F478667
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 437 | 1484 | 225 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221579|2643906132 |
| Length | 222 |
| Sequence | VVEDEHKTADYVRQGLMEAGFVVDLARDGPDGLHMATTEHYDLIVLDVMLPGMDGRKILQTIRAAGNQVPVLFLTARSSVDDRVQGLELGADDYLVKPFVFSELLARVRTLLRRGGSPIPHDRIQIADLELDLARRRATRAGQRINLTSKEFALLELLARRQGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDSFEPKLIQTVRGMGYTLDLPDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 235 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 361 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 362 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 366 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 367 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 368 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 369 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 370 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 371 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 372 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 373 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 374 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 375 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 376 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 377 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 378 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 379 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 380 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 381 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 382 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 383 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 384 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 385 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 386 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 387 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 388 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 389 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 390 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 391 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 392 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 393 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 394 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 395 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 396 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 397 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 398 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 399 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 400 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 401 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 402 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 403 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 404 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 405 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 406 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 407 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 408 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 409 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 410 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 411 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 412 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 413 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 414 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 415 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 416 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 417 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 418 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 419 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 420 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 421 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 422 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 423 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 424 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 425 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 426 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 427 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 428 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 429 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 430 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 431 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 432 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 433 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 434 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 435 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 436 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 437 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.89 |
| Metatranscriptomes | 0.13 |
| Isolates | 9.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 21.7 |
| Nodule | 3.37 |
| Rhizoplane | 1.35 |
| Rhizosphere | 59.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000369 | 3300001915 | Bacteria | 13464 |
| 2 | JGI24740J21852_10001501 | 3300001979 | Bacteria | 10744 |
| 3 | JGI24740J21852_10008613 | 3300001979 | Bacteria | 4053 |
| 4 | JGI25156J39149_1000226 | 3300002705 | Bacteria | 38895 |
| 5 | JGI25156J39149_1000457 | 3300002705 | Bacteria | 24896 |
| 6 | JGI25156J39149_1002321 | 3300002705 | Bacteria | 6937 |
| 7 | JGI25156J39149_1014190 | 3300002705 | Bacteria | 1655 |
| 8 | JGI25154J39366_1000925 | 3300002738 | Bacteria | 12344 |
| 9 | JGI25154J39366_1002083 | 3300002738 | Bacteria | 5664 |
| 10 | JGI25158J39367_1000006 | 3300002739 | Bacteria | 58790 |
| 11 | JGI25159J45721_1000955 | 3300002987 | Bacteria | 12587 |
| 12 | JGI25151J46595_10000868 | 3300003187 | Bacteria | 23934 |
| 13 | JGI25151J46595_10006764 | 3300003187 | Bacteria | 5710 |
| 14 | rootH2_10125873 | 3300003320 | Bacteria | 4761 |
| 15 | rootH1_10161873 | 3300003323 | Bacteria | 3231 |
| 16 | JGI25161J50226_1000052 | 3300003374 | Bacteria | 107273 |
| 17 | Ga0055538_1002531 | 3300003751 | Bacteria | 2639 |
| 18 | Ga0055539_1000078 | 3300003752 | Bacteria | 127408 |
| 19 | Ga0055539_1000104 | 3300003752 | Bacteria | 95182 |
| 20 | Ga0055533_1000084 | 3300003756 | Bacteria | 127408 |
| 21 | Ga0055533_1000946 | 3300003756 | Bacteria | 8575 |
| 22 | Ga0055525_1000112 | 3300003759 | Bacteria | 127408 |
| 23 | Ga0055525_1000245 | 3300003759 | Bacteria | 54959 |
| 24 | Ga0055535_1000229 | 3300003761 | Bacteria | 58945 |
| 25 | Ga0055542_1002814 | 3300003762 | Bacteria | 5216 |
| 26 | Ga0055529_1000064 | 3300003763 | Bacteria | 178831 |
| 27 | Ga0055526_1000193 | 3300003771 | Bacteria | 53165 |
| 28 | Ga0055526_1000563 | 3300003771 | Bacteria | 29353 |
| 29 | Ga0055526_1003347 | 3300003771 | Bacteria | 10240 |
| 30 | Ga0055526_1009481 | 3300003771 | Bacteria | 4672 |
| 31 | Ga0055537_1000060 | 3300003773 | Bacteria | 79376 |
| 32 | Ga0055537_1000514 | 3300003773 | Bacteria | 22884 |
| 33 | Ga0055524_1000263 | 3300003775 | Bacteria | 52900 |
| 34 | Ga0055524_1009149 | 3300003775 | Bacteria | 4054 |
| 35 | Ga0055524_1011593 | 3300003775 | Bacteria | 3437 |
| 36 | Ga0055536_1000195 | 3300003781 | Bacteria | 49966 |
| 37 | Ga0055534_1000009 | 3300003784 | Bacteria | 210256 |
| 38 | Ga0055534_1000710 | 3300003784 | Bacteria | 16303 |
| 39 | Ga0055534_1000845 | 3300003784 | Bacteria | 14090 |
| 40 | Ga0055528_1000012 | 3300003790 | Bacteria | 182704 |
| 41 | Ga0055530_10011488 | 3300003791 | Bacteria | 3175 |
| 42 | Ga0055540_1000365 | 3300003792 | Bacteria | 38078 |
| 43 | Ga0055531_10000454 | 3300003794 | Bacteria | 38078 |
| 44 | Ga0055541_1000055 | 3300003841 | Bacteria | 127408 |
| 45 | Ga0055541_1000236 | 3300003841 | Bacteria | 20548 |
| 46 | Ga0055543_1000038 | 3300004625 | Bacteria | 124032 |
| 47 | Ga0065165_1000117 | 3300005262 | Bacteria | 134716 |
| 48 | Ga0065707_10219170 | 3300005295 | Bacteria | 1232 |
| 49 | Ga0070676_10022339 | 3300005328 | Bacteria | 3547 |
| 50 | Ga0070676_10025379 | 3300005328 | Bacteria | 3350 |
| 51 | Ga0070670_100026170 | 3300005331 | Bacteria | 5022 |
| 52 | Ga0070670_100047641 | 3300005331 | Bacteria | 3688 |
| 53 | Ga0070677_10010141 | 3300005333 | Bacteria | 3214 |
| 54 | Ga0070677_10066040 | 3300005333 | Bacteria | 1507 |
| 55 | Ga0070666_10008536 | 3300005335 | Bacteria | 6366 |
| 56 | Ga0068868_100005862 | 3300005338 | Bacteria | 8667 |
| 57 | Ga0070660_100028306 | 3300005339 | Bacteria | 4191 |
| 58 | Ga0070661_100000086 | 3300005344 | Bacteria | 74801 |
| 59 | Ga0070669_100043440 | 3300005353 | Bacteria | 3273 |
| 60 | Ga0070675_100003180 | 3300005354 | Bacteria | 12427 |
| 61 | Ga0070675_100024981 | 3300005354 | Bacteria | 4788 |
| 62 | Ga0070671_100019225 | 3300005355 | Bacteria | 5558 |
| 63 | Ga0070674_100066440 | 3300005356 | Bacteria | 2534 |
| 64 | Ga0070673_100018078 | 3300005364 | Bacteria | 5029 |
| 65 | Ga0070667_100041257 | 3300005367 | Bacteria | 3871 |
| 66 | Ga0070667_100119620 | 3300005367 | Bacteria | 2290 |
| 67 | Ga0070667_100286366 | 3300005367 | Bacteria | 1481 |
| 68 | Ga0070700_100173676 | 3300005441 | Bacteria | 1494 |
| 69 | Ga0070708_100421982 | 3300005445 | Bacteria | 1258 |
| 70 | Ga0070663_100000008 | 3300005455 | Bacteria | 188775 |
| 71 | Ga0070663_100117202 | 3300005455 | Bacteria | 2008 |
| 72 | Ga0070678_100028471 | 3300005456 | Bacteria | 3811 |
| 73 | Ga0070678_100355146 | 3300005456 | Bacteria | 1261 |
| 74 | Ga0070662_100032991 | 3300005457 | Bacteria | 3643 |
| 75 | Ga0068867_100044856 | 3300005459 | Bacteria | 3240 |
| 76 | Ga0070707_100033508 | 3300005468 | Bacteria | 4899 |
| 77 | Ga0068853_100222086 | 3300005539 | Bacteria | 1726 |
| 78 | Ga0070672_100093643 | 3300005543 | Bacteria | 2428 |
| 79 | Ga0070686_100214341 | 3300005544 | Bacteria | 1388 |
| 80 | Ga0070665_100005314 | 3300005548 | Bacteria | 13303 |
| 81 | Ga0068855_100002159 | 3300005563 | Bacteria | 24312 |
| 82 | Ga0068855_100005393 | 3300005563 | Bacteria | 15602 |
| 83 | Ga0070664_100000009 | 3300005564 | Bacteria | 166396 |
| 84 | Ga0068857_100011248 | 3300005577 | Bacteria | 7781 |
| 85 | Ga0068857_100076197 | 3300005577 | Bacteria | 2991 |
| 86 | Ga0068857_100088447 | 3300005577 | Bacteria | 2771 |
| 87 | Ga0068854_100000024 | 3300005578 | Bacteria | 124310 |
| 88 | Ga0068854_100084113 | 3300005578 | Bacteria | 2354 |
| 89 | Ga0068856_100000019 | 3300005614 | Bacteria | 150500 |
| 90 | Ga0068856_100073614 | 3300005614 | Bacteria | 3382 |
| 91 | Ga0068852_100082745 | 3300005616 | Bacteria | 2853 |
| 92 | Ga0068852_100156478 | 3300005616 | Bacteria | 2123 |
| 93 | Ga0068859_100000133 | 3300005617 | Bacteria | 70133 |
| 94 | Ga0068859_100043840 | 3300005617 | Bacteria | 4496 |
| 95 | Ga0068864_100001250 | 3300005618 | Bacteria | 21104 |
| 96 | Ga0068866_10036697 | 3300005718 | Bacteria | 2402 |
| 97 | Ga0068866_10101057 | 3300005718 | Bacteria | 1591 |
| 98 | Ga0068866_10282877 | 3300005718 | Bacteria | 1028 |
| 99 | Ga0068851_10158668 | 3300005834 | Bacteria | 1241 |
| 100 | Ga0068863_100005731 | 3300005841 | Bacteria | 12192 |
| 101 | Ga0068858_100002132 | 3300005842 | Bacteria | 20043 |
| 102 | Ga0068858_100192128 | 3300005842 | Bacteria | 1929 |
| 103 | Ga0068860_100061058 | 3300005843 | Bacteria | 3581 |
| 104 | Ga0068862_100013318 | 3300005844 | Bacteria | 6803 |
| 105 | Ga0068862_100077746 | 3300005844 | Bacteria | 2874 |
| 106 | Ga0068862_100409347 | 3300005844 | Bacteria | 1270 |
| 107 | Ga0075368_10006655 | 3300006042 | Bacteria | 4052 |
| 108 | Ga0075368_10018365 | 3300006042 | Bacteria | 2628 |
| 109 | Ga0075368_10113430 | 3300006042 | Bacteria | 1118 |
| 110 | Ga0075363_100014803 | 3300006048 | Bacteria | 3822 |
| 111 | Ga0075364_10003498 | 3300006051 | Bacteria | 8939 |
| 112 | Ga0075364_10011010 | 3300006051 | Bacteria | 5486 |
| 113 | Ga0075362_10006536 | 3300006177 | Bacteria | 4353 |
| 114 | Ga0075362_10028681 | 3300006177 | Bacteria | 2392 |
| 115 | Ga0075362_10070784 | 3300006177 | Bacteria | 1593 |
| 116 | Ga0075367_10004846 | 3300006178 | Bacteria | 6631 |
| 117 | Ga0075367_10005944 | 3300006178 | Bacteria | 6125 |
| 118 | Ga0075367_10017103 | 3300006178 | Bacteria | 3974 |
| 119 | Ga0075367_10248397 | 3300006178 | Bacteria | 1115 |
| 120 | Ga0075369_10015092 | 3300006186 | Bacteria | 3096 |
| 121 | Ga0075366_10002580 | 3300006195 | Bacteria | 9314 |
| 122 | Ga0075366_10003197 | 3300006195 | Bacteria | 8592 |
| 123 | Ga0075366_10009381 | 3300006195 | Bacteria | 5461 |
| 124 | Ga0075366_10037856 | 3300006195 | Bacteria | 2849 |
| 125 | Ga0075366_10058362 | 3300006195 | Bacteria | 2292 |
| 126 | Ga0075366_10060910 | 3300006195 | Bacteria | 2242 |
| 127 | Ga0075366_10069603 | 3300006195 | Bacteria | 2095 |
| 128 | Ga0075366_10126576 | 3300006195 | Bacteria | 1541 |
| 129 | Ga0097621_100026446 | 3300006237 | Bacteria | 4552 |
| 130 | Ga0075370_10001421 | 3300006353 | Bacteria | 10366 |
| 131 | Ga0075370_10002322 | 3300006353 | Bacteria | 8785 |
| 132 | Ga0075370_10004186 | 3300006353 | Bacteria | 6963 |
| 133 | Ga0075370_10008164 | 3300006353 | Bacteria | 5373 |
| 134 | Ga0075370_10018172 | 3300006353 | Bacteria | 3810 |
| 135 | Ga0075370_10022238 | 3300006353 | Bacteria | 3480 |
| 136 | Ga0075370_10127081 | 3300006353 | Bacteria | 1486 |
| 137 | Ga0068871_100028383 | 3300006358 | Bacteria | 4386 |
| 138 | Ga0075428_100117122 | 3300006844 | Bacteria | 2902 |
| 139 | Ga0075428_100231028 | 3300006844 | Bacteria | 1996 |
| 140 | Ga0075433_10350460 | 3300006852 | Bacteria | 1305 |
| 141 | Ga0075436_100083157 | 3300006914 | Bacteria | 2221 |
| 142 | Ga0097620_100000133 | 3300006931 | Bacteria | 70133 |
| 143 | Ga0097620_100043840 | 3300006931 | Bacteria | 4496 |
| 144 | Ga0079104_1000981 | 3300006946 | Bacteria | 22291 |
| 145 | Ga0079104_1009557 | 3300006946 | Bacteria | 3275 |
| 146 | Ga0099826_10000021 | 3300006948 | Bacteria | 173580 |
| 147 | Ga0105251_10000119 | 3300009011 | Bacteria | 79040 |
| 148 | Ga0105251_10009294 | 3300009011 | Bacteria | 5819 |
| 149 | Ga0105251_10011487 | 3300009011 | Bacteria | 5056 |
| 150 | Ga0105251_10100281 | 3300009011 | Bacteria | 1324 |
| 151 | Ga0105244_10000216 | 3300009036 | Bacteria | 59709 |
| 152 | Ga0105244_10050773 | 3300009036 | Bacteria | 2115 |
| 153 | Ga0105250_10001281 | 3300009092 | Bacteria | 13801 |
| 154 | Ga0105240_10019531 | 3300009093 | Bacteria | 9051 |
| 155 | Ga0105240_10194851 | 3300009093 | Bacteria | 2380 |
| 156 | Ga0105240_10200358 | 3300009093 | Bacteria | 2340 |
| 157 | Ga0105245_10006724 | 3300009098 | Bacteria | 10088 |
| 158 | Ga0105245_10149100 | 3300009098 | Bacteria | 2210 |
| 159 | Ga0105247_10000103 | 3300009101 | Bacteria | 90413 |
| 160 | Ga0114129_10016285 | 3300009147 | Bacteria | 10582 |
| 161 | Ga0105243_10733848 | 3300009148 | Bacteria | 966 |
| 162 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 163 | Ga0105248_10064141 | 3300009177 | Bacteria | 4124 |
| 164 | Ga0105248_10094740 | 3300009177 | Bacteria | 3361 |
| 165 | Ga0105248_10253180 | 3300009177 | Bacteria | 1982 |
| 166 | Ga0105237_10005998 | 3300009545 | Bacteria | 13599 |
| 167 | Ga0105237_10016397 | 3300009545 | Bacteria | 7700 |
| 168 | Ga0105237_10051254 | 3300009545 | Bacteria | 4145 |
| 169 | Ga0105237_10634643 | 3300009545 | Bacteria | 1075 |
| 170 | Ga0105238_10000039 | 3300009551 | Bacteria | 161870 |
| 171 | Ga0105238_10332945 | 3300009551 | Bacteria | 1505 |
| 172 | Ga0105249_10265310 | 3300009553 | Bacteria | 1708 |
| 173 | Ga0099796_10023884 | 3300010159 | Bacteria | 1914 |
| 174 | Ga0105239_10003085 | 3300010375 | Bacteria | 20688 |
| 175 | Ga0105239_10044552 | 3300010375 | Bacteria | 4863 |
| 176 | Ga0105246_10152632 | 3300011119 | Bacteria | 1750 |
| 177 | Ga0157373_10001832 | 3300013100 | Bacteria | 16186 |
| 178 | Ga0157371_10003951 | 3300013102 | Bacteria | 13158 |
| 179 | Ga0157370_10001398 | 3300013104 | Bacteria | 29918 |
| 180 | Ga0157369_10000723 | 3300013105 | Bacteria | 42490 |
| 181 | Ga0157369_10007814 | 3300013105 | Bacteria | 12310 |
| 182 | Ga0157369_10045584 | 3300013105 | Bacteria | 4767 |
| 183 | Ga0157374_10000699 | 3300013296 | Bacteria | 29519 |
| 184 | Ga0157378_10082857 | 3300013297 | Bacteria | 2901 |
| 185 | Ga0157378_10132119 | 3300013297 | Bacteria | 2312 |
| 186 | Ga0157378_10394154 | 3300013297 | Bacteria | 1363 |
| 187 | Ga0157375_10053321 | 3300013308 | Bacteria | 3979 |
| 188 | Ga0157375_10373065 | 3300013308 | Bacteria | 1593 |
| 189 | Ga0163163_10000957 | 3300014325 | Bacteria | 24512 |
| 190 | Ga0157380_10037401 | 3300014326 | Bacteria | 3761 |
| 191 | Ga0157380_10314794 | 3300014326 | Bacteria | 1448 |
| 192 | Ga0182008_10001015 | 3300014497 | Bacteria | 19489 |
| 193 | Ga0157379_10091696 | 3300014968 | Bacteria | 2725 |
| 194 | Ga0182006_1000428 | 3300015261 | Bacteria | 33619 |
| 195 | Ga0182007_10015494 | 3300015262 | Bacteria | 2841 |
| 196 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 197 | Ga0154015_1301551 | 3300020610 | Bacteria | 16162 |
| 198 | Ga0213872_10002397 | 3300021361 | Bacteria | 11068 |
| 199 | Ga0213872_10006953 | 3300021361 | Bacteria | 5619 |
| 200 | Ga0209435_100096 | 3300025206 | Bacteria | 38561 |
| 201 | Ga0209436_100033 | 3300025208 | Bacteria | 80428 |
| 202 | Ga0209784_100029 | 3300025224 | Bacteria | 347315 |
| 203 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 204 | Ga0209784_100533 | 3300025224 | Bacteria | 14063 |
| 205 | Ga0209784_100849 | 3300025224 | Bacteria | 6758 |
| 206 | Ga0209566_100030 | 3300025225 | Bacteria | 347329 |
| 207 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 208 | Ga0209566_100143 | 3300025225 | Bacteria | 84572 |
| 209 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 210 | Ga0209674_100075 | 3300025226 | Bacteria | 216004 |
| 211 | Ga0209674_100232 | 3300025226 | Bacteria | 49385 |
| 212 | Ga0209674_103311 | 3300025226 | Bacteria | 3012 |
| 213 | Ga0209672_100147 | 3300025228 | Bacteria | 63618 |
| 214 | Ga0209672_110418 | 3300025228 | Bacteria | 1257 |
| 215 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 216 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 217 | Ga0209563_100117 | 3300025230 | Bacteria | 132048 |
| 218 | Ga0209563_102809 | 3300025230 | Bacteria | 3801 |
| 219 | Ga0209563_116273 | 3300025230 | Bacteria | 917 |
| 220 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 221 | Ga0209258_100124 | 3300025242 | Bacteria | 178883 |
| 222 | Ga0207425_1022748 | 3300025245 | Bacteria | 1318 |
| 223 | Ga0209646_1000046 | 3300025246 | Bacteria | 332737 |
| 224 | Ga0209646_1000093 | 3300025246 | Bacteria | 183840 |
| 225 | Ga0209026_1003869 | 3300025250 | Bacteria | 4717 |
| 226 | Ga0209026_1004472 | 3300025250 | Bacteria | 4128 |
| 227 | Ga0209677_100030 | 3300025253 | Bacteria | 347314 |
| 228 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 229 | Ga0209677_101312 | 3300025253 | Bacteria | 11002 |
| 230 | Ga0209148_1000110 | 3300025254 | Bacteria | 203536 |
| 231 | Ga0209148_1002047 | 3300025254 | Bacteria | 7816 |
| 232 | Ga0209148_1002586 | 3300025254 | Bacteria | 5970 |
| 233 | Ga0209759_1000077 | 3300025256 | Bacteria | 175706 |
| 234 | Ga0209759_1000248 | 3300025256 | Bacteria | 80537 |
| 235 | Ga0209759_1000543 | 3300025256 | Bacteria | 39344 |
| 236 | Ga0209759_1000652 | 3300025256 | Bacteria | 32306 |
| 237 | Ga0209759_1009789 | 3300025256 | Bacteria | 2868 |
| 238 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 239 | Ga0209565_1000077 | 3300025263 | Bacteria | 161163 |
| 240 | Ga0209455_1000114 | 3300025272 | Bacteria | 178883 |
| 241 | Ga0209455_1000130 | 3300025272 | Bacteria | 161669 |
| 242 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 243 | Ga0209130_1000059 | 3300025284 | Bacteria | 204772 |
| 244 | Ga0209130_1020390 | 3300025284 | Bacteria | 1518 |
| 245 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 246 | Ga0209675_1000065 | 3300025291 | Bacteria | 174791 |
| 247 | Ga0209675_1000717 | 3300025291 | Bacteria | 22637 |
| 248 | Ga0209675_1004584 | 3300025291 | Bacteria | 6090 |
| 249 | Ga0209676_1000044 | 3300025292 | Bacteria | 416215 |
| 250 | Ga0209676_1000383 | 3300025292 | Bacteria | 81259 |
| 251 | Ga0209025_1001105 | 3300025294 | Bacteria | 38808 |
| 252 | Ga0209025_1002071 | 3300025294 | Bacteria | 22775 |
| 253 | Ga0209025_1004496 | 3300025294 | Bacteria | 12063 |
| 254 | Ga0209025_1010692 | 3300025294 | Bacteria | 6176 |
| 255 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 256 | Ga0209564_1000080 | 3300025295 | Bacteria | 263547 |
| 257 | Ga0209564_1000404 | 3300025295 | Bacteria | 76827 |
| 258 | Ga0209564_1000643 | 3300025295 | Bacteria | 52864 |
| 259 | Ga0209758_1022683 | 3300025297 | Bacteria | 2867 |
| 260 | Ga0209050_1000952 | 3300025298 | Bacteria | 37637 |
| 261 | Ga0209256_1000119 | 3300025299 | Bacteria | 168215 |
| 262 | Ga0209256_1000127 | 3300025299 | Bacteria | 164393 |
| 263 | Ga0209256_1000314 | 3300025299 | Bacteria | 84164 |
| 264 | Ga0209051_1000259 | 3300025303 | Bacteria | 88311 |
| 265 | Ga0209051_1002766 | 3300025303 | Bacteria | 12109 |
| 266 | Ga0209051_1017508 | 3300025303 | Bacteria | 3200 |
| 267 | Ga0209257_1000116 | 3300025304 | Bacteria | 228733 |
| 268 | Ga0207656_10022496 | 3300025321 | Bacteria | 2530 |
| 269 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 270 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 271 | Ga0207713_1000026 | 3300025735 | Bacteria | 319032 |
| 272 | Ga0207713_1068833 | 3300025735 | Bacteria | 1314 |
| 273 | Ga0207682_10007326 | 3300025893 | Bacteria | 4401 |
| 274 | Ga0207710_10000140 | 3300025900 | Bacteria | 83223 |
| 275 | Ga0207688_10010878 | 3300025901 | Bacteria | 4952 |
| 276 | Ga0207680_10045672 | 3300025903 | Bacteria | 2584 |
| 277 | Ga0207685_10074152 | 3300025905 | Bacteria | 1388 |
| 278 | Ga0207645_10037393 | 3300025907 | Bacteria | 3114 |
| 279 | Ga0207645_10158265 | 3300025907 | Bacteria | 1481 |
| 280 | Ga0207645_10212918 | 3300025907 | Bacteria | 1273 |
| 281 | Ga0207684_10033155 | 3300025910 | Bacteria | 4393 |
| 282 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 283 | Ga0207695_10004909 | 3300025913 | Bacteria | 18019 |
| 284 | Ga0207695_10011481 | 3300025913 | Bacteria | 10721 |
| 285 | Ga0207695_10034685 | 3300025913 | Bacteria | 5483 |
| 286 | Ga0207695_10260303 | 3300025913 | Bacteria | 1632 |
| 287 | Ga0207671_10027562 | 3300025914 | Bacteria | 4248 |
| 288 | Ga0207671_10059521 | 3300025914 | Bacteria | 2833 |
| 289 | Ga0207657_10064898 | 3300025919 | Bacteria | 3114 |
| 290 | Ga0207649_10000081 | 3300025920 | Bacteria | 82217 |
| 291 | Ga0207646_10378292 | 3300025922 | Bacteria | 1279 |
| 292 | Ga0207681_10011021 | 3300025923 | Bacteria | 5552 |
| 293 | Ga0207694_10000072 | 3300025924 | Bacteria | 118962 |
| 294 | Ga0207650_10039869 | 3300025925 | Bacteria | 3434 |
| 295 | Ga0207650_10072200 | 3300025925 | Bacteria | 2598 |
| 296 | Ga0207650_10545901 | 3300025925 | Bacteria | 971 |
| 297 | Ga0207659_10001021 | 3300025926 | Bacteria | 16643 |
| 298 | Ga0207659_10023971 | 3300025926 | Bacteria | 4082 |
| 299 | Ga0207687_10020882 | 3300025927 | Bacteria | 4346 |
| 300 | Ga0207687_10301685 | 3300025927 | Bacteria | 1290 |
| 301 | Ga0207706_10081419 | 3300025933 | Bacteria | 2845 |
| 302 | Ga0207706_10229926 | 3300025933 | Bacteria | 1623 |
| 303 | Ga0207709_10293295 | 3300025935 | Bacteria | 1206 |
| 304 | Ga0207709_10453106 | 3300025935 | Bacteria | 992 |
| 305 | Ga0207669_10146335 | 3300025937 | Bacteria | 1648 |
| 306 | Ga0207669_10483764 | 3300025937 | Bacteria | 987 |
| 307 | Ga0207704_10045950 | 3300025938 | Bacteria | 2598 |
| 308 | Ga0207665_10031054 | 3300025939 | Bacteria | 3534 |
| 309 | Ga0207691_10056292 | 3300025940 | Bacteria | 3582 |
| 310 | Ga0207711_10207181 | 3300025941 | Bacteria | 1791 |
| 311 | Ga0207689_10070370 | 3300025942 | Bacteria | 2874 |
| 312 | Ga0207689_10521481 | 3300025942 | Bacteria | 996 |
| 313 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 314 | Ga0207667_10000066 | 3300025949 | Bacteria | 185903 |
| 315 | Ga0207667_10005459 | 3300025949 | Bacteria | 15496 |
| 316 | Ga0207667_10007628 | 3300025949 | Bacteria | 12965 |
| 317 | Ga0207651_10014917 | 3300025960 | Bacteria | 4500 |
| 318 | Ga0207640_10000066 | 3300025981 | Bacteria | 86479 |
| 319 | Ga0207640_10063764 | 3300025981 | Bacteria | 2450 |
| 320 | Ga0207658_10017873 | 3300025986 | Bacteria | 4887 |
| 321 | Ga0207658_10291190 | 3300025986 | Bacteria | 1403 |
| 322 | Ga0207658_10594793 | 3300025986 | Bacteria | 993 |
| 323 | Ga0207677_10003261 | 3300026023 | Bacteria | 8570 |
| 324 | Ga0207677_10033011 | 3300026023 | Bacteria | 3333 |
| 325 | Ga0207703_10007217 | 3300026035 | Bacteria | 8839 |
| 326 | Ga0207639_10080108 | 3300026041 | Bacteria | 2582 |
| 327 | Ga0207639_10275038 | 3300026041 | Bacteria | 1479 |
| 328 | Ga0207678_10000006 | 3300026067 | Bacteria | 188733 |
| 329 | Ga0207678_10059582 | 3300026067 | Bacteria | 3285 |
| 330 | Ga0207678_10944745 | 3300026067 | Bacteria | 763 |
| 331 | Ga0207708_10309249 | 3300026075 | Bacteria | 1287 |
| 332 | Ga0207702_10000317 | 3300026078 | Bacteria | 55259 |
| 333 | Ga0207702_10075820 | 3300026078 | Bacteria | 2906 |
| 334 | Ga0207641_10190701 | 3300026088 | Bacteria | 1884 |
| 335 | Ga0207648_10058131 | 3300026089 | Bacteria | 3373 |
| 336 | Ga0207648_10061349 | 3300026089 | Bacteria | 3279 |
| 337 | Ga0207648_10065906 | 3300026089 | Bacteria | 3158 |
| 338 | Ga0207676_10005979 | 3300026095 | Bacteria | 8579 |
| 339 | Ga0207674_10018093 | 3300026116 | Bacteria | 7670 |
| 340 | Ga0207674_10041960 | 3300026116 | Bacteria | 4728 |
| 341 | Ga0207674_10064054 | 3300026116 | Bacteria | 3708 |
| 342 | Ga0207683_10022244 | 3300026121 | Bacteria | 5440 |
| 343 | Ga0207698_10053002 | 3300026142 | Bacteria | 3111 |
| 344 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 345 | Ga0209371_1024222 | 3300027312 | Bacteria | 1415 |
| 346 | Ga0209179_1012174 | 3300027512 | Bacteria | 1540 |
| 347 | Ga0209282_1000019 | 3300027666 | Bacteria | 184034 |
| 348 | Ga0209813_10028659 | 3300027866 | Bacteria | 1625 |
| 349 | Ga0268266_10018467 | 3300028379 | Bacteria | 5943 |
| 350 | Ga0268265_10088690 | 3300028380 | Bacteria | 2465 |
| 351 | Ga0268265_10559453 | 3300028380 | Bacteria | 1087 |
| 352 | Ga0268264_10051066 | 3300028381 | Bacteria | 3445 |
| 353 | Ga0307517_10108637 | 3300028786 | Bacteria | 2128 |
| 354 | Ga0307515_10000090 | 3300028794 | Bacteria | 215043 |
| 355 | Ga0307515_10055679 | 3300028794 | Bacteria | 5771 |
| 356 | Ga0268256_1027533 | 3300030500 | Bacteria | 1415 |
| 357 | Ga0307512_10065819 | 3300030522 | Bacteria | 2743 |
| 358 | Ga0307512_10084168 | 3300030522 | Bacteria | 2263 |
| 359 | Ga0265331_10018700 | 3300031250 | Bacteria | 3587 |
| 360 | Ga0307513_10066933 | 3300031456 | Bacteria | 3772 |
| 361 | Ga0307513_10101827 | 3300031456 | Bacteria | 2893 |
| 362 | Ga0307513_10463410 | 3300031456 | Bacteria | 990 |
| 363 | Ga0307509_10012445 | 3300031507 | Bacteria | 10177 |
| 364 | Ga0307509_10014214 | 3300031507 | Bacteria | 9376 |
| 365 | Ga0307509_10022560 | 3300031507 | Bacteria | 7092 |
| 366 | Ga0307509_10153052 | 3300031507 | Bacteria | 2218 |
| 367 | Ga0307408_100001072 | 3300031548 | Bacteria | 20974 |
| 368 | Ga0307508_10000204 | 3300031616 | Bacteria | 71518 |
| 369 | Ga0307508_10015442 | 3300031616 | Bacteria | 6955 |
| 370 | Ga0307514_10030723 | 3300031649 | Bacteria | 4311 |
| 371 | Ga0307514_10261641 | 3300031649 | Bacteria | 1012 |
| 372 | Ga0265314_10004469 | 3300031711 | Bacteria | 12969 |
| 373 | Ga0307516_10115391 | 3300031730 | Bacteria | 2481 |
| 374 | Ga0307516_10370432 | 3300031730 | Bacteria | 1095 |
| 375 | Ga0307518_10401184 | 3300031838 | Bacteria | 765 |
| 376 | Ga0307409_100240448 | 3300031995 | Bacteria | 1648 |
| 377 | Ga0373930_0054339 | 3300034816 | Bacteria | 881 |
| 378 | Ga0373934_0016237 | 3300035086 | Bacteria | 2830 |
| 379 | Ga0373923_0037327 | 3300035111 | Bacteria | 1987 |
| 380 | Ga0373936_0045157 | 3300035113 | Bacteria | 1774 |
| 381 | Ga0373953_0002534 | 3300035117 | Bacteria | 5519 |
| 382 | Ga0373953_0052967 | 3300035117 | Bacteria | 1643 |
| 383 | Ga0373954_0001622 | 3300035118 | Bacteria | 9199 |
| 384 | Ga0373956_0041514 | 3300035119 | Bacteria | 2042 |
| 385 | Ga0373955_0007992 | 3300035172 | Bacteria | 4888 |
| 386 | Ga0373924_0048578 | 3300035410 | Bacteria | 1753 |
| 387 | Ga0373931_0021864 | 3300035691 | Bacteria | 3213 |
| 388 | Ga0373935_0156296 | 3300035692 | Bacteria | 1551 |
| 389 | Ga0373927_0088815 | 3300035695 | Bacteria | 2007 |
| 390 | Ga0373933_0143550 | 3300035724 | Bacteria | 1508 |
| 391 | Ga0395899_0012785 | 3300037312 | Bacteria | 6431 |
| 392 | Ga0395900_0002388 | 3300037418 | Bacteria | 20734 |
| 393 | Ga0395900_0005683 | 3300037418 | Bacteria | 13040 |
| 394 | Ga0395898_0246500 | 3300037466 | Bacteria | 1704 |
| 395 | Ga0395905_0076340 | 3300037471 | Bacteria | 3140 |
| 396 | Ga0395905_0281177 | 3300037471 | Bacteria | 1550 |
| 397 | Ga0395901_0019835 | 3300038443 | Bacteria | 6877 |
| 398 | Ga0436365_0404413 | 3300039437 | Bacteria | 2699 |
| 399 | Ga0436361_0298749 | 3300039447 | Bacteria | 31426 |
| 400 | Ga0436361_0417552 | 3300039447 | Bacteria | 13691 |
| 401 | Ga0436363_0102659 | 3300039450 | Bacteria | 2718 |
| 402 | Ga0451802_0204181 | 3300041460 | Bacteria | 846 |
| 403 | Ga0466986_0020637 | 3300044650 | Bacteria | 4343 |
| 404 | Ga0466965_0060143 | 3300044683 | Bacteria | 1897 |
| 405 | Ga0466964_0010177 | 3300044706 | Bacteria | 3545 |
| 406 | Ga0466957_0186962 | 3300044842 | Bacteria | 1355 |
| 407 | Ga0451576_0000219 | 3300045051 | Bacteria | 141949 |
| 408 | Ga0451576_1022860 | 3300045051 | Bacteria | 866 |
| 409 | Ga0466958_0568108 | 3300045836 | Bacteria | 737 |
| 410 | Ga0466967_0037796 | 3300045976 | Bacteria | 4135 |
| 411 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 412 | Ga0495592_0043346 | 3300046454 | Bacteria | 3366 |
| 413 | Ga0495603_0091264 | 3300046455 | Bacteria | 1781 |
| 414 | Ga0495603_0278203 | 3300046455 | Bacteria | 962 |
| 415 | Ga0495590_0005074 | 3300046457 | Bacteria | 5251 |
| 416 | Ga0495590_0005591 | 3300046457 | Bacteria | 4963 |
| 417 | Ga0495638_0031939 | 3300046460 | Bacteria | 3381 |
| 418 | Ga0495638_0038165 | 3300046460 | Bacteria | 3054 |
| 419 | Ga0495638_0368939 | 3300046460 | Bacteria | 753 |
| 420 | Ga0495651_0007885 | 3300046462 | Bacteria | 8157 |
| 421 | Ga0495651_0041968 | 3300046462 | Bacteria | 3553 |
| 422 | Ga0495653_0001329 | 3300046463 | Bacteria | 19191 |
| 423 | Ga0495653_0281795 | 3300046463 | Bacteria | 1090 |
| 424 | Ga0495653_0312402 | 3300046463 | Bacteria | 1021 |
| 425 | Ga0495650_0000067 | 3300046471 | Bacteria | 269882 |
| 426 | Ga0495650_0001377 | 3300046471 | Bacteria | 23996 |
| 427 | Ga0495650_0006331 | 3300046471 | Bacteria | 7401 |
| 428 | Ga0495650_0098159 | 3300046471 | Bacteria | 1103 |
| 429 | Ga0495580_0000022 | 3300046472 | Bacteria | 89749 |
| 430 | Ga0495580_0013347 | 3300046472 | Bacteria | 6275 |
| 431 | Ga0495580_0070401 | 3300046472 | Bacteria | 2443 |
| 432 | Ga0495605_0000338 | 3300046474 | Bacteria | 46528 |
| 433 | Ga0495605_0001573 | 3300046474 | Bacteria | 14825 |
| 434 | Ga0495605_0005932 | 3300046474 | Bacteria | 7062 |
| 435 | Ga0495605_0023002 | 3300046474 | Bacteria | 3283 |
| 436 | Ga0495639_0100021 | 3300046475 | Bacteria | 1368 |
| 437 | Ga0495664_0034872 | 3300046477 | Bacteria | 2961 |
| 438 | Ga0495584_0037839 | 3300046491 | Bacteria | 2439 |
| 439 | Ga0495585_0000541 | 3300046492 | Bacteria | 35747 |
| 440 | Ga0495585_0151390 | 3300046492 | Bacteria | 1209 |
| 441 | Ga0495596_0000064 | 3300046500 | Bacteria | 77744 |
| 442 | Ga0495596_0007244 | 3300046500 | Bacteria | 5018 |
| 443 | Ga0495596_0012851 | 3300046500 | Bacteria | 3571 |
| 444 | Ga0495607_0007594 | 3300046501 | Bacteria | 7478 |
| 445 | Ga0495583_0009912 | 3300046506 | Bacteria | 5633 |
| 446 | Ga0495583_0057647 | 3300046506 | Bacteria | 1745 |
| 447 | Ga0495583_0092295 | 3300046506 | Bacteria | 1302 |
| 448 | Ga0495606_0000873 | 3300046507 | Bacteria | 45086 |
| 449 | Ga0495606_0085957 | 3300046507 | Bacteria | 1944 |
| 450 | Ga0495606_0123541 | 3300046507 | Bacteria | 1546 |
| 451 | Ga0495606_0172866 | 3300046507 | Bacteria | 1252 |
| 452 | Ga0495608_0068548 | 3300046511 | Bacteria | 2319 |
| 453 | Ga0495610_0000012 | 3300046512 | Bacteria | 517442 |
| 454 | Ga0495610_0000545 | 3300046512 | Bacteria | 37663 |
| 455 | Ga0495610_0138379 | 3300046512 | Bacteria | 1050 |
| 456 | Ga0495616_0019456 | 3300046513 | Bacteria | 3705 |
| 457 | Ga0495618_0027335 | 3300046514 | Bacteria | 3551 |
| 458 | Ga0495620_0010312 | 3300046515 | Bacteria | 4931 |
| 459 | Ga0495628_0023140 | 3300046516 | Bacteria | 5102 |
| 460 | Ga0495628_0044505 | 3300046516 | Bacteria | 3531 |
| 461 | Ga0495628_0163218 | 3300046516 | Bacteria | 1692 |
| 462 | Ga0495630_0004503 | 3300046517 | Bacteria | 9760 |
| 463 | Ga0495630_0007646 | 3300046517 | Bacteria | 7729 |
| 464 | Ga0495630_0038278 | 3300046517 | Bacteria | 3587 |
| 465 | Ga0495630_0129848 | 3300046517 | Bacteria | 1913 |
| 466 | Ga0495632_0005360 | 3300046519 | Bacteria | 8492 |
| 467 | Ga0495637_0042020 | 3300046520 | Bacteria | 1958 |
| 468 | Ga0495643_0081534 | 3300046522 | Bacteria | 1682 |
| 469 | Ga0495643_0099290 | 3300046522 | Bacteria | 1494 |
| 470 | Ga0495648_0000488 | 3300046524 | Bacteria | 42550 |
| 471 | Ga0495648_0015815 | 3300046524 | Bacteria | 5455 |
| 472 | Ga0495648_0133194 | 3300046524 | Bacteria | 1318 |
| 473 | Ga0495648_0235193 | 3300046524 | Bacteria | 894 |
| 474 | Ga0495648_0261869 | 3300046524 | Bacteria | 829 |
| 475 | Ga0495666_0000640 | 3300046526 | Bacteria | 15782 |
| 476 | Ga0495666_0000647 | 3300046526 | Bacteria | 15640 |
| 477 | Ga0495666_0031773 | 3300046526 | Bacteria | 2587 |
| 478 | Ga0495642_0025633 | 3300046528 | Bacteria | 2338 |
| 479 | Ga0495642_0047751 | 3300046528 | Bacteria | 1754 |
| 480 | Ga0495652_0056516 | 3300046529 | Bacteria | 3332 |
| 481 | Ga0495652_0305205 | 3300046529 | Bacteria | 1155 |
| 482 | Ga0495654_0000179 | 3300046530 | Bacteria | 62287 |
| 483 | Ga0495665_0000343 | 3300046531 | Bacteria | 23520 |
| 484 | Ga0495665_0005986 | 3300046531 | Bacteria | 6556 |
| 485 | Ga0495665_0070081 | 3300046531 | Bacteria | 1848 |
| 486 | Ga0495640_0016185 | 3300046533 | Bacteria | 5582 |
| 487 | Ga0495586_0211055 | 3300046535 | Bacteria | 1102 |
| 488 | Ga0495587_0082338 | 3300046536 | Bacteria | 1865 |
| 489 | Ga0495587_0172481 | 3300046536 | Bacteria | 1228 |
| 490 | Ga0495609_0001589 | 3300046538 | Bacteria | 14847 |
| 491 | Ga0495609_0195937 | 3300046538 | Bacteria | 846 |
| 492 | Ga0495656_0014508 | 3300046615 | Bacteria | 2956 |
| 493 | Ga0495668_0133670 | 3300046616 | Bacteria | 1358 |
| 494 | Ga0495634_0018730 | 3300046642 | Bacteria | 4924 |
| 495 | Ga0495634_0038615 | 3300046642 | Bacteria | 3254 |
| 496 | Ga0495634_0191529 | 3300046642 | Bacteria | 1275 |
| 497 | Ga0495611_0036848 | 3300046648 | Bacteria | 2172 |
| 498 | Ga0495625_0004802 | 3300046660 | Bacteria | 12639 |
| 499 | Ga0495625_0328673 | 3300046660 | Bacteria | 972 |
| 500 | Ga0495661_0000010 | 3300046665 | Bacteria | 284261 |
| 501 | Ga0495661_0014051 | 3300046665 | Bacteria | 5367 |
| 502 | Ga0495661_0027807 | 3300046665 | Bacteria | 3627 |
| 503 | Ga0495661_0110498 | 3300046665 | Bacteria | 1533 |
| 504 | Ga0495657_0292533 | 3300046675 | Bacteria | 972 |
| 505 | Ga0495599_0036083 | 3300046678 | Bacteria | 3103 |
| 506 | Ga0495599_0094493 | 3300046678 | Bacteria | 1865 |
| 507 | Ga0495599_0265830 | 3300046678 | Bacteria | 1041 |
| 508 | Ga0495623_0030411 | 3300046679 | Bacteria | 3473 |
| 509 | Ga0495646_0047046 | 3300046680 | Bacteria | 2628 |
| 510 | Ga0495658_0009089 | 3300046683 | Bacteria | 4941 |
| 511 | Ga0495658_0038342 | 3300046683 | Bacteria | 2653 |
| 512 | Ga0495613_0093372 | 3300046689 | Bacteria | 2178 |
| 513 | Ga0495624_0000591 | 3300046690 | Bacteria | 28234 |
| 514 | Ga0495624_0003991 | 3300046690 | Bacteria | 10858 |
| 515 | Ga0495624_0006876 | 3300046690 | Bacteria | 8031 |
| 516 | Ga0495624_0027630 | 3300046690 | Bacteria | 3714 |
| 517 | Ga0495624_0139487 | 3300046690 | Bacteria | 1486 |
| 518 | Ga0495670_0125945 | 3300046691 | Bacteria | 1333 |
| 519 | Ga0495671_0000006 | 3300046692 | Bacteria | 500471 |
| 520 | Ga0495671_0002046 | 3300046692 | Bacteria | 12914 |
| 521 | Ga0495671_0024517 | 3300046692 | Bacteria | 3141 |
| 522 | Ga0495671_0199409 | 3300046692 | Bacteria | 971 |
| 523 | Ga0495649_0014012 | 3300046694 | Bacteria | 4610 |
| 524 | Ga0495649_0024624 | 3300046694 | Bacteria | 3355 |
| 525 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 526 | Ga0495589_0159891 | 3300046794 | Bacteria | 1073 |
| 527 | Ga0495600_0049868 | 3300046809 | Bacteria | 2731 |
| 528 | Ga0495600_0237127 | 3300046809 | Bacteria | 1163 |
| 529 | Ga0495581_0030225 | 3300047315 | Bacteria | 3140 |
| 530 | Ga0495604_0047540 | 3300047317 | Bacteria | 3341 |
| 531 | Ga0495604_0105019 | 3300047317 | Bacteria | 2068 |
| 532 | Ga0495636_0022136 | 3300047318 | Bacteria | 2568 |
| 533 | Ga0495674_0002270 | 3300047319 | Bacteria | 18876 |
| 534 | Ga0495674_0003547 | 3300047319 | Bacteria | 15166 |
| 535 | Ga0495674_0017065 | 3300047319 | Bacteria | 6762 |
| 536 | Ga0495674_0392107 | 3300047319 | Bacteria | 1122 |
| 537 | Ga0495672_0024400 | 3300047320 | Bacteria | 3896 |
| 538 | Ga0495672_0120052 | 3300047320 | Bacteria | 1398 |
| 539 | Ga0495676_0013598 | 3300047321 | Bacteria | 7308 |
| 540 | Ga0495676_0027523 | 3300047321 | Bacteria | 4872 |
| 541 | Ga0495676_0127291 | 3300047321 | Bacteria | 1844 |
| 542 | Ga0495676_0231914 | 3300047321 | Bacteria | 1267 |
| 543 | Ga0495680_0066087 | 3300047322 | Bacteria | 2768 |
| 544 | Ga0495680_0082056 | 3300047322 | Bacteria | 2433 |
| 545 | Ga0495683_0012249 | 3300047323 | Bacteria | 4505 |
| 546 | Ga0495683_0012638 | 3300047323 | Bacteria | 4433 |
| 547 | Ga0495687_001305 | 3300047443 | Bacteria | 23391 |
| 548 | Ga0495687_004784 | 3300047443 | Bacteria | 8936 |
| 549 | Ga0495687_069145 | 3300047443 | Bacteria | 1423 |
| 550 | Ga0495675_0016284 | 3300047444 | Bacteria | 4703 |
| 551 | Ga0495675_0016313 | 3300047444 | Bacteria | 4698 |
| 552 | Ga0495675_0052393 | 3300047444 | Bacteria | 2591 |
| 553 | Ga0495679_000022 | 3300047446 | Bacteria | 215296 |
| 554 | Ga0495679_000063 | 3300047446 | Bacteria | 103758 |
| 555 | Ga0495679_021066 | 3300047446 | Bacteria | 2259 |
| 556 | Ga0495673_0007417 | 3300047469 | Bacteria | 6307 |
| 557 | Ga0495673_0113417 | 3300047469 | Bacteria | 1081 |
| 558 | Ga0495684_0065247 | 3300047471 | Bacteria | 2768 |
| 559 | Ga0495684_0081512 | 3300047471 | Bacteria | 2455 |
| 560 | Ga0495686_0000906 | 3300047472 | Bacteria | 37300 |
| 561 | Ga0495686_0016430 | 3300047472 | Bacteria | 5019 |
| 562 | Ga0495686_0155448 | 3300047472 | Bacteria | 1340 |
| 563 | Ga0495593_0020498 | 3300047673 | Bacteria | 3703 |
| 564 | Ga0495593_0045729 | 3300047673 | Bacteria | 2335 |
| 565 | Ga0495602_0201405 | 3300048088 | Bacteria | 1518 |
| 566 | Ga0495626_0222237 | 3300048091 | Bacteria | 767 |
| 567 | Ga0496103_0018389 | 3300048906 | Bacteria | 4192 |
| 568 | Ga0496103_0285745 | 3300048906 | Bacteria | 1061 |
| 569 | Ga0496104_0506870 | 3300048907 | Bacteria | 1118 |
| 570 | Ga0496106_0000009 | 3300048909 | Bacteria | 238601 |
| 571 | Ga0496108_0048166 | 3300048911 | Bacteria | 3563 |
| 572 | Ga0496109_0115094 | 3300048912 | Bacteria | 2502 |
| 573 | Ga0496112_0761572 | 3300048915 | Bacteria | 894 |
| 574 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 575 | Ga0496116_0019948 | 3300048919 | Bacteria | 5111 |
| 576 | Ga0496117_0000463 | 3300048920 | Bacteria | 67832 |
| 577 | Ga0496117_0004391 | 3300048920 | Bacteria | 15625 |
| 578 | Ga0496117_0047596 | 3300048920 | Bacteria | 3073 |
| 579 | Ga0496117_0065741 | 3300048920 | Bacteria | 2463 |
| 580 | Ga0496118_0016438 | 3300048921 | Bacteria | 6788 |
| 581 | Ga0496118_0039111 | 3300048921 | Bacteria | 3789 |
| 582 | Ga0496119_0001547 | 3300048922 | Bacteria | 27462 |
| 583 | Ga0496119_0006664 | 3300048922 | Bacteria | 10622 |
| 584 | Ga0496120_0000052 | 3300048923 | Bacteria | 186071 |
| 585 | Ga0496120_0001403 | 3300048923 | Bacteria | 29166 |
| 586 | Ga0496121_0002315 | 3300048924 | Bacteria | 29518 |
| 587 | Ga0496121_0018569 | 3300048924 | Bacteria | 7004 |
| 588 | Ga0496121_0020758 | 3300048924 | Bacteria | 6477 |
| 589 | Ga0496121_0051649 | 3300048924 | Bacteria | 3460 |
| 590 | Ga0496121_0077937 | 3300048924 | Bacteria | 2637 |
| 591 | Ga0496121_0082005 | 3300048924 | Bacteria | 2551 |
| 592 | Ga0496121_0373910 | 3300048924 | Bacteria | 942 |
| 593 | Ga0496122_0005874 | 3300048925 | Bacteria | 14380 |
| 594 | Ga0496123_0002314 | 3300048926 | Bacteria | 23928 |
| 595 | Ga0496123_0297012 | 3300048926 | Bacteria | 773 |
| 596 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 597 | Ga0496124_0024477 | 3300048927 | Bacteria | 5487 |
| 598 | Ga0496125_0002936 | 3300048928 | Bacteria | 21466 |
| 599 | Ga0496125_0077506 | 3300048928 | Bacteria | 2562 |
| 600 | Ga0496126_0000099 | 3300048929 | Bacteria | 204249 |
| 601 | Ga0496126_0000414 | 3300048929 | Bacteria | 86330 |
| 602 | Ga0496126_0008498 | 3300048929 | Bacteria | 11062 |
| 603 | Ga0496126_0043863 | 3300048929 | Bacteria | 4122 |
| 604 | Ga0496126_0101735 | 3300048929 | Bacteria | 2513 |
| 605 | Ga0496126_0266554 | 3300048929 | Bacteria | 1423 |
| 606 | Ga0496126_0739240 | 3300048929 | Bacteria | 761 |
| 607 | Ga0495678_013915 | 3300049459 | Bacteria | 3760 |
| 608 | Ga0495678_024271 | 3300049459 | Bacteria | 2620 |
| 609 | Ga0495682_0016744 | 3300049460 | Bacteria | 2773 |
| 610 | Ga0495682_0081158 | 3300049460 | Bacteria | 1166 |
| 611 | Ga0501031_0000078 | 3300049568 | Bacteria | 51307 |
| 612 | Ga0501032_0000153 | 3300049569 | Bacteria | 55592 |
| 613 | Ga0501033_0002228 | 3300049570 | Bacteria | 16673 |
| 614 | Ga0501034_0000178 | 3300049571 | Bacteria | 118886 |
| 615 | Ga0501034_0001831 | 3300049571 | Bacteria | 26995 |
| 616 | Ga0501036_0000044 | 3300049572 | Bacteria | 78673 |
| 617 | Ga0501037_0000206 | 3300049573 | Bacteria | 52615 |
| 618 | Ga0501037_0455315 | 3300049573 | Bacteria | 872 |
| 619 | Ga0501038_0000071 | 3300049574 | Bacteria | 83962 |
| 620 | Ga0501039_0000104 | 3300049575 | Bacteria | 56961 |
| 621 | Ga0501040_0001995 | 3300049576 | Bacteria | 13159 |
| 622 | Ga0501043_0000134 | 3300049579 | Bacteria | 68845 |
| 623 | Ga0501047_0000364 | 3300049581 | Bacteria | 51328 |
| 624 | Ga0501068_0143384 | 3300049584 | Bacteria | 1498 |
| 625 | Ga0501035_0000379 | 3300049822 | Bacteria | 51213 |
| 626 | Ga0501044_0000194 | 3300049823 | Bacteria | 76727 |
| 627 | Ga0501045_0067547 | 3300049824 | Bacteria | 2626 |
| 628 | nmdc:mga03683_20798_c1 | 3300050489 | Bacteria | 2523 |
| 629 | nmdc:mga03683_8634_c1 | 3300050489 | Bacteria | 3590 |
| 630 | nmdc:mga03683_89068_c1 | 3300050489 | Bacteria | 1343 |
| 631 | nmdc:mga03n38_23716_c1 | 3300050490 | Bacteria | 2500 |
| 632 | nmdc:mga03n38_69885_c1 | 3300050490 | Bacteria | 1623 |
| 633 | nmdc:mga03n38_85091_c1 | 3300050490 | Bacteria | 1494 |
| 634 | nmdc:mga0yw44_36795_c1 | 3300050492 | Bacteria | 2886 |
| 635 | nmdc:mga0yw44_422215_c1 | 3300050492 | Bacteria | 903 |
| 636 | nmdc:mga0k408_107216_c1 | 3300050493 | Bacteria | 1650 |
| 637 | nmdc:mga0k408_15631_c2 | 3300050493 | Bacteria | 3392 |
| 638 | nmdc:mga0k408_16156_c1 | 3300050493 | Bacteria | 4138 |
| 639 | nmdc:mga0k408_3449_c1 | 3300050493 | Bacteria | 8373 |
| 640 | nmdc:mga0k408_3650_c1 | 3300050493 | Bacteria | 8147 |
| 641 | nmdc:mga0k408_4851_c1 | 3300050493 | Bacteria | 7136 |
| 642 | nmdc:mga0k408_5689_c1 | 3300050493 | Bacteria | 6629 |
| 643 | nmdc:mga06z11_14019_c1 | 3300050494 | Bacteria | 3537 |
| 644 | nmdc:mga06z11_141457_c1 | 3300050494 | Bacteria | 1361 |
| 645 | nmdc:mga06z11_417217_c1 | 3300050494 | Bacteria | 809 |
| 646 | nmdc:mga07m45_1253_c1 | 3300050496 | Bacteria | 11546 |
| 647 | nmdc:mga07m45_12928_c1 | 3300050496 | Bacteria | 4417 |
| 648 | nmdc:mga07m45_28763_c1 | 3300050496 | Bacteria | 3068 |
| 649 | nmdc:mga07m45_49009_c1 | 3300050496 | Bacteria | 2377 |
| 650 | nmdc:mga07m45_8279_c1 | 3300050496 | Bacteria | 5337 |
| 651 | nmdc:mga07m45_8482_c1 | 3300050496 | Bacteria | 5287 |
| 652 | nmdc:mga07m45_874_c1 | 3300050496 | Bacteria | 13122 |
| 653 | nmdc:mga05p37_60980_c1 | 3300050507 | Bacteria | 2652 |
| 654 | nmdc:mga0n895_298049_c1 | 3300050512 | Bacteria | 1634 |
| 655 | nmdc:mga08x19_6767_c1 | 3300050514 | Bacteria | 6807 |
| 656 | nmdc:mga08x19_71667_c1 | 3300050514 | Bacteria | 2259 |
| 657 | nmdc:mga0sz30_135896_c1 | 3300050516 | Bacteria | 1085 |
| 658 | nmdc:mga0sz30_8183_c2 | 3300050516 | Bacteria | 3356 |
| 659 | Ga0495601_0002885 | 3300053077 | Bacteria | 9782 |
| 660 | Ga0500578_0011098 | 3300053086 | Bacteria | 5822 |
| 661 | Ga0500578_0227963 | 3300053086 | Bacteria | 1130 |
| 662 | Ga0500651_0222487 | 3300053093 | Bacteria | 1106 |
| 663 | Ga0500618_050777 | 3300053125 | Bacteria | 939 |
| 664 | Ga0500658_0002381 | 3300053134 | Bacteria | 7285 |
| 665 | Ga0500568_0013094 | 3300053139 | Bacteria | 3793 |
| 666 | Ga0500637_0120390 | 3300053178 | Bacteria | 1523 |
| 667 | Ga0500645_001807 | 3300053730 | Bacteria | 10238 |
| 668 | Ga0500645_013146 | 3300053730 | Bacteria | 2663 |
| 669 | 2643906132 | 2643221579 | Bacteria | 4443405 |
| 670 | 2510249133 | 2510065045 | Bacteria | 7761063 |
| 671 | 2510281047 | 2510065053 | Bacteria | 5005518 |
| 672 | 2510294822 | 2510065055 | Bacteria | 5037935 |
| 673 | 2510309195 | 2510065058 | Bacteria | 5005894 |
| 674 | 2511248908 | 2511231003 | Bacteria | 5606035 |
| 675 | 2511249734 | 2511231003 | Bacteria | 5606035 |
| 676 | 2513568685 | 2513237084 | Bacteria | 7231967 |
| 677 | 2513955538 | 2513237150 | Bacteria | 6553639 |
| 678 | 2514040884 | 2513237165 | Bacteria | 6771773 |
| 679 | 2553005838 | 2551306416 | Bacteria | 6152985 |
| 680 | 2599445051 | 2599185178 | Bacteria | 5365746 |
| 681 | 2608380773 | 2606217733 | Bacteria | 6360972 |
| 682 | 2644302857 | 2643221654 | Bacteria | 5273570 |
| 683 | 2644400371 | 2643221672 | Bacteria | 6322190 |
| 684 | 2656277424 | 2654587920 | Bacteria | 5475511 |
| 685 | 2656279125 | 2654587920 | Bacteria | 5475511 |
| 686 | 2689444015 | 2687453601 | Bacteria | 5546041 |
| 687 | 2719642458 | 2718217991 | Bacteria | 7829542 |
| 688 | 2739293266 | 2738543021 | Bacteria | 5718241 |
| 689 | 2765571699 | 2765235838 | Bacteria | 5445269 |
| 690 | 2774131987 | 2773857672 | Bacteria | 4993178 |
| 691 | 2807179565 | 2806310673 | Bacteria | 4801221 |
| 692 | 2808984308 | 2808606386 | Bacteria | 4471946 |
| 693 | 2809130661 | 2808606415 | Bacteria | 4576710 |
| 694 | 2809149861 | 2808606419 | Bacteria | 4576925 |
| 695 | 2819618569 | 2818991449 | Bacteria | 5518009 |
| 696 | 2834644347 | 2834641062 | Bacteria | 5559922 |
| 697 | 2838684803 | 2838680041 | Bacteria | 6545511 |
| 698 | 2838698964 | 2838694306 | Bacteria | 6853137 |
| 699 | 2838712156 | 2838707686 | Bacteria | 6619912 |
| 700 | 2839098612 | 2839094727 | Bacteria | 5534556 |
| 701 | 2842122555 | 2842118031 | Bacteria | 7033875 |
| 702 | 2842241568 | 2842237096 | Bacteria | 6620661 |
| 703 | 2842295922 | 2842291075 | Bacteria | 7076806 |
| 704 | 2842374197 | 2842370503 | Bacteria | 7038661 |
| 705 | 2842382326 | 2842377471 | Bacteria | 7140707 |
| 706 | 2842389103 | 2842384541 | Bacteria | 7057858 |
| 707 | 2842806010 | 2842805378 | Bacteria | 5385175 |
| 708 | 2852619997 | 2852618963 | Bacteria | 4577824 |
| 709 | 2855736454 | 2855730933 | Bacteria | 7047938 |
| 710 | 2855773391 | 2855767633 | Bacteria | 7049357 |
| 711 | 2858696270 | 2858688981 | Bacteria | 8184122 |
| 712 | 2888368064 | 2888366609 | Bacteria | 5155009 |
| 713 | 2900580572 | 2900577576 | Bacteria | 5438534 |
| 714 | 2900638536 | 2900634093 | Bacteria | 10263517 |
| 715 | 2901303032 | 2901300506 | Bacteria | 8463898 |
| 716 | 2904429351 | 2904424332 | Bacteria | 7633521 |
| 717 | 2904444289 | 2904439833 | Bacteria | 5931679 |
| 718 | 2904533894 | 2904530477 | Bacteria | 5876334 |
| 719 | 2904589272 | 2904584206 | Bacteria | 6028872 |
| 720 | 2904594974 | 2904589729 | Bacteria | 6113573 |
| 721 | 2904606551 | 2904601388 | Bacteria | 5884906 |
| 722 | 2917834958 | 2917832318 | Bacteria | 5346010 |
| 723 | 2919051114 | 2919046199 | Bacteria | 5567169 |
| 724 | 2919084507 | 2919079590 | Bacteria | 5946433 |
| 725 | 2919128708 | 2919125081 | Bacteria | 5385106 |
| 726 | 2919503458 | 2919501602 | Bacteria | 5286340 |
| 727 | 2926065971 | 2926063275 | Bacteria | 5285848 |
| 728 | 2928060214 | 2928058823 | Bacteria | 5520022 |
| 729 | 2935898882 | 2935894831 | Bacteria | 6620579 |
| 730 | 2974301052 | 2974298342 | Bacteria | 4840922 |
| 731 | 2984503526 | 2984499530 | Bacteria | 5020881 |
| 732 | 2984507996 | 2984504281 | Bacteria | 5262371 |
| 733 | 640937030 | 640753048 | Bacteria | 5495657 |
| 734 | 642615482 | 642555113 | Bacteria | 8214658 |
| 735 | 642621075 | 642555113 | Bacteria | 8214658 |
| 736 | 644751488 | 644736347 | Bacteria | 6476522 |
| 737 | 8003404247 | 8003400568 | Bacteria | 5535898 |
| 738 | 8015394872 | 8015394850 | Bacteria | 5064660 |
| 739 | 8016729827 | 8016728285 | Bacteria | 5263933 |
| 740 | 8018154115 | 8018150411 | Bacteria | 5549903 |
| 741 | 8033234533 | 8033232454 | Bacteria | 3202805 |
| 742 | 8055307746 | 8055301274 | Bacteria | 8587385 |
| 743 | JGI24741J21665_1000369 | |||
| 744 | JGI24740J21852_10001501 | |||
| 745 | JGI24740J21852_10008613 | |||
| 746 | JGI25156J39149_1000226 | |||
| 747 | JGI25156J39149_1000457 | |||
| 748 | JGI25156J39149_1002321 | |||
| 749 | JGI25156J39149_1014190 | |||
| 750 | JGI25154J39366_1000925 | |||
| 751 | JGI25154J39366_1002083 | |||
| 752 | JGI25158J39367_1000006 | |||
| 753 | JGI25159J45721_1000955 | |||
| 754 | JGI25151J46595_10000868 | |||
| 755 | JGI25151J46595_10006764 | |||
| 756 | rootH2_10125873 | |||
| 757 | rootH1_10161873 | |||
| 758 | JGI25161J50226_1000052 | |||
| 759 | Ga0055538_1002531 | |||
| 760 | Ga0055539_1000078 | |||
| 761 | Ga0055539_1000104 | |||
| 762 | Ga0055533_1000084 | |||
| 763 | Ga0055533_1000946 | |||
| 764 | Ga0055525_1000112 | |||
| 765 | Ga0055525_1000245 | |||
| 766 | Ga0055535_1000229 | |||
| 767 | Ga0055542_1002814 | |||
| 768 | Ga0055529_1000064 | |||
| 769 | Ga0055526_1000193 | |||
| 770 | Ga0055526_1000563 | |||
| 771 | Ga0055526_1003347 | |||
| 772 | Ga0055526_1009481 | |||
| 773 | Ga0055537_1000060 | |||
| 774 | Ga0055537_1000514 | |||
| 775 | Ga0055524_1000263 | |||
| 776 | Ga0055524_1009149 | |||
| 777 | Ga0055524_1011593 | |||
| 778 | Ga0055536_1000195 | |||
| 779 | Ga0055534_1000009 | |||
| 780 | Ga0055534_1000710 | |||
| 781 | Ga0055534_1000845 | |||
| 782 | Ga0055528_1000012 | |||
| 783 | Ga0055530_10011488 | |||
| 784 | Ga0055540_1000365 | |||
| 785 | Ga0055531_10000454 | |||
| 786 | Ga0055541_1000055 | |||
| 787 | Ga0055541_1000236 | |||
| 788 | Ga0055543_1000038 | |||
| 789 | Ga0065165_1000117 | |||
| 790 | Ga0065707_10219170 | |||
| 791 | Ga0070676_10022339 | |||
| 792 | Ga0070676_10025379 | |||
| 793 | Ga0070670_100026170 | |||
| 794 | Ga0070670_100047641 | |||
| 795 | Ga0070677_10010141 | |||
| 796 | Ga0070677_10066040 | |||
| 797 | Ga0070666_10008536 | |||
| 798 | Ga0068868_100005862 | |||
| 799 | Ga0070660_100028306 | |||
| 800 | Ga0070661_100000086 | |||
| 801 | Ga0070669_100043440 | |||
| 802 | Ga0070675_100003180 | |||
| 803 | Ga0070675_100024981 | |||
| 804 | Ga0070671_100019225 | |||
| 805 | Ga0070674_100066440 | |||
| 806 | Ga0070673_100018078 | |||
| 807 | Ga0070667_100041257 | |||
| 808 | Ga0070667_100119620 | |||
| 809 | Ga0070667_100286366 | |||
| 810 | Ga0070700_100173676 | |||
| 811 | Ga0070708_100421982 | |||
| 812 | Ga0070663_100000008 | |||
| 813 | Ga0070663_100117202 | |||
| 814 | Ga0070678_100028471 | |||
| 815 | Ga0070678_100355146 | |||
| 816 | Ga0070662_100032991 | |||
| 817 | Ga0068867_100044856 | |||
| 818 | Ga0070707_100033508 | |||
| 819 | Ga0068853_100222086 | |||
| 820 | Ga0070672_100093643 | |||
| 821 | Ga0070686_100214341 | |||
| 822 | Ga0070665_100005314 | |||
| 823 | Ga0068855_100002159 | |||
| 824 | Ga0068855_100005393 | |||
| 825 | Ga0070664_100000009 | |||
| 826 | Ga0068857_100011248 | |||
| 827 | Ga0068857_100076197 | |||
| 828 | Ga0068857_100088447 | |||
| 829 | Ga0068854_100000024 | |||
| 830 | Ga0068854_100084113 | |||
| 831 | Ga0068856_100000019 | |||
| 832 | Ga0068856_100073614 | |||
| 833 | Ga0068852_100082745 | |||
| 834 | Ga0068852_100156478 | |||
| 835 | Ga0068859_100000133 | |||
| 836 | Ga0068859_100043840 | |||
| 837 | Ga0068864_100001250 | |||
| 838 | Ga0068866_10036697 | |||
| 839 | Ga0068866_10101057 | |||
| 840 | Ga0068866_10282877 | |||
| 841 | Ga0068851_10158668 | |||
| 842 | Ga0068863_100005731 | |||
| 843 | Ga0068858_100002132 | |||
| 844 | Ga0068858_100192128 | |||
| 845 | Ga0068860_100061058 | |||
| 846 | Ga0068862_100013318 | |||
| 847 | Ga0068862_100077746 | |||
| 848 | Ga0068862_100409347 | |||
| 849 | Ga0075368_10006655 | |||
| 850 | Ga0075368_10018365 | |||
| 851 | Ga0075368_10113430 | |||
| 852 | Ga0075363_100014803 | |||
| 853 | Ga0075364_10003498 | |||
| 854 | Ga0075364_10011010 | |||
| 855 | Ga0075362_10006536 | |||
| 856 | Ga0075362_10028681 | |||
| 857 | Ga0075362_10070784 | |||
| 858 | Ga0075367_10004846 | |||
| 859 | Ga0075367_10005944 | |||
| 860 | Ga0075367_10017103 | |||
| 861 | Ga0075367_10248397 | |||
| 862 | Ga0075369_10015092 | |||
| 863 | Ga0075366_10002580 | |||
| 864 | Ga0075366_10003197 | |||
| 865 | Ga0075366_10009381 | |||
| 866 | Ga0075366_10037856 | |||
| 867 | Ga0075366_10058362 | |||
| 868 | Ga0075366_10060910 | |||
| 869 | Ga0075366_10069603 | |||
| 870 | Ga0075366_10126576 | |||
| 871 | Ga0097621_100026446 | |||
| 872 | Ga0075370_10001421 | |||
| 873 | Ga0075370_10002322 | |||
| 874 | Ga0075370_10004186 | |||
| 875 | Ga0075370_10008164 | |||
| 876 | Ga0075370_10018172 | |||
| 877 | Ga0075370_10022238 | |||
| 878 | Ga0075370_10127081 | |||
| 879 | Ga0068871_100028383 | |||
| 880 | Ga0075428_100117122 | |||
| 881 | Ga0075428_100231028 | |||
| 882 | Ga0075433_10350460 | |||
| 883 | Ga0075436_100083157 | |||
| 884 | Ga0097620_100000133 | |||
| 885 | Ga0097620_100043840 | |||
| 886 | Ga0079104_1000981 | |||
| 887 | Ga0079104_1009557 | |||
| 888 | Ga0099826_10000021 | |||
| 889 | Ga0105251_10000119 | |||
| 890 | Ga0105251_10009294 | |||
| 891 | Ga0105251_10011487 | |||
| 892 | Ga0105251_10100281 | |||
| 893 | Ga0105244_10000216 | |||
| 894 | Ga0105244_10050773 | |||
| 895 | Ga0105250_10001281 | |||
| 896 | Ga0105240_10019531 | |||
| 897 | Ga0105240_10194851 | |||
| 898 | Ga0105240_10200358 | |||
| 899 | Ga0105245_10006724 | |||
| 900 | Ga0105245_10149100 | |||
| 901 | Ga0105247_10000103 | |||
| 902 | Ga0114129_10016285 | |||
| 903 | Ga0105243_10733848 | |||
| 904 | Ga0105241_10000004 | |||
| 905 | Ga0105248_10064141 | |||
| 906 | Ga0105248_10094740 | |||
| 907 | Ga0105248_10253180 | |||
| 908 | Ga0105237_10005998 | |||
| 909 | Ga0105237_10016397 | |||
| 910 | Ga0105237_10051254 | |||
| 911 | Ga0105237_10634643 | |||
| 912 | Ga0105238_10000039 | |||
| 913 | Ga0105238_10332945 | |||
| 914 | Ga0105249_10265310 | |||
| 915 | Ga0099796_10023884 | |||
| 916 | Ga0105239_10003085 | |||
| 917 | Ga0105239_10044552 | |||
| 918 | Ga0105246_10152632 | |||
| 919 | Ga0157373_10001832 | |||
| 920 | Ga0157371_10003951 | |||
| 921 | Ga0157370_10001398 | |||
| 922 | Ga0157369_10000723 | |||
| 923 | Ga0157369_10007814 | |||
| 924 | Ga0157369_10045584 | |||
| 925 | Ga0157374_10000699 | |||
| 926 | Ga0157378_10082857 | |||
| 927 | Ga0157378_10132119 | |||
| 928 | Ga0157378_10394154 | |||
| 929 | Ga0157375_10053321 | |||
| 930 | Ga0157375_10373065 | |||
| 931 | Ga0163163_10000957 | |||
| 932 | Ga0157380_10037401 | |||
| 933 | Ga0157380_10314794 | |||
| 934 | Ga0182008_10001015 | |||
| 935 | Ga0157379_10091696 | |||
| 936 | Ga0182006_1000428 | |||
| 937 | Ga0182007_10015494 | |||
| 938 | Ga0163161_10000001 | |||
| 939 | Ga0154015_1301551 | |||
| 940 | Ga0213872_10002397 | |||
| 941 | Ga0213872_10006953 | |||
| 942 | Ga0209435_100096 | |||
| 943 | Ga0209436_100033 | |||
| 944 | Ga0209784_100029 | |||
| 945 | Ga0209784_100035 | |||
| 946 | Ga0209784_100533 | |||
| 947 | Ga0209784_100849 | |||
| 948 | Ga0209566_100030 | |||
| 949 | Ga0209566_100040 | |||
| 950 | Ga0209566_100143 | |||
| 951 | Ga0209674_100057 | |||
| 952 | Ga0209674_100075 | |||
| 953 | Ga0209674_100232 | |||
| 954 | Ga0209674_103311 | |||
| 955 | Ga0209672_100147 | |||
| 956 | Ga0209672_110418 | |||
| 957 | Ga0209147_100008 | |||
| 958 | Ga0209563_100059 | |||
| 959 | Ga0209563_100117 | |||
| 960 | Ga0209563_102809 | |||
| 961 | Ga0209563_116273 | |||
| 962 | Ga0209258_100013 | |||
| 963 | Ga0209258_100124 | |||
| 964 | Ga0207425_1022748 | |||
| 965 | Ga0209646_1000046 | |||
| 966 | Ga0209646_1000093 | |||
| 967 | Ga0209026_1003869 | |||
| 968 | Ga0209026_1004472 | |||
| 969 | Ga0209677_100030 | |||
| 970 | Ga0209677_100036 | |||
| 971 | Ga0209677_101312 | |||
| 972 | Ga0209148_1000110 | |||
| 973 | Ga0209148_1002047 | |||
| 974 | Ga0209148_1002586 | |||
| 975 | Ga0209759_1000077 | |||
| 976 | Ga0209759_1000248 | |||
| 977 | Ga0209759_1000543 | |||
| 978 | Ga0209759_1000652 | |||
| 979 | Ga0209759_1009789 | |||
| 980 | Ga0209565_1000015 | |||
| 981 | Ga0209565_1000077 | |||
| 982 | Ga0209455_1000114 | |||
| 983 | Ga0209455_1000130 | |||
| 984 | Ga0209673_1000017 | |||
| 985 | Ga0209130_1000059 | |||
| 986 | Ga0209130_1020390 | |||
| 987 | Ga0209675_1000012 | |||
| 988 | Ga0209675_1000065 | |||
| 989 | Ga0209675_1000717 | |||
| 990 | Ga0209675_1004584 | |||
| 991 | Ga0209676_1000044 | |||
| 992 | Ga0209676_1000383 | |||
| 993 | Ga0209025_1001105 | |||
| 994 | Ga0209025_1002071 | |||
| 995 | Ga0209025_1004496 | |||
| 996 | Ga0209025_1010692 | |||
| 997 | Ga0209564_1000016 | |||
| 998 | Ga0209564_1000080 | |||
| 999 | Ga0209564_1000404 | |||
| 1000 | Ga0209564_1000643 | |||
| 1001 | Ga0209758_1022683 | |||
| 1002 | Ga0209050_1000952 | |||
| 1003 | Ga0209256_1000119 | |||
| 1004 | Ga0209256_1000127 | |||
| 1005 | Ga0209256_1000314 | |||
| 1006 | Ga0209051_1000259 | |||
| 1007 | Ga0209051_1002766 | |||
| 1008 | Ga0209051_1017508 | |||
| 1009 | Ga0209257_1000116 | |||
| 1010 | Ga0207656_10022496 | |||
| 1011 | Ga0207696_1000001 | |||
| 1012 | Ga0207713_1000024 | |||
| 1013 | Ga0207713_1000026 | |||
| 1014 | Ga0207713_1068833 | |||
| 1015 | Ga0207682_10007326 | |||
| 1016 | Ga0207710_10000140 | |||
| 1017 | Ga0207688_10010878 | |||
| 1018 | Ga0207680_10045672 | |||
| 1019 | Ga0207685_10074152 | |||
| 1020 | Ga0207645_10037393 | |||
| 1021 | Ga0207645_10158265 | |||
| 1022 | Ga0207645_10212918 | |||
| 1023 | Ga0207684_10033155 | |||
| 1024 | Ga0207654_10000006 | |||
| 1025 | Ga0207695_10004909 | |||
| 1026 | Ga0207695_10011481 | |||
| 1027 | Ga0207695_10034685 | |||
| 1028 | Ga0207695_10260303 | |||
| 1029 | Ga0207671_10027562 | |||
| 1030 | Ga0207671_10059521 | |||
| 1031 | Ga0207657_10064898 | |||
| 1032 | Ga0207649_10000081 | |||
| 1033 | Ga0207646_10378292 | |||
| 1034 | Ga0207681_10011021 | |||
| 1035 | Ga0207694_10000072 | |||
| 1036 | Ga0207650_10039869 | |||
| 1037 | Ga0207650_10072200 | |||
| 1038 | Ga0207650_10545901 | |||
| 1039 | Ga0207659_10001021 | |||
| 1040 | Ga0207659_10023971 | |||
| 1041 | Ga0207687_10020882 | |||
| 1042 | Ga0207687_10301685 | |||
| 1043 | Ga0207706_10081419 | |||
| 1044 | Ga0207706_10229926 | |||
| 1045 | Ga0207709_10293295 | |||
| 1046 | Ga0207709_10453106 | |||
| 1047 | Ga0207669_10146335 | |||
| 1048 | Ga0207669_10483764 | |||
| 1049 | Ga0207704_10045950 | |||
| 1050 | Ga0207665_10031054 | |||
| 1051 | Ga0207691_10056292 | |||
| 1052 | Ga0207711_10207181 | |||
| 1053 | Ga0207689_10070370 | |||
| 1054 | Ga0207689_10521481 | |||
| 1055 | Ga0207679_10000004 | |||
| 1056 | Ga0207667_10000066 | |||
| 1057 | Ga0207667_10005459 | |||
| 1058 | Ga0207667_10007628 | |||
| 1059 | Ga0207651_10014917 | |||
| 1060 | Ga0207640_10000066 | |||
| 1061 | Ga0207640_10063764 | |||
| 1062 | Ga0207658_10017873 | |||
| 1063 | Ga0207658_10291190 | |||
| 1064 | Ga0207658_10594793 | |||
| 1065 | Ga0207677_10003261 | |||
| 1066 | Ga0207677_10033011 | |||
| 1067 | Ga0207703_10007217 | |||
| 1068 | Ga0207639_10080108 | |||
| 1069 | Ga0207639_10275038 | |||
| 1070 | Ga0207678_10000006 | |||
| 1071 | Ga0207678_10059582 | |||
| 1072 | Ga0207678_10944745 | |||
| 1073 | Ga0207708_10309249 | |||
| 1074 | Ga0207702_10000317 | |||
| 1075 | Ga0207702_10075820 | |||
| 1076 | Ga0207641_10190701 | |||
| 1077 | Ga0207648_10058131 | |||
| 1078 | Ga0207648_10061349 | |||
| 1079 | Ga0207648_10065906 | |||
| 1080 | Ga0207676_10005979 | |||
| 1081 | Ga0207674_10018093 | |||
| 1082 | Ga0207674_10041960 | |||
| 1083 | Ga0207674_10064054 | |||
| 1084 | Ga0207683_10022244 | |||
| 1085 | Ga0207698_10053002 | |||
| 1086 | Ga0209281_1000008 | |||
| 1087 | Ga0209371_1024222 | |||
| 1088 | Ga0209179_1012174 | |||
| 1089 | Ga0209282_1000019 | |||
| 1090 | Ga0209813_10028659 | |||
| 1091 | Ga0268266_10018467 | |||
| 1092 | Ga0268265_10088690 | |||
| 1093 | Ga0268265_10559453 | |||
| 1094 | Ga0268264_10051066 | |||
| 1095 | Ga0307517_10108637 | |||
| 1096 | Ga0307515_10000090 | |||
| 1097 | Ga0307515_10055679 | |||
| 1098 | Ga0268256_1027533 | |||
| 1099 | Ga0307512_10065819 | |||
| 1100 | Ga0307512_10084168 | |||
| 1101 | Ga0265331_10018700 | |||
| 1102 | Ga0307513_10066933 | |||
| 1103 | Ga0307513_10101827 | |||
| 1104 | Ga0307513_10463410 | |||
| 1105 | Ga0307509_10012445 | |||
| 1106 | Ga0307509_10014214 | |||
| 1107 | Ga0307509_10022560 | |||
| 1108 | Ga0307509_10153052 | |||
| 1109 | Ga0307408_100001072 | |||
| 1110 | Ga0307508_10000204 | |||
| 1111 | Ga0307508_10015442 | |||
| 1112 | Ga0307514_10030723 | |||
| 1113 | Ga0307514_10261641 | |||
| 1114 | Ga0265314_10004469 | |||
| 1115 | Ga0307516_10115391 | |||
| 1116 | Ga0307516_10370432 | |||
| 1117 | Ga0307518_10401184 | |||
| 1118 | Ga0307409_100240448 | |||
| 1119 | Ga0373930_0054339 | |||
| 1120 | Ga0373934_0016237 | |||
| 1121 | Ga0373923_0037327 | |||
| 1122 | Ga0373936_0045157 | |||
| 1123 | Ga0373953_0002534 | |||
| 1124 | Ga0373953_0052967 | |||
| 1125 | Ga0373954_0001622 | |||
| 1126 | Ga0373956_0041514 | |||
| 1127 | Ga0373955_0007992 | |||
| 1128 | Ga0373924_0048578 | |||
| 1129 | Ga0373931_0021864 | |||
| 1130 | Ga0373935_0156296 | |||
| 1131 | Ga0373927_0088815 | |||
| 1132 | Ga0373933_0143550 | |||
| 1133 | Ga0395899_0012785 | |||
| 1134 | Ga0395900_0002388 | |||
| 1135 | Ga0395900_0005683 | |||
| 1136 | Ga0395898_0246500 | |||
| 1137 | Ga0395905_0076340 | |||
| 1138 | Ga0395905_0281177 | |||
| 1139 | Ga0395901_0019835 | |||
| 1140 | Ga0436365_0404413 | |||
| 1141 | Ga0436361_0298749 | |||
| 1142 | Ga0436361_0417552 | |||
| 1143 | Ga0436363_0102659 | |||
| 1144 | Ga0451802_0204181 | |||
| 1145 | Ga0466986_0020637 | |||
| 1146 | Ga0466965_0060143 | |||
| 1147 | Ga0466964_0010177 | |||
| 1148 | Ga0466957_0186962 | |||
| 1149 | Ga0451576_0000219 | |||
| 1150 | Ga0451576_1022860 | |||
| 1151 | Ga0466958_0568108 | |||
| 1152 | Ga0466967_0037796 | |||
| 1153 | Ga0495627_000018 | |||
| 1154 | Ga0495592_0043346 | |||
| 1155 | Ga0495603_0091264 | |||
| 1156 | Ga0495603_0278203 | |||
| 1157 | Ga0495590_0005074 | |||
| 1158 | Ga0495590_0005591 | |||
| 1159 | Ga0495638_0031939 | |||
| 1160 | Ga0495638_0038165 | |||
| 1161 | Ga0495638_0368939 | |||
| 1162 | Ga0495651_0007885 | |||
| 1163 | Ga0495651_0041968 | |||
| 1164 | Ga0495653_0001329 | |||
| 1165 | Ga0495653_0281795 | |||
| 1166 | Ga0495653_0312402 | |||
| 1167 | Ga0495650_0000067 | |||
| 1168 | Ga0495650_0001377 | |||
| 1169 | Ga0495650_0006331 | |||
| 1170 | Ga0495650_0098159 | |||
| 1171 | Ga0495580_0000022 | |||
| 1172 | Ga0495580_0013347 | |||
| 1173 | Ga0495580_0070401 | |||
| 1174 | Ga0495605_0000338 | |||
| 1175 | Ga0495605_0001573 | |||
| 1176 | Ga0495605_0005932 | |||
| 1177 | Ga0495605_0023002 | |||
| 1178 | Ga0495639_0100021 | |||
| 1179 | Ga0495664_0034872 | |||
| 1180 | Ga0495584_0037839 | |||
| 1181 | Ga0495585_0000541 | |||
| 1182 | Ga0495585_0151390 | |||
| 1183 | Ga0495596_0000064 | |||
| 1184 | Ga0495596_0007244 | |||
| 1185 | Ga0495596_0012851 | |||
| 1186 | Ga0495607_0007594 | |||
| 1187 | Ga0495583_0009912 | |||
| 1188 | Ga0495583_0057647 | |||
| 1189 | Ga0495583_0092295 | |||
| 1190 | Ga0495606_0000873 | |||
| 1191 | Ga0495606_0085957 | |||
| 1192 | Ga0495606_0123541 | |||
| 1193 | Ga0495606_0172866 | |||
| 1194 | Ga0495608_0068548 | |||
| 1195 | Ga0495610_0000012 | |||
| 1196 | Ga0495610_0000545 | |||
| 1197 | Ga0495610_0138379 | |||
| 1198 | Ga0495616_0019456 | |||
| 1199 | Ga0495618_0027335 | |||
| 1200 | Ga0495620_0010312 | |||
| 1201 | Ga0495628_0023140 | |||
| 1202 | Ga0495628_0044505 | |||
| 1203 | Ga0495628_0163218 | |||
| 1204 | Ga0495630_0004503 | |||
| 1205 | Ga0495630_0007646 | |||
| 1206 | Ga0495630_0038278 | |||
| 1207 | Ga0495630_0129848 | |||
| 1208 | Ga0495632_0005360 | |||
| 1209 | Ga0495637_0042020 | |||
| 1210 | Ga0495643_0081534 | |||
| 1211 | Ga0495643_0099290 | |||
| 1212 | Ga0495648_0000488 | |||
| 1213 | Ga0495648_0015815 | |||
| 1214 | Ga0495648_0133194 | |||
| 1215 | Ga0495648_0235193 | |||
| 1216 | Ga0495648_0261869 | |||
| 1217 | Ga0495666_0000640 | |||
| 1218 | Ga0495666_0000647 | |||
| 1219 | Ga0495666_0031773 | |||
| 1220 | Ga0495642_0025633 | |||
| 1221 | Ga0495642_0047751 | |||
| 1222 | Ga0495652_0056516 | |||
| 1223 | Ga0495652_0305205 | |||
| 1224 | Ga0495654_0000179 | |||
| 1225 | Ga0495665_0000343 | |||
| 1226 | Ga0495665_0005986 | |||
| 1227 | Ga0495665_0070081 | |||
| 1228 | Ga0495640_0016185 | |||
| 1229 | Ga0495586_0211055 | |||
| 1230 | Ga0495587_0082338 | |||
| 1231 | Ga0495587_0172481 | |||
| 1232 | Ga0495609_0001589 | |||
| 1233 | Ga0495609_0195937 | |||
| 1234 | Ga0495656_0014508 | |||
| 1235 | Ga0495668_0133670 | |||
| 1236 | Ga0495634_0018730 | |||
| 1237 | Ga0495634_0038615 | |||
| 1238 | Ga0495634_0191529 | |||
| 1239 | Ga0495611_0036848 | |||
| 1240 | Ga0495625_0004802 | |||
| 1241 | Ga0495625_0328673 | |||
| 1242 | Ga0495661_0000010 | |||
| 1243 | Ga0495661_0014051 | |||
| 1244 | Ga0495661_0027807 | |||
| 1245 | Ga0495661_0110498 | |||
| 1246 | Ga0495657_0292533 | |||
| 1247 | Ga0495599_0036083 | |||
| 1248 | Ga0495599_0094493 | |||
| 1249 | Ga0495599_0265830 | |||
| 1250 | Ga0495623_0030411 | |||
| 1251 | Ga0495646_0047046 | |||
| 1252 | Ga0495658_0009089 | |||
| 1253 | Ga0495658_0038342 | |||
| 1254 | Ga0495613_0093372 | |||
| 1255 | Ga0495624_0000591 | |||
| 1256 | Ga0495624_0003991 | |||
| 1257 | Ga0495624_0006876 | |||
| 1258 | Ga0495624_0027630 | |||
| 1259 | Ga0495624_0139487 | |||
| 1260 | Ga0495670_0125945 | |||
| 1261 | Ga0495671_0000006 | |||
| 1262 | Ga0495671_0002046 | |||
| 1263 | Ga0495671_0024517 | |||
| 1264 | Ga0495671_0199409 | |||
| 1265 | Ga0495649_0014012 | |||
| 1266 | Ga0495649_0024624 | |||
| 1267 | Ga0495589_0000002 | |||
| 1268 | Ga0495589_0159891 | |||
| 1269 | Ga0495600_0049868 | |||
| 1270 | Ga0495600_0237127 | |||
| 1271 | Ga0495581_0030225 | |||
| 1272 | Ga0495604_0047540 | |||
| 1273 | Ga0495604_0105019 | |||
| 1274 | Ga0495636_0022136 | |||
| 1275 | Ga0495674_0002270 | |||
| 1276 | Ga0495674_0003547 | |||
| 1277 | Ga0495674_0017065 | |||
| 1278 | Ga0495674_0392107 | |||
| 1279 | Ga0495672_0024400 | |||
| 1280 | Ga0495672_0120052 | |||
| 1281 | Ga0495676_0013598 | |||
| 1282 | Ga0495676_0027523 | |||
| 1283 | Ga0495676_0127291 | |||
| 1284 | Ga0495676_0231914 | |||
| 1285 | Ga0495680_0066087 | |||
| 1286 | Ga0495680_0082056 | |||
| 1287 | Ga0495683_0012249 | |||
| 1288 | Ga0495683_0012638 | |||
| 1289 | Ga0495687_001305 | |||
| 1290 | Ga0495687_004784 | |||
| 1291 | Ga0495687_069145 | |||
| 1292 | Ga0495675_0016284 | |||
| 1293 | Ga0495675_0016313 | |||
| 1294 | Ga0495675_0052393 | |||
| 1295 | Ga0495679_000022 | |||
| 1296 | Ga0495679_000063 | |||
| 1297 | Ga0495679_021066 | |||
| 1298 | Ga0495673_0007417 | |||
| 1299 | Ga0495673_0113417 | |||
| 1300 | Ga0495684_0065247 | |||
| 1301 | Ga0495684_0081512 | |||
| 1302 | Ga0495686_0000906 | |||
| 1303 | Ga0495686_0016430 | |||
| 1304 | Ga0495686_0155448 | |||
| 1305 | Ga0495593_0020498 | |||
| 1306 | Ga0495593_0045729 | |||
| 1307 | Ga0495602_0201405 | |||
| 1308 | Ga0495626_0222237 | |||
| 1309 | Ga0496103_0018389 | |||
| 1310 | Ga0496103_0285745 | |||
| 1311 | Ga0496104_0506870 | |||
| 1312 | Ga0496106_0000009 | |||
| 1313 | Ga0496108_0048166 | |||
| 1314 | Ga0496109_0115094 | |||
| 1315 | Ga0496112_0761572 | |||
| 1316 | Ga0496116_0000023 | |||
| 1317 | Ga0496116_0019948 | |||
| 1318 | Ga0496117_0000463 | |||
| 1319 | Ga0496117_0004391 | |||
| 1320 | Ga0496117_0047596 | |||
| 1321 | Ga0496117_0065741 | |||
| 1322 | Ga0496118_0016438 | |||
| 1323 | Ga0496118_0039111 | |||
| 1324 | Ga0496119_0001547 | |||
| 1325 | Ga0496119_0006664 | |||
| 1326 | Ga0496120_0000052 | |||
| 1327 | Ga0496120_0001403 | |||
| 1328 | Ga0496121_0002315 | |||
| 1329 | Ga0496121_0018569 | |||
| 1330 | Ga0496121_0020758 | |||
| 1331 | Ga0496121_0051649 | |||
| 1332 | Ga0496121_0077937 | |||
| 1333 | Ga0496121_0082005 | |||
| 1334 | Ga0496121_0373910 | |||
| 1335 | Ga0496122_0005874 | |||
| 1336 | Ga0496123_0002314 | |||
| 1337 | Ga0496123_0297012 | |||
| 1338 | Ga0496124_0000017 | |||
| 1339 | Ga0496124_0024477 | |||
| 1340 | Ga0496125_0002936 | |||
| 1341 | Ga0496125_0077506 | |||
| 1342 | Ga0496126_0000099 | |||
| 1343 | Ga0496126_0000414 | |||
| 1344 | Ga0496126_0008498 | |||
| 1345 | Ga0496126_0043863 | |||
| 1346 | Ga0496126_0101735 | |||
| 1347 | Ga0496126_0266554 | |||
| 1348 | Ga0496126_0739240 | |||
| 1349 | Ga0495678_013915 | |||
| 1350 | Ga0495678_024271 | |||
| 1351 | Ga0495682_0016744 | |||
| 1352 | Ga0495682_0081158 | |||
| 1353 | Ga0501031_0000078 | |||
| 1354 | Ga0501032_0000153 | |||
| 1355 | Ga0501033_0002228 | |||
| 1356 | Ga0501034_0000178 | |||
| 1357 | Ga0501034_0001831 | |||
| 1358 | Ga0501036_0000044 | |||
| 1359 | Ga0501037_0000206 | |||
| 1360 | Ga0501037_0455315 | |||
| 1361 | Ga0501038_0000071 | |||
| 1362 | Ga0501039_0000104 | |||
| 1363 | Ga0501040_0001995 | |||
| 1364 | Ga0501043_0000134 | |||
| 1365 | Ga0501047_0000364 | |||
| 1366 | Ga0501068_0143384 | |||
| 1367 | Ga0501035_0000379 | |||
| 1368 | Ga0501044_0000194 | |||
| 1369 | Ga0501045_0067547 | |||
| 1370 | nmdc:mga03683_20798_c1 | |||
| 1371 | nmdc:mga03683_8634_c1 | |||
| 1372 | nmdc:mga03683_89068_c1 | |||
| 1373 | nmdc:mga03n38_23716_c1 | |||
| 1374 | nmdc:mga03n38_69885_c1 | |||
| 1375 | nmdc:mga03n38_85091_c1 | |||
| 1376 | nmdc:mga0yw44_36795_c1 | |||
| 1377 | nmdc:mga0yw44_422215_c1 | |||
| 1378 | nmdc:mga0k408_107216_c1 | |||
| 1379 | nmdc:mga0k408_15631_c2 | |||
| 1380 | nmdc:mga0k408_16156_c1 | |||
| 1381 | nmdc:mga0k408_3449_c1 | |||
| 1382 | nmdc:mga0k408_3650_c1 | |||
| 1383 | nmdc:mga0k408_4851_c1 | |||
| 1384 | nmdc:mga0k408_5689_c1 | |||
| 1385 | nmdc:mga06z11_14019_c1 | |||
| 1386 | nmdc:mga06z11_141457_c1 | |||
| 1387 | nmdc:mga06z11_417217_c1 | |||
| 1388 | nmdc:mga07m45_1253_c1 | |||
| 1389 | nmdc:mga07m45_12928_c1 | |||
| 1390 | nmdc:mga07m45_28763_c1 | |||
| 1391 | nmdc:mga07m45_49009_c1 | |||
| 1392 | nmdc:mga07m45_8279_c1 | |||
| 1393 | nmdc:mga07m45_8482_c1 | |||
| 1394 | nmdc:mga07m45_874_c1 | |||
| 1395 | nmdc:mga05p37_60980_c1 | |||
| 1396 | nmdc:mga0n895_298049_c1 | |||
| 1397 | nmdc:mga08x19_6767_c1 | |||
| 1398 | nmdc:mga08x19_71667_c1 | |||
| 1399 | nmdc:mga0sz30_135896_c1 | |||
| 1400 | nmdc:mga0sz30_8183_c2 | |||
| 1401 | Ga0495601_0002885 | |||
| 1402 | Ga0500578_0011098 | |||
| 1403 | Ga0500578_0227963 | |||
| 1404 | Ga0500651_0222487 | |||
| 1405 | Ga0500618_050777 | |||
| 1406 | Ga0500658_0002381 | |||
| 1407 | Ga0500568_0013094 | |||
| 1408 | Ga0500637_0120390 | |||
| 1409 | Ga0500645_001807 | |||
| 1410 | Ga0500645_013146 | |||
| 1411 | 2643906132 | |||
| 1412 | 2510249133 | |||
| 1413 | 2510281047 | |||
| 1414 | 2510294822 | |||
| 1415 | 2510309195 | |||
| 1416 | 2511248908 | |||
| 1417 | 2511249734 | |||
| 1418 | 2513568685 | |||
| 1419 | 2513955538 | |||
| 1420 | 2514040884 | |||
| 1421 | 2553005838 | |||
| 1422 | 2599445051 | |||
| 1423 | 2608380773 | |||
| 1424 | 2644302857 | |||
| 1425 | 2644400371 | |||
| 1426 | 2656277424 | |||
| 1427 | 2656279125 | |||
| 1428 | 2689444015 | |||
| 1429 | 2719642458 | |||
| 1430 | 2739293266 | |||
| 1431 | 2765571699 | |||
| 1432 | 2774131987 | |||
| 1433 | 2807179565 | |||
| 1434 | 2808984308 | |||
| 1435 | 2809130661 | |||
| 1436 | 2809149861 | |||
| 1437 | 2819618569 | |||
| 1438 | 2834644347 | |||
| 1439 | 2838684803 | |||
| 1440 | 2838698964 | |||
| 1441 | 2838712156 | |||
| 1442 | 2839098612 | |||
| 1443 | 2842122555 | |||
| 1444 | 2842241568 | |||
| 1445 | 2842295922 | |||
| 1446 | 2842374197 | |||
| 1447 | 2842382326 | |||
| 1448 | 2842389103 | |||
| 1449 | 2842806010 | |||
| 1450 | 2852619997 | |||
| 1451 | 2855736454 | |||
| 1452 | 2855773391 | |||
| 1453 | 2858696270 | |||
| 1454 | 2888368064 | |||
| 1455 | 2900580572 | |||
| 1456 | 2900638536 | |||
| 1457 | 2901303032 | |||
| 1458 | 2904429351 | |||
| 1459 | 2904444289 | |||
| 1460 | 2904533894 | |||
| 1461 | 2904589272 | |||
| 1462 | 2904594974 | |||
| 1463 | 2904606551 | |||
| 1464 | 2917834958 | |||
| 1465 | 2919051114 | |||
| 1466 | 2919084507 | |||
| 1467 | 2919128708 | |||
| 1468 | 2919503458 | |||
| 1469 | 2926065971 | |||
| 1470 | 2928060214 | |||
| 1471 | 2935898882 | |||
| 1472 | 2974301052 | |||
| 1473 | 2984503526 | |||
| 1474 | 2984507996 | |||
| 1475 | 640937030 | |||
| 1476 | 642615482 | |||
| 1477 | 642621075 | |||
| 1478 | 644751488 | |||
| 1479 | 8003404247 | |||
| 1480 | 8015394872 | |||
| 1481 | 8016729827 | |||
| 1482 | 8018154115 | |||
| 1483 | 8033234533 | |||
| 1484 | 8055307746 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9855 | 1 | 118 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9841 | 1 | 118 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9832 | 2 | 117 |
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9825 | 1 | 119 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9802 | 1 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9941 | 1 | 79 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9924 | 1 | 79 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9842 | 1 | 79 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9817 | 1 | 79 | 3.40.50.2300 |
| af_P0ACZ8_124_225_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9809 | 126 | 223 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J3A137-F1-model_v4 | Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain | 0.9741 | 2 | 122 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A0M9XS95-F1-model_v4 | Transcriptional regulatory protein AfsQ1 | 0.9727 | 2 | 117 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3B8YBM5-F1-model_v4 | deleted | 0.9418 | 2 | 124 |
|
| AF-A0A0M9XS95-F1-model_v4 | Transcriptional regulatory protein AfsQ1 | 0.9185 | 2 | 117 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A534BQA9-F1-model_v4 | Response regulator transcription factor | 0.918 | 2 | 127 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |