F478667

General Info

Members Datasets Scaffolds Average Seq Length
742 437 1484 225

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221579|2643906132
Length 222
Sequence VVEDEHKTADYVRQGLMEAGFVVDLARDGPDGLHMATTEHYDLIVLDVMLPGMDGRKILQTIRAAGNQVPVLFLTARSSVDDRVQGLELGADDYLVKPFVFSELLARVRTLLRRGGSPIPHDRIQIADLELDLARRRATRAGQRINLTSKEFALLELLARRQGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDSFEPKLIQTVRGMGYTLDLPDA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
202 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
235 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
258 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
362 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
368 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
369 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
370 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
371 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
372 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
373 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
374 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
375 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
376 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
377 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
378 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
379 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
380 2643221672 Variovorax sp. Root434 Isolate Unclassified
381 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
382 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
383 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
384 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
385 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
386 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
387 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
388 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
389 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
390 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
391 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
392 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
393 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
394 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
395 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
396 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
397 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
398 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
399 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
400 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
401 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
402 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
403 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
404 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
405 2855730933 Achromobacter sp. HZ28 Isolate Nodule
406 2855767633 Achromobacter sp. HZ34 Isolate Nodule
407 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
408 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
409 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
410 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
411 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
412 2904424332 Duganella sp. 1411 Isolate Rhizosphere
413 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
414 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
415 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
416 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
417 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
418 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
419 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
420 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
421 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
422 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
423 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
424 2928058823 Ralstonia sp. 1138 Isolate Unclassified
425 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
426 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
427 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
428 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
429 640753048 Serratia proteamaculans 568 Isolate Endosphere
430 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
431 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
432 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
433 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
434 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
435 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
436 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
437 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.89
Metatranscriptomes 0.13
Isolates 9.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 21.7
Nodule 3.37
Rhizoplane 1.35
Rhizosphere 59.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000369 3300001915 Bacteria 13464
2 JGI24740J21852_10001501 3300001979 Bacteria 10744
3 JGI24740J21852_10008613 3300001979 Bacteria 4053
4 JGI25156J39149_1000226 3300002705 Bacteria 38895
5 JGI25156J39149_1000457 3300002705 Bacteria 24896
6 JGI25156J39149_1002321 3300002705 Bacteria 6937
7 JGI25156J39149_1014190 3300002705 Bacteria 1655
8 JGI25154J39366_1000925 3300002738 Bacteria 12344
9 JGI25154J39366_1002083 3300002738 Bacteria 5664
10 JGI25158J39367_1000006 3300002739 Bacteria 58790
11 JGI25159J45721_1000955 3300002987 Bacteria 12587
12 JGI25151J46595_10000868 3300003187 Bacteria 23934
13 JGI25151J46595_10006764 3300003187 Bacteria 5710
14 rootH2_10125873 3300003320 Bacteria 4761
15 rootH1_10161873 3300003323 Bacteria 3231
16 JGI25161J50226_1000052 3300003374 Bacteria 107273
17 Ga0055538_1002531 3300003751 Bacteria 2639
18 Ga0055539_1000078 3300003752 Bacteria 127408
19 Ga0055539_1000104 3300003752 Bacteria 95182
20 Ga0055533_1000084 3300003756 Bacteria 127408
21 Ga0055533_1000946 3300003756 Bacteria 8575
22 Ga0055525_1000112 3300003759 Bacteria 127408
23 Ga0055525_1000245 3300003759 Bacteria 54959
24 Ga0055535_1000229 3300003761 Bacteria 58945
25 Ga0055542_1002814 3300003762 Bacteria 5216
26 Ga0055529_1000064 3300003763 Bacteria 178831
27 Ga0055526_1000193 3300003771 Bacteria 53165
28 Ga0055526_1000563 3300003771 Bacteria 29353
29 Ga0055526_1003347 3300003771 Bacteria 10240
30 Ga0055526_1009481 3300003771 Bacteria 4672
31 Ga0055537_1000060 3300003773 Bacteria 79376
32 Ga0055537_1000514 3300003773 Bacteria 22884
33 Ga0055524_1000263 3300003775 Bacteria 52900
34 Ga0055524_1009149 3300003775 Bacteria 4054
35 Ga0055524_1011593 3300003775 Bacteria 3437
36 Ga0055536_1000195 3300003781 Bacteria 49966
37 Ga0055534_1000009 3300003784 Bacteria 210256
38 Ga0055534_1000710 3300003784 Bacteria 16303
39 Ga0055534_1000845 3300003784 Bacteria 14090
40 Ga0055528_1000012 3300003790 Bacteria 182704
41 Ga0055530_10011488 3300003791 Bacteria 3175
42 Ga0055540_1000365 3300003792 Bacteria 38078
43 Ga0055531_10000454 3300003794 Bacteria 38078
44 Ga0055541_1000055 3300003841 Bacteria 127408
45 Ga0055541_1000236 3300003841 Bacteria 20548
46 Ga0055543_1000038 3300004625 Bacteria 124032
47 Ga0065165_1000117 3300005262 Bacteria 134716
48 Ga0065707_10219170 3300005295 Bacteria 1232
49 Ga0070676_10022339 3300005328 Bacteria 3547
50 Ga0070676_10025379 3300005328 Bacteria 3350
51 Ga0070670_100026170 3300005331 Bacteria 5022
52 Ga0070670_100047641 3300005331 Bacteria 3688
53 Ga0070677_10010141 3300005333 Bacteria 3214
54 Ga0070677_10066040 3300005333 Bacteria 1507
55 Ga0070666_10008536 3300005335 Bacteria 6366
56 Ga0068868_100005862 3300005338 Bacteria 8667
57 Ga0070660_100028306 3300005339 Bacteria 4191
58 Ga0070661_100000086 3300005344 Bacteria 74801
59 Ga0070669_100043440 3300005353 Bacteria 3273
60 Ga0070675_100003180 3300005354 Bacteria 12427
61 Ga0070675_100024981 3300005354 Bacteria 4788
62 Ga0070671_100019225 3300005355 Bacteria 5558
63 Ga0070674_100066440 3300005356 Bacteria 2534
64 Ga0070673_100018078 3300005364 Bacteria 5029
65 Ga0070667_100041257 3300005367 Bacteria 3871
66 Ga0070667_100119620 3300005367 Bacteria 2290
67 Ga0070667_100286366 3300005367 Bacteria 1481
68 Ga0070700_100173676 3300005441 Bacteria 1494
69 Ga0070708_100421982 3300005445 Bacteria 1258
70 Ga0070663_100000008 3300005455 Bacteria 188775
71 Ga0070663_100117202 3300005455 Bacteria 2008
72 Ga0070678_100028471 3300005456 Bacteria 3811
73 Ga0070678_100355146 3300005456 Bacteria 1261
74 Ga0070662_100032991 3300005457 Bacteria 3643
75 Ga0068867_100044856 3300005459 Bacteria 3240
76 Ga0070707_100033508 3300005468 Bacteria 4899
77 Ga0068853_100222086 3300005539 Bacteria 1726
78 Ga0070672_100093643 3300005543 Bacteria 2428
79 Ga0070686_100214341 3300005544 Bacteria 1388
80 Ga0070665_100005314 3300005548 Bacteria 13303
81 Ga0068855_100002159 3300005563 Bacteria 24312
82 Ga0068855_100005393 3300005563 Bacteria 15602
83 Ga0070664_100000009 3300005564 Bacteria 166396
84 Ga0068857_100011248 3300005577 Bacteria 7781
85 Ga0068857_100076197 3300005577 Bacteria 2991
86 Ga0068857_100088447 3300005577 Bacteria 2771
87 Ga0068854_100000024 3300005578 Bacteria 124310
88 Ga0068854_100084113 3300005578 Bacteria 2354
89 Ga0068856_100000019 3300005614 Bacteria 150500
90 Ga0068856_100073614 3300005614 Bacteria 3382
91 Ga0068852_100082745 3300005616 Bacteria 2853
92 Ga0068852_100156478 3300005616 Bacteria 2123
93 Ga0068859_100000133 3300005617 Bacteria 70133
94 Ga0068859_100043840 3300005617 Bacteria 4496
95 Ga0068864_100001250 3300005618 Bacteria 21104
96 Ga0068866_10036697 3300005718 Bacteria 2402
97 Ga0068866_10101057 3300005718 Bacteria 1591
98 Ga0068866_10282877 3300005718 Bacteria 1028
99 Ga0068851_10158668 3300005834 Bacteria 1241
100 Ga0068863_100005731 3300005841 Bacteria 12192
101 Ga0068858_100002132 3300005842 Bacteria 20043
102 Ga0068858_100192128 3300005842 Bacteria 1929
103 Ga0068860_100061058 3300005843 Bacteria 3581
104 Ga0068862_100013318 3300005844 Bacteria 6803
105 Ga0068862_100077746 3300005844 Bacteria 2874
106 Ga0068862_100409347 3300005844 Bacteria 1270
107 Ga0075368_10006655 3300006042 Bacteria 4052
108 Ga0075368_10018365 3300006042 Bacteria 2628
109 Ga0075368_10113430 3300006042 Bacteria 1118
110 Ga0075363_100014803 3300006048 Bacteria 3822
111 Ga0075364_10003498 3300006051 Bacteria 8939
112 Ga0075364_10011010 3300006051 Bacteria 5486
113 Ga0075362_10006536 3300006177 Bacteria 4353
114 Ga0075362_10028681 3300006177 Bacteria 2392
115 Ga0075362_10070784 3300006177 Bacteria 1593
116 Ga0075367_10004846 3300006178 Bacteria 6631
117 Ga0075367_10005944 3300006178 Bacteria 6125
118 Ga0075367_10017103 3300006178 Bacteria 3974
119 Ga0075367_10248397 3300006178 Bacteria 1115
120 Ga0075369_10015092 3300006186 Bacteria 3096
121 Ga0075366_10002580 3300006195 Bacteria 9314
122 Ga0075366_10003197 3300006195 Bacteria 8592
123 Ga0075366_10009381 3300006195 Bacteria 5461
124 Ga0075366_10037856 3300006195 Bacteria 2849
125 Ga0075366_10058362 3300006195 Bacteria 2292
126 Ga0075366_10060910 3300006195 Bacteria 2242
127 Ga0075366_10069603 3300006195 Bacteria 2095
128 Ga0075366_10126576 3300006195 Bacteria 1541
129 Ga0097621_100026446 3300006237 Bacteria 4552
130 Ga0075370_10001421 3300006353 Bacteria 10366
131 Ga0075370_10002322 3300006353 Bacteria 8785
132 Ga0075370_10004186 3300006353 Bacteria 6963
133 Ga0075370_10008164 3300006353 Bacteria 5373
134 Ga0075370_10018172 3300006353 Bacteria 3810
135 Ga0075370_10022238 3300006353 Bacteria 3480
136 Ga0075370_10127081 3300006353 Bacteria 1486
137 Ga0068871_100028383 3300006358 Bacteria 4386
138 Ga0075428_100117122 3300006844 Bacteria 2902
139 Ga0075428_100231028 3300006844 Bacteria 1996
140 Ga0075433_10350460 3300006852 Bacteria 1305
141 Ga0075436_100083157 3300006914 Bacteria 2221
142 Ga0097620_100000133 3300006931 Bacteria 70133
143 Ga0097620_100043840 3300006931 Bacteria 4496
144 Ga0079104_1000981 3300006946 Bacteria 22291
145 Ga0079104_1009557 3300006946 Bacteria 3275
146 Ga0099826_10000021 3300006948 Bacteria 173580
147 Ga0105251_10000119 3300009011 Bacteria 79040
148 Ga0105251_10009294 3300009011 Bacteria 5819
149 Ga0105251_10011487 3300009011 Bacteria 5056
150 Ga0105251_10100281 3300009011 Bacteria 1324
151 Ga0105244_10000216 3300009036 Bacteria 59709
152 Ga0105244_10050773 3300009036 Bacteria 2115
153 Ga0105250_10001281 3300009092 Bacteria 13801
154 Ga0105240_10019531 3300009093 Bacteria 9051
155 Ga0105240_10194851 3300009093 Bacteria 2380
156 Ga0105240_10200358 3300009093 Bacteria 2340
157 Ga0105245_10006724 3300009098 Bacteria 10088
158 Ga0105245_10149100 3300009098 Bacteria 2210
159 Ga0105247_10000103 3300009101 Bacteria 90413
160 Ga0114129_10016285 3300009147 Bacteria 10582
161 Ga0105243_10733848 3300009148 Bacteria 966
162 Ga0105241_10000004 3300009174 Bacteria 803007
163 Ga0105248_10064141 3300009177 Bacteria 4124
164 Ga0105248_10094740 3300009177 Bacteria 3361
165 Ga0105248_10253180 3300009177 Bacteria 1982
166 Ga0105237_10005998 3300009545 Bacteria 13599
167 Ga0105237_10016397 3300009545 Bacteria 7700
168 Ga0105237_10051254 3300009545 Bacteria 4145
169 Ga0105237_10634643 3300009545 Bacteria 1075
170 Ga0105238_10000039 3300009551 Bacteria 161870
171 Ga0105238_10332945 3300009551 Bacteria 1505
172 Ga0105249_10265310 3300009553 Bacteria 1708
173 Ga0099796_10023884 3300010159 Bacteria 1914
174 Ga0105239_10003085 3300010375 Bacteria 20688
175 Ga0105239_10044552 3300010375 Bacteria 4863
176 Ga0105246_10152632 3300011119 Bacteria 1750
177 Ga0157373_10001832 3300013100 Bacteria 16186
178 Ga0157371_10003951 3300013102 Bacteria 13158
179 Ga0157370_10001398 3300013104 Bacteria 29918
180 Ga0157369_10000723 3300013105 Bacteria 42490
181 Ga0157369_10007814 3300013105 Bacteria 12310
182 Ga0157369_10045584 3300013105 Bacteria 4767
183 Ga0157374_10000699 3300013296 Bacteria 29519
184 Ga0157378_10082857 3300013297 Bacteria 2901
185 Ga0157378_10132119 3300013297 Bacteria 2312
186 Ga0157378_10394154 3300013297 Bacteria 1363
187 Ga0157375_10053321 3300013308 Bacteria 3979
188 Ga0157375_10373065 3300013308 Bacteria 1593
189 Ga0163163_10000957 3300014325 Bacteria 24512
190 Ga0157380_10037401 3300014326 Bacteria 3761
191 Ga0157380_10314794 3300014326 Bacteria 1448
192 Ga0182008_10001015 3300014497 Bacteria 19489
193 Ga0157379_10091696 3300014968 Bacteria 2725
194 Ga0182006_1000428 3300015261 Bacteria 33619
195 Ga0182007_10015494 3300015262 Bacteria 2841
196 Ga0163161_10000001 3300017792 Bacteria 2041488
197 Ga0154015_1301551 3300020610 Bacteria 16162
198 Ga0213872_10002397 3300021361 Bacteria 11068
199 Ga0213872_10006953 3300021361 Bacteria 5619
200 Ga0209435_100096 3300025206 Bacteria 38561
201 Ga0209436_100033 3300025208 Bacteria 80428
202 Ga0209784_100029 3300025224 Bacteria 347315
203 Ga0209784_100035 3300025224 Bacteria 299760
204 Ga0209784_100533 3300025224 Bacteria 14063
205 Ga0209784_100849 3300025224 Bacteria 6758
206 Ga0209566_100030 3300025225 Bacteria 347329
207 Ga0209566_100040 3300025225 Bacteria 299760
208 Ga0209566_100143 3300025225 Bacteria 84572
209 Ga0209674_100057 3300025226 Bacteria 299760
210 Ga0209674_100075 3300025226 Bacteria 216004
211 Ga0209674_100232 3300025226 Bacteria 49385
212 Ga0209674_103311 3300025226 Bacteria 3012
213 Ga0209672_100147 3300025228 Bacteria 63618
214 Ga0209672_110418 3300025228 Bacteria 1257
215 Ga0209147_100008 3300025229 Bacteria 777096
216 Ga0209563_100059 3300025230 Bacteria 299760
217 Ga0209563_100117 3300025230 Bacteria 132048
218 Ga0209563_102809 3300025230 Bacteria 3801
219 Ga0209563_116273 3300025230 Bacteria 917
220 Ga0209258_100013 3300025242 Bacteria 777096
221 Ga0209258_100124 3300025242 Bacteria 178883
222 Ga0207425_1022748 3300025245 Bacteria 1318
223 Ga0209646_1000046 3300025246 Bacteria 332737
224 Ga0209646_1000093 3300025246 Bacteria 183840
225 Ga0209026_1003869 3300025250 Bacteria 4717
226 Ga0209026_1004472 3300025250 Bacteria 4128
227 Ga0209677_100030 3300025253 Bacteria 347314
228 Ga0209677_100036 3300025253 Bacteria 299760
229 Ga0209677_101312 3300025253 Bacteria 11002
230 Ga0209148_1000110 3300025254 Bacteria 203536
231 Ga0209148_1002047 3300025254 Bacteria 7816
232 Ga0209148_1002586 3300025254 Bacteria 5970
233 Ga0209759_1000077 3300025256 Bacteria 175706
234 Ga0209759_1000248 3300025256 Bacteria 80537
235 Ga0209759_1000543 3300025256 Bacteria 39344
236 Ga0209759_1000652 3300025256 Bacteria 32306
237 Ga0209759_1009789 3300025256 Bacteria 2868
238 Ga0209565_1000015 3300025263 Bacteria 494091
239 Ga0209565_1000077 3300025263 Bacteria 161163
240 Ga0209455_1000114 3300025272 Bacteria 178883
241 Ga0209455_1000130 3300025272 Bacteria 161669
242 Ga0209673_1000017 3300025273 Bacteria 492994
243 Ga0209130_1000059 3300025284 Bacteria 204772
244 Ga0209130_1020390 3300025284 Bacteria 1518
245 Ga0209675_1000012 3300025291 Bacteria 494061
246 Ga0209675_1000065 3300025291 Bacteria 174791
247 Ga0209675_1000717 3300025291 Bacteria 22637
248 Ga0209675_1004584 3300025291 Bacteria 6090
249 Ga0209676_1000044 3300025292 Bacteria 416215
250 Ga0209676_1000383 3300025292 Bacteria 81259
251 Ga0209025_1001105 3300025294 Bacteria 38808
252 Ga0209025_1002071 3300025294 Bacteria 22775
253 Ga0209025_1004496 3300025294 Bacteria 12063
254 Ga0209025_1010692 3300025294 Bacteria 6176
255 Ga0209564_1000016 3300025295 Bacteria 613131
256 Ga0209564_1000080 3300025295 Bacteria 263547
257 Ga0209564_1000404 3300025295 Bacteria 76827
258 Ga0209564_1000643 3300025295 Bacteria 52864
259 Ga0209758_1022683 3300025297 Bacteria 2867
260 Ga0209050_1000952 3300025298 Bacteria 37637
261 Ga0209256_1000119 3300025299 Bacteria 168215
262 Ga0209256_1000127 3300025299 Bacteria 164393
263 Ga0209256_1000314 3300025299 Bacteria 84164
264 Ga0209051_1000259 3300025303 Bacteria 88311
265 Ga0209051_1002766 3300025303 Bacteria 12109
266 Ga0209051_1017508 3300025303 Bacteria 3200
267 Ga0209257_1000116 3300025304 Bacteria 228733
268 Ga0207656_10022496 3300025321 Bacteria 2530
269 Ga0207696_1000001 3300025711 Bacteria 2579611
270 Ga0207713_1000024 3300025735 Bacteria 339156
271 Ga0207713_1000026 3300025735 Bacteria 319032
272 Ga0207713_1068833 3300025735 Bacteria 1314
273 Ga0207682_10007326 3300025893 Bacteria 4401
274 Ga0207710_10000140 3300025900 Bacteria 83223
275 Ga0207688_10010878 3300025901 Bacteria 4952
276 Ga0207680_10045672 3300025903 Bacteria 2584
277 Ga0207685_10074152 3300025905 Bacteria 1388
278 Ga0207645_10037393 3300025907 Bacteria 3114
279 Ga0207645_10158265 3300025907 Bacteria 1481
280 Ga0207645_10212918 3300025907 Bacteria 1273
281 Ga0207684_10033155 3300025910 Bacteria 4393
282 Ga0207654_10000006 3300025911 Bacteria 815027
283 Ga0207695_10004909 3300025913 Bacteria 18019
284 Ga0207695_10011481 3300025913 Bacteria 10721
285 Ga0207695_10034685 3300025913 Bacteria 5483
286 Ga0207695_10260303 3300025913 Bacteria 1632
287 Ga0207671_10027562 3300025914 Bacteria 4248
288 Ga0207671_10059521 3300025914 Bacteria 2833
289 Ga0207657_10064898 3300025919 Bacteria 3114
290 Ga0207649_10000081 3300025920 Bacteria 82217
291 Ga0207646_10378292 3300025922 Bacteria 1279
292 Ga0207681_10011021 3300025923 Bacteria 5552
293 Ga0207694_10000072 3300025924 Bacteria 118962
294 Ga0207650_10039869 3300025925 Bacteria 3434
295 Ga0207650_10072200 3300025925 Bacteria 2598
296 Ga0207650_10545901 3300025925 Bacteria 971
297 Ga0207659_10001021 3300025926 Bacteria 16643
298 Ga0207659_10023971 3300025926 Bacteria 4082
299 Ga0207687_10020882 3300025927 Bacteria 4346
300 Ga0207687_10301685 3300025927 Bacteria 1290
301 Ga0207706_10081419 3300025933 Bacteria 2845
302 Ga0207706_10229926 3300025933 Bacteria 1623
303 Ga0207709_10293295 3300025935 Bacteria 1206
304 Ga0207709_10453106 3300025935 Bacteria 992
305 Ga0207669_10146335 3300025937 Bacteria 1648
306 Ga0207669_10483764 3300025937 Bacteria 987
307 Ga0207704_10045950 3300025938 Bacteria 2598
308 Ga0207665_10031054 3300025939 Bacteria 3534
309 Ga0207691_10056292 3300025940 Bacteria 3582
310 Ga0207711_10207181 3300025941 Bacteria 1791
311 Ga0207689_10070370 3300025942 Bacteria 2874
312 Ga0207689_10521481 3300025942 Bacteria 996
313 Ga0207679_10000004 3300025945 Bacteria 589021
314 Ga0207667_10000066 3300025949 Bacteria 185903
315 Ga0207667_10005459 3300025949 Bacteria 15496
316 Ga0207667_10007628 3300025949 Bacteria 12965
317 Ga0207651_10014917 3300025960 Bacteria 4500
318 Ga0207640_10000066 3300025981 Bacteria 86479
319 Ga0207640_10063764 3300025981 Bacteria 2450
320 Ga0207658_10017873 3300025986 Bacteria 4887
321 Ga0207658_10291190 3300025986 Bacteria 1403
322 Ga0207658_10594793 3300025986 Bacteria 993
323 Ga0207677_10003261 3300026023 Bacteria 8570
324 Ga0207677_10033011 3300026023 Bacteria 3333
325 Ga0207703_10007217 3300026035 Bacteria 8839
326 Ga0207639_10080108 3300026041 Bacteria 2582
327 Ga0207639_10275038 3300026041 Bacteria 1479
328 Ga0207678_10000006 3300026067 Bacteria 188733
329 Ga0207678_10059582 3300026067 Bacteria 3285
330 Ga0207678_10944745 3300026067 Bacteria 763
331 Ga0207708_10309249 3300026075 Bacteria 1287
332 Ga0207702_10000317 3300026078 Bacteria 55259
333 Ga0207702_10075820 3300026078 Bacteria 2906
334 Ga0207641_10190701 3300026088 Bacteria 1884
335 Ga0207648_10058131 3300026089 Bacteria 3373
336 Ga0207648_10061349 3300026089 Bacteria 3279
337 Ga0207648_10065906 3300026089 Bacteria 3158
338 Ga0207676_10005979 3300026095 Bacteria 8579
339 Ga0207674_10018093 3300026116 Bacteria 7670
340 Ga0207674_10041960 3300026116 Bacteria 4728
341 Ga0207674_10064054 3300026116 Bacteria 3708
342 Ga0207683_10022244 3300026121 Bacteria 5440
343 Ga0207698_10053002 3300026142 Bacteria 3111
344 Ga0209281_1000008 3300027111 Bacteria 867470
345 Ga0209371_1024222 3300027312 Bacteria 1415
346 Ga0209179_1012174 3300027512 Bacteria 1540
347 Ga0209282_1000019 3300027666 Bacteria 184034
348 Ga0209813_10028659 3300027866 Bacteria 1625
349 Ga0268266_10018467 3300028379 Bacteria 5943
350 Ga0268265_10088690 3300028380 Bacteria 2465
351 Ga0268265_10559453 3300028380 Bacteria 1087
352 Ga0268264_10051066 3300028381 Bacteria 3445
353 Ga0307517_10108637 3300028786 Bacteria 2128
354 Ga0307515_10000090 3300028794 Bacteria 215043
355 Ga0307515_10055679 3300028794 Bacteria 5771
356 Ga0268256_1027533 3300030500 Bacteria 1415
357 Ga0307512_10065819 3300030522 Bacteria 2743
358 Ga0307512_10084168 3300030522 Bacteria 2263
359 Ga0265331_10018700 3300031250 Bacteria 3587
360 Ga0307513_10066933 3300031456 Bacteria 3772
361 Ga0307513_10101827 3300031456 Bacteria 2893
362 Ga0307513_10463410 3300031456 Bacteria 990
363 Ga0307509_10012445 3300031507 Bacteria 10177
364 Ga0307509_10014214 3300031507 Bacteria 9376
365 Ga0307509_10022560 3300031507 Bacteria 7092
366 Ga0307509_10153052 3300031507 Bacteria 2218
367 Ga0307408_100001072 3300031548 Bacteria 20974
368 Ga0307508_10000204 3300031616 Bacteria 71518
369 Ga0307508_10015442 3300031616 Bacteria 6955
370 Ga0307514_10030723 3300031649 Bacteria 4311
371 Ga0307514_10261641 3300031649 Bacteria 1012
372 Ga0265314_10004469 3300031711 Bacteria 12969
373 Ga0307516_10115391 3300031730 Bacteria 2481
374 Ga0307516_10370432 3300031730 Bacteria 1095
375 Ga0307518_10401184 3300031838 Bacteria 765
376 Ga0307409_100240448 3300031995 Bacteria 1648
377 Ga0373930_0054339 3300034816 Bacteria 881
378 Ga0373934_0016237 3300035086 Bacteria 2830
379 Ga0373923_0037327 3300035111 Bacteria 1987
380 Ga0373936_0045157 3300035113 Bacteria 1774
381 Ga0373953_0002534 3300035117 Bacteria 5519
382 Ga0373953_0052967 3300035117 Bacteria 1643
383 Ga0373954_0001622 3300035118 Bacteria 9199
384 Ga0373956_0041514 3300035119 Bacteria 2042
385 Ga0373955_0007992 3300035172 Bacteria 4888
386 Ga0373924_0048578 3300035410 Bacteria 1753
387 Ga0373931_0021864 3300035691 Bacteria 3213
388 Ga0373935_0156296 3300035692 Bacteria 1551
389 Ga0373927_0088815 3300035695 Bacteria 2007
390 Ga0373933_0143550 3300035724 Bacteria 1508
391 Ga0395899_0012785 3300037312 Bacteria 6431
392 Ga0395900_0002388 3300037418 Bacteria 20734
393 Ga0395900_0005683 3300037418 Bacteria 13040
394 Ga0395898_0246500 3300037466 Bacteria 1704
395 Ga0395905_0076340 3300037471 Bacteria 3140
396 Ga0395905_0281177 3300037471 Bacteria 1550
397 Ga0395901_0019835 3300038443 Bacteria 6877
398 Ga0436365_0404413 3300039437 Bacteria 2699
399 Ga0436361_0298749 3300039447 Bacteria 31426
400 Ga0436361_0417552 3300039447 Bacteria 13691
401 Ga0436363_0102659 3300039450 Bacteria 2718
402 Ga0451802_0204181 3300041460 Bacteria 846
403 Ga0466986_0020637 3300044650 Bacteria 4343
404 Ga0466965_0060143 3300044683 Bacteria 1897
405 Ga0466964_0010177 3300044706 Bacteria 3545
406 Ga0466957_0186962 3300044842 Bacteria 1355
407 Ga0451576_0000219 3300045051 Bacteria 141949
408 Ga0451576_1022860 3300045051 Bacteria 866
409 Ga0466958_0568108 3300045836 Bacteria 737
410 Ga0466967_0037796 3300045976 Bacteria 4135
411 Ga0495627_000018 3300046453 Bacteria 315125
412 Ga0495592_0043346 3300046454 Bacteria 3366
413 Ga0495603_0091264 3300046455 Bacteria 1781
414 Ga0495603_0278203 3300046455 Bacteria 962
415 Ga0495590_0005074 3300046457 Bacteria 5251
416 Ga0495590_0005591 3300046457 Bacteria 4963
417 Ga0495638_0031939 3300046460 Bacteria 3381
418 Ga0495638_0038165 3300046460 Bacteria 3054
419 Ga0495638_0368939 3300046460 Bacteria 753
420 Ga0495651_0007885 3300046462 Bacteria 8157
421 Ga0495651_0041968 3300046462 Bacteria 3553
422 Ga0495653_0001329 3300046463 Bacteria 19191
423 Ga0495653_0281795 3300046463 Bacteria 1090
424 Ga0495653_0312402 3300046463 Bacteria 1021
425 Ga0495650_0000067 3300046471 Bacteria 269882
426 Ga0495650_0001377 3300046471 Bacteria 23996
427 Ga0495650_0006331 3300046471 Bacteria 7401
428 Ga0495650_0098159 3300046471 Bacteria 1103
429 Ga0495580_0000022 3300046472 Bacteria 89749
430 Ga0495580_0013347 3300046472 Bacteria 6275
431 Ga0495580_0070401 3300046472 Bacteria 2443
432 Ga0495605_0000338 3300046474 Bacteria 46528
433 Ga0495605_0001573 3300046474 Bacteria 14825
434 Ga0495605_0005932 3300046474 Bacteria 7062
435 Ga0495605_0023002 3300046474 Bacteria 3283
436 Ga0495639_0100021 3300046475 Bacteria 1368
437 Ga0495664_0034872 3300046477 Bacteria 2961
438 Ga0495584_0037839 3300046491 Bacteria 2439
439 Ga0495585_0000541 3300046492 Bacteria 35747
440 Ga0495585_0151390 3300046492 Bacteria 1209
441 Ga0495596_0000064 3300046500 Bacteria 77744
442 Ga0495596_0007244 3300046500 Bacteria 5018
443 Ga0495596_0012851 3300046500 Bacteria 3571
444 Ga0495607_0007594 3300046501 Bacteria 7478
445 Ga0495583_0009912 3300046506 Bacteria 5633
446 Ga0495583_0057647 3300046506 Bacteria 1745
447 Ga0495583_0092295 3300046506 Bacteria 1302
448 Ga0495606_0000873 3300046507 Bacteria 45086
449 Ga0495606_0085957 3300046507 Bacteria 1944
450 Ga0495606_0123541 3300046507 Bacteria 1546
451 Ga0495606_0172866 3300046507 Bacteria 1252
452 Ga0495608_0068548 3300046511 Bacteria 2319
453 Ga0495610_0000012 3300046512 Bacteria 517442
454 Ga0495610_0000545 3300046512 Bacteria 37663
455 Ga0495610_0138379 3300046512 Bacteria 1050
456 Ga0495616_0019456 3300046513 Bacteria 3705
457 Ga0495618_0027335 3300046514 Bacteria 3551
458 Ga0495620_0010312 3300046515 Bacteria 4931
459 Ga0495628_0023140 3300046516 Bacteria 5102
460 Ga0495628_0044505 3300046516 Bacteria 3531
461 Ga0495628_0163218 3300046516 Bacteria 1692
462 Ga0495630_0004503 3300046517 Bacteria 9760
463 Ga0495630_0007646 3300046517 Bacteria 7729
464 Ga0495630_0038278 3300046517 Bacteria 3587
465 Ga0495630_0129848 3300046517 Bacteria 1913
466 Ga0495632_0005360 3300046519 Bacteria 8492
467 Ga0495637_0042020 3300046520 Bacteria 1958
468 Ga0495643_0081534 3300046522 Bacteria 1682
469 Ga0495643_0099290 3300046522 Bacteria 1494
470 Ga0495648_0000488 3300046524 Bacteria 42550
471 Ga0495648_0015815 3300046524 Bacteria 5455
472 Ga0495648_0133194 3300046524 Bacteria 1318
473 Ga0495648_0235193 3300046524 Bacteria 894
474 Ga0495648_0261869 3300046524 Bacteria 829
475 Ga0495666_0000640 3300046526 Bacteria 15782
476 Ga0495666_0000647 3300046526 Bacteria 15640
477 Ga0495666_0031773 3300046526 Bacteria 2587
478 Ga0495642_0025633 3300046528 Bacteria 2338
479 Ga0495642_0047751 3300046528 Bacteria 1754
480 Ga0495652_0056516 3300046529 Bacteria 3332
481 Ga0495652_0305205 3300046529 Bacteria 1155
482 Ga0495654_0000179 3300046530 Bacteria 62287
483 Ga0495665_0000343 3300046531 Bacteria 23520
484 Ga0495665_0005986 3300046531 Bacteria 6556
485 Ga0495665_0070081 3300046531 Bacteria 1848
486 Ga0495640_0016185 3300046533 Bacteria 5582
487 Ga0495586_0211055 3300046535 Bacteria 1102
488 Ga0495587_0082338 3300046536 Bacteria 1865
489 Ga0495587_0172481 3300046536 Bacteria 1228
490 Ga0495609_0001589 3300046538 Bacteria 14847
491 Ga0495609_0195937 3300046538 Bacteria 846
492 Ga0495656_0014508 3300046615 Bacteria 2956
493 Ga0495668_0133670 3300046616 Bacteria 1358
494 Ga0495634_0018730 3300046642 Bacteria 4924
495 Ga0495634_0038615 3300046642 Bacteria 3254
496 Ga0495634_0191529 3300046642 Bacteria 1275
497 Ga0495611_0036848 3300046648 Bacteria 2172
498 Ga0495625_0004802 3300046660 Bacteria 12639
499 Ga0495625_0328673 3300046660 Bacteria 972
500 Ga0495661_0000010 3300046665 Bacteria 284261
501 Ga0495661_0014051 3300046665 Bacteria 5367
502 Ga0495661_0027807 3300046665 Bacteria 3627
503 Ga0495661_0110498 3300046665 Bacteria 1533
504 Ga0495657_0292533 3300046675 Bacteria 972
505 Ga0495599_0036083 3300046678 Bacteria 3103
506 Ga0495599_0094493 3300046678 Bacteria 1865
507 Ga0495599_0265830 3300046678 Bacteria 1041
508 Ga0495623_0030411 3300046679 Bacteria 3473
509 Ga0495646_0047046 3300046680 Bacteria 2628
510 Ga0495658_0009089 3300046683 Bacteria 4941
511 Ga0495658_0038342 3300046683 Bacteria 2653
512 Ga0495613_0093372 3300046689 Bacteria 2178
513 Ga0495624_0000591 3300046690 Bacteria 28234
514 Ga0495624_0003991 3300046690 Bacteria 10858
515 Ga0495624_0006876 3300046690 Bacteria 8031
516 Ga0495624_0027630 3300046690 Bacteria 3714
517 Ga0495624_0139487 3300046690 Bacteria 1486
518 Ga0495670_0125945 3300046691 Bacteria 1333
519 Ga0495671_0000006 3300046692 Bacteria 500471
520 Ga0495671_0002046 3300046692 Bacteria 12914
521 Ga0495671_0024517 3300046692 Bacteria 3141
522 Ga0495671_0199409 3300046692 Bacteria 971
523 Ga0495649_0014012 3300046694 Bacteria 4610
524 Ga0495649_0024624 3300046694 Bacteria 3355
525 Ga0495589_0000002 3300046794 Bacteria 758846
526 Ga0495589_0159891 3300046794 Bacteria 1073
527 Ga0495600_0049868 3300046809 Bacteria 2731
528 Ga0495600_0237127 3300046809 Bacteria 1163
529 Ga0495581_0030225 3300047315 Bacteria 3140
530 Ga0495604_0047540 3300047317 Bacteria 3341
531 Ga0495604_0105019 3300047317 Bacteria 2068
532 Ga0495636_0022136 3300047318 Bacteria 2568
533 Ga0495674_0002270 3300047319 Bacteria 18876
534 Ga0495674_0003547 3300047319 Bacteria 15166
535 Ga0495674_0017065 3300047319 Bacteria 6762
536 Ga0495674_0392107 3300047319 Bacteria 1122
537 Ga0495672_0024400 3300047320 Bacteria 3896
538 Ga0495672_0120052 3300047320 Bacteria 1398
539 Ga0495676_0013598 3300047321 Bacteria 7308
540 Ga0495676_0027523 3300047321 Bacteria 4872
541 Ga0495676_0127291 3300047321 Bacteria 1844
542 Ga0495676_0231914 3300047321 Bacteria 1267
543 Ga0495680_0066087 3300047322 Bacteria 2768
544 Ga0495680_0082056 3300047322 Bacteria 2433
545 Ga0495683_0012249 3300047323 Bacteria 4505
546 Ga0495683_0012638 3300047323 Bacteria 4433
547 Ga0495687_001305 3300047443 Bacteria 23391
548 Ga0495687_004784 3300047443 Bacteria 8936
549 Ga0495687_069145 3300047443 Bacteria 1423
550 Ga0495675_0016284 3300047444 Bacteria 4703
551 Ga0495675_0016313 3300047444 Bacteria 4698
552 Ga0495675_0052393 3300047444 Bacteria 2591
553 Ga0495679_000022 3300047446 Bacteria 215296
554 Ga0495679_000063 3300047446 Bacteria 103758
555 Ga0495679_021066 3300047446 Bacteria 2259
556 Ga0495673_0007417 3300047469 Bacteria 6307
557 Ga0495673_0113417 3300047469 Bacteria 1081
558 Ga0495684_0065247 3300047471 Bacteria 2768
559 Ga0495684_0081512 3300047471 Bacteria 2455
560 Ga0495686_0000906 3300047472 Bacteria 37300
561 Ga0495686_0016430 3300047472 Bacteria 5019
562 Ga0495686_0155448 3300047472 Bacteria 1340
563 Ga0495593_0020498 3300047673 Bacteria 3703
564 Ga0495593_0045729 3300047673 Bacteria 2335
565 Ga0495602_0201405 3300048088 Bacteria 1518
566 Ga0495626_0222237 3300048091 Bacteria 767
567 Ga0496103_0018389 3300048906 Bacteria 4192
568 Ga0496103_0285745 3300048906 Bacteria 1061
569 Ga0496104_0506870 3300048907 Bacteria 1118
570 Ga0496106_0000009 3300048909 Bacteria 238601
571 Ga0496108_0048166 3300048911 Bacteria 3563
572 Ga0496109_0115094 3300048912 Bacteria 2502
573 Ga0496112_0761572 3300048915 Bacteria 894
574 Ga0496116_0000023 3300048919 Bacteria 475792
575 Ga0496116_0019948 3300048919 Bacteria 5111
576 Ga0496117_0000463 3300048920 Bacteria 67832
577 Ga0496117_0004391 3300048920 Bacteria 15625
578 Ga0496117_0047596 3300048920 Bacteria 3073
579 Ga0496117_0065741 3300048920 Bacteria 2463
580 Ga0496118_0016438 3300048921 Bacteria 6788
581 Ga0496118_0039111 3300048921 Bacteria 3789
582 Ga0496119_0001547 3300048922 Bacteria 27462
583 Ga0496119_0006664 3300048922 Bacteria 10622
584 Ga0496120_0000052 3300048923 Bacteria 186071
585 Ga0496120_0001403 3300048923 Bacteria 29166
586 Ga0496121_0002315 3300048924 Bacteria 29518
587 Ga0496121_0018569 3300048924 Bacteria 7004
588 Ga0496121_0020758 3300048924 Bacteria 6477
589 Ga0496121_0051649 3300048924 Bacteria 3460
590 Ga0496121_0077937 3300048924 Bacteria 2637
591 Ga0496121_0082005 3300048924 Bacteria 2551
592 Ga0496121_0373910 3300048924 Bacteria 942
593 Ga0496122_0005874 3300048925 Bacteria 14380
594 Ga0496123_0002314 3300048926 Bacteria 23928
595 Ga0496123_0297012 3300048926 Bacteria 773
596 Ga0496124_0000017 3300048927 Bacteria 444389
597 Ga0496124_0024477 3300048927 Bacteria 5487
598 Ga0496125_0002936 3300048928 Bacteria 21466
599 Ga0496125_0077506 3300048928 Bacteria 2562
600 Ga0496126_0000099 3300048929 Bacteria 204249
601 Ga0496126_0000414 3300048929 Bacteria 86330
602 Ga0496126_0008498 3300048929 Bacteria 11062
603 Ga0496126_0043863 3300048929 Bacteria 4122
604 Ga0496126_0101735 3300048929 Bacteria 2513
605 Ga0496126_0266554 3300048929 Bacteria 1423
606 Ga0496126_0739240 3300048929 Bacteria 761
607 Ga0495678_013915 3300049459 Bacteria 3760
608 Ga0495678_024271 3300049459 Bacteria 2620
609 Ga0495682_0016744 3300049460 Bacteria 2773
610 Ga0495682_0081158 3300049460 Bacteria 1166
611 Ga0501031_0000078 3300049568 Bacteria 51307
612 Ga0501032_0000153 3300049569 Bacteria 55592
613 Ga0501033_0002228 3300049570 Bacteria 16673
614 Ga0501034_0000178 3300049571 Bacteria 118886
615 Ga0501034_0001831 3300049571 Bacteria 26995
616 Ga0501036_0000044 3300049572 Bacteria 78673
617 Ga0501037_0000206 3300049573 Bacteria 52615
618 Ga0501037_0455315 3300049573 Bacteria 872
619 Ga0501038_0000071 3300049574 Bacteria 83962
620 Ga0501039_0000104 3300049575 Bacteria 56961
621 Ga0501040_0001995 3300049576 Bacteria 13159
622 Ga0501043_0000134 3300049579 Bacteria 68845
623 Ga0501047_0000364 3300049581 Bacteria 51328
624 Ga0501068_0143384 3300049584 Bacteria 1498
625 Ga0501035_0000379 3300049822 Bacteria 51213
626 Ga0501044_0000194 3300049823 Bacteria 76727
627 Ga0501045_0067547 3300049824 Bacteria 2626
628 nmdc:mga03683_20798_c1 3300050489 Bacteria 2523
629 nmdc:mga03683_8634_c1 3300050489 Bacteria 3590
630 nmdc:mga03683_89068_c1 3300050489 Bacteria 1343
631 nmdc:mga03n38_23716_c1 3300050490 Bacteria 2500
632 nmdc:mga03n38_69885_c1 3300050490 Bacteria 1623
633 nmdc:mga03n38_85091_c1 3300050490 Bacteria 1494
634 nmdc:mga0yw44_36795_c1 3300050492 Bacteria 2886
635 nmdc:mga0yw44_422215_c1 3300050492 Bacteria 903
636 nmdc:mga0k408_107216_c1 3300050493 Bacteria 1650
637 nmdc:mga0k408_15631_c2 3300050493 Bacteria 3392
638 nmdc:mga0k408_16156_c1 3300050493 Bacteria 4138
639 nmdc:mga0k408_3449_c1 3300050493 Bacteria 8373
640 nmdc:mga0k408_3650_c1 3300050493 Bacteria 8147
641 nmdc:mga0k408_4851_c1 3300050493 Bacteria 7136
642 nmdc:mga0k408_5689_c1 3300050493 Bacteria 6629
643 nmdc:mga06z11_14019_c1 3300050494 Bacteria 3537
644 nmdc:mga06z11_141457_c1 3300050494 Bacteria 1361
645 nmdc:mga06z11_417217_c1 3300050494 Bacteria 809
646 nmdc:mga07m45_1253_c1 3300050496 Bacteria 11546
647 nmdc:mga07m45_12928_c1 3300050496 Bacteria 4417
648 nmdc:mga07m45_28763_c1 3300050496 Bacteria 3068
649 nmdc:mga07m45_49009_c1 3300050496 Bacteria 2377
650 nmdc:mga07m45_8279_c1 3300050496 Bacteria 5337
651 nmdc:mga07m45_8482_c1 3300050496 Bacteria 5287
652 nmdc:mga07m45_874_c1 3300050496 Bacteria 13122
653 nmdc:mga05p37_60980_c1 3300050507 Bacteria 2652
654 nmdc:mga0n895_298049_c1 3300050512 Bacteria 1634
655 nmdc:mga08x19_6767_c1 3300050514 Bacteria 6807
656 nmdc:mga08x19_71667_c1 3300050514 Bacteria 2259
657 nmdc:mga0sz30_135896_c1 3300050516 Bacteria 1085
658 nmdc:mga0sz30_8183_c2 3300050516 Bacteria 3356
659 Ga0495601_0002885 3300053077 Bacteria 9782
660 Ga0500578_0011098 3300053086 Bacteria 5822
661 Ga0500578_0227963 3300053086 Bacteria 1130
662 Ga0500651_0222487 3300053093 Bacteria 1106
663 Ga0500618_050777 3300053125 Bacteria 939
664 Ga0500658_0002381 3300053134 Bacteria 7285
665 Ga0500568_0013094 3300053139 Bacteria 3793
666 Ga0500637_0120390 3300053178 Bacteria 1523
667 Ga0500645_001807 3300053730 Bacteria 10238
668 Ga0500645_013146 3300053730 Bacteria 2663
669 2643906132 2643221579 Bacteria 4443405
670 2510249133 2510065045 Bacteria 7761063
671 2510281047 2510065053 Bacteria 5005518
672 2510294822 2510065055 Bacteria 5037935
673 2510309195 2510065058 Bacteria 5005894
674 2511248908 2511231003 Bacteria 5606035
675 2511249734 2511231003 Bacteria 5606035
676 2513568685 2513237084 Bacteria 7231967
677 2513955538 2513237150 Bacteria 6553639
678 2514040884 2513237165 Bacteria 6771773
679 2553005838 2551306416 Bacteria 6152985
680 2599445051 2599185178 Bacteria 5365746
681 2608380773 2606217733 Bacteria 6360972
682 2644302857 2643221654 Bacteria 5273570
683 2644400371 2643221672 Bacteria 6322190
684 2656277424 2654587920 Bacteria 5475511
685 2656279125 2654587920 Bacteria 5475511
686 2689444015 2687453601 Bacteria 5546041
687 2719642458 2718217991 Bacteria 7829542
688 2739293266 2738543021 Bacteria 5718241
689 2765571699 2765235838 Bacteria 5445269
690 2774131987 2773857672 Bacteria 4993178
691 2807179565 2806310673 Bacteria 4801221
692 2808984308 2808606386 Bacteria 4471946
693 2809130661 2808606415 Bacteria 4576710
694 2809149861 2808606419 Bacteria 4576925
695 2819618569 2818991449 Bacteria 5518009
696 2834644347 2834641062 Bacteria 5559922
697 2838684803 2838680041 Bacteria 6545511
698 2838698964 2838694306 Bacteria 6853137
699 2838712156 2838707686 Bacteria 6619912
700 2839098612 2839094727 Bacteria 5534556
701 2842122555 2842118031 Bacteria 7033875
702 2842241568 2842237096 Bacteria 6620661
703 2842295922 2842291075 Bacteria 7076806
704 2842374197 2842370503 Bacteria 7038661
705 2842382326 2842377471 Bacteria 7140707
706 2842389103 2842384541 Bacteria 7057858
707 2842806010 2842805378 Bacteria 5385175
708 2852619997 2852618963 Bacteria 4577824
709 2855736454 2855730933 Bacteria 7047938
710 2855773391 2855767633 Bacteria 7049357
711 2858696270 2858688981 Bacteria 8184122
712 2888368064 2888366609 Bacteria 5155009
713 2900580572 2900577576 Bacteria 5438534
714 2900638536 2900634093 Bacteria 10263517
715 2901303032 2901300506 Bacteria 8463898
716 2904429351 2904424332 Bacteria 7633521
717 2904444289 2904439833 Bacteria 5931679
718 2904533894 2904530477 Bacteria 5876334
719 2904589272 2904584206 Bacteria 6028872
720 2904594974 2904589729 Bacteria 6113573
721 2904606551 2904601388 Bacteria 5884906
722 2917834958 2917832318 Bacteria 5346010
723 2919051114 2919046199 Bacteria 5567169
724 2919084507 2919079590 Bacteria 5946433
725 2919128708 2919125081 Bacteria 5385106
726 2919503458 2919501602 Bacteria 5286340
727 2926065971 2926063275 Bacteria 5285848
728 2928060214 2928058823 Bacteria 5520022
729 2935898882 2935894831 Bacteria 6620579
730 2974301052 2974298342 Bacteria 4840922
731 2984503526 2984499530 Bacteria 5020881
732 2984507996 2984504281 Bacteria 5262371
733 640937030 640753048 Bacteria 5495657
734 642615482 642555113 Bacteria 8214658
735 642621075 642555113 Bacteria 8214658
736 644751488 644736347 Bacteria 6476522
737 8003404247 8003400568 Bacteria 5535898
738 8015394872 8015394850 Bacteria 5064660
739 8016729827 8016728285 Bacteria 5263933
740 8018154115 8018150411 Bacteria 5549903
741 8033234533 8033232454 Bacteria 3202805
742 8055307746 8055301274 Bacteria 8587385
743 JGI24741J21665_1000369
744 JGI24740J21852_10001501
745 JGI24740J21852_10008613
746 JGI25156J39149_1000226
747 JGI25156J39149_1000457
748 JGI25156J39149_1002321
749 JGI25156J39149_1014190
750 JGI25154J39366_1000925
751 JGI25154J39366_1002083
752 JGI25158J39367_1000006
753 JGI25159J45721_1000955
754 JGI25151J46595_10000868
755 JGI25151J46595_10006764
756 rootH2_10125873
757 rootH1_10161873
758 JGI25161J50226_1000052
759 Ga0055538_1002531
760 Ga0055539_1000078
761 Ga0055539_1000104
762 Ga0055533_1000084
763 Ga0055533_1000946
764 Ga0055525_1000112
765 Ga0055525_1000245
766 Ga0055535_1000229
767 Ga0055542_1002814
768 Ga0055529_1000064
769 Ga0055526_1000193
770 Ga0055526_1000563
771 Ga0055526_1003347
772 Ga0055526_1009481
773 Ga0055537_1000060
774 Ga0055537_1000514
775 Ga0055524_1000263
776 Ga0055524_1009149
777 Ga0055524_1011593
778 Ga0055536_1000195
779 Ga0055534_1000009
780 Ga0055534_1000710
781 Ga0055534_1000845
782 Ga0055528_1000012
783 Ga0055530_10011488
784 Ga0055540_1000365
785 Ga0055531_10000454
786 Ga0055541_1000055
787 Ga0055541_1000236
788 Ga0055543_1000038
789 Ga0065165_1000117
790 Ga0065707_10219170
791 Ga0070676_10022339
792 Ga0070676_10025379
793 Ga0070670_100026170
794 Ga0070670_100047641
795 Ga0070677_10010141
796 Ga0070677_10066040
797 Ga0070666_10008536
798 Ga0068868_100005862
799 Ga0070660_100028306
800 Ga0070661_100000086
801 Ga0070669_100043440
802 Ga0070675_100003180
803 Ga0070675_100024981
804 Ga0070671_100019225
805 Ga0070674_100066440
806 Ga0070673_100018078
807 Ga0070667_100041257
808 Ga0070667_100119620
809 Ga0070667_100286366
810 Ga0070700_100173676
811 Ga0070708_100421982
812 Ga0070663_100000008
813 Ga0070663_100117202
814 Ga0070678_100028471
815 Ga0070678_100355146
816 Ga0070662_100032991
817 Ga0068867_100044856
818 Ga0070707_100033508
819 Ga0068853_100222086
820 Ga0070672_100093643
821 Ga0070686_100214341
822 Ga0070665_100005314
823 Ga0068855_100002159
824 Ga0068855_100005393
825 Ga0070664_100000009
826 Ga0068857_100011248
827 Ga0068857_100076197
828 Ga0068857_100088447
829 Ga0068854_100000024
830 Ga0068854_100084113
831 Ga0068856_100000019
832 Ga0068856_100073614
833 Ga0068852_100082745
834 Ga0068852_100156478
835 Ga0068859_100000133
836 Ga0068859_100043840
837 Ga0068864_100001250
838 Ga0068866_10036697
839 Ga0068866_10101057
840 Ga0068866_10282877
841 Ga0068851_10158668
842 Ga0068863_100005731
843 Ga0068858_100002132
844 Ga0068858_100192128
845 Ga0068860_100061058
846 Ga0068862_100013318
847 Ga0068862_100077746
848 Ga0068862_100409347
849 Ga0075368_10006655
850 Ga0075368_10018365
851 Ga0075368_10113430
852 Ga0075363_100014803
853 Ga0075364_10003498
854 Ga0075364_10011010
855 Ga0075362_10006536
856 Ga0075362_10028681
857 Ga0075362_10070784
858 Ga0075367_10004846
859 Ga0075367_10005944
860 Ga0075367_10017103
861 Ga0075367_10248397
862 Ga0075369_10015092
863 Ga0075366_10002580
864 Ga0075366_10003197
865 Ga0075366_10009381
866 Ga0075366_10037856
867 Ga0075366_10058362
868 Ga0075366_10060910
869 Ga0075366_10069603
870 Ga0075366_10126576
871 Ga0097621_100026446
872 Ga0075370_10001421
873 Ga0075370_10002322
874 Ga0075370_10004186
875 Ga0075370_10008164
876 Ga0075370_10018172
877 Ga0075370_10022238
878 Ga0075370_10127081
879 Ga0068871_100028383
880 Ga0075428_100117122
881 Ga0075428_100231028
882 Ga0075433_10350460
883 Ga0075436_100083157
884 Ga0097620_100000133
885 Ga0097620_100043840
886 Ga0079104_1000981
887 Ga0079104_1009557
888 Ga0099826_10000021
889 Ga0105251_10000119
890 Ga0105251_10009294
891 Ga0105251_10011487
892 Ga0105251_10100281
893 Ga0105244_10000216
894 Ga0105244_10050773
895 Ga0105250_10001281
896 Ga0105240_10019531
897 Ga0105240_10194851
898 Ga0105240_10200358
899 Ga0105245_10006724
900 Ga0105245_10149100
901 Ga0105247_10000103
902 Ga0114129_10016285
903 Ga0105243_10733848
904 Ga0105241_10000004
905 Ga0105248_10064141
906 Ga0105248_10094740
907 Ga0105248_10253180
908 Ga0105237_10005998
909 Ga0105237_10016397
910 Ga0105237_10051254
911 Ga0105237_10634643
912 Ga0105238_10000039
913 Ga0105238_10332945
914 Ga0105249_10265310
915 Ga0099796_10023884
916 Ga0105239_10003085
917 Ga0105239_10044552
918 Ga0105246_10152632
919 Ga0157373_10001832
920 Ga0157371_10003951
921 Ga0157370_10001398
922 Ga0157369_10000723
923 Ga0157369_10007814
924 Ga0157369_10045584
925 Ga0157374_10000699
926 Ga0157378_10082857
927 Ga0157378_10132119
928 Ga0157378_10394154
929 Ga0157375_10053321
930 Ga0157375_10373065
931 Ga0163163_10000957
932 Ga0157380_10037401
933 Ga0157380_10314794
934 Ga0182008_10001015
935 Ga0157379_10091696
936 Ga0182006_1000428
937 Ga0182007_10015494
938 Ga0163161_10000001
939 Ga0154015_1301551
940 Ga0213872_10002397
941 Ga0213872_10006953
942 Ga0209435_100096
943 Ga0209436_100033
944 Ga0209784_100029
945 Ga0209784_100035
946 Ga0209784_100533
947 Ga0209784_100849
948 Ga0209566_100030
949 Ga0209566_100040
950 Ga0209566_100143
951 Ga0209674_100057
952 Ga0209674_100075
953 Ga0209674_100232
954 Ga0209674_103311
955 Ga0209672_100147
956 Ga0209672_110418
957 Ga0209147_100008
958 Ga0209563_100059
959 Ga0209563_100117
960 Ga0209563_102809
961 Ga0209563_116273
962 Ga0209258_100013
963 Ga0209258_100124
964 Ga0207425_1022748
965 Ga0209646_1000046
966 Ga0209646_1000093
967 Ga0209026_1003869
968 Ga0209026_1004472
969 Ga0209677_100030
970 Ga0209677_100036
971 Ga0209677_101312
972 Ga0209148_1000110
973 Ga0209148_1002047
974 Ga0209148_1002586
975 Ga0209759_1000077
976 Ga0209759_1000248
977 Ga0209759_1000543
978 Ga0209759_1000652
979 Ga0209759_1009789
980 Ga0209565_1000015
981 Ga0209565_1000077
982 Ga0209455_1000114
983 Ga0209455_1000130
984 Ga0209673_1000017
985 Ga0209130_1000059
986 Ga0209130_1020390
987 Ga0209675_1000012
988 Ga0209675_1000065
989 Ga0209675_1000717
990 Ga0209675_1004584
991 Ga0209676_1000044
992 Ga0209676_1000383
993 Ga0209025_1001105
994 Ga0209025_1002071
995 Ga0209025_1004496
996 Ga0209025_1010692
997 Ga0209564_1000016
998 Ga0209564_1000080
999 Ga0209564_1000404
1000 Ga0209564_1000643
1001 Ga0209758_1022683
1002 Ga0209050_1000952
1003 Ga0209256_1000119
1004 Ga0209256_1000127
1005 Ga0209256_1000314
1006 Ga0209051_1000259
1007 Ga0209051_1002766
1008 Ga0209051_1017508
1009 Ga0209257_1000116
1010 Ga0207656_10022496
1011 Ga0207696_1000001
1012 Ga0207713_1000024
1013 Ga0207713_1000026
1014 Ga0207713_1068833
1015 Ga0207682_10007326
1016 Ga0207710_10000140
1017 Ga0207688_10010878
1018 Ga0207680_10045672
1019 Ga0207685_10074152
1020 Ga0207645_10037393
1021 Ga0207645_10158265
1022 Ga0207645_10212918
1023 Ga0207684_10033155
1024 Ga0207654_10000006
1025 Ga0207695_10004909
1026 Ga0207695_10011481
1027 Ga0207695_10034685
1028 Ga0207695_10260303
1029 Ga0207671_10027562
1030 Ga0207671_10059521
1031 Ga0207657_10064898
1032 Ga0207649_10000081
1033 Ga0207646_10378292
1034 Ga0207681_10011021
1035 Ga0207694_10000072
1036 Ga0207650_10039869
1037 Ga0207650_10072200
1038 Ga0207650_10545901
1039 Ga0207659_10001021
1040 Ga0207659_10023971
1041 Ga0207687_10020882
1042 Ga0207687_10301685
1043 Ga0207706_10081419
1044 Ga0207706_10229926
1045 Ga0207709_10293295
1046 Ga0207709_10453106
1047 Ga0207669_10146335
1048 Ga0207669_10483764
1049 Ga0207704_10045950
1050 Ga0207665_10031054
1051 Ga0207691_10056292
1052 Ga0207711_10207181
1053 Ga0207689_10070370
1054 Ga0207689_10521481
1055 Ga0207679_10000004
1056 Ga0207667_10000066
1057 Ga0207667_10005459
1058 Ga0207667_10007628
1059 Ga0207651_10014917
1060 Ga0207640_10000066
1061 Ga0207640_10063764
1062 Ga0207658_10017873
1063 Ga0207658_10291190
1064 Ga0207658_10594793
1065 Ga0207677_10003261
1066 Ga0207677_10033011
1067 Ga0207703_10007217
1068 Ga0207639_10080108
1069 Ga0207639_10275038
1070 Ga0207678_10000006
1071 Ga0207678_10059582
1072 Ga0207678_10944745
1073 Ga0207708_10309249
1074 Ga0207702_10000317
1075 Ga0207702_10075820
1076 Ga0207641_10190701
1077 Ga0207648_10058131
1078 Ga0207648_10061349
1079 Ga0207648_10065906
1080 Ga0207676_10005979
1081 Ga0207674_10018093
1082 Ga0207674_10041960
1083 Ga0207674_10064054
1084 Ga0207683_10022244
1085 Ga0207698_10053002
1086 Ga0209281_1000008
1087 Ga0209371_1024222
1088 Ga0209179_1012174
1089 Ga0209282_1000019
1090 Ga0209813_10028659
1091 Ga0268266_10018467
1092 Ga0268265_10088690
1093 Ga0268265_10559453
1094 Ga0268264_10051066
1095 Ga0307517_10108637
1096 Ga0307515_10000090
1097 Ga0307515_10055679
1098 Ga0268256_1027533
1099 Ga0307512_10065819
1100 Ga0307512_10084168
1101 Ga0265331_10018700
1102 Ga0307513_10066933
1103 Ga0307513_10101827
1104 Ga0307513_10463410
1105 Ga0307509_10012445
1106 Ga0307509_10014214
1107 Ga0307509_10022560
1108 Ga0307509_10153052
1109 Ga0307408_100001072
1110 Ga0307508_10000204
1111 Ga0307508_10015442
1112 Ga0307514_10030723
1113 Ga0307514_10261641
1114 Ga0265314_10004469
1115 Ga0307516_10115391
1116 Ga0307516_10370432
1117 Ga0307518_10401184
1118 Ga0307409_100240448
1119 Ga0373930_0054339
1120 Ga0373934_0016237
1121 Ga0373923_0037327
1122 Ga0373936_0045157
1123 Ga0373953_0002534
1124 Ga0373953_0052967
1125 Ga0373954_0001622
1126 Ga0373956_0041514
1127 Ga0373955_0007992
1128 Ga0373924_0048578
1129 Ga0373931_0021864
1130 Ga0373935_0156296
1131 Ga0373927_0088815
1132 Ga0373933_0143550
1133 Ga0395899_0012785
1134 Ga0395900_0002388
1135 Ga0395900_0005683
1136 Ga0395898_0246500
1137 Ga0395905_0076340
1138 Ga0395905_0281177
1139 Ga0395901_0019835
1140 Ga0436365_0404413
1141 Ga0436361_0298749
1142 Ga0436361_0417552
1143 Ga0436363_0102659
1144 Ga0451802_0204181
1145 Ga0466986_0020637
1146 Ga0466965_0060143
1147 Ga0466964_0010177
1148 Ga0466957_0186962
1149 Ga0451576_0000219
1150 Ga0451576_1022860
1151 Ga0466958_0568108
1152 Ga0466967_0037796
1153 Ga0495627_000018
1154 Ga0495592_0043346
1155 Ga0495603_0091264
1156 Ga0495603_0278203
1157 Ga0495590_0005074
1158 Ga0495590_0005591
1159 Ga0495638_0031939
1160 Ga0495638_0038165
1161 Ga0495638_0368939
1162 Ga0495651_0007885
1163 Ga0495651_0041968
1164 Ga0495653_0001329
1165 Ga0495653_0281795
1166 Ga0495653_0312402
1167 Ga0495650_0000067
1168 Ga0495650_0001377
1169 Ga0495650_0006331
1170 Ga0495650_0098159
1171 Ga0495580_0000022
1172 Ga0495580_0013347
1173 Ga0495580_0070401
1174 Ga0495605_0000338
1175 Ga0495605_0001573
1176 Ga0495605_0005932
1177 Ga0495605_0023002
1178 Ga0495639_0100021
1179 Ga0495664_0034872
1180 Ga0495584_0037839
1181 Ga0495585_0000541
1182 Ga0495585_0151390
1183 Ga0495596_0000064
1184 Ga0495596_0007244
1185 Ga0495596_0012851
1186 Ga0495607_0007594
1187 Ga0495583_0009912
1188 Ga0495583_0057647
1189 Ga0495583_0092295
1190 Ga0495606_0000873
1191 Ga0495606_0085957
1192 Ga0495606_0123541
1193 Ga0495606_0172866
1194 Ga0495608_0068548
1195 Ga0495610_0000012
1196 Ga0495610_0000545
1197 Ga0495610_0138379
1198 Ga0495616_0019456
1199 Ga0495618_0027335
1200 Ga0495620_0010312
1201 Ga0495628_0023140
1202 Ga0495628_0044505
1203 Ga0495628_0163218
1204 Ga0495630_0004503
1205 Ga0495630_0007646
1206 Ga0495630_0038278
1207 Ga0495630_0129848
1208 Ga0495632_0005360
1209 Ga0495637_0042020
1210 Ga0495643_0081534
1211 Ga0495643_0099290
1212 Ga0495648_0000488
1213 Ga0495648_0015815
1214 Ga0495648_0133194
1215 Ga0495648_0235193
1216 Ga0495648_0261869
1217 Ga0495666_0000640
1218 Ga0495666_0000647
1219 Ga0495666_0031773
1220 Ga0495642_0025633
1221 Ga0495642_0047751
1222 Ga0495652_0056516
1223 Ga0495652_0305205
1224 Ga0495654_0000179
1225 Ga0495665_0000343
1226 Ga0495665_0005986
1227 Ga0495665_0070081
1228 Ga0495640_0016185
1229 Ga0495586_0211055
1230 Ga0495587_0082338
1231 Ga0495587_0172481
1232 Ga0495609_0001589
1233 Ga0495609_0195937
1234 Ga0495656_0014508
1235 Ga0495668_0133670
1236 Ga0495634_0018730
1237 Ga0495634_0038615
1238 Ga0495634_0191529
1239 Ga0495611_0036848
1240 Ga0495625_0004802
1241 Ga0495625_0328673
1242 Ga0495661_0000010
1243 Ga0495661_0014051
1244 Ga0495661_0027807
1245 Ga0495661_0110498
1246 Ga0495657_0292533
1247 Ga0495599_0036083
1248 Ga0495599_0094493
1249 Ga0495599_0265830
1250 Ga0495623_0030411
1251 Ga0495646_0047046
1252 Ga0495658_0009089
1253 Ga0495658_0038342
1254 Ga0495613_0093372
1255 Ga0495624_0000591
1256 Ga0495624_0003991
1257 Ga0495624_0006876
1258 Ga0495624_0027630
1259 Ga0495624_0139487
1260 Ga0495670_0125945
1261 Ga0495671_0000006
1262 Ga0495671_0002046
1263 Ga0495671_0024517
1264 Ga0495671_0199409
1265 Ga0495649_0014012
1266 Ga0495649_0024624
1267 Ga0495589_0000002
1268 Ga0495589_0159891
1269 Ga0495600_0049868
1270 Ga0495600_0237127
1271 Ga0495581_0030225
1272 Ga0495604_0047540
1273 Ga0495604_0105019
1274 Ga0495636_0022136
1275 Ga0495674_0002270
1276 Ga0495674_0003547
1277 Ga0495674_0017065
1278 Ga0495674_0392107
1279 Ga0495672_0024400
1280 Ga0495672_0120052
1281 Ga0495676_0013598
1282 Ga0495676_0027523
1283 Ga0495676_0127291
1284 Ga0495676_0231914
1285 Ga0495680_0066087
1286 Ga0495680_0082056
1287 Ga0495683_0012249
1288 Ga0495683_0012638
1289 Ga0495687_001305
1290 Ga0495687_004784
1291 Ga0495687_069145
1292 Ga0495675_0016284
1293 Ga0495675_0016313
1294 Ga0495675_0052393
1295 Ga0495679_000022
1296 Ga0495679_000063
1297 Ga0495679_021066
1298 Ga0495673_0007417
1299 Ga0495673_0113417
1300 Ga0495684_0065247
1301 Ga0495684_0081512
1302 Ga0495686_0000906
1303 Ga0495686_0016430
1304 Ga0495686_0155448
1305 Ga0495593_0020498
1306 Ga0495593_0045729
1307 Ga0495602_0201405
1308 Ga0495626_0222237
1309 Ga0496103_0018389
1310 Ga0496103_0285745
1311 Ga0496104_0506870
1312 Ga0496106_0000009
1313 Ga0496108_0048166
1314 Ga0496109_0115094
1315 Ga0496112_0761572
1316 Ga0496116_0000023
1317 Ga0496116_0019948
1318 Ga0496117_0000463
1319 Ga0496117_0004391
1320 Ga0496117_0047596
1321 Ga0496117_0065741
1322 Ga0496118_0016438
1323 Ga0496118_0039111
1324 Ga0496119_0001547
1325 Ga0496119_0006664
1326 Ga0496120_0000052
1327 Ga0496120_0001403
1328 Ga0496121_0002315
1329 Ga0496121_0018569
1330 Ga0496121_0020758
1331 Ga0496121_0051649
1332 Ga0496121_0077937
1333 Ga0496121_0082005
1334 Ga0496121_0373910
1335 Ga0496122_0005874
1336 Ga0496123_0002314
1337 Ga0496123_0297012
1338 Ga0496124_0000017
1339 Ga0496124_0024477
1340 Ga0496125_0002936
1341 Ga0496125_0077506
1342 Ga0496126_0000099
1343 Ga0496126_0000414
1344 Ga0496126_0008498
1345 Ga0496126_0043863
1346 Ga0496126_0101735
1347 Ga0496126_0266554
1348 Ga0496126_0739240
1349 Ga0495678_013915
1350 Ga0495678_024271
1351 Ga0495682_0016744
1352 Ga0495682_0081158
1353 Ga0501031_0000078
1354 Ga0501032_0000153
1355 Ga0501033_0002228
1356 Ga0501034_0000178
1357 Ga0501034_0001831
1358 Ga0501036_0000044
1359 Ga0501037_0000206
1360 Ga0501037_0455315
1361 Ga0501038_0000071
1362 Ga0501039_0000104
1363 Ga0501040_0001995
1364 Ga0501043_0000134
1365 Ga0501047_0000364
1366 Ga0501068_0143384
1367 Ga0501035_0000379
1368 Ga0501044_0000194
1369 Ga0501045_0067547
1370 nmdc:mga03683_20798_c1
1371 nmdc:mga03683_8634_c1
1372 nmdc:mga03683_89068_c1
1373 nmdc:mga03n38_23716_c1
1374 nmdc:mga03n38_69885_c1
1375 nmdc:mga03n38_85091_c1
1376 nmdc:mga0yw44_36795_c1
1377 nmdc:mga0yw44_422215_c1
1378 nmdc:mga0k408_107216_c1
1379 nmdc:mga0k408_15631_c2
1380 nmdc:mga0k408_16156_c1
1381 nmdc:mga0k408_3449_c1
1382 nmdc:mga0k408_3650_c1
1383 nmdc:mga0k408_4851_c1
1384 nmdc:mga0k408_5689_c1
1385 nmdc:mga06z11_14019_c1
1386 nmdc:mga06z11_141457_c1
1387 nmdc:mga06z11_417217_c1
1388 nmdc:mga07m45_1253_c1
1389 nmdc:mga07m45_12928_c1
1390 nmdc:mga07m45_28763_c1
1391 nmdc:mga07m45_49009_c1
1392 nmdc:mga07m45_8279_c1
1393 nmdc:mga07m45_8482_c1
1394 nmdc:mga07m45_874_c1
1395 nmdc:mga05p37_60980_c1
1396 nmdc:mga0n895_298049_c1
1397 nmdc:mga08x19_6767_c1
1398 nmdc:mga08x19_71667_c1
1399 nmdc:mga0sz30_135896_c1
1400 nmdc:mga0sz30_8183_c2
1401 Ga0495601_0002885
1402 Ga0500578_0011098
1403 Ga0500578_0227963
1404 Ga0500651_0222487
1405 Ga0500618_050777
1406 Ga0500658_0002381
1407 Ga0500568_0013094
1408 Ga0500637_0120390
1409 Ga0500645_001807
1410 Ga0500645_013146
1411 2643906132
1412 2510249133
1413 2510281047
1414 2510294822
1415 2510309195
1416 2511248908
1417 2511249734
1418 2513568685
1419 2513955538
1420 2514040884
1421 2553005838
1422 2599445051
1423 2608380773
1424 2644302857
1425 2644400371
1426 2656277424
1427 2656279125
1428 2689444015
1429 2719642458
1430 2739293266
1431 2765571699
1432 2774131987
1433 2807179565
1434 2808984308
1435 2809130661
1436 2809149861
1437 2819618569
1438 2834644347
1439 2838684803
1440 2838698964
1441 2838712156
1442 2839098612
1443 2842122555
1444 2842241568
1445 2842295922
1446 2842374197
1447 2842382326
1448 2842389103
1449 2842806010
1450 2852619997
1451 2855736454
1452 2855773391
1453 2858696270
1454 2888368064
1455 2900580572
1456 2900638536
1457 2901303032
1458 2904429351
1459 2904444289
1460 2904533894
1461 2904589272
1462 2904594974
1463 2904606551
1464 2917834958
1465 2919051114
1466 2919084507
1467 2919128708
1468 2919503458
1469 2926065971
1470 2928060214
1471 2935898882
1472 2974301052
1473 2984503526
1474 2984507996
1475 640937030
1476 642615482
1477 642621075
1478 644751488
1479 8003404247
1480 8015394872
1481 8016729827
1482 8018154115
1483 8033234533
1484 8055307746

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

1

109

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

142

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9855 1 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9841 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9832 2 117
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9825 1 119
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9802 1 117
ID Description Score Start End Superfamily
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9941 1 79 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9924 1 79 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9842 1 79 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9817 1 79 3.40.50.2300
af_P0ACZ8_124_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9809 126 223 1.10.10.10
ID Description Score Start End GO Terms
AF-J3A137-F1-model_v4 Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain 0.9741 2 122 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0M9XS95-F1-model_v4 Transcriptional regulatory protein AfsQ1 0.9727 2 117 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3B8YBM5-F1-model_v4 deleted 0.9418 2 124
AF-A0A0M9XS95-F1-model_v4 Transcriptional regulatory protein AfsQ1 0.9185 2 117 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A534BQA9-F1-model_v4 Response regulator transcription factor 0.918 2 127 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map