F478652

General Info

Members Datasets Scaffolds Average Seq Length
742 374 1482 164

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0003148|Ga0439436_0003148_4412_4975
Length 187
Sequence LRFARGRAKVRRTMSAIPNDPHPFPLEGGCTCRAVRYRMTTRPLFVHCCHCRWCQRETGSAFALNAMIEADRVQLLQCEIELVATPSASGKGQKIARCPHCRVALWSHYAGAGDAVCFVRVGTLDAPDHLPPDIHIFTMSKQPWVLLPPGTPAVAEYYSRAEHWPAESLARARALKASRPPAGPTAA

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
230 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
231 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
232 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
240 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
241 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
242 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
243 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
244 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
245 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
246 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
247 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
248 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
251 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
262 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
358 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
359 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
360 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
364 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
368 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
369 2643221652 Acidovorax sp. Root402 Isolate Unclassified
370 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
371 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
372 2904456579 Variovorax sp. 2002 Isolate Unclassified
373 2906610324
374 2929520902 Variovorax beijingensis 502 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.27
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0
Rhizoplane 4.18
Rhizosphere 85.18
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0003148 3300041404 Bacteria 5000
2 JGI25406J46586_10055306 3300003203 Bacteria 1308
3 JGI25404J52841_10018468 3300003659 Bacteria 1511
4 Ga0055536_1008437 3300003781 Bacteria 4424
5 Ga0055540_1001803 3300003792 Bacteria 12167
6 JGI25405J52794_10060666 3300003911 Bacteria 818
7 Ga0065704_10096637 3300005289 Bacteria 2431
8 Ga0070658_10004903 3300005327 Bacteria 10905
9 Ga0070658_10292523 3300005327 Bacteria 1388
10 Ga0070676_10008737 3300005328 Bacteria 5466
11 Ga0070683_100060012 3300005329 Bacteria 3534
12 Ga0070683_100065267 3300005329 Bacteria 3389
13 Ga0070683_100093284 3300005329 Bacteria 2828
14 Ga0070690_100104351 3300005330 Bacteria 1883
15 Ga0070670_100136543 3300005331 Bacteria 2119
16 Ga0070670_100611844 3300005331 Bacteria 975
17 Ga0070670_100932427 3300005331 Bacteria 788
18 Ga0068869_100003076 3300005334 Bacteria 10155
19 Ga0070666_10260613 3300005335 Bacteria 1229
20 Ga0070680_100043420 3300005336 Bacteria 3652
21 Ga0070680_100572697 3300005336 Bacteria 968
22 Ga0070682_100022201 3300005337 Bacteria 3756
23 Ga0070682_100434821 3300005337 Bacteria 1001
24 Ga0070682_100605306 3300005337 Bacteria 866
25 Ga0068868_100006730 3300005338 Bacteria 8160
26 Ga0068868_100088596 3300005338 Bacteria 2491
27 Ga0070660_100040061 3300005339 Bacteria 3564
28 Ga0070660_100319412 3300005339 Bacteria 1275
29 Ga0070687_100390302 3300005343 Bacteria 910
30 Ga0070661_100008214 3300005344 Bacteria 7201
31 Ga0070661_100069065 3300005344 Bacteria 2597
32 Ga0070661_100116416 3300005344 Bacteria 1999
33 Ga0070692_10311318 3300005345 Bacteria 965
34 Ga0070668_100009361 3300005347 Bacteria 7266
35 Ga0070668_100094910 3300005347 Bacteria 2355
36 Ga0070668_100628639 3300005347 Bacteria 942
37 Ga0070669_100032735 3300005353 Bacteria 3756
38 Ga0070669_100449332 3300005353 Bacteria 1062
39 Ga0070669_100581184 3300005353 Bacteria 937
40 Ga0070675_100001332 3300005354 Bacteria 18063
41 Ga0070675_100009544 3300005354 Bacteria 7549
42 Ga0070675_100145716 3300005354 Bacteria 2027
43 Ga0070671_100370767 3300005355 Bacteria 1223
44 Ga0070671_100565684 3300005355 Bacteria 981
45 Ga0070674_100617468 3300005356 Bacteria 918
46 Ga0070674_100934981 3300005356 Bacteria 757
47 Ga0070673_100019233 3300005364 Bacteria 4902
48 Ga0070673_100274085 3300005364 Bacteria 1478
49 Ga0070688_100156917 3300005365 Bacteria 1560
50 Ga0070659_100006591 3300005366 Bacteria 8385
51 Ga0070659_100021473 3300005366 Bacteria 4917
52 Ga0070659_100029753 3300005366 Bacteria 4221
53 Ga0070667_100151577 3300005367 Bacteria 2037
54 Ga0070667_100184786 3300005367 Bacteria 1845
55 Ga0070667_100222687 3300005367 Bacteria 1680
56 Ga0070667_100331904 3300005367 Bacteria 1374
57 Ga0070709_10154543 3300005434 Bacteria 1589
58 Ga0070714_100179753 3300005435 Bacteria 1924
59 Ga0070713_100094954 3300005436 Bacteria 2571
60 Ga0070713_100229022 3300005436 Bacteria 1689
61 Ga0070701_10155143 3300005438 Bacteria 1322
62 Ga0070705_100389088 3300005440 Bacteria 1029
63 Ga0070694_100444842 3300005444 Bacteria 1022
64 Ga0070663_100004462 3300005455 Bacteria 8235
65 Ga0070678_100020170 3300005456 Bacteria 4368
66 Ga0070678_100200248 3300005456 Bacteria 1647
67 Ga0070662_100001945 3300005457 Bacteria 12698
68 Ga0070662_100074926 3300005457 Bacteria 2505
69 Ga0070662_100087750 3300005457 Bacteria 2330
70 Ga0070681_10001057 3300005458 Bacteria 23417
71 Ga0070681_10043520 3300005458 Bacteria 4498
72 Ga0070681_10235580 3300005458 Bacteria 1744
73 Ga0070681_10339154 3300005458 Bacteria 1413
74 Ga0070681_10361123 3300005458 Bacteria 1363
75 Ga0070681_10420942 3300005458 Bacteria 1248
76 Ga0068867_100224621 3300005459 Bacteria 1515
77 Ga0068867_100698835 3300005459 Bacteria 895
78 Ga0070706_100091293 3300005467 Bacteria 2824
79 Ga0070698_100001208 3300005471 Bacteria 28691
80 Ga0070699_100128414 3300005518 Bacteria 2234
81 Ga0070679_100002239 3300005530 Bacteria 17474
82 Ga0070679_100027302 3300005530 Bacteria 5617
83 Ga0070679_100062734 3300005530 Bacteria 3705
84 Ga0070679_100071601 3300005530 Bacteria 3457
85 Ga0070679_100248698 3300005530 Bacteria 1734
86 Ga0070684_100028635 3300005535 Bacteria 4713
87 Ga0070684_100051865 3300005535 Bacteria 3565
88 Ga0070684_100210190 3300005535 Bacteria 1773
89 Ga0070684_101355003 3300005535 Bacteria 670
90 Ga0070697_100275317 3300005536 Bacteria 1443
91 Ga0068853_100030678 3300005539 Bacteria 4542
92 Ga0068853_100034435 3300005539 Bacteria 4299
93 Ga0068853_100073542 3300005539 Bacteria 2980
94 Ga0068853_100199327 3300005539 Bacteria 1821
95 Ga0068853_100691977 3300005539 Bacteria 972
96 Ga0068853_100885602 3300005539 Bacteria 857
97 Ga0070672_100008896 3300005543 Bacteria 6897
98 Ga0070672_100062557 3300005543 Bacteria 2937
99 Ga0070672_100070593 3300005543 Bacteria 2776
100 Ga0070672_100851877 3300005543 Bacteria 804
101 Ga0070695_100022143 3300005545 Bacteria 3896
102 Ga0070693_100015270 3300005547 Bacteria 3952
103 Ga0070665_100046991 3300005548 Bacteria 4333
104 Ga0070665_101486032 3300005548 Bacteria 686
105 Ga0070704_100457546 3300005549 Bacteria 1100
106 Ga0068855_100008812 3300005563 Bacteria 12194
107 Ga0068855_100031980 3300005563 Bacteria 6282
108 Ga0068855_100049234 3300005563 Bacteria 4971
109 Ga0068855_100051023 3300005563 Bacteria 4874
110 Ga0068855_100118175 3300005563 Bacteria 3037
111 Ga0068855_100379473 3300005563 Bacteria 1552
112 Ga0068855_100831048 3300005563 Bacteria 980
113 Ga0070664_100086137 3300005564 Bacteria 2714
114 Ga0070664_100154124 3300005564 Bacteria 2029
115 Ga0068857_100059280 3300005577 Bacteria 3400
116 Ga0068857_100159007 3300005577 Bacteria 2050
117 Ga0068854_100006691 3300005578 Bacteria 7347
118 Ga0068854_100062380 3300005578 Bacteria 2702
119 Ga0068856_100004796 3300005614 Bacteria 13406
120 Ga0068856_100052398 3300005614 Bacteria 4024
121 Ga0068856_100085508 3300005614 Bacteria 3133
122 Ga0068856_100149251 3300005614 Bacteria 2346
123 Ga0068856_100236682 3300005614 Bacteria 1841
124 Ga0068856_100432497 3300005614 Bacteria 1336
125 Ga0070702_100224909 3300005615 Bacteria 1257
126 Ga0068852_100000615 3300005616 Bacteria 23368
127 Ga0068852_100001686 3300005616 Bacteria 15048
128 Ga0068852_100085852 3300005616 Bacteria 2804
129 Ga0068852_100275740 3300005616 Bacteria 1620
130 Ga0068852_100380885 3300005616 Bacteria 1384
131 Ga0068852_101033626 3300005616 Bacteria 841
132 Ga0068859_100219748 3300005617 Bacteria 1987
133 Ga0068859_100305303 3300005617 Bacteria 1685
134 Ga0068864_100028438 3300005618 Bacteria 4725
135 Ga0068864_100806211 3300005618 Bacteria 923
136 Ga0068861_100000384 3300005719 Bacteria 25460
137 Ga0068861_100019833 3300005719 Bacteria 4806
138 Ga0068861_100227768 3300005719 Bacteria 1579
139 Ga0068851_10008669 3300005834 Bacteria 4709
140 Ga0068851_10034847 3300005834 Bacteria 2514
141 Ga0068870_10125636 3300005840 Bacteria 1483
142 Ga0068858_100027002 3300005842 Bacteria 5333
143 Ga0068858_100045670 3300005842 Bacteria 4060
144 Ga0068860_100007870 3300005843 Bacteria 10641
145 Ga0068860_100021841 3300005843 Bacteria 6192
146 Ga0068860_100355931 3300005843 Bacteria 1441
147 Ga0068862_100127742 3300005844 Bacteria 2246
148 Ga0068862_100241341 3300005844 Bacteria 1643
149 Ga0068862_100305993 3300005844 Bacteria 1464
150 Ga0068862_101105251 3300005844 Bacteria 788
151 Ga0081455_10001734 3300005937 Bacteria 26379
152 Ga0081455_10017747 3300005937 Bacteria 6807
153 Ga0081455_10063978 3300005937 Bacteria 3083
154 Ga0081455_10667880 3300005937 Bacteria 666
155 Ga0081540_1001682 3300005983 Bacteria 18799
156 Ga0081540_1040152 3300005983 Bacteria 2443
157 Ga0081539_10000001 3300005985 Bacteria 808331
158 Ga0081539_10001294 3300005985 Bacteria 43916
159 Ga0081539_10001470 3300005985 Bacteria 39952
160 Ga0081539_10041426 3300005985 Bacteria 2692
161 Ga0081539_10275840 3300005985 Bacteria 734
162 Ga0070717_10056285 3300006028 Bacteria 3248
163 Ga0070717_10826012 3300006028 Bacteria 843
164 Ga0070717_11199538 3300006028 Bacteria 691
165 Ga0075368_10192414 3300006042 Bacteria 862
166 Ga0075362_10007616 3300006177 Bacteria 4113
167 Ga0075362_10015283 3300006177 Bacteria 3119
168 Ga0075362_10039087 3300006177 Bacteria 2085
169 Ga0075362_10165403 3300006177 Bacteria 1067
170 Ga0075367_10142406 3300006178 Bacteria 1485
171 Ga0075367_10198578 3300006178 Bacteria 1253
172 Ga0075369_10005411 3300006186 Bacteria 4770
173 Ga0075369_10194647 3300006186 Bacteria 935
174 Ga0097621_100190080 3300006237 Bacteria 1778
175 Ga0097621_100524986 3300006237 Bacteria 1075
176 Ga0097621_101206025 3300006237 Bacteria 713
177 Ga0075370_10012362 3300006353 Bacteria 4510
178 Ga0068871_100036905 3300006358 Bacteria 3894
179 Ga0068871_100129082 3300006358 Bacteria 2142
180 Ga0068871_100192582 3300006358 Bacteria 1757
181 Ga0068871_101320468 3300006358 Bacteria 679
182 Ga0075428_100001751 3300006844 Bacteria 23186
183 Ga0075433_10099961 3300006852 Bacteria 2568
184 Ga0075433_10100388 3300006852 Bacteria 2562
185 Ga0075434_100000816 3300006871 Bacteria 24729
186 Ga0075434_100195892 3300006871 Bacteria 2040
187 Ga0075434_100419668 3300006871 Bacteria 1359
188 Ga0075434_100467802 3300006871 Unclassified 1282
189 Ga0068865_100019910 3300006881 Bacteria 4347
190 Ga0075436_100487470 3300006914 Bacteria 901
191 Ga0097620_100219755 3300006931 Bacteria 1987
192 Ga0097620_100305324 3300006931 Bacteria 1685
193 Ga0097620_101859227 3300006931 Bacteria 665
194 Ga0075435_100027706 3300007076 Bacteria 4435
195 Ga0075435_100484954 3300007076 Bacteria 1068
196 Ga0075435_100838637 3300007076 Bacteria 801
197 Ga0105251_10306120 3300009011 Bacteria 721
198 Ga0105244_10078389 3300009036 Bacteria 1638
199 Ga0105240_10004485 3300009093 Bacteria 21237
200 Ga0105240_10005388 3300009093 Bacteria 19075
201 Ga0105240_10520545 3300009093 Bacteria 1320
202 Ga0111539_10004025 3300009094 Bacteria 19296
203 Ga0111539_11133167 3300009094 Bacteria 909
204 Ga0105245_10021575 3300009098 Bacteria 5652
205 Ga0105247_10391516 3300009101 Bacteria 988
206 Ga0114129_10004052 3300009147 Bacteria 20681
207 Ga0105243_10001608 3300009148 Bacteria 19691
208 Ga0105241_10003669 3300009174 Bacteria 11403
209 Ga0105241_10067234 3300009174 Bacteria 2773
210 Ga0105241_10070482 3300009174 Bacteria 2712
211 Ga0105241_10279328 3300009174 Bacteria 1425
212 Ga0105248_10007485 3300009177 Bacteria 11977
213 Ga0105248_10251994 3300009177 Bacteria 1987
214 Ga0105237_10126533 3300009545 Bacteria 2550
215 Ga0105237_10223013 3300009545 Bacteria 1885
216 Ga0105237_10312041 3300009545 Bacteria 1576
217 Ga0105238_10005726 3300009551 Bacteria 12285
218 Ga0105238_10010115 3300009551 Bacteria 9456
219 Ga0105238_10027853 3300009551 Bacteria 5758
220 Ga0105238_10041404 3300009551 Bacteria 4665
221 Ga0105238_11012070 3300009551 Bacteria 852
222 Ga0105249_10113389 3300009553 Bacteria 2565
223 Ga0105030_100276 3300009987 Bacteria 4454
224 Ga0105239_10081049 3300010375 Bacteria 3572
225 Ga0157347_1011671 3300012502 Bacteria 937
226 Ga0157373_10010816 3300013100 Bacteria 6717
227 Ga0157373_10072075 3300013100 Bacteria 2439
228 Ga0157371_10054153 3300013102 Bacteria 2849
229 Ga0157371_10958005 3300013102 Bacteria 651
230 Ga0157370_10006388 3300013104 Bacteria 13010
231 Ga0157370_10010672 3300013104 Bacteria 9663
232 Ga0157370_10140960 3300013104 Bacteria 2246
233 Ga0157370_10749837 3300013104 Bacteria 890
234 Ga0157369_10022153 3300013105 Bacteria 7098
235 Ga0157369_10081473 3300013105 Bacteria 3464
236 Ga0157369_10135626 3300013105 Bacteria 2606
237 Ga0157369_10523144 3300013105 Bacteria 1227
238 Ga0157374_10078442 3300013296 Bacteria 3128
239 Ga0157374_10089163 3300013296 Bacteria 2938
240 Ga0163162_10000830 3300013306 Bacteria 28736
241 Ga0163162_11051101 3300013306 Bacteria 922
242 Ga0157372_10010331 3300013307 Bacteria 9920
243 Ga0157372_10015817 3300013307 Bacteria 8093
244 Ga0157372_10147351 3300013307 Bacteria 2714
245 Ga0157372_10192002 3300013307 Bacteria 2365
246 Ga0157372_10824481 3300013307 Bacteria 1077
247 Ga0157372_10867425 3300013307 Bacteria 1048
248 Ga0157375_10112491 3300013308 Bacteria 2823
249 Ga0157375_11103786 3300013308 Bacteria 929
250 Ga0157514_125748 3300013874 Bacteria 1492
251 Ga0157380_10008236 3300014326 Bacteria 7428
252 Ga0157380_10033720 3300014326 Bacteria 3944
253 Ga0157380_10245494 3300014326 Bacteria 1617
254 Ga0182008_10159318 3300014497 Bacteria 1135
255 Ga0182008_10262274 3300014497 Bacteria 894
256 Ga0182008_10419587 3300014497 Bacteria 722
257 Ga0157377_10112496 3300014745 Bacteria 1638
258 Ga0157379_10001870 3300014968 Bacteria 17410
259 Ga0157379_10014560 3300014968 Bacteria 6901
260 Ga0157376_10011825 3300014969 Bacteria 6453
261 Ga0157376_10808996 3300014969 Bacteria 950
262 Ga0182006_1023666 3300015261 Bacteria 2542
263 Ga0182006_1051890 3300015261 Bacteria 1577
264 Ga0182005_1052785 3300015265 Bacteria 1107
265 Ga0163161_10033820 3300017792 Bacteria 3653
266 Ga0163161_10849548 3300017792 Bacteria 770
267 Ga0197907_10899683 3300020069 Bacteria 604
268 Ga0206353_10916553 3300020082 Bacteria 3787
269 Ga0213873_10222063 3300021358 Bacteria 592
270 Ga0213876_10151763 3300021384 Bacteria 1232
271 Ga0209676_1000346 3300025292 Bacteria 87684
272 Ga0209676_1094387 3300025292 Bacteria 650
273 Ga0209051_1000284 3300025303 Bacteria 82589
274 Ga0209051_1000446 3300025303 Bacteria 55218
275 Ga0209257_1016774 3300025304 Bacteria 2937
276 Ga0207697_10050884 3300025315 Bacteria 1711
277 Ga0207697_10107830 3300025315 Bacteria 1191
278 Ga0207656_10023822 3300025321 Bacteria 2469
279 Ga0207656_10298542 3300025321 Bacteria 797
280 Ga0207710_10157475 3300025900 Bacteria 1104
281 Ga0207688_10047326 3300025901 Bacteria 2402
282 Ga0207680_10171283 3300025903 Bacteria 1462
283 Ga0207647_10135962 3300025904 Bacteria 1442
284 Ga0207645_10029005 3300025907 Bacteria 3567
285 Ga0207645_10034706 3300025907 Bacteria 3241
286 Ga0207645_10209618 3300025907 Bacteria 1283
287 Ga0207643_10030417 3300025908 Bacteria 3005
288 Ga0207705_10138462 3300025909 Bacteria 1816
289 Ga0207705_10180664 3300025909 Bacteria 1592
290 Ga0207654_10020632 3300025911 Bacteria 3496
291 Ga0207654_10038141 3300025911 Bacteria 2694
292 Ga0207654_10059670 3300025911 Bacteria 2226
293 Ga0207654_10087143 3300025911 Bacteria 1894
294 Ga0207707_10005989 3300025912 Bacteria 10642
295 Ga0207707_10198647 3300025912 Bacteria 1749
296 Ga0207707_10249186 3300025912 Bacteria 1543
297 Ga0207707_10305204 3300025912 Bacteria 1376
298 Ga0207707_10408934 3300025912 Bacteria 1164
299 Ga0207695_10006376 3300025913 Bacteria 15351
300 Ga0207695_10020075 3300025913 Bacteria 7667
301 Ga0207695_10023115 3300025913 Bacteria 7035
302 Ga0207671_10066078 3300025914 Bacteria 2691
303 Ga0207671_10131025 3300025914 Bacteria 1924
304 Ga0207671_10212401 3300025914 Bacteria 1514
305 Ga0207660_10089498 3300025917 Bacteria 2279
306 Ga0207660_10196334 3300025917 Bacteria 1574
307 Ga0207662_10157113 3300025918 Bacteria 1450
308 Ga0207657_10000142 3300025919 Bacteria 72309
309 Ga0207657_10032616 3300025919 Bacteria 4703
310 Ga0207657_10191922 3300025919 Bacteria 1647
311 Ga0207649_10025495 3300025920 Bacteria 3447
312 Ga0207649_10034563 3300025920 Bacteria 3030
313 Ga0207652_10021625 3300025921 Bacteria 5310
314 Ga0207652_10036122 3300025921 Bacteria 4176
315 Ga0207652_10075818 3300025921 Bacteria 2931
316 Ga0207652_10119723 3300025921 Bacteria 2341
317 Ga0207652_10622321 3300025921 Unclassified 967
318 Ga0207681_10043206 3300025923 Bacteria 3015
319 Ga0207681_10043214 3300025923 Bacteria 3015
320 Ga0207681_10078926 3300025923 Bacteria 2318
321 Ga0207694_10023532 3300025924 Bacteria 4676
322 Ga0207694_10023870 3300025924 Bacteria 4644
323 Ga0207694_10032630 3300025924 Bacteria 3987
324 Ga0207694_10109709 3300025924 Bacteria 2194
325 Ga0207694_10275402 3300025924 Bacteria 1381
326 Ga0207650_10646730 3300025925 Bacteria 891
327 Ga0207659_10004432 3300025926 Bacteria 8491
328 Ga0207659_10013115 3300025926 Bacteria 5299
329 Ga0207659_10052279 3300025926 Bacteria 2910
330 Ga0207700_10032738 3300025928 Bacteria 3712
331 Ga0207664_10031551 3300025929 Bacteria 4054
332 Ga0207664_10058301 3300025929 Bacteria 3071
333 Ga0207664_10087250 3300025929 Bacteria 2550
334 Ga0207664_10325607 3300025929 Bacteria 1356
335 Ga0207644_10117356 3300025931 Bacteria 2021
336 Ga0207644_10253898 3300025931 Bacteria 1404
337 Ga0207644_10322759 3300025931 Bacteria 1249
338 Ga0207644_11409404 3300025931 Bacteria 585
339 Ga0207690_10043611 3300025932 Bacteria 2953
340 Ga0207690_10094722 3300025932 Bacteria 2119
341 Ga0207690_10183883 3300025932 Bacteria 1576
342 Ga0207690_10234300 3300025932 Bacteria 1411
343 Ga0207706_10006991 3300025933 Bacteria 10429
344 Ga0207706_10130409 3300025933 Bacteria 2211
345 Ga0207706_10147178 3300025933 Bacteria 2072
346 Ga0207706_10212120 3300025933 Bacteria 1697
347 Ga0207686_10082791 3300025934 Bacteria 2099
348 Ga0207686_10127860 3300025934 Bacteria 1739
349 Ga0207709_10000540 3300025935 Bacteria 32468
350 Ga0207709_11299289 3300025935 Bacteria 601
351 Ga0207669_10155065 3300025937 Bacteria 1610
352 Ga0207704_10431593 3300025938 Bacteria 1047
353 Ga0207665_10094659 3300025939 Bacteria 2075
354 Ga0207691_10010913 3300025940 Bacteria 8721
355 Ga0207691_10022589 3300025940 Bacteria 5932
356 Ga0207691_10037814 3300025940 Bacteria 4467
357 Ga0207711_10013899 3300025941 Bacteria 6686
358 Ga0207689_10000856 3300025942 Bacteria 29352
359 Ga0207689_10044075 3300025942 Bacteria 3688
360 Ga0207661_10004542 3300025944 Bacteria 9725
361 Ga0207661_10172051 3300025944 Bacteria 1886
362 Ga0207661_10481505 3300025944 Bacteria 1133
363 Ga0207679_10037148 3300025945 Bacteria 3460
364 Ga0207679_10040785 3300025945 Bacteria 3326
365 Ga0207679_10264138 3300025945 Bacteria 1469
366 Ga0207667_10009529 3300025949 Bacteria 11427
367 Ga0207667_10009780 3300025949 Bacteria 11279
368 Ga0207667_10039768 3300025949 Bacteria 5009
369 Ga0207667_10061183 3300025949 Bacteria 3940
370 Ga0207667_10482506 3300025949 Bacteria 1258
371 Ga0207651_10061416 3300025960 Bacteria 2614
372 Ga0207651_10160284 3300025960 Bacteria 1763
373 Ga0207651_10250911 3300025960 Bacteria 1448
374 Ga0207712_10428723 3300025961 Bacteria 1117
375 Ga0207668_10021657 3300025972 Bacteria 4102
376 Ga0207668_10054598 3300025972 Bacteria 2774
377 Ga0207668_10264901 3300025972 Bacteria 1402
378 Ga0207668_10367953 3300025972 Bacteria 1206
379 Ga0207640_10018518 3300025981 Bacteria 4094
380 Ga0207640_10120090 3300025981 Bacteria 1881
381 Ga0207640_10290709 3300025981 Bacteria 1288
382 Ga0207658_10031259 3300025986 Bacteria 3779
383 Ga0207658_10155781 3300025986 Bacteria 1867
384 Ga0207658_10244428 3300025986 Bacteria 1522
385 Ga0207677_10010028 3300026023 Bacteria 5345
386 Ga0207677_10063012 3300026023 Bacteria 2575
387 Ga0207677_10646602 3300026023 Bacteria 933
388 Ga0207703_10036792 3300026035 Bacteria 3897
389 Ga0207703_10092359 3300026035 Bacteria 2547
390 Ga0207639_10011932 3300026041 Bacteria 6045
391 Ga0207639_10022769 3300026041 Bacteria 4516
392 Ga0207639_10060832 3300026041 Bacteria 2914
393 Ga0207639_10402480 3300026041 Bacteria 1233
394 Ga0207639_10930788 3300026041 Bacteria 813
395 Ga0207678_10002761 3300026067 Bacteria 15887
396 Ga0207708_11766791 3300026075 Bacteria 543
397 Ga0207702_10048315 3300026078 Bacteria 3588
398 Ga0207702_10087151 3300026078 Bacteria 2724
399 Ga0207702_10226326 3300026078 Bacteria 1745
400 Ga0207702_10252025 3300026078 Bacteria 1658
401 Ga0207702_10465458 3300026078 Bacteria 1228
402 Ga0207641_10024573 3300026088 Bacteria 4966
403 Ga0207641_10341124 3300026088 Bacteria 1426
404 Ga0207648_10342919 3300026089 Bacteria 1346
405 Ga0207648_10371813 3300026089 Bacteria 1291
406 Ga0207648_10402052 3300026089 Bacteria 1241
407 Ga0207676_10010625 3300026095 Bacteria 6563
408 Ga0207676_10459617 3300026095 Bacteria 1202
409 Ga0207674_10005503 3300026116 Bacteria 15037
410 Ga0207674_10021603 3300026116 Bacteria 6928
411 Ga0207674_10039387 3300026116 Bacteria 4899
412 Ga0207674_10041802 3300026116 Bacteria 4739
413 Ga0207674_11259224 3300026116 Bacteria 709
414 Ga0207675_100000879 3300026118 Bacteria 29982
415 Ga0207675_100052670 3300026118 Bacteria 3798
416 Ga0207675_100071229 3300026118 Bacteria 3250
417 Ga0207675_100293719 3300026118 Bacteria 1581
418 Ga0207683_10034658 3300026121 Bacteria 4388
419 Ga0207683_10052440 3300026121 Bacteria 3574
420 Ga0207683_10180203 3300026121 Bacteria 1915
421 Ga0207683_10272545 3300026121 Bacteria 1546
422 Ga0207698_10003937 3300026142 Bacteria 8993
423 Ga0207698_10033549 3300026142 Bacteria 3731
424 Ga0207698_10088288 3300026142 Bacteria 2528
425 Ga0207698_10104328 3300026142 Bacteria 2358
426 Ga0207698_10145649 3300026142 Bacteria 2048
427 Ga0207698_10279019 3300026142 Bacteria 1545
428 Ga0207698_10313335 3300026142 Bacteria 1466
429 Ga0209999_1029774 3300027543 Bacteria 1013
430 Ga0209983_1026658 3300027665 Bacteria 1223
431 Ga0209813_10093257 3300027866 Bacteria 1014
432 Ga0209813_10110162 3300027866 Bacteria 947
433 Ga0209974_10026407 3300027876 Bacteria 1922
434 Ga0207428_10000152 3300027907 Bacteria 94307
435 Ga0207428_10027374 3300027907 Bacteria 4747
436 Ga0268266_10163840 3300028379 Bacteria 2013
437 Ga0268266_11015477 3300028379 Bacteria 803
438 Ga0268265_10033763 3300028380 Bacteria 3723
439 Ga0268265_10067102 3300028380 Bacteria 2776
440 Ga0268265_10187744 3300028380 Bacteria 1782
441 Ga0268265_10548045 3300028380 Bacteria 1097
442 Ga0268265_10628508 3300028380 Bacteria 1030
443 Ga0268264_10060839 3300028381 Bacteria 3166
444 Ga0268264_10101594 3300028381 Bacteria 2500
445 Ga0268264_10394552 3300028381 Bacteria 1328
446 Ga0307515_10000034 3300028794 Bacteria 344640
447 Ga0307515_10018885 3300028794 Bacteria 12446
448 Ga0307515_10271307 3300028794 Bacteria 1417
449 Ga0307511_10028923 3300030521 Bacteria 5017
450 Ga0265320_10054034 3300031240 Bacteria 1939
451 Ga0265331_10068472 3300031250 Bacteria 1664
452 Ga0307513_10515171 3300031456 Bacteria 912
453 Ga0307408_100093008 3300031548 Bacteria 2280
454 Ga0307408_100329535 3300031548 Bacteria 1289
455 Ga0307408_100717860 3300031548 Bacteria 900
456 Ga0307408_100851507 3300031548 Bacteria 831
457 Ga0316576_10060513 3300031727 Bacteria 2774
458 Ga0307516_10003296 3300031730 Bacteria 20894
459 Ga0307516_10020560 3300031730 Bacteria 6817
460 Ga0307405_10085115 3300031731 Bacteria 2077
461 Ga0307406_10334983 3300031901 Bacteria 1176
462 Ga0307407_10007279 3300031903 Bacteria 5003
463 Ga0307412_11056780 3300031911 Bacteria 720
464 Ga0307416_100053978 3300032002 Bacteria 3228
465 Ga0307416_101032367 3300032002 Bacteria 926
466 Ga0307415_101211109 3300032126 Bacteria 712
467 Ga0373930_0010975 3300034816 Bacteria 1629
468 Ga0373940_0010835 3300035088 Bacteria 2153
469 Ga0373939_0049193 3300035114 Bacteria 1302
470 Ga0373946_0094085 3300035171 Bacteria 1333
471 Ga0373962_0007567 3300035242 Bacteria 2663
472 Ga0316574_0265126 3300035398 Bacteria 1096
473 Ga0373931_0006633 3300035691 Bacteria 5420
474 Ga0373931_0128858 3300035691 Bacteria 1454
475 Ga0373931_0494448 3300035691 Bacteria 788
476 Ga0373935_0861804 3300035692 Bacteria 670
477 Ga0373925_0040624 3300037068 Bacteria 3445
478 Ga0373925_0279482 3300037068 Bacteria 1344
479 Ga0395899_0012535 3300037312 Bacteria 6498
480 Ga0395899_0295694 3300037312 Bacteria 1097
481 Ga0395900_0009587 3300037418 Bacteria 9926
482 Ga0395900_0115638 3300037418 Bacteria 2752
483 Ga0395900_0145253 3300037418 Bacteria 2426
484 Ga0395900_0240303 3300037418 Bacteria 1817
485 Ga0395900_0707581 3300037418 Bacteria 940
486 Ga0395898_0191039 3300037466 Bacteria 1956
487 Ga0395898_0211074 3300037466 Bacteria 1852
488 Ga0395905_0000883 3300037471 Bacteria 39095
489 Ga0395905_0010764 3300037471 Bacteria 8867
490 Ga0395905_0020602 3300037471 Bacteria 6243
491 Ga0395905_0317436 3300037471 Bacteria 1447
492 Ga0395905_0415180 3300037471 Bacteria 1241
493 Ga0395905_0637139 3300037471 Unclassified 968
494 Ga0395901_0004759 3300038443 Bacteria 13696
495 Ga0395901_0015549 3300038443 Bacteria 7750
496 Ga0395901_1033885 3300038443 Bacteria 795
497 Ga0436365_0208379 3300039437 Bacteria 3000
498 Ga0436365_1016022 3300039437 Bacteria 3902
499 Ga0436363_0107667 3300039450 Bacteria 2144
500 Ga0436363_1649827 3300039450 Bacteria 893
501 Ga0439436_0007708 3300041404 Bacteria 3312
502 Ga0439439_0012756 3300041406 Bacteria 2033
503 Ga0439439_0032576 3300041406 Bacteria 1331
504 Ga0439447_020102 3300041407 Bacteria 1775
505 Ga0439466_0004735 3300041411 Bacteria 5229
506 Ga0439466_0011107 3300041411 Bacteria 3336
507 Ga0439465_0035965 3300041413 Bacteria 1589
508 Ga0451793_0211241 3300041452 Bacteria 865
509 Ga0451797_0461082 3300041453 Bacteria 2806
510 Ga0451800_0593028 3300041459 Bacteria 838
511 Ga0451800_0767295 3300041459 Bacteria 831
512 Ga0451804_0103686 3300041463 Bacteria 855
513 Ga0451833_0809994 3300041491 Bacteria 648
514 Ga0451835_0946079 3300041492 Bacteria 1226
515 Ga0451841_0631142 3300041498 Bacteria 913
516 Ga0451845_0537950 3300041501 Bacteria 1158
517 Ga0451843_1764350 3300041509 Bacteria 1028
518 Ga0451853_2282553 3300041512 Bacteria 1049
519 Ga0439431_0005421 3300041997 Bacteria 2818
520 Ga0439433_0004518 3300041999 Bacteria 2997
521 Ga0439442_007850 3300042002 Bacteria 2154
522 Ga0439445_0003668 3300042004 Bacteria 3446
523 Ga0439445_0067481 3300042004 Bacteria 986
524 Ga0439432_017634 3300042006 Bacteria 2394
525 Ga0439432_038634 3300042006 Bacteria 1519
526 Ga0439449_0002894 3300042007 Bacteria 6676
527 Ga0439449_0029030 3300042007 Bacteria 2061
528 Ga0439449_0030220 3300042007 Bacteria 2018
529 Ga0439452_004744 3300042010 Bacteria 4497
530 Ga0439452_008152 3300042010 Bacteria 3169
531 Ga0439457_023486 3300042014 Bacteria 1364
532 Ga0439462_0005459 3300042015 Bacteria 3135
533 Ga0439462_0007022 3300042015 Bacteria 2814
534 Ga0439463_107213 3300042016 Bacteria 721
535 Ga0450911_000289 3300042115 Bacteria 18464
536 Ga0450923_020159 3300042125 Bacteria 1290
537 Ga0450897_000960 3300042128 Bacteria 1818
538 Ga0450899_028104 3300042135 Bacteria 677
539 Ga0450906_046895 3300042145 Bacteria 762
540 Ga0450907_022937 3300042146 Bacteria 1052
541 Ga0439446_0047533 3300042156 Bacteria 1276
542 Ga0439434_0065141 3300042435 Bacteria 1143
543 Ga0450893_0009616 3300042532 Bacteria 1580
544 Ga0451577_0101976 3300042876 Bacteria 2564
545 Ga0466972_0003747 3300044658 Bacteria 7561
546 Ga0466965_0005827 3300044683 Bacteria 5560
547 Ga0466965_0107847 3300044683 Bacteria 1429
548 Ga0466966_0010532 3300044684 Bacteria 6144
549 Ga0466963_0251649 3300044694 Bacteria 1240
550 Ga0466964_0008502 3300044706 Bacteria 3859
551 Ga0453684_1044128 3300044712 Bacteria 867
552 Ga0466968_0011304 3300044735 Bacteria 3476
553 Ga0466970_0289142 3300044765 Bacteria 923
554 Ga0451576_0072876 3300045051 Bacteria 3574
555 Ga0495627_009665 3300046453 Bacteria 3540
556 Ga0495592_0391866 3300046454 Bacteria 882
557 Ga0495629_0076852 3300046459 Bacteria 2331
558 Ga0495653_0395302 3300046463 Bacteria 880
559 Ga0495582_0234121 3300046473 Bacteria 1052
560 Ga0495639_0004103 3300046475 Bacteria 6238
561 Ga0495664_0200440 3300046477 Bacteria 1209
562 Ga0495610_0177203 3300046512 Bacteria 889
563 Ga0495620_0022193 3300046515 Bacteria 3064
564 Ga0495628_0480078 3300046516 Bacteria 900
565 Ga0495628_0485497 3300046516 Bacteria 894
566 Ga0495637_0021694 3300046520 Bacteria 2941
567 Ga0495642_0118147 3300046528 Bacteria 1137
568 Ga0495654_0002010 3300046530 Bacteria 13387
569 Ga0495621_0039969 3300046539 Bacteria 1642
570 Ga0495621_0171873 3300046539 Bacteria 861
571 Ga0495622_0063474 3300046557 Bacteria 1709
572 Ga0495633_0246467 3300046558 Bacteria 816
573 Ga0495656_0079131 3300046615 Bacteria 1479
574 Ga0495625_0154116 3300046660 Bacteria 1543
575 Ga0495661_0282655 3300046665 Bacteria 836
576 Ga0495588_0070315 3300046674 Bacteria 1819
577 Ga0495670_0120972 3300046691 Bacteria 1360
578 Ga0495671_0005355 3300046692 Bacteria 7529
579 Ga0495660_0374002 3300046810 Bacteria 629
580 Ga0495674_1201294 3300047319 Bacteria 573
581 Ga0495672_0166756 3300047320 Bacteria 1127
582 Ga0495676_0638229 3300047321 Bacteria 692
583 Ga0496100_0019573 3300048903 Bacteria 4042
584 Ga0496100_0026056 3300048903 Bacteria 3581
585 Ga0496101_0013253 3300048904 Bacteria 5521
586 Ga0496101_0053277 3300048904 Bacteria 2918
587 Ga0496102_0008824 3300048905 Bacteria 8648
588 Ga0496102_0068465 3300048905 Bacteria 3257
589 Ga0496103_0103431 3300048906 Bacteria 1804
590 Ga0496104_0049293 3300048907 Bacteria 3971
591 Ga0496105_0035902 3300048908 Bacteria 4082
592 Ga0496105_0148386 3300048908 Bacteria 1928
593 Ga0496106_0008083 3300048909 Bacteria 7771
594 Ga0496106_0015833 3300048909 Bacteria 5577
595 Ga0496107_0004328 3300048910 Bacteria 9610
596 Ga0496108_0104079 3300048911 Bacteria 2422
597 Ga0496108_0137221 3300048911 Bacteria 2105
598 Ga0496109_0095016 3300048912 Bacteria 2759
599 Ga0496109_0691489 3300048912 Bacteria 957
600 Ga0496109_0766675 3300048912 Bacteria 903
601 Ga0496110_0029184 3300048913 Bacteria 4744
602 Ga0496110_0299570 3300048913 Bacteria 1464
603 Ga0496111_0031530 3300048914 Bacteria 3776
604 Ga0496111_0092473 3300048914 Bacteria 2217
605 Ga0496111_0172260 3300048914 Bacteria 1608
606 Ga0496114_0044725 3300048917 Bacteria 3675
607 Ga0496114_0097804 3300048917 Bacteria 2501
608 Ga0496115_0033835 3300048918 Bacteria 4037
609 Ga0496121_0020745 3300048924 Bacteria 6479
610 Ga0496121_0239264 3300048924 Bacteria 1266
611 Ga0496121_0757043 3300048924 Bacteria 577
612 Ga0496122_0305092 3300048925 Bacteria 856
613 Ga0496124_0036939 3300048927 Bacteria 4254
614 Ga0496125_0005367 3300048928 Bacteria 14295
615 Ga0496125_0005937 3300048928 Bacteria 13381
616 Ga0496126_0014536 3300048929 Bacteria 7952
617 Ga0496126_0083272 3300048929 Bacteria 2824
618 Ga0496126_0207500 3300048929 Bacteria 1651
619 Ga0501034_0287736 3300049571 Bacteria 1582
620 Ga0501034_0514116 3300049571 Bacteria 1110
621 Ga0501036_0023593 3300049572 Bacteria 5184
622 Ga0501036_0163149 3300049572 Bacteria 1879
623 Ga0501037_0387929 3300049573 Bacteria 959
624 Ga0501037_0499091 3300049573 Bacteria 826
625 Ga0501038_0681013 3300049574 Bacteria 772
626 Ga0501039_0055156 3300049575 Bacteria 3077
627 Ga0501040_0001677 3300049576 Bacteria 14176
628 Ga0501040_0005535 3300049576 Bacteria 8178
629 Ga0501041_0003272 3300049577 Bacteria 9311
630 Ga0501041_0004599 3300049577 Bacteria 8006
631 Ga0501042_0018555 3300049578 Bacteria 4818
632 Ga0501042_0024465 3300049578 Bacteria 4235
633 Ga0501043_0000573 3300049579 Bacteria 32893
634 Ga0501043_0566612 3300049579 Bacteria 842
635 Ga0501046_0000752 3300049580 Bacteria 31319
636 Ga0501046_0014242 3300049580 Bacteria 6717
637 Ga0501046_0019277 3300049580 Bacteria 5659
638 Ga0501046_0805325 3300049580 Bacteria 658
639 Ga0501047_0000298 3300049581 Bacteria 57038
640 Ga0501047_0005437 3300049581 Bacteria 11984
641 Ga0501048_0003640 3300049582 Bacteria 11740
642 Ga0501048_0012421 3300049582 Bacteria 6335
643 Ga0501048_0134828 3300049582 Bacteria 1745
644 Ga0501048_0750661 3300049582 Bacteria 701
645 Ga0501068_0047704 3300049584 Bacteria 2584
646 Ga0501068_0192506 3300049584 Bacteria 1292
647 Ga0501068_0508668 3300049584 Bacteria 782
648 Ga0501069_0277742 3300049585 Bacteria 980
649 Ga0501070_0061210 3300049586 Bacteria 3119
650 Ga0501071_0048023 3300049587 Unclassified 3068
651 Ga0501071_0058241 3300049587 Bacteria 2793
652 Ga0501071_0164637 3300049587 Bacteria 1659
653 Ga0501072_0034140 3300049588 Bacteria 3986
654 Ga0501073_0109059 3300049589 Bacteria 1921
655 Ga0501073_0204780 3300049589 Bacteria 1364
656 Ga0501073_0245596 3300049589 Bacteria 1236
657 Ga0501074_0057744 3300049590 Bacteria 2796
658 Ga0501074_0078648 3300049590 Bacteria 2367
659 Ga0501074_0265037 3300049590 Bacteria 1221
660 Ga0501075_0009539 3300049591 Bacteria 6794
661 Ga0501075_0011038 3300049591 Bacteria 6376
662 Ga0501075_0026233 3300049591 Unclassified 4287
663 Ga0501076_0080875 3300049592 Bacteria 2608
664 Ga0501076_0085239 3300049592 Bacteria 2538
665 Ga0501076_0263667 3300049592 Bacteria 1411
666 Ga0501077_0013790 3300049593 Bacteria 5069
667 Ga0501077_0305422 3300049593 Bacteria 1014
668 Ga0501252_033465 3300049682 Bacteria 721
669 Ga0501079_0005863 3300049741 Bacteria 9192
670 Ga0501079_0278273 3300049741 Bacteria 1308
671 Ga0501079_0781858 3300049741 Bacteria 751
672 Ga0501080_0002090 3300049742 Bacteria 17331
673 Ga0501080_0010278 3300049742 Bacteria 8555
674 Ga0501080_0082448 3300049742 Unclassified 2987
675 Ga0501080_0123510 3300049742 Bacteria 2398
676 Ga0501080_0367905 3300049742 Bacteria 1297
677 Ga0501081_0005137 3300049743 Bacteria 8427
678 Ga0501081_0105990 3300049743 Bacteria 1992
679 Ga0501083_0064057 3300049744 Bacteria 2451
680 Ga0501035_0200872 3300049822 Bacteria 1710
681 Ga0501035_0776298 3300049822 Bacteria 767
682 Ga0501044_0117400 3300049823 Bacteria 2665
683 Ga0501045_0009696 3300049824 Bacteria 6736
684 Ga0501045_0017809 3300049824 Bacteria 5045
685 Ga0501045_0027684 3300049824 Bacteria 4087
686 Ga0501045_0042241 3300049824 Bacteria 3319
687 Ga0501045_0988830 3300049824 Bacteria 617
688 nmdc:mga03683_1140_c1 3300050489 Bacteria 5531
689 nmdc:mga03683_122698_c1 3300050489 Bacteria 1156
690 nmdc:mga03683_4303_c1 3300050489 Bacteria 4705
691 nmdc:mga03683_5158_c1 3300050489 Bacteria 4391
692 nmdc:mga03683_609841_c1 3300050489 Bacteria 535
693 nmdc:mga03n38_282687_c1 3300050490 Bacteria 886
694 nmdc:mga00v17_573807_c1 3300050491 Bacteria 728
695 nmdc:mga0yw44_350879_c1 3300050492 Bacteria 993
696 nmdc:mga06z11_334771_c1 3300050494 Bacteria 904
697 nmdc:mga06z11_564985_c1 3300050494 Bacteria 691
698 nmdc:mga04h51_31991_c1 3300050495 Bacteria 1665
699 nmdc:mga04h51_36159_c1 3300050495 Bacteria 1587
700 nmdc:mga07m45_9139_c1 3300050496 Bacteria 1936
701 nmdc:mga05p37_108188_c1 3300050507 Bacteria 3420
702 nmdc:mga05p37_229145_c1 3300050507 Bacteria 2239
703 nmdc:mga0qj67_791822_c1 3300050509 Bacteria 751
704 nmdc:mga08y16_37683_c1 3300050511 Bacteria 5076
705 nmdc:mga08y16_54_c1 3300050511 Bacteria 102957
706 nmdc:mga08y16_821575_c1 3300050511 Bacteria 921
707 nmdc:mga0n895_9679_c1 3300050512 Bacteria 8452
708 nmdc:mga0rr50_165557_c1 3300050513 Bacteria 1797
709 nmdc:mga0rr50_765905_c1 3300050513 Bacteria 824
710 nmdc:mga08x19_509528_c1 3300050514 Bacteria 850
711 nmdc:mga0a205_2327_c1 3300050515 Bacteria 16764
712 nmdc:mga0sz30_16457_c1 3300050516 Bacteria 2937
713 nmdc:mga0sz30_16817_c1 3300050516 Bacteria 2910
714 Ga0500610_0005742 3300053079 Bacteria 5125
715 Ga0500610_0018232 3300053079 Bacteria 3388
716 Ga0495619_0728934 3300053085 Bacteria 673
717 Ga0500651_0155396 3300053093 Bacteria 1371
718 Ga0500650_0284169 3300053098 Bacteria 735
719 Ga0500593_003920 3300053117 Bacteria 5704
720 Ga0500607_009966 3300053121 Bacteria 5692
721 Ga0500652_067867 3300053131 Bacteria 1475
722 Ga0500559_0016122 3300053136 Bacteria 3155
723 Ga0500559_0126437 3300053136 Unclassified 1192
724 Ga0500616_0002351 3300053153 Bacteria 15902
725 Ga0500634_0002047 3300053161 Bacteria 8295
726 Ga0500552_000821 3300053733 Bacteria 2913
727 Ga0501084_0011061 3300054114 Bacteria 7472
728 Ga0501084_0015960 3300054114 Bacteria 6232
729 Ga0501084_0367677 3300054114 Bacteria 1215
730 Ga0501082_0003668 3300060353 Bacteria 13416
731 Ga0501082_0555056 3300060353 Bacteria 1005
732 Ga0530510_0016521 3300061734 Bacteria 5226
733 Ga0530510_0054832 3300061734 Bacteria 2880
734 Ga0530510_0345218 3300061734 Bacteria 1118
735 2587758082 2585428062 Bacteria 6842168
736 2644291967 2643221652 Bacteria 5140275
737 2885194328 2885192300 Bacteria 5882526
738 2904451648 2904449895 Bacteria 6927402
739 2904461863 2904456579 Bacteria 6819253
740 2906616518
741 2929526566 2929520902 Bacteria 6765052
742 Ga0439436_0003148
743 JGI25406J46586_10055306
744 JGI25404J52841_10018468
745 Ga0055536_1008437
746 Ga0055540_1001803
747 JGI25405J52794_10060666
748 Ga0065704_10096637
749 Ga0070658_10004903
750 Ga0070658_10292523
751 Ga0070676_10008737
752 Ga0070683_100060012
753 Ga0070683_100065267
754 Ga0070683_100093284
755 Ga0070690_100104351
756 Ga0070670_100136543
757 Ga0070670_100611844
758 Ga0070670_100932427
759 Ga0068869_100003076
760 Ga0070666_10260613
761 Ga0070680_100043420
762 Ga0070680_100572697
763 Ga0070682_100022201
764 Ga0070682_100434821
765 Ga0070682_100605306
766 Ga0068868_100006730
767 Ga0068868_100088596
768 Ga0070660_100040061
769 Ga0070660_100319412
770 Ga0070687_100390302
771 Ga0070661_100008214
772 Ga0070661_100069065
773 Ga0070661_100116416
774 Ga0070692_10311318
775 Ga0070668_100009361
776 Ga0070668_100094910
777 Ga0070668_100628639
778 Ga0070669_100032735
779 Ga0070669_100449332
780 Ga0070669_100581184
781 Ga0070675_100001332
782 Ga0070675_100009544
783 Ga0070675_100145716
784 Ga0070671_100370767
785 Ga0070671_100565684
786 Ga0070674_100617468
787 Ga0070674_100934981
788 Ga0070673_100019233
789 Ga0070673_100274085
790 Ga0070688_100156917
791 Ga0070659_100006591
792 Ga0070659_100021473
793 Ga0070659_100029753
794 Ga0070667_100151577
795 Ga0070667_100184786
796 Ga0070667_100222687
797 Ga0070667_100331904
798 Ga0070709_10154543
799 Ga0070714_100179753
800 Ga0070713_100094954
801 Ga0070713_100229022
802 Ga0070701_10155143
803 Ga0070705_100389088
804 Ga0070694_100444842
805 Ga0070663_100004462
806 Ga0070678_100020170
807 Ga0070678_100200248
808 Ga0070662_100001945
809 Ga0070662_100074926
810 Ga0070662_100087750
811 Ga0070681_10001057
812 Ga0070681_10043520
813 Ga0070681_10235580
814 Ga0070681_10339154
815 Ga0070681_10361123
816 Ga0070681_10420942
817 Ga0068867_100224621
818 Ga0068867_100698835
819 Ga0070706_100091293
820 Ga0070698_100001208
821 Ga0070699_100128414
822 Ga0070679_100002239
823 Ga0070679_100027302
824 Ga0070679_100062734
825 Ga0070679_100071601
826 Ga0070679_100248698
827 Ga0070684_100028635
828 Ga0070684_100051865
829 Ga0070684_100210190
830 Ga0070684_101355003
831 Ga0070697_100275317
832 Ga0068853_100030678
833 Ga0068853_100034435
834 Ga0068853_100073542
835 Ga0068853_100199327
836 Ga0068853_100691977
837 Ga0068853_100885602
838 Ga0070672_100008896
839 Ga0070672_100062557
840 Ga0070672_100070593
841 Ga0070672_100851877
842 Ga0070695_100022143
843 Ga0070693_100015270
844 Ga0070665_100046991
845 Ga0070665_101486032
846 Ga0070704_100457546
847 Ga0068855_100008812
848 Ga0068855_100031980
849 Ga0068855_100049234
850 Ga0068855_100051023
851 Ga0068855_100118175
852 Ga0068855_100379473
853 Ga0068855_100831048
854 Ga0070664_100086137
855 Ga0070664_100154124
856 Ga0068857_100059280
857 Ga0068857_100159007
858 Ga0068854_100006691
859 Ga0068854_100062380
860 Ga0068856_100004796
861 Ga0068856_100052398
862 Ga0068856_100085508
863 Ga0068856_100149251
864 Ga0068856_100236682
865 Ga0068856_100432497
866 Ga0070702_100224909
867 Ga0068852_100000615
868 Ga0068852_100001686
869 Ga0068852_100085852
870 Ga0068852_100275740
871 Ga0068852_100380885
872 Ga0068852_101033626
873 Ga0068859_100219748
874 Ga0068859_100305303
875 Ga0068864_100028438
876 Ga0068864_100806211
877 Ga0068861_100000384
878 Ga0068861_100019833
879 Ga0068861_100227768
880 Ga0068851_10008669
881 Ga0068851_10034847
882 Ga0068870_10125636
883 Ga0068858_100027002
884 Ga0068858_100045670
885 Ga0068860_100007870
886 Ga0068860_100021841
887 Ga0068860_100355931
888 Ga0068862_100127742
889 Ga0068862_100241341
890 Ga0068862_100305993
891 Ga0068862_101105251
892 Ga0081455_10001734
893 Ga0081455_10017747
894 Ga0081455_10063978
895 Ga0081455_10667880
896 Ga0081540_1001682
897 Ga0081540_1040152
898 Ga0081539_10000001
899 Ga0081539_10001294
900 Ga0081539_10001470
901 Ga0081539_10041426
902 Ga0081539_10275840
903 Ga0070717_10056285
904 Ga0070717_10826012
905 Ga0070717_11199538
906 Ga0075368_10192414
907 Ga0075362_10007616
908 Ga0075362_10015283
909 Ga0075362_10039087
910 Ga0075362_10165403
911 Ga0075367_10142406
912 Ga0075367_10198578
913 Ga0075369_10005411
914 Ga0075369_10194647
915 Ga0097621_100190080
916 Ga0097621_100524986
917 Ga0097621_101206025
918 Ga0075370_10012362
919 Ga0068871_100036905
920 Ga0068871_100129082
921 Ga0068871_100192582
922 Ga0068871_101320468
923 Ga0075428_100001751
924 Ga0075433_10099961
925 Ga0075433_10100388
926 Ga0075434_100000816
927 Ga0075434_100195892
928 Ga0075434_100419668
929 Ga0075434_100467802
930 Ga0068865_100019910
931 Ga0075436_100487470
932 Ga0097620_100219755
933 Ga0097620_100305324
934 Ga0097620_101859227
935 Ga0075435_100027706
936 Ga0075435_100484954
937 Ga0075435_100838637
938 Ga0105251_10306120
939 Ga0105244_10078389
940 Ga0105240_10004485
941 Ga0105240_10005388
942 Ga0105240_10520545
943 Ga0111539_10004025
944 Ga0111539_11133167
945 Ga0105245_10021575
946 Ga0105247_10391516
947 Ga0114129_10004052
948 Ga0105243_10001608
949 Ga0105241_10003669
950 Ga0105241_10067234
951 Ga0105241_10070482
952 Ga0105241_10279328
953 Ga0105248_10007485
954 Ga0105248_10251994
955 Ga0105237_10126533
956 Ga0105237_10223013
957 Ga0105237_10312041
958 Ga0105238_10005726
959 Ga0105238_10010115
960 Ga0105238_10027853
961 Ga0105238_10041404
962 Ga0105238_11012070
963 Ga0105249_10113389
964 Ga0105030_100276
965 Ga0105239_10081049
966 Ga0157347_1011671
967 Ga0157373_10010816
968 Ga0157373_10072075
969 Ga0157371_10054153
970 Ga0157371_10958005
971 Ga0157370_10006388
972 Ga0157370_10010672
973 Ga0157370_10140960
974 Ga0157370_10749837
975 Ga0157369_10022153
976 Ga0157369_10081473
977 Ga0157369_10135626
978 Ga0157369_10523144
979 Ga0157374_10078442
980 Ga0157374_10089163
981 Ga0163162_10000830
982 Ga0163162_11051101
983 Ga0157372_10010331
984 Ga0157372_10015817
985 Ga0157372_10147351
986 Ga0157372_10192002
987 Ga0157372_10824481
988 Ga0157372_10867425
989 Ga0157375_10112491
990 Ga0157375_11103786
991 Ga0157514_125748
992 Ga0157380_10008236
993 Ga0157380_10033720
994 Ga0157380_10245494
995 Ga0182008_10159318
996 Ga0182008_10262274
997 Ga0182008_10419587
998 Ga0157377_10112496
999 Ga0157379_10001870
1000 Ga0157379_10014560
1001 Ga0157376_10011825
1002 Ga0157376_10808996
1003 Ga0182006_1023666
1004 Ga0182006_1051890
1005 Ga0182005_1052785
1006 Ga0163161_10033820
1007 Ga0163161_10849548
1008 Ga0197907_10899683
1009 Ga0206353_10916553
1010 Ga0213873_10222063
1011 Ga0213876_10151763
1012 Ga0209676_1000346
1013 Ga0209676_1094387
1014 Ga0209051_1000284
1015 Ga0209051_1000446
1016 Ga0209257_1016774
1017 Ga0207697_10050884
1018 Ga0207697_10107830
1019 Ga0207656_10023822
1020 Ga0207656_10298542
1021 Ga0207710_10157475
1022 Ga0207688_10047326
1023 Ga0207680_10171283
1024 Ga0207647_10135962
1025 Ga0207645_10029005
1026 Ga0207645_10034706
1027 Ga0207645_10209618
1028 Ga0207643_10030417
1029 Ga0207705_10138462
1030 Ga0207705_10180664
1031 Ga0207654_10020632
1032 Ga0207654_10038141
1033 Ga0207654_10059670
1034 Ga0207654_10087143
1035 Ga0207707_10005989
1036 Ga0207707_10198647
1037 Ga0207707_10249186
1038 Ga0207707_10305204
1039 Ga0207707_10408934
1040 Ga0207695_10006376
1041 Ga0207695_10020075
1042 Ga0207695_10023115
1043 Ga0207671_10066078
1044 Ga0207671_10131025
1045 Ga0207671_10212401
1046 Ga0207660_10089498
1047 Ga0207660_10196334
1048 Ga0207662_10157113
1049 Ga0207657_10000142
1050 Ga0207657_10032616
1051 Ga0207657_10191922
1052 Ga0207649_10025495
1053 Ga0207649_10034563
1054 Ga0207652_10021625
1055 Ga0207652_10036122
1056 Ga0207652_10075818
1057 Ga0207652_10119723
1058 Ga0207652_10622321
1059 Ga0207681_10043206
1060 Ga0207681_10043214
1061 Ga0207681_10078926
1062 Ga0207694_10023532
1063 Ga0207694_10023870
1064 Ga0207694_10032630
1065 Ga0207694_10109709
1066 Ga0207694_10275402
1067 Ga0207650_10646730
1068 Ga0207659_10004432
1069 Ga0207659_10013115
1070 Ga0207659_10052279
1071 Ga0207700_10032738
1072 Ga0207664_10031551
1073 Ga0207664_10058301
1074 Ga0207664_10087250
1075 Ga0207664_10325607
1076 Ga0207644_10117356
1077 Ga0207644_10253898
1078 Ga0207644_10322759
1079 Ga0207644_11409404
1080 Ga0207690_10043611
1081 Ga0207690_10094722
1082 Ga0207690_10183883
1083 Ga0207690_10234300
1084 Ga0207706_10006991
1085 Ga0207706_10130409
1086 Ga0207706_10147178
1087 Ga0207706_10212120
1088 Ga0207686_10082791
1089 Ga0207686_10127860
1090 Ga0207709_10000540
1091 Ga0207709_11299289
1092 Ga0207669_10155065
1093 Ga0207704_10431593
1094 Ga0207665_10094659
1095 Ga0207691_10010913
1096 Ga0207691_10022589
1097 Ga0207691_10037814
1098 Ga0207711_10013899
1099 Ga0207689_10000856
1100 Ga0207689_10044075
1101 Ga0207661_10004542
1102 Ga0207661_10172051
1103 Ga0207661_10481505
1104 Ga0207679_10037148
1105 Ga0207679_10040785
1106 Ga0207679_10264138
1107 Ga0207667_10009529
1108 Ga0207667_10009780
1109 Ga0207667_10039768
1110 Ga0207667_10061183
1111 Ga0207667_10482506
1112 Ga0207651_10061416
1113 Ga0207651_10160284
1114 Ga0207651_10250911
1115 Ga0207712_10428723
1116 Ga0207668_10021657
1117 Ga0207668_10054598
1118 Ga0207668_10264901
1119 Ga0207668_10367953
1120 Ga0207640_10018518
1121 Ga0207640_10120090
1122 Ga0207640_10290709
1123 Ga0207658_10031259
1124 Ga0207658_10155781
1125 Ga0207658_10244428
1126 Ga0207677_10010028
1127 Ga0207677_10063012
1128 Ga0207677_10646602
1129 Ga0207703_10036792
1130 Ga0207703_10092359
1131 Ga0207639_10011932
1132 Ga0207639_10022769
1133 Ga0207639_10060832
1134 Ga0207639_10402480
1135 Ga0207639_10930788
1136 Ga0207678_10002761
1137 Ga0207708_11766791
1138 Ga0207702_10048315
1139 Ga0207702_10087151
1140 Ga0207702_10226326
1141 Ga0207702_10252025
1142 Ga0207702_10465458
1143 Ga0207641_10024573
1144 Ga0207641_10341124
1145 Ga0207648_10342919
1146 Ga0207648_10371813
1147 Ga0207648_10402052
1148 Ga0207676_10010625
1149 Ga0207676_10459617
1150 Ga0207674_10005503
1151 Ga0207674_10021603
1152 Ga0207674_10039387
1153 Ga0207674_10041802
1154 Ga0207674_11259224
1155 Ga0207675_100000879
1156 Ga0207675_100052670
1157 Ga0207675_100071229
1158 Ga0207675_100293719
1159 Ga0207683_10034658
1160 Ga0207683_10052440
1161 Ga0207683_10180203
1162 Ga0207683_10272545
1163 Ga0207698_10003937
1164 Ga0207698_10033549
1165 Ga0207698_10088288
1166 Ga0207698_10104328
1167 Ga0207698_10145649
1168 Ga0207698_10279019
1169 Ga0207698_10313335
1170 Ga0209999_1029774
1171 Ga0209983_1026658
1172 Ga0209813_10093257
1173 Ga0209813_10110162
1174 Ga0209974_10026407
1175 Ga0207428_10000152
1176 Ga0207428_10027374
1177 Ga0268266_10163840
1178 Ga0268266_11015477
1179 Ga0268265_10033763
1180 Ga0268265_10067102
1181 Ga0268265_10187744
1182 Ga0268265_10548045
1183 Ga0268265_10628508
1184 Ga0268264_10060839
1185 Ga0268264_10101594
1186 Ga0268264_10394552
1187 Ga0307515_10000034
1188 Ga0307515_10018885
1189 Ga0307515_10271307
1190 Ga0307511_10028923
1191 Ga0265320_10054034
1192 Ga0265331_10068472
1193 Ga0307513_10515171
1194 Ga0307408_100093008
1195 Ga0307408_100329535
1196 Ga0307408_100717860
1197 Ga0307408_100851507
1198 Ga0316576_10060513
1199 Ga0307516_10003296
1200 Ga0307516_10020560
1201 Ga0307405_10085115
1202 Ga0307406_10334983
1203 Ga0307407_10007279
1204 Ga0307412_11056780
1205 Ga0307416_100053978
1206 Ga0307416_101032367
1207 Ga0307415_101211109
1208 Ga0373930_0010975
1209 Ga0373940_0010835
1210 Ga0373939_0049193
1211 Ga0373946_0094085
1212 Ga0373962_0007567
1213 Ga0316574_0265126
1214 Ga0373931_0006633
1215 Ga0373931_0128858
1216 Ga0373931_0494448
1217 Ga0373935_0861804
1218 Ga0373925_0040624
1219 Ga0373925_0279482
1220 Ga0395899_0012535
1221 Ga0395899_0295694
1222 Ga0395900_0009587
1223 Ga0395900_0115638
1224 Ga0395900_0145253
1225 Ga0395900_0240303
1226 Ga0395900_0707581
1227 Ga0395898_0191039
1228 Ga0395898_0211074
1229 Ga0395905_0000883
1230 Ga0395905_0010764
1231 Ga0395905_0020602
1232 Ga0395905_0317436
1233 Ga0395905_0415180
1234 Ga0395905_0637139
1235 Ga0395901_0004759
1236 Ga0395901_0015549
1237 Ga0395901_1033885
1238 Ga0436365_0208379
1239 Ga0436365_1016022
1240 Ga0436363_0107667
1241 Ga0436363_1649827
1242 Ga0439436_0007708
1243 Ga0439439_0012756
1244 Ga0439439_0032576
1245 Ga0439447_020102
1246 Ga0439466_0004735
1247 Ga0439466_0011107
1248 Ga0439465_0035965
1249 Ga0451793_0211241
1250 Ga0451797_0461082
1251 Ga0451800_0593028
1252 Ga0451800_0767295
1253 Ga0451804_0103686
1254 Ga0451833_0809994
1255 Ga0451835_0946079
1256 Ga0451841_0631142
1257 Ga0451845_0537950
1258 Ga0451843_1764350
1259 Ga0451853_2282553
1260 Ga0439431_0005421
1261 Ga0439433_0004518
1262 Ga0439442_007850
1263 Ga0439445_0003668
1264 Ga0439445_0067481
1265 Ga0439432_017634
1266 Ga0439432_038634
1267 Ga0439449_0002894
1268 Ga0439449_0029030
1269 Ga0439449_0030220
1270 Ga0439452_004744
1271 Ga0439452_008152
1272 Ga0439457_023486
1273 Ga0439462_0005459
1274 Ga0439462_0007022
1275 Ga0439463_107213
1276 Ga0450911_000289
1277 Ga0450923_020159
1278 Ga0450897_000960
1279 Ga0450899_028104
1280 Ga0450906_046895
1281 Ga0450907_022937
1282 Ga0439446_0047533
1283 Ga0439434_0065141
1284 Ga0450893_0009616
1285 Ga0451577_0101976
1286 Ga0466972_0003747
1287 Ga0466965_0005827
1288 Ga0466965_0107847
1289 Ga0466966_0010532
1290 Ga0466963_0251649
1291 Ga0466964_0008502
1292 Ga0453684_1044128
1293 Ga0466968_0011304
1294 Ga0466970_0289142
1295 Ga0451576_0072876
1296 Ga0495627_009665
1297 Ga0495592_0391866
1298 Ga0495629_0076852
1299 Ga0495653_0395302
1300 Ga0495582_0234121
1301 Ga0495639_0004103
1302 Ga0495664_0200440
1303 Ga0495610_0177203
1304 Ga0495620_0022193
1305 Ga0495628_0480078
1306 Ga0495628_0485497
1307 Ga0495637_0021694
1308 Ga0495642_0118147
1309 Ga0495654_0002010
1310 Ga0495621_0039969
1311 Ga0495621_0171873
1312 Ga0495622_0063474
1313 Ga0495633_0246467
1314 Ga0495656_0079131
1315 Ga0495625_0154116
1316 Ga0495661_0282655
1317 Ga0495588_0070315
1318 Ga0495670_0120972
1319 Ga0495671_0005355
1320 Ga0495660_0374002
1321 Ga0495674_1201294
1322 Ga0495672_0166756
1323 Ga0495676_0638229
1324 Ga0496100_0019573
1325 Ga0496100_0026056
1326 Ga0496101_0013253
1327 Ga0496101_0053277
1328 Ga0496102_0008824
1329 Ga0496102_0068465
1330 Ga0496103_0103431
1331 Ga0496104_0049293
1332 Ga0496105_0035902
1333 Ga0496105_0148386
1334 Ga0496106_0008083
1335 Ga0496106_0015833
1336 Ga0496107_0004328
1337 Ga0496108_0104079
1338 Ga0496108_0137221
1339 Ga0496109_0095016
1340 Ga0496109_0691489
1341 Ga0496109_0766675
1342 Ga0496110_0029184
1343 Ga0496110_0299570
1344 Ga0496111_0031530
1345 Ga0496111_0092473
1346 Ga0496111_0172260
1347 Ga0496114_0044725
1348 Ga0496114_0097804
1349 Ga0496115_0033835
1350 Ga0496121_0020745
1351 Ga0496121_0239264
1352 Ga0496121_0757043
1353 Ga0496122_0305092
1354 Ga0496124_0036939
1355 Ga0496125_0005367
1356 Ga0496125_0005937
1357 Ga0496126_0014536
1358 Ga0496126_0083272
1359 Ga0496126_0207500
1360 Ga0501034_0287736
1361 Ga0501034_0514116
1362 Ga0501036_0023593
1363 Ga0501036_0163149
1364 Ga0501037_0387929
1365 Ga0501037_0499091
1366 Ga0501038_0681013
1367 Ga0501039_0055156
1368 Ga0501040_0001677
1369 Ga0501040_0005535
1370 Ga0501041_0003272
1371 Ga0501041_0004599
1372 Ga0501042_0018555
1373 Ga0501042_0024465
1374 Ga0501043_0000573
1375 Ga0501043_0566612
1376 Ga0501046_0000752
1377 Ga0501046_0014242
1378 Ga0501046_0019277
1379 Ga0501046_0805325
1380 Ga0501047_0000298
1381 Ga0501047_0005437
1382 Ga0501048_0003640
1383 Ga0501048_0012421
1384 Ga0501048_0134828
1385 Ga0501048_0750661
1386 Ga0501068_0047704
1387 Ga0501068_0192506
1388 Ga0501068_0508668
1389 Ga0501069_0277742
1390 Ga0501070_0061210
1391 Ga0501071_0048023
1392 Ga0501071_0058241
1393 Ga0501071_0164637
1394 Ga0501072_0034140
1395 Ga0501073_0109059
1396 Ga0501073_0204780
1397 Ga0501073_0245596
1398 Ga0501074_0057744
1399 Ga0501074_0078648
1400 Ga0501074_0265037
1401 Ga0501075_0009539
1402 Ga0501075_0011038
1403 Ga0501075_0026233
1404 Ga0501076_0080875
1405 Ga0501076_0085239
1406 Ga0501076_0263667
1407 Ga0501077_0013790
1408 Ga0501077_0305422
1409 Ga0501252_033465
1410 Ga0501079_0005863
1411 Ga0501079_0278273
1412 Ga0501079_0781858
1413 Ga0501080_0002090
1414 Ga0501080_0010278
1415 Ga0501080_0082448
1416 Ga0501080_0123510
1417 Ga0501080_0367905
1418 Ga0501081_0005137
1419 Ga0501081_0105990
1420 Ga0501083_0064057
1421 Ga0501035_0200872
1422 Ga0501035_0776298
1423 Ga0501044_0117400
1424 Ga0501045_0009696
1425 Ga0501045_0017809
1426 Ga0501045_0027684
1427 Ga0501045_0042241
1428 Ga0501045_0988830
1429 nmdc:mga03683_1140_c1
1430 nmdc:mga03683_122698_c1
1431 nmdc:mga03683_4303_c1
1432 nmdc:mga03683_5158_c1
1433 nmdc:mga03683_609841_c1
1434 nmdc:mga03n38_282687_c1
1435 nmdc:mga00v17_573807_c1
1436 nmdc:mga0yw44_350879_c1
1437 nmdc:mga06z11_334771_c1
1438 nmdc:mga06z11_564985_c1
1439 nmdc:mga04h51_31991_c1
1440 nmdc:mga04h51_36159_c1
1441 nmdc:mga07m45_9139_c1
1442 nmdc:mga05p37_108188_c1
1443 nmdc:mga05p37_229145_c1
1444 nmdc:mga0qj67_791822_c1
1445 nmdc:mga08y16_37683_c1
1446 nmdc:mga08y16_54_c1
1447 nmdc:mga08y16_821575_c1
1448 nmdc:mga0n895_9679_c1
1449 nmdc:mga0rr50_165557_c1
1450 nmdc:mga0rr50_765905_c1
1451 nmdc:mga08x19_509528_c1
1452 nmdc:mga0a205_2327_c1
1453 nmdc:mga0sz30_16457_c1
1454 nmdc:mga0sz30_16817_c1
1455 Ga0500610_0005742
1456 Ga0500610_0018232
1457 Ga0495619_0728934
1458 Ga0500651_0155396
1459 Ga0500650_0284169
1460 Ga0500593_003920
1461 Ga0500607_009966
1462 Ga0500652_067867
1463 Ga0500559_0016122
1464 Ga0500559_0126437
1465 Ga0500616_0002351
1466 Ga0500634_0002047
1467 Ga0500552_000821
1468 Ga0501084_0011061
1469 Ga0501084_0015960
1470 Ga0501084_0367677
1471 Ga0501082_0003668
1472 Ga0501082_0555056
1473 Ga0530510_0016521
1474 Ga0530510_0054832
1475 Ga0530510_0345218
1476 2587758082
1477 2644291967
1478 2885194328
1479 2904451648
1480 2904461863
1481 2906616518
1482 2929526566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

47

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8601 2 135
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7813 2 135
4zgr-assembly1.cif.gz_A structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with t-antigen. 0.7595 54 85
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.7574 54 83
6loq-assembly1.cif.gz_A crystal structure of alpha-momorcharin in complex with camp 0.7534 54 85
ID Description Score Start End Superfamily
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7473 54 85 3.40.420.10
4z8sA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7444 54 83 3.40.420.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7435 1 101 2.170.150.70
2k7iB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.7387 56 83 3.30.160.160
1j1qA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7243 53 85 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A175WBH7-F1-model_v4 Putative glutathione-dependent formaldehyde-activating enzyme 0.9879 1 134 GO:0016846
GO:0046872
AF-A0A0R3M6V1-F1-model_v4 Aldehyde-activating protein 0.9861 1 153 GO:0016846
GO:0046872
AF-A0A2S7K7D9-F1-model_v4 Aldehyde-activating protein 0.9848 2 153 GO:0016846
GO:0046872
AF-A0A534BLW2-F1-model_v4 GFA family protein 0.9845 2 122 GO:0016846
GO:0046872
AF-A0A848H3V4-F1-model_v4 GFA family protein 0.9815 2 152 GO:0016846
GO:0046872

Map