | 3300050496 | Bacteria | 18428 |
| 710 | nmdc:mga07m45_41801_c1 | 3300050496 | Bacteria | 2568 |
| 711 | nmdc:mga07m45_7408_c1 | 3300050496 | Bacteria | 5607 |
| 712 | nmdc:mga0sz30_153264_c1 | 3300050516 | Bacteria | 1020 |
| 713 | nmdc:mga0sz30_54366_c1 | 3300050516 | Bacteria | 1703 |
| 714 | Ga0500635_0000187 | 3300053080 | Bacteria | 31687 |
| 715 | Ga0495619_0313064 | 3300053085 | Bacteria | 1087 |
| 716 | Ga0500578_0025540 | 3300053086 | Bacteria | 3789 |
| 717 | Ga0500651_0101228 | 3300053093 | Bacteria | 1766 |
| 718 | Ga0500593_053320 | 3300053117 | Bacteria | 1790 |
| 719 | Ga0500607_143161 | 3300053121 | Bacteria | 1121 |
| 720 | Ga0500652_023850 | 3300053131 | Bacteria | 2330 |
| 721 | Ga0500559_0026005 | 3300053136 | Bacteria | 2491 |
| 722 | Ga0500561_0000912 | 3300053137 | Bacteria | 4722 |
| 723 | Ga0500568_0004552 | 3300053139 | Bacteria | 7395 |
| 724 | Ga0500568_0020559 | 3300053139 | Bacteria | 2853 |
| 725 | Ga0500622_0000874 | 3300053156 | Bacteria | 25654 |
| 726 | Ga0500636_0066706 | 3300053177 | Bacteria | 2092 |
| 727 | Ga0500645_006071 | 3300053730 | Bacteria | 4356 |
| 728 | Ga0500587_003671 | 3300053739 | Bacteria | 2133 |
| 729 | Ga0500661_010132 | 3300055283 | Bacteria | 1718 |
| 730 | Ga0466962_0007408 | 3300061719 | Bacteria | 5266 |
| 731 | 2587756219 | 2585428062 | Bacteria | 6842168 |
| 732 | 2643746401 | 2643221544 | Bacteria | 5886209 |
| 733 | 2643933122 | 2643221585 | Bacteria | 5812563 |
| 734 | 2644217265 | 2643221639 | Bacteria | 6649903 |
| 735 | 2644243740 | 2643221644 | Bacteria | 6865017 |
| 736 | 2644258966 | 2643221646 | Bacteria | 6433402 |
| 737 | 2644301795 | 2643221654 | Bacteria | 5273570 |
| 738 | 2644314371 | 2643221656 | Bacteria | 5809961 |
| 739 | 2644338730 | 2643221660 | Bacteria | 4208257 |
| 740 | 2723879822 | 2721755763 | Bacteria | 4464185 |
| 741 | 2739055700 | 2738541337 | Bacteria | 6183410 |
| 742 | 2831866170 | 2831864461 | Bacteria | 6502356 |
| 743 | 2886852453 | 2886848708 | Bacteria | 5632523 |
| 744 | Ga0307508_10001328 | |||
| 745 | JGI25156J39149_1000819 | |||
| 746 | JGI25156J39149_1008311 | |||
| 747 | JGI25154J39366_1000824 | |||
| 748 | JGI25157J39369_1000027 | |||
| 749 | JGI25164J39214_1003672 | |||
| 750 | JGI25152J39213_1001390 | |||
| 751 | JGI25150J39212_1012465 | |||
| 752 | JGI25153J46596_10003685 | |||
| 753 | rootH1_10004916 | |||
| 754 | rootH1_10006365 | |||
| 755 | rootH2_10047071 | |||
| 756 | rootL2_10003861 | |||
| 757 | rootL2_10009273 | |||
| 758 | rootH1_10006621 | |||
| 759 | rootH1_10019349 | |||
| 760 | rootH1_10027533 | |||
| 761 | rootH1_10031598 | |||
| 762 | Ga0055539_1004569 | |||
| 763 | Ga0055539_1004861 | |||
| 764 | Ga0055533_1000073 | |||
| 765 | Ga0055525_1000038 | |||
| 766 | Ga0055525_1000687 | |||
| 767 | Ga0055535_1000229 | |||
| 768 | Ga0055529_1000064 | |||
| 769 | Ga0055526_1002388 | |||
| 770 | Ga0055530_10029662 | |||
| 771 | Ga0055540_1009954 | |||
| 772 | Ga0055540_1024456 | |||
| 773 | Ga0055531_10003179 | |||
| 774 | Ga0055531_10028054 | |||
| 775 | Ga0055543_1002234 | |||
| 776 | Ga0055543_1013363 | |||
| 777 | Ga0065165_1000283 | |||
| 778 | Ga0070658_10112110 | |||
| 779 | Ga0070658_10162910 | |||
| 780 | Ga0070658_10186426 | |||
| 781 | Ga0070658_10336633 | |||
| 782 | Ga0070658_10386740 | |||
| 783 | Ga0070676_10001564 | |||
| 784 | Ga0070676_10008248 | |||
| 785 | Ga0070676_10021053 | |||
| 786 | Ga0070676_10203141 | |||
| 787 | Ga0070683_100049545 | |||
| 788 | Ga0070670_100058457 | |||
| 789 | Ga0070670_100078920 | |||
| 790 | Ga0070670_100164150 | |||
| 791 | Ga0068869_100006946 | |||
| 792 | Ga0068869_100032102 | |||
| 793 | Ga0070666_10010360 | |||
| 794 | Ga0070682_100011477 | |||
| 795 | Ga0068868_100015353 | |||
| 796 | Ga0068868_100150412 | |||
| 797 | Ga0070691_10093657 | |||
| 798 | Ga0070661_100000220 | |||
| 799 | Ga0070661_100122816 | |||
| 800 | Ga0070661_100471212 | |||
| 801 | Ga0070668_100017395 | |||
| 802 | Ga0070668_100404298 | |||
| 803 | Ga0070669_100009995 | |||
| 804 | Ga0070669_100012537 | |||
| 805 | Ga0070675_100005126 | |||
| 806 | Ga0070675_100018606 | |||
| 807 | Ga0070675_100065579 | |||
| 808 | Ga0070675_100067887 | |||
| 809 | Ga0070675_100085117 | |||
| 810 | Ga0070675_100235705 | |||
| 811 | Ga0070671_100027816 | |||
| 812 | Ga0070671_100164531 | |||
| 813 | Ga0070674_100010227 | |||
| 814 | Ga0070674_100015369 | |||
| 815 | Ga0070674_100034505 | |||
| 816 | Ga0070673_100007297 | |||
| 817 | Ga0070673_100018847 | |||
| 818 | Ga0070673_100027663 | |||
| 819 | Ga0070688_100323478 | |||
| 820 | Ga0070659_100011721 | |||
| 821 | Ga0070659_100279317 | |||
| 822 | Ga0070659_100541699 | |||
| 823 | Ga0070667_100015900 | |||
| 824 | Ga0070667_100413156 | |||
| 825 | Ga0070667_100644164 | |||
| 826 | Ga0070700_100072194 | |||
| 827 | Ga0070708_100224098 | |||
| 828 | Ga0070663_100000511 | |||
| 829 | Ga0070663_100040338 | |||
| 830 | Ga0070663_100047246 | |||
| 831 | Ga0070663_100147313 | |||
| 832 | Ga0070678_100094551 | |||
| 833 | Ga0070678_100299788 | |||
| 834 | Ga0070678_100383983 | |||
| 835 | Ga0070662_100011606 | |||
| 836 | Ga0070662_100025773 | |||
| 837 | Ga0070662_100059050 | |||
| 838 | Ga0070662_100075848 | |||
| 839 | Ga0070662_100162304 | |||
| 840 | Ga0070662_100179951 | |||
| 841 | Ga0070662_100182899 | |||
| 842 | Ga0070681_10803284 | |||
| 843 | Ga0068867_100000790 | |||
| 844 | Ga0068867_100013500 | |||
| 845 | Ga0068867_100026443 | |||
| 846 | Ga0068867_100036682 | |||
| 847 | Ga0068867_100052050 | |||
| 848 | Ga0068867_100159120 | |||
| 849 | Ga0070706_100006257 | |||
| 850 | Ga0070706_100091805 | |||
| 851 | Ga0070698_100147344 | |||
| 852 | Ga0070699_100039909 | |||
| 853 | Ga0070684_100184945 | |||
| 854 | Ga0070684_100431796 | |||
| 855 | Ga0068853_100054053 | |||
| 856 | Ga0070672_100007320 | |||
| 857 | Ga0070672_100025782 | |||
| 858 | Ga0070672_100077068 | |||
| 859 | Ga0070672_100201268 | |||
| 860 | Ga0070672_100248257 | |||
| 861 | Ga0070665_100235654 | |||
| 862 | Ga0070665_100340176 | |||
| 863 | Ga0070665_100593165 | |||
| 864 | Ga0070704_100738292 | |||
| 865 | Ga0068855_100036949 | |||
| 866 | Ga0068855_100232839 | |||
| 867 | Ga0068855_100234373 | |||
| 868 | Ga0068855_100804494 | |||
| 869 | Ga0070664_100000267 | |||
| 870 | Ga0068857_100029449 | |||
| 871 | Ga0068857_100095589 | |||
| 872 | Ga0068857_100445996 | |||
| 873 | Ga0068854_100022875 | |||
| 874 | Ga0068854_100024167 | |||
| 875 | Ga0068856_100002053 | |||
| 876 | Ga0068856_100024851 | |||
| 877 | Ga0068856_100341809 | |||
| 878 | Ga0068852_100043701 | |||
| 879 | Ga0068852_100056636 | |||
| 880 | Ga0068852_100093722 | |||
| 881 | Ga0068852_100142284 | |||
| 882 | Ga0068852_100216417 | |||
| 883 | Ga0068852_100356599 | |||
| 884 | Ga0068852_100679484 | |||
| 885 | Ga0068859_100106772 | |||
| 886 | Ga0068859_100108883 | |||
| 887 | Ga0068864_100060031 | |||
| 888 | Ga0068864_100219491 | |||
| 889 | Ga0068864_100421101 | |||
| 890 | Ga0068864_100710494 | |||
| 891 | Ga0068866_10110123 | |||
| 892 | Ga0068861_100015673 | |||
| 893 | Ga0068861_100022104 | |||
| 894 | Ga0068861_100022301 | |||
| 895 | Ga0068851_10037386 | |||
| 896 | Ga0068851_10100469 | |||
| 897 | Ga0068870_10267380 | |||
| 898 | Ga0068863_100049597 | |||
| 899 | Ga0068858_100006620 | |||
| 900 | Ga0068858_100120280 | |||
| 901 | Ga0068860_100097662 | |||
| 902 | Ga0068860_100172086 | |||
| 903 | Ga0068862_100063807 | |||
| 904 | Ga0068862_100228663 | |||
| 905 | Ga0075363_100038359 | |||
| 906 | Ga0075364_10053170 | |||
| 907 | Ga0075362_10012284 | |||
| 908 | Ga0075362_10028110 | |||
| 909 | Ga0075367_10002209 | |||
| 910 | Ga0075367_10088704 | |||
| 911 | Ga0075369_10023004 | |||
| 912 | Ga0075366_10007775 | |||
| 913 | Ga0075366_10013362 | |||
| 914 | Ga0075366_10029844 | |||
| 915 | Ga0075366_10078048 | |||
| 916 | Ga0075366_10086045 | |||
| 917 | Ga0075366_10134156 | |||
| 918 | Ga0075366_10356339 | |||
| 919 | Ga0097621_100168995 | |||
| 920 | Ga0075370_10000201 | |||
| 921 | Ga0075370_10001234 | |||
| 922 | Ga0075370_10003435 | |||
| 923 | Ga0075370_10009591 | |||
| 924 | Ga0075370_10010256 | |||
| 925 | Ga0075370_10029300 | |||
| 926 | Ga0075370_10034024 | |||
| 927 | Ga0075370_10044650 | |||
| 928 | Ga0075370_10044825 | |||
| 929 | Ga0068871_100020051 | |||
| 930 | Ga0068871_100081992 | |||
| 931 | Ga0068865_100014886 | |||
| 932 | Ga0068865_100221348 | |||
| 933 | Ga0097620_100106761 | |||
| 934 | Ga0097620_100108885 | |||
| 935 | Ga0099823_1000083 | |||
| 936 | Ga0079104_1000013 | |||
| 937 | Ga0105240_10015301 | |||
| 938 | Ga0105240_10118894 | |||
| 939 | Ga0105240_10524014 | |||
| 940 | Ga0105245_10013187 | |||
| 941 | Ga0105245_10228508 | |||
| 942 | Ga0105245_10470397 | |||
| 943 | Ga0114129_10241375 | |||
| 944 | Ga0105243_10002845 | |||
| 945 | Ga0105243_10004374 | |||
| 946 | Ga0105243_10010965 | |||
| 947 | Ga0105243_10078629 | |||
| 948 | Ga0105243_10091822 | |||
| 949 | Ga0105243_10120701 | |||
| 950 | Ga0105243_10124756 | |||
| 951 | Ga0105242_10313640 | |||
| 952 | Ga0105242_10351715 | |||
| 953 | Ga0105242_10726124 | |||
| 954 | Ga0105248_10022270 | |||
| 955 | Ga0105248_10095190 | |||
| 956 | Ga0105248_10124017 | |||
| 957 | Ga0105237_10000441 | |||
| 958 | Ga0105237_10005851 | |||
| 959 | Ga0105238_10009732 | |||
| 960 | Ga0105238_10070600 | |||
| 961 | Ga0105238_10171909 | |||
| 962 | Ga0105249_10029198 | |||
| 963 | Ga0105239_10000417 | |||
| 964 | Ga0105239_10037957 | |||
| 965 | Ga0105239_10081431 | |||
| 966 | Ga0105239_10083030 | |||
| 967 | Ga0105239_10239407 | |||
| 968 | Ga0105246_10115928 | |||
| 969 | Ga0157319_1000037 | |||
| 970 | Ga0157371_10167673 | |||
| 971 | Ga0157369_10028648 | |||
| 972 | Ga0157369_10842038 | |||
| 973 | Ga0157374_10029986 | |||
| 974 | Ga0157374_10524788 | |||
| 975 | Ga0157374_10707214 | |||
| 976 | Ga0157378_10095407 | |||
| 977 | Ga0157378_10208963 | |||
| 978 | Ga0157378_10501530 | |||
| 979 | Ga0163162_10025537 | |||
| 980 | Ga0163162_10065803 | |||
| 981 | Ga0163162_10939741 | |||
| 982 | Ga0157372_10033672 | |||
| 983 | Ga0157375_10196704 | |||
| 984 | Ga0157375_10226234 | |||
| 985 | Ga0157375_11210744 | |||
| 986 | Ga0163163_11011645 | |||
| 987 | Ga0157380_10269980 | |||
| 988 | Ga0157377_10000091 | |||
| 989 | Ga0157377_10016804 | |||
| 990 | Ga0157377_10198369 | |||
| 991 | Ga0157379_10019670 | |||
| 992 | Ga0157379_10048077 | |||
| 993 | Ga0157379_10257130 | |||
| 994 | Ga0157379_10446633 | |||
| 995 | Ga0157376_10014494 | |||
| 996 | Ga0157376_10325280 | |||
| 997 | Ga0157376_10494306 | |||
| 998 | Ga0163161_10019047 | |||
| 999 | Ga0163161_10031397 | |||
| 1000 | Ga0213872_10000018 | |||
| 1001 | Ga0213872_10000070 | |||
| 1002 | Ga0213872_10000417 | |||
| 1003 | Ga0209674_100039 | |||
| 1004 | Ga0209563_100005 | |||
| 1005 | Ga0209563_100110 | |||
| 1006 | Ga0207427_101215 | |||
| 1007 | Ga0209258_100124 | |||
| 1008 | Ga0209258_105648 | |||
| 1009 | Ga0207425_1000333 | |||
| 1010 | Ga0209646_1000196 | |||
| 1011 | Ga0209646_1016918 | |||
| 1012 | Ga0209026_1000011 | |||
| 1013 | Ga0209677_100151 | |||
| 1014 | Ga0209677_100488 | |||
| 1015 | Ga0209677_100877 | |||
| 1016 | Ga0209759_1000107 | |||
| 1017 | Ga0209759_1000652 | |||
| 1018 | Ga0209759_1000898 | |||
| 1019 | Ga0209759_1019767 | |||
| 1020 | Ga0209759_1037097 | |||
| 1021 | Ga0209129_1000027 | |||
| 1022 | Ga0209455_1000114 | |||
| 1023 | Ga0209673_1009846 | |||
| 1024 | Ga0209675_1019509 | |||
| 1025 | Ga0209564_1000003 | |||
| 1026 | Ga0209564_1000014 | |||
| 1027 | Ga0209758_1000193 | |||
| 1028 | Ga0209758_1000208 | |||
| 1029 | Ga0209050_1008652 | |||
| 1030 | Ga0209256_1000130 | |||
| 1031 | Ga0209256_1000471 | |||
| 1032 | Ga0209051_1001932 | |||
| 1033 | Ga0209051_1002398 | |||
| 1034 | Ga0209051_1006338 | |||
| 1035 | Ga0209051_1009233 | |||
| 1036 | Ga0209257_1000049 | |||
| 1037 | Ga0209257_1001013 | |||
| 1038 | Ga0209257_1001664 | |||
| 1039 | Ga0209257_1060265 | |||
| 1040 | Ga0207697_10024132 | |||
| 1041 | Ga0207697_10029145 | |||
| 1042 | Ga0207697_10101257 | |||
| 1043 | Ga0207656_10088785 | |||
| 1044 | Ga0207656_10115967 | |||
| 1045 | Ga0207682_10022146 | |||
| 1046 | Ga0207682_10026607 | |||
| 1047 | Ga0207682_10081982 | |||
| 1048 | Ga0207688_10030413 | |||
| 1049 | Ga0207688_10036249 | |||
| 1050 | Ga0207688_10095062 | |||
| 1051 | Ga0207680_10456126 | |||
| 1052 | Ga0207645_10001787 | |||
| 1053 | Ga0207645_10008457 | |||
| 1054 | Ga0207645_10014732 | |||
| 1055 | Ga0207645_10110772 | |||
| 1056 | Ga0207643_10082044 | |||
| 1057 | Ga0207643_10335907 | |||
| 1058 | Ga0207643_10492395 | |||
| 1059 | Ga0207705_10126816 | |||
| 1060 | Ga0207705_10134771 | |||
| 1061 | Ga0207705_10174068 | |||
| 1062 | Ga0207705_10439247 | |||
| 1063 | Ga0207684_10041453 | |||
| 1064 | Ga0207654_10019687 | |||
| 1065 | Ga0207695_10023628 | |||
| 1066 | Ga0207695_10024383 | |||
| 1067 | Ga0207695_10731186 | |||
| 1068 | Ga0207671_10001929 | |||
| 1069 | Ga0207671_10045543 | |||
| 1070 | Ga0207657_10044064 | |||
| 1071 | Ga0207657_10127028 | |||
| 1072 | Ga0207657_10342328 | |||
| 1073 | Ga0207649_10001581 | |||
| 1074 | Ga0207649_10079481 | |||
| 1075 | Ga0207649_10112887 | |||
| 1076 | Ga0207681_10000974 | |||
| 1077 | Ga0207681_10035283 | |||
| 1078 | Ga0207681_10062794 | |||
| 1079 | Ga0207694_10062742 | |||
| 1080 | Ga0207694_10106435 | |||
| 1081 | Ga0207650_10060020 | |||
| 1082 | Ga0207650_10072212 | |||
| 1083 | Ga0207650_10093142 | |||
| 1084 | Ga0207650_10191466 | |||
| 1085 | Ga0207659_10020790 | |||
| 1086 | Ga0207659_10042645 | |||
| 1087 | Ga0207659_10086103 | |||
| 1088 | Ga0207659_10090565 | |||
| 1089 | Ga0207659_10197159 | |||
| 1090 | Ga0207687_10082878 | |||
| 1091 | Ga0207687_10289598 | |||
| 1092 | Ga0207644_10016843 | |||
| 1093 | Ga0207644_10024152 | |||
| 1094 | Ga0207644_10368925 | |||
| 1095 | Ga0207690_10147841 | |||
| 1096 | Ga0207690_10154917 | |||
| 1097 | Ga0207690_10434774 | |||
| 1098 | Ga0207706_10000993 | |||
| 1099 | Ga0207706_10001576 | |||
| 1100 | Ga0207706_10091398 | |||
| 1101 | Ga0207706_10129692 | |||
| 1102 | Ga0207706_10182261 | |||
| 1103 | Ga0207706_10184163 | |||
| 1104 | Ga0207686_10192095 | |||
| 1105 | Ga0207709_10004566 | |||
| 1106 | Ga0207709_10026089 | |||
| 1107 | Ga0207709_10035015 | |||
| 1108 | Ga0207709_10084466 | |||
| 1109 | Ga0207669_10019498 | |||
| 1110 | Ga0207669_10027345 | |||
| 1111 | Ga0207704_10056029 | |||
| 1112 | Ga0207704_10205333 | |||
| 1113 | Ga0207704_10450450 | |||
| 1114 | Ga0207704_10715257 | |||
| 1115 | Ga0207665_10239116 | |||
| 1116 | Ga0207691_10006575 | |||
| 1117 | Ga0207691_10042436 | |||
| 1118 | Ga0207691_10115314 | |||
| 1119 | Ga0207691_10469389 | |||
| 1120 | Ga0207711_10005046 | |||
| 1121 | Ga0207711_10015814 | |||
| 1122 | Ga0207689_10000855 | |||
| 1123 | Ga0207689_10003648 | |||
| 1124 | Ga0207689_10009091 | |||
| 1125 | Ga0207689_10113469 | |||
| 1126 | Ga0207679_10000486 | |||
| 1127 | Ga0207679_10256730 | |||
| 1128 | Ga0207679_10365409 | |||
| 1129 | Ga0207679_10453235 | |||
| 1130 | Ga0207679_10782839 | |||
| 1131 | Ga0207667_10099975 | |||
| 1132 | Ga0207667_10159584 | |||
| 1133 | Ga0207667_10360759 | |||
| 1134 | Ga0207651_10002160 | |||
| 1135 | Ga0207651_10243179 | |||
| 1136 | Ga0207712_10106021 | |||
| 1137 | Ga0207668_10129350 | |||
| 1138 | Ga0207640_10011945 | |||
| 1139 | Ga0207640_10058408 | |||
| 1140 | Ga0207640_10496267 | |||
| 1141 | Ga0207658_10005961 | |||
| 1142 | Ga0207658_10168912 | |||
| 1143 | Ga0207658_10599759 | |||
| 1144 | Ga0207677_10017341 | |||
| 1145 | Ga0207677_10158644 | |||
| 1146 | Ga0207677_10168103 | |||
| 1147 | Ga0207703_10065050 | |||
| 1148 | Ga0207703_10246180 | |||
| 1149 | Ga0207703_10436691 | |||
| 1150 | Ga0207639_10015071 | |||
| 1151 | Ga0207639_10680217 | |||
| 1152 | Ga0207678_10005512 | |||
| 1153 | Ga0207678_10023385 | |||
| 1154 | Ga0207678_10166497 | |||
| 1155 | Ga0207678_10236701 | |||
| 1156 | Ga0207678_10319869 | |||
| 1157 | Ga0207708_10041755 | |||
| 1158 | Ga0207702_10000356 | |||
| 1159 | Ga0207702_10047997 | |||
| 1160 | Ga0207702_10183623 | |||
| 1161 | Ga0207702_10190137 | |||
| 1162 | Ga0207641_10001680 | |||
| 1163 | Ga0207641_10559869 | |||
| 1164 | Ga0207648_10002162 | |||
| 1165 | Ga0207648_10010360 | |||
| 1166 | Ga0207648_10040097 | |||
| 1167 | Ga0207648_10058384 | |||
| 1168 | Ga0207648_10410318 | |||
| 1169 | Ga0207676_10200144 | |||
| 1170 | Ga0207676_10476828 | |||
| 1171 | Ga0207674_10026355 | |||
| 1172 | Ga0207674_10054067 | |||
| 1173 | Ga0207674_10112313 | |||
| 1174 | Ga0207674_10122177 | |||
| 1175 | Ga0207675_100000911 | |||
| 1176 | Ga0207675_100025343 | |||
| 1177 | Ga0207675_100112287 | |||
| 1178 | Ga0207683_10025099 | |||
| 1179 | Ga0207683_10067518 | |||
| 1180 | Ga0207683_10247414 | |||
| 1181 | Ga0207683_10280562 | |||
| 1182 | Ga0207683_10734175 | |||
| 1183 | Ga0207683_10861978 | |||
| 1184 | Ga0207698_10006990 | |||
| 1185 | Ga0207698_10043539 | |||
| 1186 | Ga0207698_10128705 | |||
| 1187 | Ga0207698_10171264 | |||
| 1188 | Ga0209281_1000076 | |||
| 1189 | Ga0209996_1004814 | |||
| 1190 | Ga0268266_10259244 | |||
| 1191 | Ga0268266_10555972 | |||
| 1192 | Ga0268265_10016231 | |||
| 1193 | Ga0268265_10158640 | |||
| 1194 | Ga0268265_10843370 | |||
| 1195 | Ga0268264_10052692 | |||
| 1196 | Ga0268264_10223286 | |||
| 1197 | Ga0265334_10067856 | |||
| 1198 | Ga0265336_10000022 | |||
| 1199 | Ga0307517_10335046 | |||
| 1200 | Ga0307515_10000131 | |||
| 1201 | Ga0307515_10000165 | |||
| 1202 | Ga0307515_10000232 | |||
| 1203 | Ga0307515_10001456 | |||
| 1204 | Ga0307515_10003007 | |||
| 1205 | Ga0307515_10027050 | |||
| 1206 | Ga0307515_10101925 | |||
| 1207 | Ga0265324_10002326 | |||
| 1208 | Ga0268256_1021399 | |||
| 1209 | Ga0265328_10027240 | |||
| 1210 | Ga0265331_10091700 | |||
| 1211 | Ga0265327_10000028 | |||
| 1212 | Ga0307513_10001541 | |||
| 1213 | Ga0307509_10246280 | |||
| 1214 | Ga0307408_100000160 | |||
| 1215 | Ga0307408_100039869 | |||
| 1216 | Ga0307408_100064966 | |||
| 1217 | Ga0307408_100096425 | |||
| 1218 | Ga0307408_100216238 | |||
| 1219 | Ga0307514_10001289 | |||
| 1220 | Ga0307516_10002032 | |||
| 1221 | Ga0307516_10002726 | |||
| 1222 | Ga0307516_10015871 | |||
| 1223 | Ga0307516_10051235 | |||
| 1224 | Ga0307516_10276676 | |||
| 1225 | Ga0307409_100464726 | |||
| 1226 | Ga0307416_100078114 | |||
| 1227 | Ga0307416_100942918 | |||
| 1228 | Ga0307414_10005757 | |||
| 1229 | Ga0307414_10777095 | |||
| 1230 | Ga0307411_10009492 | |||
| 1231 | Ga0307411_10212005 | |||
| 1232 | Ga0307411_10392620 | |||
| 1233 | Ga0307510_10007541 | |||
| 1234 | Ga0373959_0040877 | |||
| 1235 | Ga0373940_0096976 | |||
| 1236 | Ga0373949_0022695 | |||
| 1237 | Ga0373932_0116696 | |||
| 1238 | Ga0373939_0001481 | |||
| 1239 | Ga0373956_0228389 | |||
| 1240 | Ga0373960_0012261 | |||
| 1241 | Ga0373960_0072452 | |||
| 1242 | Ga0373943_0256544 | |||
| 1243 | Ga0373962_0010650 | |||
| 1244 | Ga0373962_0034740 | |||
| 1245 | Ga0373931_0000429 | |||
| 1246 | Ga0373931_0001168 | |||
| 1247 | Ga0373931_0001365 | |||
| 1248 | Ga0373927_0164516 | |||
| 1249 | Ga0373937_0201608 | |||
| 1250 | Ga0373925_0046695 | |||
| 1251 | Ga0395905_0008848 | |||
| 1252 | Ga0395905_0015785 | |||
| 1253 | Ga0395905_0242112 | |||
| 1254 | Ga0395901_0004869 | |||
| 1255 | Ga0436365_0394409 | |||
| 1256 | Ga0436361_0275830 | |||
| 1257 | Ga0436361_0677882 | |||
| 1258 | Ga0436361_0763381 | |||
| 1259 | Ga0436361_0812713 | |||
| 1260 | Ga0439461_0046392 | |||
| 1261 | Ga0451793_1137656 | |||
| 1262 | Ga0451795_0619171 | |||
| 1263 | Ga0451807_2445078 | |||
| 1264 | Ga0451833_0114255 | |||
| 1265 | Ga0451853_3442311 | |||
| 1266 | Ga0439454_003233 | |||
| 1267 | Ga0450917_000073 | |||
| 1268 | Ga0450919_007815 | |||
| 1269 | Ga0450923_013417 | |||
| 1270 | Ga0450890_001264 | |||
| 1271 | Ga0450890_003134 | |||
| 1272 | Ga0450891_000191 | |||
| 1273 | Ga0450889_000610 | |||
| 1274 | Ga0439458_0020111 | |||
| 1275 | Ga0439458_0027396 | |||
| 1276 | Ga0439459_0001224 | |||
| 1277 | Ga0439459_0011217 | |||
| 1278 | Ga0450918_000573 | |||
| 1279 | Ga0451577_0000152 | |||
| 1280 | Ga0451577_0007214 | |||
| 1281 | Ga0451577_0021763 | |||
| 1282 | Ga0466969_0002697 | |||
| 1283 | Ga0466969_0019974 | |||
| 1284 | Ga0466969_0048861 | |||
| 1285 | Ga0466972_0000265 | |||
| 1286 | Ga0466977_0000007 | |||
| 1287 | Ga0466965_0000290 | |||
| 1288 | Ga0466966_0001287 | |||
| 1289 | Ga0466966_0084879 | |||
| 1290 | Ga0466963_0018757 | |||
| 1291 | Ga0466963_0171347 | |||
| 1292 | Ga0466964_0000836 | |||
| 1293 | Ga0466964_0293918 | |||
| 1294 | Ga0453684_0000122 | |||
| 1295 | Ga0453684_0064995 | |||
| 1296 | Ga0453684_0074293 | |||
| 1297 | Ga0453684_0198585 | |||
| 1298 | Ga0466971_0000304 | |||
| 1299 | Ga0466968_0006186 | |||
| 1300 | Ga0466968_0009938 | |||
| 1301 | Ga0466970_0000659 | |||
| 1302 | Ga0466970_0008455 | |||
| 1303 | Ga0466957_0001020 | |||
| 1304 | Ga0466959_0001171 | |||
| 1305 | Ga0466959_0002228 | |||
| 1306 | Ga0451576_0000559 | |||
| 1307 | Ga0451576_0074522 | |||
| 1308 | Ga0451576_0103352 | |||
| 1309 | Ga0451576_0126788 | |||
| 1310 | Ga0451576_0333617 | |||
| 1311 | Ga0451576_0483882 | |||
| 1312 | Ga0466958_0015806 | |||
| 1313 | Ga0466958_0157085 | |||
| 1314 | Ga0466967_0033285 | |||
| 1315 | Ga0495629_0007894 | |||
| 1316 | Ga0495638_0087017 | |||
| 1317 | Ga0495650_0000002 | |||
| 1318 | Ga0495650_0000478 | |||
| 1319 | Ga0495650_0042201 | |||
| 1320 | Ga0495605_0004250 | |||
| 1321 | Ga0495639_0018631 | |||
| 1322 | Ga0495585_0230808 | |||
| 1323 | Ga0495594_0007426 | |||
| 1324 | Ga0495596_0000001 | |||
| 1325 | Ga0495607_0000175 | |||
| 1326 | Ga0495583_0000123 | |||
| 1327 | Ga0495606_0001921 | |||
| 1328 | Ga0495606_0216870 | |||
| 1329 | Ga0495610_0000002 | |||
| 1330 | Ga0495610_0090865 | |||
| 1331 | Ga0495620_0103979 | |||
| 1332 | Ga0495632_0011879 | |||
| 1333 | Ga0495632_0014006 | |||
| 1334 | Ga0495632_0016647 | |||
| 1335 | Ga0495637_0000005 | |||
| 1336 | Ga0495643_0000002 | |||
| 1337 | Ga0495643_0012023 | |||
| 1338 | Ga0495666_0010876 | |||
| 1339 | Ga0495654_0091466 | |||
| 1340 | Ga0495598_0015441 | |||
| 1341 | Ga0495598_0045602 | |||
| 1342 | Ga0495621_0002970 | |||
| 1343 | Ga0495621_0085259 | |||
| 1344 | Ga0495597_0000015 | |||
| 1345 | Ga0495597_0001359 | |||
| 1346 | Ga0495597_0042619 | |||
| 1347 | Ga0495645_0170854 | |||
| 1348 | Ga0495622_0150409 | |||
| 1349 | Ga0495668_0084528 | |||
| 1350 | Ga0495625_0001732 | |||
| 1351 | Ga0495625_0003731 | |||
| 1352 | Ga0495625_0004458 | |||
| 1353 | Ga0495625_0441550 | |||
| 1354 | Ga0495625_0456567 | |||
| 1355 | Ga0495658_0080334 | |||
| 1356 | Ga0495670_0214521 | |||
| 1357 | Ga0495671_0001269 | |||
| 1358 | Ga0495671_0280824 | |||
| 1359 | Ga0495649_0005186 | |||
| 1360 | Ga0495649_0006920 | |||
| 1361 | Ga0495589_0002708 | |||
| 1362 | Ga0495672_0182064 | |||
| 1363 | Ga0495676_0236226 | |||
| 1364 | Ga0495680_0416232 | |||
| 1365 | Ga0495687_002069 | |||
| 1366 | Ga0495673_0094227 | |||
| 1367 | Ga0495681_0000088 | |||
| 1368 | Ga0495681_0000426 | |||
| 1369 | Ga0495686_0000641 | |||
| 1370 | Ga0495686_0065561 | |||
| 1371 | Ga0495686_0138772 | |||
| 1372 | Ga0495593_0079323 | |||
| 1373 | Ga0495626_0000001 | |||
| 1374 | Ga0495626_0156711 | |||
| 1375 | Ga0496101_0072926 | |||
| 1376 | Ga0496102_0015830 | |||
| 1377 | Ga0496103_0150067 | |||
| 1378 | Ga0496104_0071764 | |||
| 1379 | Ga0496107_0004920 | |||
| 1380 | Ga0496108_0028353 | |||
| 1381 | Ga0496108_0065613 | |||
| 1382 | Ga0496108_0075008 | |||
| 1383 | Ga0496108_0358728 | |||
| 1384 | Ga0496109_0184833 | |||
| 1385 | Ga0496109_0185790 | |||
| 1386 | Ga0496109_0235792 | |||
| 1387 | Ga0496110_0008007 | |||
| 1388 | Ga0496110_0697743 | |||
| 1389 | Ga0496111_0053758 | |||
| 1390 | Ga0496112_0277599 | |||
| 1391 | Ga0496114_0012468 | |||
| 1392 | Ga0496114_0047847 | |||
| 1393 | Ga0496114_0121229 | |||
| 1394 | Ga0496115_0036144 | |||
| 1395 | Ga0496121_0008194 | |||
| 1396 | Ga0496124_0000344 | |||
| 1397 | Ga0496124_0015117 | |||
| 1398 | Ga0496124_0188253 | |||
| 1399 | Ga0496125_0028418 | |||
| 1400 | Ga0496125_0387021 | |||
| 1401 | Ga0501306_010277 | |||
| 1402 | Ga0501308_000125 | |||
| 1403 | Ga0501309_000072 | |||
| 1404 | Ga0501309_002714 | |||
| 1405 | Ga0501310_000166 | |||
| 1406 | Ga0501304_000040 | |||
| 1407 | Ga0495678_002620 | |||
| 1408 | Ga0495682_0077610 | |||
| 1409 | Ga0501312_000083 | |||
| 1410 | Ga0501312_000733 | |||
| 1411 | Ga0501314_004425 | |||
| 1412 | Ga0501320_000886 | |||
| 1413 | Ga0501043_0000004 | |||
| 1414 | Ga0501046_0000016 | |||
| 1415 | Ga0501047_0000012 | |||
| 1416 | Ga0501048_0000091 | |||
| 1417 | Ga0501206_016782 | |||
| 1418 | Ga0501211_000060 | |||
| 1419 | Ga0501222_000573 | |||
| 1420 | Ga0501233_001248 | |||
| 1421 | Ga0501235_005384 | |||
| 1422 | Ga0501236_007587 | |||
| 1423 | Ga0501249_019913 | |||
| 1424 | Ga0501258_000044 | |||
| 1425 | Ga0501229_000386 | |||
| 1426 | Ga0501262_000731 | |||
| 1427 | Ga0501271_002647 | |||
| 1428 | Ga0501272_002879 | |||
| 1429 | Ga0501045_0013429 | |||
| 1430 | nmdc:mga03683_11795_c1 | |||
| 1431 | nmdc:mga03683_26488_c1 | |||
| 1432 | nmdc:mga03n38_10564_c1 | |||
| 1433 | nmdc:mga0k408_18851_c1 | |||
| 1434 | nmdc:mga0k408_251935_c1 | |||
| 1435 | nmdc:mga0k408_2669_c1 | |||
| 1436 | nmdc:mga0k408_2914_c1 | |||
| 1437 | nmdc:mga0k408_309_c2 | |||
| 1438 | nmdc:mga0k408_3267_c1 | |||
| 1439 | nmdc:mga0k408_404264_c1 | |||
| 1440 | nmdc:mga0k408_540_c1 | |||
| 1441 | nmdc:mga0k408_79520_c1 | |||
| 1442 | nmdc:mga06z11_22603_c1 | |||
| 1443 | nmdc:mga06z11_335668_c1 | |||
| 1444 | nmdc:mga06z11_60609_c1 | |||
| 1445 | nmdc:mga07m45_12293_c1 | |||
| 1446 | nmdc:mga07m45_12332_c1 | |||
| 1447 | nmdc:mga07m45_16204_c1 | |||
| 1448 | nmdc:mga07m45_239_c1 | |||
| 1449 | nmdc:mga07m45_32789_c1 | |||
| 1450 | nmdc:mga07m45_3604_c1 | |||
| 1451 | nmdc:mga07m45_370_c1 | |||
| 1452 | nmdc:mga07m45_41801_c1 | |||
| 1453 | nmdc:mga07m45_7408_c1 | |||
| 1454 | nmdc:mga0sz30_153264_c1 | |||
| 1455 | nmdc:mga0sz30_54366_c1 | |||
| 1456 | Ga0500635_0000187 | |||
| 1457 | Ga0495619_0313064 | |||
| 1458 | Ga0500578_0025540 | |||
| 1459 | Ga0500651_0101228 | |||
| 1460 | Ga0500593_053320 | |||
| 1461 | Ga0500607_143161 | |||
| 1462 | Ga0500652_023850 | |||
| 1463 | Ga0500559_0026005 | |||
| 1464 | Ga0500561_0000912 | |||
| 1465 | Ga0500568_0004552 | |||
| 1466 | Ga0500568_0020559 | |||
| 1467 | Ga0500622_0000874 | |||
| 1468 | Ga0500636_0066706 | |||
| 1469 | Ga0500645_006071 | |||
| 1470 | Ga0500587_003671 | |||
| 1471 | Ga0500661_010132 | |||
| 1472 | Ga0466962_0007408 | |||
| 1473 | 2587756219 | |||
| 1474 | 2643746401 | |||
| 1475 | 2643933122 | |||
| 1476 | 2644217265 | |||
| 1477 | 2644243740 | |||
| 1478 | 2644258966 | |||
| 1479 | 2644301795 | |||
| 1480 | 2644314371 | |||
| 1481 | 2644338730 | |||
| 1482 | 2723879822 | |||
| 1483 | 2739055700 | |||
| 1484 | 2831866170 | |||
| 1485 | 2886852453 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jf2-assembly1.cif.gz_A | crystal structure of a 20kda fragment of flgg | 0.8465 | 67 | 200 |
| 6jf2-assembly2.cif.gz_B | crystal structure of a 20kda fragment of flgg | 0.7972 | 61 | 202 |
| 6jf2-assembly1.cif.gz_A | crystal structure of a 20kda fragment of flgg | 0.7817 | 67 | 200 |
| 1fx7-assembly1.cif.gz_A | crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis | 0.7446 | 134 | 156 |
| 5eq4-assembly2.cif.gz_C | crystal structure of the srpa adhesin r347e mutant from streptococcus sanguinis | 0.7337 | 130 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5eq3A02 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.7089 | 130 | 156 | 3.10.20.890 |
| af_K7LJY2_116_288_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6654 | 126 | 155 | 2.130.10.10 |
| 6iltB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.6652 | 133 | 155 | 3.40.1190.20 |
| 3lhxB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.6148 | 133 | 157 | 3.40.1190.20 |
| af_Q9XWF9_804_861_3.10.450.750 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.613 | 131 | 158 | 3.10.450.750 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1GZY5-F1-model_v4 | Flagellar hook protein FlgE/F/G-like D1 domain-containing protein | 0.9841 | 74 | 197 |
|
| AF-A0A7S1GZY5-F1-model_v4 | Flagellar hook protein FlgE/F/G-like D1 domain-containing protein | 0.9611 | 74 | 197 |
|
| AF-A0A6G0XZ50-F1-model_v4 | Flagellar basal-body rod protein FlgF (Distal rod protein) (Flagellar basal-body rod protein FlgG) (Flagellar hook protein FlgE) | 0.8956 | 74 | 200 |
GO:0003774
GO:0016020 GO:0031514 |
| AF-A0A5Q2QAE4-F1-model_v4 | Flagellar basal-body rod protein FlgF | 0.8763 | 68 | 241 |
GO:0030694
GO:0071978 |
| AF-A0A357D7W2-F1-model_v4 | Flagellar basal-body rod protein FlgG | 0.8537 | 65 | 202 |
GO:0009426
GO:0071978 |