F478671

General Info

Members Datasets Scaffolds Average Seq Length
743 256 1486 850

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10002271|JGI24735J21928_100022714
Length 1003
Sequence MARADAPTPMMIQYRRLKEEAGDALLFYRMGDFFELFFDDAKAASACLDIALTKRGEDAGEPIPMCGVPVHSAESYLARLIRGGHRVAIAEQTESPAEARKARGSKALVDRAIIRLVTPGTLTEETLLESGSPNWLAAIGRAGDDWAXAAADISTGRFELVSCGPGELAAELARLSPAETIAESPIPGIRSSAGKGGFDSIAGESALKSRFGLATLDGLGSPSRAELAAAGGLLAYVDATQKGGGILLDSPRRIARASHMAIDAATRDSLELTRSVXGTVAGSLLGEIDRCQTAAGRRLLCEDIAAPLTDRSAIEQRLVLVAWLHEDAIRRERVRSALKAMPDFARALARLAAGRGSPRDLALLRDGLAAAEALRXALDGEPDLPPLLKSLLPCLGGHDALVGKLARALVAAPPLDASKGGYIAEGFDEDLDTLRDAASNGRRAIAALEARYRDSTSIGSLKIRHNAVLGYHVEVXARHADGLMAPGSGFTHRQTLXGVVRFNSPELHEEASRVIEAGAHALAAEAVHAXELTXXAVAAAPQITGTAEAIARIDVAASHAQRAAEGGWTLPQLADQPCLELEAGRHPVVEAALRDGGERFVAXDLAMSSNDRLWLITGPNMGGKSTFLRQTALIAVLAQAGSFVPATRARXGIVDRLFSRVGASDNLARGRSTFMVEMVETAAILAQAGPSSLVILDEIGRGTSTYDGLAIAWAVVEAMHDQVKCRTLFATHYHELTRLAGRLDSLSLHHVRAREWKGDLVLLHEVADGAADXSYGIAVAKLAGLPPPVVARARSVLAKLEAGRDATGGIAAGLXDLPLFAAASXPXHGPNPLAVALEMXDPDRLTPREALDKLYXLKXLAQSSDGVSXPVTASNMAVSATXSSSLISGRQISNNSPSTTLRVSQPTRRRQPGGTTSGTWQISLVLSXPVCGGMCVPALRIEISAIGERCLMRGIGGSSSNRIVSGHRRAFSSTGSPSFHKWKALHRASLSRLCPREARSDCS

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
247 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
256 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.13
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 3.9
Rhizosphere 89.5
Stem 0
Stem Tuber 0.13
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002271 3300002067 Bacteria 6708
2 JGI24740J21852_10000664 3300001979 Bacteria 14892
3 JGI24737J22298_10000206 3300001990 Bacteria 19194
4 JGI24737J22298_10003453 3300001990 Bacteria 5584
5 JGI24738J21930_10000018 3300002075 Bacteria 30549
6 JGI24738J21930_10000329 3300002075 Bacteria 13054
7 JGI24744J21845_10002247 3300002077 Bacteria 3928
8 Ga0055536_1008392 3300003781 Bacteria 4446
9 Ga0055531_10006840 3300003794 Bacteria 6361
10 Ga0065165_1004269 3300005262 Bacteria 9029
11 Ga0070658_10000374 3300005327 Bacteria 38937
12 Ga0070658_10002325 3300005327 Bacteria 15950
13 Ga0070658_10003546 3300005327 Bacteria 12808
14 Ga0070658_10010136 3300005327 Bacteria 7564
15 Ga0070658_10016492 3300005327 Bacteria 5913
16 Ga0070658_10020039 3300005327 Bacteria 5357
17 Ga0070658_10052771 3300005327 Bacteria 3298
18 Ga0070676_10014345 3300005328 Bacteria 4354
19 Ga0070683_100004124 3300005329 Bacteria 11905
20 Ga0070683_100006559 3300005329 Bacteria 9772
21 Ga0070683_100013120 3300005329 Bacteria 7215
22 Ga0070690_100020446 3300005330 Bacteria 4033
23 Ga0070670_100000653 3300005331 Bacteria 26914
24 Ga0070670_100003772 3300005331 Bacteria 12620
25 Ga0070670_100010209 3300005331 Bacteria 8013
26 Ga0070670_100023106 3300005331 Bacteria 5352
27 Ga0070670_100037887 3300005331 Bacteria 4147
28 Ga0070677_10002908 3300005333 Bacteria 5498
29 Ga0068869_100000415 3300005334 Bacteria 23235
30 Ga0068869_100014747 3300005334 Bacteria 5227
31 Ga0070666_10000054 3300005335 Bacteria 95458
32 Ga0070666_10000701 3300005335 Bacteria 20310
33 Ga0070666_10019939 3300005335 Bacteria 4332
34 Ga0070680_100000584 3300005336 Bacteria 25171
35 Ga0070680_100002229 3300005336 Bacteria 14303
36 Ga0070680_100003391 3300005336 Bacteria 11890
37 Ga0070680_100027087 3300005336 Bacteria 4589
38 Ga0068868_100000581 3300005338 Bacteria 24527
39 Ga0068868_100000734 3300005338 Bacteria 22184
40 Ga0068868_100004915 3300005338 Bacteria 9386
41 Ga0068868_100005223 3300005338 Bacteria 9114
42 Ga0070660_100000116 3300005339 Bacteria 49715
43 Ga0070660_100000209 3300005339 Bacteria 39223
44 Ga0070660_100001300 3300005339 Bacteria 17017
45 Ga0070660_100002258 3300005339 Bacteria 13231
46 Ga0070689_100012545 3300005340 Bacteria 6109
47 Ga0070661_100000198 3300005344 Bacteria 49932
48 Ga0070661_100007737 3300005344 Bacteria 7420
49 Ga0070661_100010064 3300005344 Bacteria 6566
50 Ga0070661_100014601 3300005344 Bacteria 5537
51 Ga0070661_100026191 3300005344 Bacteria 4192
52 Ga0070692_10005845 3300005345 Bacteria 5293
53 Ga0070692_10015432 3300005345 Bacteria 3614
54 Ga0070668_100000007 3300005347 Bacteria 150621
55 Ga0070668_100000618 3300005347 Bacteria 23868
56 Ga0070668_100023246 3300005347 Bacteria 4688
57 Ga0070669_100000097 3300005353 Bacteria 86804
58 Ga0070669_100000613 3300005353 Bacteria 26394
59 Ga0070675_100001980 3300005354 Bacteria 15178
60 Ga0070675_100010635 3300005354 Bacteria 7193
61 Ga0070671_100000041 3300005355 Bacteria 91555
62 Ga0070671_100000068 3300005355 Bacteria 70220
63 Ga0070671_100001153 3300005355 Bacteria 19660
64 Ga0070671_100001512 3300005355 Bacteria 17427
65 Ga0070671_100001973 3300005355 Bacteria 15747
66 Ga0070671_100004025 3300005355 Bacteria 11581
67 Ga0070671_100004757 3300005355 Bacteria 10788
68 Ga0070671_100014134 3300005355 Bacteria 6446
69 Ga0070671_100014195 3300005355 Bacteria 6432
70 Ga0070671_100055446 3300005355 Bacteria 3297
71 Ga0070674_100001041 3300005356 Bacteria 14499
72 Ga0070673_100000858 3300005364 Bacteria 17053
73 Ga0070673_100003335 3300005364 Bacteria 9978
74 Ga0070673_100023532 3300005364 Bacteria 4501
75 Ga0070659_100000381 3300005366 Bacteria 33609
76 Ga0070659_100003487 3300005366 Bacteria 11195
77 Ga0070659_100004639 3300005366 Bacteria 9817
78 Ga0070659_100005141 3300005366 Bacteria 9381
79 Ga0070659_100005351 3300005366 Bacteria 9212
80 Ga0070659_100026671 3300005366 Bacteria 4447
81 Ga0070659_100030630 3300005366 Bacteria 4164
82 Ga0070667_100001661 3300005367 Bacteria 19879
83 Ga0070667_100003113 3300005367 Bacteria 14260
84 Ga0070667_100007351 3300005367 Bacteria 9152
85 Ga0070667_100009156 3300005367 Bacteria 8198
86 Ga0070667_100010193 3300005367 Bacteria 7765
87 Ga0070667_100017456 3300005367 Bacteria 5948
88 Ga0070667_100021092 3300005367 Bacteria 5412
89 Ga0070667_100066131 3300005367 Bacteria 3071
90 Ga0070709_10034557 3300005434 Bacteria 3066
91 Ga0070714_100009413 3300005435 Bacteria 7680
92 Ga0070713_100000066 3300005436 Bacteria 66945
93 Ga0070713_100004394 3300005436 Bacteria 9469
94 Ga0070700_100021864 3300005441 Bacteria 3723
95 Ga0070663_100033850 3300005455 Bacteria 3533
96 Ga0070678_100010042 3300005456 Bacteria 5762
97 Ga0070678_100035758 3300005456 Bacteria 3471
98 Ga0070662_100000012 3300005457 Bacteria 129380
99 Ga0070662_100000513 3300005457 Bacteria 23294
100 Ga0070662_100000723 3300005457 Bacteria 20188
101 Ga0070662_100002417 3300005457 Bacteria 11481
102 Ga0070662_100013671 3300005457 Bacteria 5404
103 Ga0070681_10019776 3300005458 Bacteria 6743
104 Ga0070681_10022891 3300005458 Bacteria 6278
105 Ga0070681_10091110 3300005458 Bacteria 2999
106 Ga0068867_100018169 3300005459 Bacteria 4997
107 Ga0068867_100027521 3300005459 Bacteria 4087
108 Ga0070679_100000001 3300005530 Bacteria 764811
109 Ga0070679_100001280 3300005530 Bacteria 22214
110 Ga0070684_100002224 3300005535 Bacteria 14298
111 Ga0068853_100000032 3300005539 Bacteria 114306
112 Ga0068853_100000570 3300005539 Bacteria 25231
113 Ga0068853_100005879 3300005539 Bacteria 9673
114 Ga0068853_100050193 3300005539 Bacteria 3589
115 Ga0068853_100053302 3300005539 Bacteria 3484
116 Ga0070672_100004663 3300005543 Bacteria 8989
117 Ga0070696_100003345 3300005546 Bacteria 10699
118 Ga0070693_100004519 3300005547 Bacteria 6588
119 Ga0070665_100000303 3300005548 Bacteria 76933
120 Ga0070665_100002063 3300005548 Bacteria 22556
121 Ga0070665_100003398 3300005548 Bacteria 17014
122 Ga0070665_100004218 3300005548 Bacteria 15126
123 Ga0070665_100006371 3300005548 Bacteria 12031
124 Ga0070665_100014300 3300005548 Bacteria 7970
125 Ga0070665_100021320 3300005548 Bacteria 6517
126 Ga0070665_100023313 3300005548 Bacteria 6231
127 Ga0070665_100025783 3300005548 Bacteria 5921
128 Ga0070704_100010200 3300005549 Bacteria 5713
129 Ga0070704_100028454 3300005549 Bacteria 3718
130 Ga0068855_100001355 3300005563 Bacteria 30354
131 Ga0068855_100006268 3300005563 Bacteria 14499
132 Ga0068855_100006747 3300005563 Bacteria 13921
133 Ga0068855_100010689 3300005563 Bacteria 11076
134 Ga0068855_100045776 3300005563 Bacteria 5173
135 Ga0070664_100000133 3300005564 Bacteria 49630
136 Ga0070664_100000848 3300005564 Bacteria 23593
137 Ga0070664_100001296 3300005564 Bacteria 19984
138 Ga0070664_100011633 3300005564 Bacteria 7141
139 Ga0070664_100015527 3300005564 Bacteria 6231
140 Ga0068857_100003085 3300005577 Bacteria 13780
141 Ga0068857_100024974 3300005577 Bacteria 5263
142 Ga0068857_100066943 3300005577 Bacteria 3196
143 Ga0068854_100001547 3300005578 Bacteria 13957
144 Ga0068854_100001986 3300005578 Bacteria 12512
145 Ga0068856_100000190 3300005614 Bacteria 64644
146 Ga0068856_100007786 3300005614 Bacteria 10469
147 Ga0068856_100009268 3300005614 Bacteria 9564
148 Ga0068856_100014423 3300005614 Bacteria 7635
149 Ga0068856_100029278 3300005614 Bacteria 5379
150 Ga0068856_100035110 3300005614 Bacteria 4913
151 Ga0068852_100001557 3300005616 Bacteria 15586
152 Ga0068852_100008321 3300005616 Bacteria 7635
153 Ga0068852_100015523 3300005616 Bacteria 5911
154 Ga0068852_100023324 3300005616 Bacteria 4979
155 Ga0068859_100000270 3300005617 Bacteria 51764
156 Ga0068859_100000685 3300005617 Bacteria 34047
157 Ga0068859_100001592 3300005617 Bacteria 23154
158 Ga0068859_100005151 3300005617 Bacteria 13272
159 Ga0068859_100016680 3300005617 Bacteria 7374
160 Ga0068859_100039659 3300005617 Bacteria 4725
161 Ga0068864_100000706 3300005618 Bacteria 28069
162 Ga0068864_100001341 3300005618 Bacteria 20455
163 Ga0068864_100003892 3300005618 Bacteria 12290
164 Ga0068864_100004090 3300005618 Bacteria 11979
165 Ga0068864_100005288 3300005618 Bacteria 10577
166 Ga0068864_100040491 3300005618 Bacteria 3986
167 Ga0068864_100047267 3300005618 Bacteria 3695
168 Ga0068861_100012258 3300005719 Bacteria 5978
169 Ga0068861_100031650 3300005719 Bacteria 3888
170 Ga0068861_100031870 3300005719 Bacteria 3877
171 Ga0068851_10010640 3300005834 Bacteria 4297
172 Ga0068851_10011140 3300005834 Bacteria 4210
173 Ga0068863_100000006 3300005841 Bacteria 265379
174 Ga0068863_100000027 3300005841 Bacteria 181884
175 Ga0068863_100005453 3300005841 Bacteria 12534
176 Ga0068863_100006973 3300005841 Bacteria 11078
177 Ga0068863_100022866 3300005841 Bacteria 5974
178 Ga0068863_100047769 3300005841 Bacteria 4059
179 Ga0068863_100060153 3300005841 Bacteria 3593
180 Ga0068863_100074369 3300005841 Bacteria 3214
181 Ga0068858_100000971 3300005842 Bacteria 29668
182 Ga0068858_100001171 3300005842 Bacteria 27205
183 Ga0068858_100001863 3300005842 Bacteria 21511
184 Ga0068858_100003773 3300005842 Bacteria 14974
185 Ga0068858_100016331 3300005842 Bacteria 6974
186 Ga0068858_100021830 3300005842 Bacteria 5979
187 Ga0068858_100035523 3300005842 Bacteria 4623
188 Ga0068860_100000093 3300005843 Bacteria 150034
189 Ga0068860_100001106 3300005843 Bacteria 29651
190 Ga0068860_100001602 3300005843 Bacteria 24319
191 Ga0068860_100001606 3300005843 Bacteria 24269
192 Ga0068860_100011638 3300005843 Bacteria 8678
193 Ga0068860_100021760 3300005843 Bacteria 6204
194 Ga0068860_100059698 3300005843 Bacteria 3626
195 Ga0068862_100002553 3300005844 Bacteria 16098
196 Ga0068862_100011671 3300005844 Bacteria 7250
197 Ga0068862_100024878 3300005844 Bacteria 5024
198 Ga0068862_100047100 3300005844 Bacteria 3678
199 Ga0070717_10003094 3300006028 Bacteria 11859
200 Ga0075367_10000329 3300006178 Bacteria 16805
201 Ga0068871_100019293 3300006358 Bacteria 5204
202 Ga0075428_100020860 3300006844 Bacteria 7254
203 Ga0075431_100013027 3300006847 Bacteria 8398
204 Ga0097620_100000270 3300006931 Bacteria 51764
205 Ga0097620_100000685 3300006931 Bacteria 34047
206 Ga0097620_100001592 3300006931 Bacteria 23154
207 Ga0097620_100005150 3300006931 Bacteria 13272
208 Ga0097620_100039658 3300006931 Bacteria 4725
209 Ga0105240_10018195 3300009093 Bacteria 9445
210 Ga0105240_10055409 3300009093 Bacteria 4963
211 Ga0105240_10072734 3300009093 Bacteria 4248
212 Ga0111539_10026357 3300009094 Bacteria 7108
213 Ga0105245_10000128 3300009098 Bacteria 72249
214 Ga0105245_10007030 3300009098 Bacteria 9875
215 Ga0105245_10013215 3300009098 Bacteria 7193
216 Ga0105245_10062817 3300009098 Bacteria 3351
217 Ga0105248_10000083 3300009177 Bacteria 110619
218 Ga0105248_10000170 3300009177 Bacteria 75642
219 Ga0105248_10000660 3300009177 Bacteria 39185
220 Ga0105248_10001290 3300009177 Bacteria 27898
221 Ga0105248_10001775 3300009177 Bacteria 24009
222 Ga0105248_10007989 3300009177 Bacteria 11618
223 Ga0105248_10011330 3300009177 Bacteria 9830
224 Ga0105248_10013432 3300009177 Bacteria 9015
225 Ga0105248_10018121 3300009177 Bacteria 7775
226 Ga0105248_10022678 3300009177 Bacteria 6967
227 Ga0105237_10019701 3300009545 Bacteria 6965
228 Ga0105237_10047358 3300009545 Bacteria 4322
229 Ga0105238_10002495 3300009551 Bacteria 18412
230 Ga0105238_10043610 3300009551 Bacteria 4539
231 Ga0105249_10000424 3300009553 Bacteria 40288
232 Ga0105249_10001126 3300009553 Bacteria 23796
233 Ga0099796_10000460 3300010159 Bacteria 6822
234 Ga0157371_10001109 3300013102 Bacteria 29189
235 Ga0157371_10001392 3300013102 Bacteria 25245
236 Ga0157371_10007119 3300013102 Bacteria 9087
237 Ga0157371_10045796 3300013102 Bacteria 3112
238 Ga0157370_10000497 3300013104 Bacteria 48916
239 Ga0157370_10008251 3300013104 Bacteria 11243
240 Ga0157370_10031202 3300013104 Bacteria 5215
241 Ga0157370_10056633 3300013104 Bacteria 3731
242 Ga0157369_10000137 3300013105 Bacteria 103542
243 Ga0157369_10003724 3300013105 Bacteria 18107
244 Ga0157369_10012543 3300013105 Bacteria 9616
245 Ga0157369_10013100 3300013105 Bacteria 9385
246 Ga0157369_10049758 3300013105 Bacteria 4542
247 Ga0157369_10095327 3300013105 Bacteria 3175
248 Ga0157378_10002066 3300013297 Bacteria 17982
249 Ga0157378_10013139 3300013297 Bacteria 7244
250 Ga0157378_10086770 3300013297 Bacteria 2837
251 Ga0163162_10001622 3300013306 Bacteria 21049
252 Ga0163162_10001754 3300013306 Bacteria 20326
253 Ga0163162_10018777 3300013306 Bacteria 6778
254 Ga0157372_10066976 3300013307 Bacteria 4035
255 Ga0157375_10005011 3300013308 Bacteria 11508
256 Ga0157375_10015938 3300013308 Bacteria 6740
257 Ga0157375_10019356 3300013308 Bacteria 6190
258 Ga0163163_10000364 3300014325 Bacteria 43563
259 Ga0163163_10000890 3300014325 Bacteria 25418
260 Ga0163163_10001686 3300014325 Bacteria 18653
261 Ga0163163_10008590 3300014325 Bacteria 9082
262 Ga0157380_10012004 3300014326 Bacteria 6269
263 Ga0157380_10018441 3300014326 Bacteria 5181
264 Ga0157377_10013175 3300014745 Bacteria 4180
265 Ga0157379_10000566 3300014968 Bacteria 29886
266 Ga0157379_10001895 3300014968 Bacteria 17285
267 Ga0163161_10042600 3300017792 Bacteria 3266
268 Ga0206353_10722721 3300020082 Bacteria 3365
269 Ga0213873_10000026 3300021358 Bacteria 74525
270 Ga0213876_10000149 3300021384 Bacteria 74548
271 Ga0213876_10000257 3300021384 Bacteria 49797
272 Ga0213875_10000166 3300021388 Bacteria 68786
273 Ga0213875_10000380 3300021388 Bacteria 40605
274 Ga0209565_1000172 3300025263 Bacteria 84264
275 Ga0209673_1001352 3300025273 Bacteria 24446
276 Ga0209675_1000773 3300025291 Bacteria 21404
277 Ga0209564_1004716 3300025295 Bacteria 8173
278 Ga0209758_1010218 3300025297 Bacteria 5659
279 Ga0209758_1021184 3300025297 Bacteria 3041
280 Ga0209050_1010889 3300025298 Bacteria 4407
281 Ga0209256_1001634 3300025299 Bacteria 21832
282 Ga0209257_1000192 3300025304 Bacteria 151851
283 Ga0207697_10000059 3300025315 Bacteria 45306
284 Ga0207682_10000177 3300025893 Bacteria 28884
285 Ga0207682_10002081 3300025893 Bacteria 9061
286 Ga0207688_10009969 3300025901 Bacteria 5169
287 Ga0207680_10000183 3300025903 Bacteria 30332
288 Ga0207680_10000328 3300025903 Bacteria 22845
289 Ga0207680_10000911 3300025903 Bacteria 13961
290 Ga0207680_10004458 3300025903 Bacteria 6643
291 Ga0207647_10000968 3300025904 Bacteria 22267
292 Ga0207647_10001938 3300025904 Bacteria 15816
293 Ga0207647_10003235 3300025904 Bacteria 12220
294 Ga0207647_10004569 3300025904 Bacteria 10254
295 Ga0207647_10006311 3300025904 Bacteria 8629
296 Ga0207647_10015394 3300025904 Bacteria 5245
297 Ga0207647_10020566 3300025904 Bacteria 4423
298 Ga0207645_10024979 3300025907 Bacteria 3870
299 Ga0207705_10000030 3300025909 Bacteria 239341
300 Ga0207705_10000072 3300025909 Bacteria 126043
301 Ga0207705_10000123 3300025909 Bacteria 85382
302 Ga0207705_10001768 3300025909 Bacteria 17064
303 Ga0207705_10002020 3300025909 Bacteria 15795
304 Ga0207705_10003058 3300025909 Bacteria 12757
305 Ga0207705_10003236 3300025909 Bacteria 12402
306 Ga0207705_10003465 3300025909 Bacteria 11997
307 Ga0207705_10004136 3300025909 Bacteria 11003
308 Ga0207705_10004488 3300025909 Bacteria 10551
309 Ga0207705_10006438 3300025909 Bacteria 8699
310 Ga0207705_10011779 3300025909 Bacteria 6320
311 Ga0207705_10014165 3300025909 Bacteria 5743
312 Ga0207705_10024163 3300025909 Bacteria 4337
313 Ga0207695_10005782 3300025913 Bacteria 16281
314 Ga0207695_10006988 3300025913 Bacteria 14488
315 Ga0207695_10010664 3300025913 Bacteria 11225
316 Ga0207695_10037772 3300025913 Bacteria 5208
317 Ga0207695_10041344 3300025913 Bacteria 4934
318 Ga0207693_10020496 3300025915 Bacteria 5258
319 Ga0207660_10001036 3300025917 Bacteria 18381
320 Ga0207660_10001792 3300025917 Bacteria 14339
321 Ga0207660_10002482 3300025917 Bacteria 12123
322 Ga0207660_10002582 3300025917 Bacteria 11894
323 Ga0207660_10004827 3300025917 Bacteria 8774
324 Ga0207660_10005438 3300025917 Bacteria 8264
325 Ga0207657_10000267 3300025919 Bacteria 55426
326 Ga0207657_10000496 3300025919 Bacteria 41552
327 Ga0207657_10002033 3300025919 Bacteria 21868
328 Ga0207657_10002077 3300025919 Bacteria 21670
329 Ga0207657_10002179 3300025919 Bacteria 21219
330 Ga0207657_10004176 3300025919 Bacteria 15303
331 Ga0207657_10005014 3300025919 Bacteria 13903
332 Ga0207657_10005448 3300025919 Bacteria 13286
333 Ga0207657_10006412 3300025919 Bacteria 12207
334 Ga0207657_10006813 3300025919 Bacteria 11794
335 Ga0207657_10008867 3300025919 Bacteria 10173
336 Ga0207657_10011037 3300025919 Bacteria 8978
337 Ga0207657_10014259 3300025919 Bacteria 7768
338 Ga0207657_10026695 3300025919 Bacteria 5300
339 Ga0207657_10041100 3300025919 Bacteria 4091
340 Ga0207657_10078768 3300025919 Bacteria 2774
341 Ga0207649_10000158 3300025920 Bacteria 55609
342 Ga0207649_10000993 3300025920 Bacteria 17572
343 Ga0207649_10037838 3300025920 Bacteria 2917
344 Ga0207652_10000034 3300025921 Bacteria 138571
345 Ga0207652_10000274 3300025921 Bacteria 53521
346 Ga0207652_10035188 3300025921 Bacteria 4226
347 Ga0207681_10000030 3300025923 Bacteria 173766
348 Ga0207681_10000737 3300025923 Bacteria 21451
349 Ga0207694_10002303 3300025924 Bacteria 15625
350 Ga0207694_10027856 3300025924 Bacteria 4305
351 Ga0207650_10003264 3300025925 Bacteria 11178
352 Ga0207650_10008777 3300025925 Bacteria 6908
353 Ga0207687_10000745 3300025927 Bacteria 21993
354 Ga0207700_10000045 3300025928 Bacteria 88536
355 Ga0207700_10047881 3300025928 Bacteria 3172
356 Ga0207664_10050213 3300025929 Bacteria 3288
357 Ga0207644_10000017 3300025931 Bacteria 177818
358 Ga0207644_10000098 3300025931 Bacteria 63062
359 Ga0207644_10000358 3300025931 Bacteria 29705
360 Ga0207644_10000415 3300025931 Bacteria 27794
361 Ga0207644_10004273 3300025931 Bacteria 9268
362 Ga0207644_10015213 3300025931 Bacteria 5162
363 Ga0207690_10000160 3300025932 Bacteria 52819
364 Ga0207690_10001997 3300025932 Bacteria 12499
365 Ga0207690_10002179 3300025932 Bacteria 11945
366 Ga0207690_10004007 3300025932 Bacteria 8696
367 Ga0207690_10006517 3300025932 Bacteria 6920
368 Ga0207706_10000041 3300025933 Bacteria 130090
369 Ga0207706_10000253 3300025933 Bacteria 58135
370 Ga0207706_10000426 3300025933 Bacteria 45291
371 Ga0207706_10001436 3300025933 Bacteria 23850
372 Ga0207706_10003800 3300025933 Bacteria 14394
373 Ga0207706_10006444 3300025933 Bacteria 10902
374 Ga0207706_10012889 3300025933 Bacteria 7609
375 Ga0207706_10024797 3300025933 Bacteria 5375
376 Ga0207706_10032157 3300025933 Bacteria 4672
377 Ga0207706_10034375 3300025933 Bacteria 4510
378 Ga0207686_10014056 3300025934 Bacteria 4445
379 Ga0207670_10005825 3300025936 Bacteria 6803
380 Ga0207669_10008626 3300025937 Bacteria 4797
381 Ga0207691_10000563 3300025940 Bacteria 37125
382 Ga0207691_10001958 3300025940 Bacteria 20115
383 Ga0207691_10005229 3300025940 Bacteria 12521
384 Ga0207691_10037280 3300025940 Bacteria 4504
385 Ga0207711_10000374 3300025941 Bacteria 47567
386 Ga0207711_10000831 3300025941 Bacteria 30006
387 Ga0207711_10002128 3300025941 Bacteria 17852
388 Ga0207711_10002381 3300025941 Bacteria 16823
389 Ga0207711_10002712 3300025941 Bacteria 15625
390 Ga0207711_10003449 3300025941 Bacteria 13681
391 Ga0207711_10007702 3300025941 Bacteria 9000
392 Ga0207711_10007812 3300025941 Bacteria 8940
393 Ga0207711_10008412 3300025941 Bacteria 8629
394 Ga0207711_10013720 3300025941 Bacteria 6728
395 Ga0207689_10000128 3300025942 Bacteria 64122
396 Ga0207689_10010796 3300025942 Bacteria 7857
397 Ga0207689_10011804 3300025942 Bacteria 7483
398 Ga0207661_10001415 3300025944 Bacteria 16185
399 Ga0207661_10008050 3300025944 Bacteria 7513
400 Ga0207661_10028679 3300025944 Bacteria 4265
401 Ga0207679_10000532 3300025945 Bacteria 25751
402 Ga0207679_10012365 3300025945 Bacteria 5564
403 Ga0207679_10018481 3300025945 Bacteria 4671
404 Ga0207679_10021199 3300025945 Bacteria 4400
405 Ga0207679_10026459 3300025945 Bacteria 4001
406 Ga0207679_10040630 3300025945 Bacteria 3331
407 Ga0207679_10057252 3300025945 Bacteria 2882
408 Ga0207667_10001389 3300025949 Bacteria 30363
409 Ga0207667_10002612 3300025949 Bacteria 22331
410 Ga0207667_10005579 3300025949 Bacteria 15355
411 Ga0207667_10008667 3300025949 Bacteria 12056
412 Ga0207667_10019982 3300025949 Bacteria 7461
413 Ga0207651_10000785 3300025960 Bacteria 13640
414 Ga0207651_10001030 3300025960 Bacteria 12321
415 Ga0207651_10011884 3300025960 Bacteria 4894
416 Ga0207712_10006289 3300025961 Bacteria 7490
417 Ga0207668_10000054 3300025972 Bacteria 95426
418 Ga0207668_10002806 3300025972 Bacteria 10183
419 Ga0207668_10005448 3300025972 Bacteria 7495
420 Ga0207640_10000589 3300025981 Bacteria 21653
421 Ga0207640_10001476 3300025981 Bacteria 12682
422 Ga0207640_10002630 3300025981 Bacteria 9625
423 Ga0207640_10015445 3300025981 Bacteria 4420
424 Ga0207640_10027401 3300025981 Bacteria 3471
425 Ga0207658_10001748 3300025986 Bacteria 16348
426 Ga0207658_10002652 3300025986 Bacteria 12965
427 Ga0207658_10006047 3300025986 Bacteria 8263
428 Ga0207658_10006879 3300025986 Bacteria 7745
429 Ga0207658_10009750 3300025986 Bacteria 6521
430 Ga0207658_10015630 3300025986 Bacteria 5209
431 Ga0207658_10015732 3300025986 Bacteria 5194
432 Ga0207677_10002148 3300026023 Bacteria 10362
433 Ga0207677_10003209 3300026023 Bacteria 8621
434 Ga0207703_10002174 3300026035 Bacteria 17221
435 Ga0207703_10003645 3300026035 Bacteria 12840
436 Ga0207703_10003816 3300026035 Bacteria 12524
437 Ga0207703_10018840 3300026035 Bacteria 5391
438 Ga0207703_10021870 3300026035 Bacteria 5008
439 Ga0207703_10038484 3300026035 Bacteria 3817
440 Ga0207639_10000074 3300026041 Bacteria 91671
441 Ga0207639_10002528 3300026041 Bacteria 12271
442 Ga0207639_10010081 3300026041 Bacteria 6533
443 Ga0207639_10036827 3300026041 Bacteria 3629
444 Ga0207678_10000530 3300026067 Bacteria 34763
445 Ga0207678_10001578 3300026067 Bacteria 20947
446 Ga0207678_10004268 3300026067 Bacteria 12818
447 Ga0207678_10030016 3300026067 Bacteria 4746
448 Ga0207708_10016875 3300026075 Bacteria 5497
449 Ga0207702_10000444 3300026078 Bacteria 46851
450 Ga0207702_10006134 3300026078 Bacteria 10413
451 Ga0207641_10000045 3300026088 Bacteria 181882
452 Ga0207641_10000113 3300026088 Bacteria 119188
453 Ga0207641_10000887 3300026088 Bacteria 31227
454 Ga0207641_10001862 3300026088 Bacteria 20270
455 Ga0207648_10008301 3300026089 Bacteria 10082
456 Ga0207648_10016665 3300026089 Bacteria 6706
457 Ga0207648_10066836 3300026089 Bacteria 3135
458 Ga0207676_10000253 3300026095 Bacteria 46261
459 Ga0207676_10001070 3300026095 Bacteria 20850
460 Ga0207676_10001717 3300026095 Bacteria 16157
461 Ga0207676_10001727 3300026095 Bacteria 16099
462 Ga0207676_10004139 3300026095 Bacteria 10244
463 Ga0207676_10006932 3300026095 Bacteria 8030
464 Ga0207676_10035629 3300026095 Bacteria 3779
465 Ga0207674_10000086 3300026116 Bacteria 100722
466 Ga0207674_10000827 3300026116 Bacteria 40278
467 Ga0207674_10001715 3300026116 Bacteria 28037
468 Ga0207674_10004040 3300026116 Bacteria 17803
469 Ga0207674_10005045 3300026116 Bacteria 15754
470 Ga0207674_10026884 3300026116 Bacteria 6102
471 Ga0207675_100003847 3300026118 Bacteria 14593
472 Ga0207675_100006057 3300026118 Bacteria 11508
473 Ga0207675_100032620 3300026118 Bacteria 4851
474 Ga0207675_100034678 3300026118 Bacteria 4706
475 Ga0207683_10002667 3300026121 Bacteria 15595
476 Ga0207683_10005397 3300026121 Bacteria 10955
477 Ga0207683_10008598 3300026121 Bacteria 8733
478 Ga0207698_10000774 3300026142 Bacteria 18579
479 Ga0207698_10000913 3300026142 Bacteria 17183
480 Ga0207698_10001798 3300026142 Bacteria 12518
481 Ga0207698_10002058 3300026142 Bacteria 11862
482 Ga0207698_10003524 3300026142 Bacteria 9437
483 Ga0207698_10008676 3300026142 Bacteria 6442
484 Ga0209813_10000029 3300027866 Bacteria 68229
485 Ga0268266_10000003 3300028379 Bacteria 1701703
486 Ga0268266_10000130 3300028379 Bacteria 147912
487 Ga0268266_10004880 3300028379 Bacteria 12724
488 Ga0268266_10012792 3300028379 Bacteria 7249
489 Ga0268266_10016486 3300028379 Bacteria 6316
490 Ga0268266_10028015 3300028379 Bacteria 4790
491 Ga0268265_10000074 3300028380 Bacteria 127599
492 Ga0268265_10017478 3300028380 Bacteria 4950
493 Ga0268265_10031854 3300028380 Bacteria 3812
494 Ga0268264_10000067 3300028381 Bacteria 284445
495 Ga0268264_10000288 3300028381 Bacteria 84755
496 Ga0268264_10000410 3300028381 Bacteria 60680
497 Ga0268264_10000418 3300028381 Bacteria 59942
498 Ga0268264_10001183 3300028381 Bacteria 25301
499 Ga0268264_10002893 3300028381 Bacteria 14931
500 Ga0268264_10013454 3300028381 Bacteria 6736
501 Ga0268264_10034425 3300028381 Bacteria 4167
502 Ga0268264_10063658 3300028381 Bacteria 3101
503 Ga0307517_10004144 3300028786 Bacteria 22364
504 Ga0265327_10000110 3300031251 Bacteria 181251
505 Ga0307513_10000178 3300031456 Bacteria 91751
506 Ga0307513_10004370 3300031456 Bacteria 18876
507 Ga0307513_10045911 3300031456 Bacteria 4771
508 Ga0307405_10001874 3300031731 Bacteria 9032
509 Ga0307405_10014302 3300031731 Bacteria 4262
510 Ga0307405_10016247 3300031731 Bacteria 4053
511 Ga0307413_10000129 3300031824 Bacteria 19750
512 Ga0307413_10008169 3300031824 Bacteria 4921
513 Ga0307410_10000283 3300031852 Bacteria 19590
514 Ga0307410_10001956 3300031852 Bacteria 9676
515 Ga0307410_10003694 3300031852 Bacteria 7739
516 Ga0307410_10005261 3300031852 Bacteria 6822
517 Ga0307410_10008760 3300031852 Bacteria 5632
518 Ga0307410_10013947 3300031852 Bacteria 4708
519 Ga0307406_10009749 3300031901 Bacteria 5400
520 Ga0307406_10021704 3300031901 Bacteria 3801
521 Ga0307407_10003822 3300031903 Bacteria 6272
522 Ga0307407_10006133 3300031903 Bacteria 5306
523 Ga0307407_10011200 3300031903 Bacteria 4257
524 Ga0307407_10012733 3300031903 Bacteria 4055
525 Ga0307412_10004529 3300031911 Bacteria 7739
526 Ga0307409_100006316 3300031995 Bacteria 6946
527 Ga0307409_100020915 3300031995 Bacteria 4473
528 Ga0307409_100050185 3300031995 Bacteria 3185
529 Ga0307416_100002293 3300032002 Bacteria 10917
530 Ga0307416_100010574 3300032002 Bacteria 6104
531 Ga0307414_10001122 3300032004 Bacteria 13688
532 Ga0307414_10005273 3300032004 Bacteria 7101
533 Ga0307414_10005424 3300032004 Bacteria 7023
534 Ga0307414_10010955 3300032004 Bacteria 5295
535 Ga0307414_10043457 3300032004 Bacteria 3061
536 Ga0307411_10000313 3300032005 Bacteria 16232
537 Ga0307411_10005025 3300032005 Bacteria 6435
538 Ga0307411_10006075 3300032005 Bacteria 6005
539 Ga0307411_10021437 3300032005 Bacteria 3781
540 Ga0307411_10022233 3300032005 Bacteria 3729
541 Ga0307411_10043732 3300032005 Bacteria 2867
542 Ga0307415_100003377 3300032126 Bacteria 8120
543 Ga0307415_100013558 3300032126 Bacteria 4761
544 Ga0307415_100016430 3300032126 Bacteria 4412
545 Ga0373943_0015049 3300035170 Bacteria 3511
546 Ga0373955_0019520 3300035172 Bacteria 3390
547 Ga0373927_0002126 3300035695 Bacteria 14596
548 Ga0373933_0008975 3300035724 Bacteria 5455
549 Ga0373933_0018215 3300035724 Bacteria 3947
550 Ga0373937_0013690 3300036401 Bacteria 7145
551 Ga0373937_0023245 3300036401 Bacteria 5580
552 Ga0373925_0000199 3300037068 Bacteria 65400
553 Ga0395899_0001291 3300037312 Bacteria 21622
554 Ga0395899_0001834 3300037312 Bacteria 17595
555 Ga0395899_0002771 3300037312 Bacteria 14143
556 Ga0395899_0003034 3300037312 Bacteria 13407
557 Ga0395899_0003740 3300037312 Bacteria 12020
558 Ga0395899_0006100 3300037312 Bacteria 9345
559 Ga0395899_0015562 3300037312 Bacteria 5800
560 Ga0395899_0029071 3300037312 Bacteria 4157
561 Ga0395900_0000380 3300037418 Bacteria 64150
562 Ga0395900_0000447 3300037418 Bacteria 59069
563 Ga0395900_0001102 3300037418 Bacteria 34357
564 Ga0395900_0007902 3300037418 Bacteria 10956
565 Ga0395900_0013390 3300037418 Bacteria 8380
566 Ga0395900_0013724 3300037418 Bacteria 8270
567 Ga0395900_0019399 3300037418 Bacteria 6935
568 Ga0395900_0023759 3300037418 Bacteria 6270
569 Ga0395900_0031497 3300037418 Bacteria 5450
570 Ga0395900_0032603 3300037418 Bacteria 5358
571 Ga0395900_0035200 3300037418 Bacteria 5158
572 Ga0395900_0069631 3300037418 Bacteria 3616
573 Ga0395900_0114751 3300037418 Bacteria 2764
574 Ga0395898_0000054 3300037466 Bacteria 279561
575 Ga0395898_0003866 3300037466 Bacteria 16551
576 Ga0395898_0007122 3300037466 Bacteria 11875
577 Ga0395898_0010930 3300037466 Bacteria 9468
578 Ga0395898_0011580 3300037466 Bacteria 9158
579 Ga0395898_0012701 3300037466 Bacteria 8700
580 Ga0395898_0057108 3300037466 Bacteria 3803
581 Ga0395898_0090622 3300037466 Bacteria 2943
582 Ga0395898_0097231 3300037466 Bacteria 2828
583 Ga0395905_0000005 3300037471 Bacteria 557808
584 Ga0395905_0000226 3300037471 Bacteria 85938
585 Ga0395905_0000500 3300037471 Bacteria 53853
586 Ga0395905_0002081 3300037471 Bacteria 22761
587 Ga0395905_0002414 3300037471 Bacteria 20738
588 Ga0395905_0002464 3300037471 Bacteria 20495
589 Ga0395905_0004286 3300037471 Bacteria 14873
590 Ga0395905_0009087 3300037471 Bacteria 9743
591 Ga0395905_0022741 3300037471 Bacteria 5928
592 Ga0395905_0023106 3300037471 Bacteria 5878
593 Ga0395905_0045850 3300037471 Bacteria 4101
594 Ga0395905_0083913 3300037471 Bacteria 2984
595 Ga0395905_0086430 3300037471 Bacteria 2939
596 Ga0436364_0424934 3300037853 Bacteria 51524
597 Ga0436364_0501064 3300037853 Bacteria 12902
598 Ga0436364_0545952 3300037853 Bacteria 79385
599 Ga0436364_0598036 3300037853 Bacteria 22487
600 Ga0395901_0000181 3300038443 Bacteria 81816
601 Ga0395901_0000324 3300038443 Bacteria 59134
602 Ga0395901_0000375 3300038443 Bacteria 53750
603 Ga0395901_0001088 3300038443 Bacteria 29016
604 Ga0395901_0002597 3300038443 Bacteria 18305
605 Ga0395901_0003871 3300038443 Bacteria 15045
606 Ga0395901_0004994 3300038443 Bacteria 13392
607 Ga0395901_0015929 3300038443 Bacteria 7658
608 Ga0395901_0017012 3300038443 Bacteria 7411
609 Ga0395901_0018581 3300038443 Bacteria 7100
610 Ga0395901_0021576 3300038443 Bacteria 6598
611 Ga0395901_0037788 3300038443 Bacteria 4993
612 Ga0395901_0048039 3300038443 Bacteria 4432
613 Ga0395901_0053704 3300038443 Bacteria 4187
614 Ga0395901_0056701 3300038443 Bacteria 4076
615 Ga0395901_0085937 3300038443 Bacteria 3289
616 Ga0436365_0083543 3300039437 Bacteria 85224
617 Ga0436365_1025078 3300039437 Bacteria 33251
618 Ga0436365_1884511 3300039437 Bacteria 98004
619 Ga0436362_0376260 3300039453 Bacteria 74620
620 Ga0439445_0000319 3300042004 Bacteria 9342
621 Ga0450889_000104 3300042144 Bacteria 8174
622 Ga0439458_0000539 3300042157 Bacteria 9729
623 Ga0439464_0000240 3300042439 Bacteria 10093
624 Ga0466969_0001635 3300044656 Bacteria 12016
625 Ga0466969_0006530 3300044656 Bacteria 6204
626 Ga0466966_0000026 3300044684 Bacteria 106896
627 Ga0466966_0002429 3300044684 Bacteria 12173
628 Ga0466966_0005498 3300044684 Bacteria 8324
629 Ga0466961_0003480 3300044693 Bacteria 9814
630 Ga0466961_0003951 3300044693 Bacteria 9274
631 Ga0466961_0014816 3300044693 Bacteria 5009
632 Ga0466963_0001562 3300044694 Bacteria 12416
633 Ga0466963_0003354 3300044694 Bacteria 9143
634 Ga0466963_0005918 3300044694 Bacteria 7200
635 Ga0466963_0008594 3300044694 Bacteria 6129
636 Ga0466963_0016743 3300044694 Bacteria 4562
637 Ga0466971_0002121 3300044719 Bacteria 8404
638 Ga0466971_0017748 3300044719 Bacteria 3151
639 Ga0466968_0011715 3300044735 Bacteria 3421
640 Ga0466970_0006740 3300044765 Bacteria 5748
641 Ga0466957_0000705 3300044842 Bacteria 17083
642 Ga0466957_0030216 3300044842 Bacteria 3234
643 Ga0466959_0045773 3300045049 Bacteria 3221
644 Ga0451576_0059938 3300045051 Bacteria 3971
645 Ga0466958_0006502 3300045836 Bacteria 6368
646 Ga0466958_0024169 3300045836 Bacteria 3574
647 Ga0466967_0000571 3300045976 Bacteria 18131
648 Ga0466967_0022346 3300045976 Bacteria 5158
649 Ga0495590_0002453 3300046457 Bacteria 7679
650 Ga0495638_0001762 3300046460 Bacteria 18966
651 Ga0495638_0010173 3300046460 Bacteria 6550
652 Ga0495638_0021069 3300046460 Bacteria 4300
653 Ga0495650_0000468 3300046471 Bacteria 62149
654 Ga0495583_0000003 3300046506 Bacteria 709273
655 Ga0495616_0000405 3300046513 Bacteria 33255
656 Ga0495632_0005670 3300046519 Bacteria 8207
657 Ga0495648_0000107 3300046524 Bacteria 104376
658 Ga0495663_0001162 3300046525 Bacteria 8502
659 Ga0495663_0002800 3300046525 Bacteria 5156
660 Ga0495642_0002496 3300046528 Bacteria 7476
661 Ga0495654_0000199 3300046530 Bacteria 58450
662 Ga0495621_0000447 3300046539 Bacteria 10144
663 Ga0495621_0000851 3300046539 Bacteria 7770
664 Ga0495621_0002433 3300046539 Bacteria 5021
665 Ga0495621_0005616 3300046539 Bacteria 3618
666 Ga0495633_0003389 3300046558 Bacteria 10664
667 Ga0495668_0012936 3300046616 Bacteria 4940
668 Ga0495668_0033131 3300046616 Bacteria 2903
669 Ga0495625_0022251 3300046660 Bacteria 4864
670 Ga0495661_0009776 3300046665 Bacteria 6566
671 Ga0495669_0000007 3300046684 Bacteria 180797
672 Ga0495669_0000829 3300046684 Bacteria 13166
673 Ga0495669_0004057 3300046684 Bacteria 6022
674 Ga0495669_0006670 3300046684 Bacteria 4829
675 Ga0495669_0007965 3300046684 Bacteria 4446
676 Ga0495669_0016859 3300046684 Bacteria 3132
677 Ga0495670_0023372 3300046691 Bacteria 3051
678 Ga0495589_0003393 3300046794 Bacteria 8637
679 Ga0495673_0000209 3300047469 Bacteria 88818
680 Ga0495673_0001113 3300047469 Bacteria 23132
681 Ga0495673_0007297 3300047469 Bacteria 6380
682 Ga0495602_0028474 3300048088 Bacteria 5345
683 Ga0496101_0023614 3300048904 Bacteria 4250
684 Ga0496104_0073099 3300048907 Bacteria 3262
685 Ga0496107_0001479 3300048910 Bacteria 14543
686 Ga0496107_0019433 3300048910 Bacteria 4794
687 Ga0496108_0000297 3300048911 Bacteria 42741
688 Ga0496108_0001787 3300048911 Bacteria 17132
689 Ga0496108_0006024 3300048911 Bacteria 9816
690 Ga0496108_0012251 3300048911 Bacteria 6973
691 Ga0496109_0006868 3300048912 Bacteria 9598
692 Ga0496109_0009460 3300048912 Bacteria 8308
693 Ga0496109_0042375 3300048912 Bacteria 4123
694 Ga0496110_0001178 3300048913 Bacteria 18586
695 Ga0496110_0003500 3300048913 Bacteria 12050
696 Ga0496110_0004595 3300048913 Bacteria 10724
697 Ga0496110_0009854 3300048913 Bacteria 7744
698 Ga0496111_0005030 3300048914 Bacteria 8409
699 Ga0496112_0002054 3300048915 Bacteria 15962
700 Ga0496112_0002179 3300048915 Bacteria 15582
701 Ga0496112_0004926 3300048915 Bacteria 11427
702 Ga0496112_0012487 3300048915 Bacteria 7805
703 Ga0496112_0018875 3300048915 Bacteria 6497
704 Ga0496113_0003949 3300048916 Bacteria 9000
705 Ga0496113_0011419 3300048916 Bacteria 5923
706 Ga0496114_0000016 3300048917 Bacteria 274656
707 Ga0496114_0002174 3300048917 Bacteria 14931
708 Ga0496114_0007398 3300048917 Bacteria 8677
709 Ga0496115_0001058 3300048918 Bacteria 19947
710 Ga0496115_0002048 3300048918 Bacteria 14424
711 Ga0496115_0015780 3300048918 Bacteria 5736
712 Ga0496118_0017554 3300048921 Bacteria 6506
713 Ga0496122_0002027 3300048925 Bacteria 30082
714 Ga0496124_0044753 3300048927 Bacteria 3796
715 Ga0501033_0003244 3300049570 Bacteria 13460
716 Ga0501034_0007326 3300049571 Bacteria 11753
717 Ga0501047_0062630 3300049581 Bacteria 3588
718 nmdc:mga06z11_112_c1 3300050494 Bacteria 33355
719 nmdc:mga04h51_89_c1 3300050495 Bacteria 28127
720 nmdc:mga07m45_2411_c1 3300050496 Bacteria 8768
721 nmdc:mga09592_70879_c1 3300050508 Bacteria 2958
722 nmdc:mga0qj67_34860_c1 3300050509 Bacteria 3932
723 nmdc:mga06r32_2074_c1 3300050510 Bacteria 7843
724 nmdc:mga08y16_34088_c1 3300050511 Bacteria 5347
725 nmdc:mga08y16_37829_c1 3300050511 Bacteria 5066
726 nmdc:mga0a205_2537_c1 3300050515 Bacteria 16089
727 Ga0495619_0032876 3300053085 Bacteria 3367
728 Ga0500578_0000015 3300053086 Bacteria 179217
729 Ga0500643_000190 3300053087 Bacteria 58677
730 Ga0500643_000843 3300053087 Bacteria 19633
731 Ga0500643_002008 3300053087 Bacteria 10954
732 Ga0500644_0000305 3300053088 Bacteria 25991
733 Ga0500592_000146 3300053116 Bacteria 14471
734 Ga0500594_0000064 3300053118 Bacteria 33313
735 Ga0500658_0000150 3300053134 Bacteria 33225
736 Ga0500604_0000073 3300053151 Bacteria 35955
737 Ga0500622_0000840 3300053156 Bacteria 26274
738 Ga0500627_0000232 3300053158 Bacteria 15858
739 Ga0500645_000706 3300053730 Bacteria 20709
740 Ga0500609_000188 3300053731 Bacteria 8721
741 Ga0466962_0001446 3300061719 Bacteria 11077
742 2512641716 2512564014 Bacteria 4639632
743 2885429148 2885427238 Bacteria 2291351
744 JGI24735J21928_10002271
745 JGI24740J21852_10000664
746 JGI24737J22298_10000206
747 JGI24737J22298_10003453
748 JGI24738J21930_10000018
749 JGI24738J21930_10000329
750 JGI24744J21845_10002247
751 Ga0055536_1008392
752 Ga0055531_10006840
753 Ga0065165_1004269
754 Ga0070658_10000374
755 Ga0070658_10002325
756 Ga0070658_10003546
757 Ga0070658_10010136
758 Ga0070658_10016492
759 Ga0070658_10020039
760 Ga0070658_10052771
761 Ga0070676_10014345
762 Ga0070683_100004124
763 Ga0070683_100006559
764 Ga0070683_100013120
765 Ga0070690_100020446
766 Ga0070670_100000653
767 Ga0070670_100003772
768 Ga0070670_100010209
769 Ga0070670_100023106
770 Ga0070670_100037887
771 Ga0070677_10002908
772 Ga0068869_100000415
773 Ga0068869_100014747
774 Ga0070666_10000054
775 Ga0070666_10000701
776 Ga0070666_10019939
777 Ga0070680_100000584
778 Ga0070680_100002229
779 Ga0070680_100003391
780 Ga0070680_100027087
781 Ga0068868_100000581
782 Ga0068868_100000734
783 Ga0068868_100004915
784 Ga0068868_100005223
785 Ga0070660_100000116
786 Ga0070660_100000209
787 Ga0070660_100001300
788 Ga0070660_100002258
789 Ga0070689_100012545
790 Ga0070661_100000198
791 Ga0070661_100007737
792 Ga0070661_100010064
793 Ga0070661_100014601
794 Ga0070661_100026191
795 Ga0070692_10005845
796 Ga0070692_10015432
797 Ga0070668_100000007
798 Ga0070668_100000618
799 Ga0070668_100023246
800 Ga0070669_100000097
801 Ga0070669_100000613
802 Ga0070675_100001980
803 Ga0070675_100010635
804 Ga0070671_100000041
805 Ga0070671_100000068
806 Ga0070671_100001153
807 Ga0070671_100001512
808 Ga0070671_100001973
809 Ga0070671_100004025
810 Ga0070671_100004757
811 Ga0070671_100014134
812 Ga0070671_100014195
813 Ga0070671_100055446
814 Ga0070674_100001041
815 Ga0070673_100000858
816 Ga0070673_100003335
817 Ga0070673_100023532
818 Ga0070659_100000381
819 Ga0070659_100003487
820 Ga0070659_100004639
821 Ga0070659_100005141
822 Ga0070659_100005351
823 Ga0070659_100026671
824 Ga0070659_100030630
825 Ga0070667_100001661
826 Ga0070667_100003113
827 Ga0070667_100007351
828 Ga0070667_100009156
829 Ga0070667_100010193
830 Ga0070667_100017456
831 Ga0070667_100021092
832 Ga0070667_100066131
833 Ga0070709_10034557
834 Ga0070714_100009413
835 Ga0070713_100000066
836 Ga0070713_100004394
837 Ga0070700_100021864
838 Ga0070663_100033850
839 Ga0070678_100010042
840 Ga0070678_100035758
841 Ga0070662_100000012
842 Ga0070662_100000513
843 Ga0070662_100000723
844 Ga0070662_100002417
845 Ga0070662_100013671
846 Ga0070681_10019776
847 Ga0070681_10022891
848 Ga0070681_10091110
849 Ga0068867_100018169
850 Ga0068867_100027521
851 Ga0070679_100000001
852 Ga0070679_100001280
853 Ga0070684_100002224
854 Ga0068853_100000032
855 Ga0068853_100000570
856 Ga0068853_100005879
857 Ga0068853_100050193
858 Ga0068853_100053302
859 Ga0070672_100004663
860 Ga0070696_100003345
861 Ga0070693_100004519
862 Ga0070665_100000303
863 Ga0070665_100002063
864 Ga0070665_100003398
865 Ga0070665_100004218
866 Ga0070665_100006371
867 Ga0070665_100014300
868 Ga0070665_100021320
869 Ga0070665_100023313
870 Ga0070665_100025783
871 Ga0070704_100010200
872 Ga0070704_100028454
873 Ga0068855_100001355
874 Ga0068855_100006268
875 Ga0068855_100006747
876 Ga0068855_100010689
877 Ga0068855_100045776
878 Ga0070664_100000133
879 Ga0070664_100000848
880 Ga0070664_100001296
881 Ga0070664_100011633
882 Ga0070664_100015527
883 Ga0068857_100003085
884 Ga0068857_100024974
885 Ga0068857_100066943
886 Ga0068854_100001547
887 Ga0068854_100001986
888 Ga0068856_100000190
889 Ga0068856_100007786
890 Ga0068856_100009268
891 Ga0068856_100014423
892 Ga0068856_100029278
893 Ga0068856_100035110
894 Ga0068852_100001557
895 Ga0068852_100008321
896 Ga0068852_100015523
897 Ga0068852_100023324
898 Ga0068859_100000270
899 Ga0068859_100000685
900 Ga0068859_100001592
901 Ga0068859_100005151
902 Ga0068859_100016680
903 Ga0068859_100039659
904 Ga0068864_100000706
905 Ga0068864_100001341
906 Ga0068864_100003892
907 Ga0068864_100004090
908 Ga0068864_100005288
909 Ga0068864_100040491
910 Ga0068864_100047267
911 Ga0068861_100012258
912 Ga0068861_100031650
913 Ga0068861_100031870
914 Ga0068851_10010640
915 Ga0068851_10011140
916 Ga0068863_100000006
917 Ga0068863_100000027
918 Ga0068863_100005453
919 Ga0068863_100006973
920 Ga0068863_100022866
921 Ga0068863_100047769
922 Ga0068863_100060153
923 Ga0068863_100074369
924 Ga0068858_100000971
925 Ga0068858_100001171
926 Ga0068858_100001863
927 Ga0068858_100003773
928 Ga0068858_100016331
929 Ga0068858_100021830
930 Ga0068858_100035523
931 Ga0068860_100000093
932 Ga0068860_100001106
933 Ga0068860_100001602
934 Ga0068860_100001606
935 Ga0068860_100011638
936 Ga0068860_100021760
937 Ga0068860_100059698
938 Ga0068862_100002553
939 Ga0068862_100011671
940 Ga0068862_100024878
941 Ga0068862_100047100
942 Ga0070717_10003094
943 Ga0075367_10000329
944 Ga0068871_100019293
945 Ga0075428_100020860
946 Ga0075431_100013027
947 Ga0097620_100000270
948 Ga0097620_100000685
949 Ga0097620_100001592
950 Ga0097620_100005150
951 Ga0097620_100039658
952 Ga0105240_10018195
953 Ga0105240_10055409
954 Ga0105240_10072734
955 Ga0111539_10026357
956 Ga0105245_10000128
957 Ga0105245_10007030
958 Ga0105245_10013215
959 Ga0105245_10062817
960 Ga0105248_10000083
961 Ga0105248_10000170
962 Ga0105248_10000660
963 Ga0105248_10001290
964 Ga0105248_10001775
965 Ga0105248_10007989
966 Ga0105248_10011330
967 Ga0105248_10013432
968 Ga0105248_10018121
969 Ga0105248_10022678
970 Ga0105237_10019701
971 Ga0105237_10047358
972 Ga0105238_10002495
973 Ga0105238_10043610
974 Ga0105249_10000424
975 Ga0105249_10001126
976 Ga0099796_10000460
977 Ga0157371_10001109
978 Ga0157371_10001392
979 Ga0157371_10007119
980 Ga0157371_10045796
981 Ga0157370_10000497
982 Ga0157370_10008251
983 Ga0157370_10031202
984 Ga0157370_10056633
985 Ga0157369_10000137
986 Ga0157369_10003724
987 Ga0157369_10012543
988 Ga0157369_10013100
989 Ga0157369_10049758
990 Ga0157369_10095327
991 Ga0157378_10002066
992 Ga0157378_10013139
993 Ga0157378_10086770
994 Ga0163162_10001622
995 Ga0163162_10001754
996 Ga0163162_10018777
997 Ga0157372_10066976
998 Ga0157375_10005011
999 Ga0157375_10015938
1000 Ga0157375_10019356
1001 Ga0163163_10000364
1002 Ga0163163_10000890
1003 Ga0163163_10001686
1004 Ga0163163_10008590
1005 Ga0157380_10012004
1006 Ga0157380_10018441
1007 Ga0157377_10013175
1008 Ga0157379_10000566
1009 Ga0157379_10001895
1010 Ga0163161_10042600
1011 Ga0206353_10722721
1012 Ga0213873_10000026
1013 Ga0213876_10000149
1014 Ga0213876_10000257
1015 Ga0213875_10000166
1016 Ga0213875_10000380
1017 Ga0209565_1000172
1018 Ga0209673_1001352
1019 Ga0209675_1000773
1020 Ga0209564_1004716
1021 Ga0209758_1010218
1022 Ga0209758_1021184
1023 Ga0209050_1010889
1024 Ga0209256_1001634
1025 Ga0209257_1000192
1026 Ga0207697_10000059
1027 Ga0207682_10000177
1028 Ga0207682_10002081
1029 Ga0207688_10009969
1030 Ga0207680_10000183
1031 Ga0207680_10000328
1032 Ga0207680_10000911
1033 Ga0207680_10004458
1034 Ga0207647_10000968
1035 Ga0207647_10001938
1036 Ga0207647_10003235
1037 Ga0207647_10004569
1038 Ga0207647_10006311
1039 Ga0207647_10015394
1040 Ga0207647_10020566
1041 Ga0207645_10024979
1042 Ga0207705_10000030
1043 Ga0207705_10000072
1044 Ga0207705_10000123
1045 Ga0207705_10001768
1046 Ga0207705_10002020
1047 Ga0207705_10003058
1048 Ga0207705_10003236
1049 Ga0207705_10003465
1050 Ga0207705_10004136
1051 Ga0207705_10004488
1052 Ga0207705_10006438
1053 Ga0207705_10011779
1054 Ga0207705_10014165
1055 Ga0207705_10024163
1056 Ga0207695_10005782
1057 Ga0207695_10006988
1058 Ga0207695_10010664
1059 Ga0207695_10037772
1060 Ga0207695_10041344
1061 Ga0207693_10020496
1062 Ga0207660_10001036
1063 Ga0207660_10001792
1064 Ga0207660_10002482
1065 Ga0207660_10002582
1066 Ga0207660_10004827
1067 Ga0207660_10005438
1068 Ga0207657_10000267
1069 Ga0207657_10000496
1070 Ga0207657_10002033
1071 Ga0207657_10002077
1072 Ga0207657_10002179
1073 Ga0207657_10004176
1074 Ga0207657_10005014
1075 Ga0207657_10005448
1076 Ga0207657_10006412
1077 Ga0207657_10006813
1078 Ga0207657_10008867
1079 Ga0207657_10011037
1080 Ga0207657_10014259
1081 Ga0207657_10026695
1082 Ga0207657_10041100
1083 Ga0207657_10078768
1084 Ga0207649_10000158
1085 Ga0207649_10000993
1086 Ga0207649_10037838
1087 Ga0207652_10000034
1088 Ga0207652_10000274
1089 Ga0207652_10035188
1090 Ga0207681_10000030
1091 Ga0207681_10000737
1092 Ga0207694_10002303
1093 Ga0207694_10027856
1094 Ga0207650_10003264
1095 Ga0207650_10008777
1096 Ga0207687_10000745
1097 Ga0207700_10000045
1098 Ga0207700_10047881
1099 Ga0207664_10050213
1100 Ga0207644_10000017
1101 Ga0207644_10000098
1102 Ga0207644_10000358
1103 Ga0207644_10000415
1104 Ga0207644_10004273
1105 Ga0207644_10015213
1106 Ga0207690_10000160
1107 Ga0207690_10001997
1108 Ga0207690_10002179
1109 Ga0207690_10004007
1110 Ga0207690_10006517
1111 Ga0207706_10000041
1112 Ga0207706_10000253
1113 Ga0207706_10000426
1114 Ga0207706_10001436
1115 Ga0207706_10003800
1116 Ga0207706_10006444
1117 Ga0207706_10012889
1118 Ga0207706_10024797
1119 Ga0207706_10032157
1120 Ga0207706_10034375
1121 Ga0207686_10014056
1122 Ga0207670_10005825
1123 Ga0207669_10008626
1124 Ga0207691_10000563
1125 Ga0207691_10001958
1126 Ga0207691_10005229
1127 Ga0207691_10037280
1128 Ga0207711_10000374
1129 Ga0207711_10000831
1130 Ga0207711_10002128
1131 Ga0207711_10002381
1132 Ga0207711_10002712
1133 Ga0207711_10003449
1134 Ga0207711_10007702
1135 Ga0207711_10007812
1136 Ga0207711_10008412
1137 Ga0207711_10013720
1138 Ga0207689_10000128
1139 Ga0207689_10010796
1140 Ga0207689_10011804
1141 Ga0207661_10001415
1142 Ga0207661_10008050
1143 Ga0207661_10028679
1144 Ga0207679_10000532
1145 Ga0207679_10012365
1146 Ga0207679_10018481
1147 Ga0207679_10021199
1148 Ga0207679_10026459
1149 Ga0207679_10040630
1150 Ga0207679_10057252
1151 Ga0207667_10001389
1152 Ga0207667_10002612
1153 Ga0207667_10005579
1154 Ga0207667_10008667
1155 Ga0207667_10019982
1156 Ga0207651_10000785
1157 Ga0207651_10001030
1158 Ga0207651_10011884
1159 Ga0207712_10006289
1160 Ga0207668_10000054
1161 Ga0207668_10002806
1162 Ga0207668_10005448
1163 Ga0207640_10000589
1164 Ga0207640_10001476
1165 Ga0207640_10002630
1166 Ga0207640_10015445
1167 Ga0207640_10027401
1168 Ga0207658_10001748
1169 Ga0207658_10002652
1170 Ga0207658_10006047
1171 Ga0207658_10006879
1172 Ga0207658_10009750
1173 Ga0207658_10015630
1174 Ga0207658_10015732
1175 Ga0207677_10002148
1176 Ga0207677_10003209
1177 Ga0207703_10002174
1178 Ga0207703_10003645
1179 Ga0207703_10003816
1180 Ga0207703_10018840
1181 Ga0207703_10021870
1182 Ga0207703_10038484
1183 Ga0207639_10000074
1184 Ga0207639_10002528
1185 Ga0207639_10010081
1186 Ga0207639_10036827
1187 Ga0207678_10000530
1188 Ga0207678_10001578
1189 Ga0207678_10004268
1190 Ga0207678_10030016
1191 Ga0207708_10016875
1192 Ga0207702_10000444
1193 Ga0207702_10006134
1194 Ga0207641_10000045
1195 Ga0207641_10000113
1196 Ga0207641_10000887
1197 Ga0207641_10001862
1198 Ga0207648_10008301
1199 Ga0207648_10016665
1200 Ga0207648_10066836
1201 Ga0207676_10000253
1202 Ga0207676_10001070
1203 Ga0207676_10001717
1204 Ga0207676_10001727
1205 Ga0207676_10004139
1206 Ga0207676_10006932
1207 Ga0207676_10035629
1208 Ga0207674_10000086
1209 Ga0207674_10000827
1210 Ga0207674_10001715
1211 Ga0207674_10004040
1212 Ga0207674_10005045
1213 Ga0207674_10026884
1214 Ga0207675_100003847
1215 Ga0207675_100006057
1216 Ga0207675_100032620
1217 Ga0207675_100034678
1218 Ga0207683_10002667
1219 Ga0207683_10005397
1220 Ga0207683_10008598
1221 Ga0207698_10000774
1222 Ga0207698_10000913
1223 Ga0207698_10001798
1224 Ga0207698_10002058
1225 Ga0207698_10003524
1226 Ga0207698_10008676
1227 Ga0209813_10000029
1228 Ga0268266_10000003
1229 Ga0268266_10000130
1230 Ga0268266_10004880
1231 Ga0268266_10012792
1232 Ga0268266_10016486
1233 Ga0268266_10028015
1234 Ga0268265_10000074
1235 Ga0268265_10017478
1236 Ga0268265_10031854
1237 Ga0268264_10000067
1238 Ga0268264_10000288
1239 Ga0268264_10000410
1240 Ga0268264_10000418
1241 Ga0268264_10001183
1242 Ga0268264_10002893
1243 Ga0268264_10013454
1244 Ga0268264_10034425
1245 Ga0268264_10063658
1246 Ga0307517_10004144
1247 Ga0265327_10000110
1248 Ga0307513_10000178
1249 Ga0307513_10004370
1250 Ga0307513_10045911
1251 Ga0307405_10001874
1252 Ga0307405_10014302
1253 Ga0307405_10016247
1254 Ga0307413_10000129
1255 Ga0307413_10008169
1256 Ga0307410_10000283
1257 Ga0307410_10001956
1258 Ga0307410_10003694
1259 Ga0307410_10005261
1260 Ga0307410_10008760
1261 Ga0307410_10013947
1262 Ga0307406_10009749
1263 Ga0307406_10021704
1264 Ga0307407_10003822
1265 Ga0307407_10006133
1266 Ga0307407_10011200
1267 Ga0307407_10012733
1268 Ga0307412_10004529
1269 Ga0307409_100006316
1270 Ga0307409_100020915
1271 Ga0307409_100050185
1272 Ga0307416_100002293
1273 Ga0307416_100010574
1274 Ga0307414_10001122
1275 Ga0307414_10005273
1276 Ga0307414_10005424
1277 Ga0307414_10010955
1278 Ga0307414_10043457
1279 Ga0307411_10000313
1280 Ga0307411_10005025
1281 Ga0307411_10006075
1282 Ga0307411_10021437
1283 Ga0307411_10022233
1284 Ga0307411_10043732
1285 Ga0307415_100003377
1286 Ga0307415_100013558
1287 Ga0307415_100016430
1288 Ga0373943_0015049
1289 Ga0373955_0019520
1290 Ga0373927_0002126
1291 Ga0373933_0008975
1292 Ga0373933_0018215
1293 Ga0373937_0013690
1294 Ga0373937_0023245
1295 Ga0373925_0000199
1296 Ga0395899_0001291
1297 Ga0395899_0001834
1298 Ga0395899_0002771
1299 Ga0395899_0003034
1300 Ga0395899_0003740
1301 Ga0395899_0006100
1302 Ga0395899_0015562
1303 Ga0395899_0029071
1304 Ga0395900_0000380
1305 Ga0395900_0000447
1306 Ga0395900_0001102
1307 Ga0395900_0007902
1308 Ga0395900_0013390
1309 Ga0395900_0013724
1310 Ga0395900_0019399
1311 Ga0395900_0023759
1312 Ga0395900_0031497
1313 Ga0395900_0032603
1314 Ga0395900_0035200
1315 Ga0395900_0069631
1316 Ga0395900_0114751
1317 Ga0395898_0000054
1318 Ga0395898_0003866
1319 Ga0395898_0007122
1320 Ga0395898_0010930
1321 Ga0395898_0011580
1322 Ga0395898_0012701
1323 Ga0395898_0057108
1324 Ga0395898_0090622
1325 Ga0395898_0097231
1326 Ga0395905_0000005
1327 Ga0395905_0000226
1328 Ga0395905_0000500
1329 Ga0395905_0002081
1330 Ga0395905_0002414
1331 Ga0395905_0002464
1332 Ga0395905_0004286
1333 Ga0395905_0009087
1334 Ga0395905_0022741
1335 Ga0395905_0023106
1336 Ga0395905_0045850
1337 Ga0395905_0083913
1338 Ga0395905_0086430
1339 Ga0436364_0424934
1340 Ga0436364_0501064
1341 Ga0436364_0545952
1342 Ga0436364_0598036
1343 Ga0395901_0000181
1344 Ga0395901_0000324
1345 Ga0395901_0000375
1346 Ga0395901_0001088
1347 Ga0395901_0002597
1348 Ga0395901_0003871
1349 Ga0395901_0004994
1350 Ga0395901_0015929
1351 Ga0395901_0017012
1352 Ga0395901_0018581
1353 Ga0395901_0021576
1354 Ga0395901_0037788
1355 Ga0395901_0048039
1356 Ga0395901_0053704
1357 Ga0395901_0056701
1358 Ga0395901_0085937
1359 Ga0436365_0083543
1360 Ga0436365_1025078
1361 Ga0436365_1884511
1362 Ga0436362_0376260
1363 Ga0439445_0000319
1364 Ga0450889_000104
1365 Ga0439458_0000539
1366 Ga0439464_0000240
1367 Ga0466969_0001635
1368 Ga0466969_0006530
1369 Ga0466966_0000026
1370 Ga0466966_0002429
1371 Ga0466966_0005498
1372 Ga0466961_0003480
1373 Ga0466961_0003951
1374 Ga0466961_0014816
1375 Ga0466963_0001562
1376 Ga0466963_0003354
1377 Ga0466963_0005918
1378 Ga0466963_0008594
1379 Ga0466963_0016743
1380 Ga0466971_0002121
1381 Ga0466971_0017748
1382 Ga0466968_0011715
1383 Ga0466970_0006740
1384 Ga0466957_0000705
1385 Ga0466957_0030216
1386 Ga0466959_0045773
1387 Ga0451576_0059938
1388 Ga0466958_0006502
1389 Ga0466958_0024169
1390 Ga0466967_0000571
1391 Ga0466967_0022346
1392 Ga0495590_0002453
1393 Ga0495638_0001762
1394 Ga0495638_0010173
1395 Ga0495638_0021069
1396 Ga0495650_0000468
1397 Ga0495583_0000003
1398 Ga0495616_0000405
1399 Ga0495632_0005670
1400 Ga0495648_0000107
1401 Ga0495663_0001162
1402 Ga0495663_0002800
1403 Ga0495642_0002496
1404 Ga0495654_0000199
1405 Ga0495621_0000447
1406 Ga0495621_0000851
1407 Ga0495621_0002433
1408 Ga0495621_0005616
1409 Ga0495633_0003389
1410 Ga0495668_0012936
1411 Ga0495668_0033131
1412 Ga0495625_0022251
1413 Ga0495661_0009776
1414 Ga0495669_0000007
1415 Ga0495669_0000829
1416 Ga0495669_0004057
1417 Ga0495669_0006670
1418 Ga0495669_0007965
1419 Ga0495669_0016859
1420 Ga0495670_0023372
1421 Ga0495589_0003393
1422 Ga0495673_0000209
1423 Ga0495673_0001113
1424 Ga0495673_0007297
1425 Ga0495602_0028474
1426 Ga0496101_0023614
1427 Ga0496104_0073099
1428 Ga0496107_0001479
1429 Ga0496107_0019433
1430 Ga0496108_0000297
1431 Ga0496108_0001787
1432 Ga0496108_0006024
1433 Ga0496108_0012251
1434 Ga0496109_0006868
1435 Ga0496109_0009460
1436 Ga0496109_0042375
1437 Ga0496110_0001178
1438 Ga0496110_0003500
1439 Ga0496110_0004595
1440 Ga0496110_0009854
1441 Ga0496111_0005030
1442 Ga0496112_0002054
1443 Ga0496112_0002179
1444 Ga0496112_0004926
1445 Ga0496112_0012487
1446 Ga0496112_0018875
1447 Ga0496113_0003949
1448 Ga0496113_0011419
1449 Ga0496114_0000016
1450 Ga0496114_0002174
1451 Ga0496114_0007398
1452 Ga0496115_0001058
1453 Ga0496115_0002048
1454 Ga0496115_0015780
1455 Ga0496118_0017554
1456 Ga0496122_0002027
1457 Ga0496124_0044753
1458 Ga0501033_0003244
1459 Ga0501034_0007326
1460 Ga0501047_0062630
1461 nmdc:mga06z11_112_c1
1462 nmdc:mga04h51_89_c1
1463 nmdc:mga07m45_2411_c1
1464 nmdc:mga09592_70879_c1
1465 nmdc:mga0qj67_34860_c1
1466 nmdc:mga06r32_2074_c1
1467 nmdc:mga08y16_34088_c1
1468 nmdc:mga08y16_37829_c1
1469 nmdc:mga0a205_2537_c1
1470 Ga0495619_0032876
1471 Ga0500578_0000015
1472 Ga0500643_000190
1473 Ga0500643_000843
1474 Ga0500643_002008
1475 Ga0500644_0000305
1476 Ga0500592_000146
1477 Ga0500594_0000064
1478 Ga0500658_0000150
1479 Ga0500604_0000073
1480 Ga0500622_0000840
1481 Ga0500627_0000232
1482 Ga0500645_000706
1483 Ga0500609_000188
1484 Ga0466962_0001446
1485 2512641716
1486 2885429148

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00488

MutS_V

MutS domain V

614

801

0.99

PF01624

MutS_I

MutS domain I

8

126

0.98

PF05192

MutS_III

MutS domain III

265

560

0.96

PF05190

MutS_IV

MutS family domain IV

426

519

0.94

PF05188

MutS_II

MutS domain II

134

250

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i5f-assembly1.cif.gz_B crystal structure of dna-free e.coli muts p839e dimer mutant 0.8893 5 792
7ou0-assembly1.cif.gz_A the structure of muts bound to two molecules of adp-vanadate 0.8858 7 792
6i5f-assembly1.cif.gz_B crystal structure of dna-free e.coli muts p839e dimer mutant 0.8851 5 792
7ou0-assembly1.cif.gz_A the structure of muts bound to two molecules of adp-vanadate 0.8822 7 792
7ou4-assembly1.cif.gz_B the structure of muts bound to one molecule of atp and one molecule of adp 0.8819 11 791
ID Description Score Start End Superfamily
3zljA05 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9604 558 792 3.40.50.300
1ewqB05 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.955 558 787 3.40.50.300
af_A0A1D8PSP4_685_923_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 561 787 3.40.50.300
af_Q9TXR4_592_846_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9486 560 791 3.40.50.300
3zljA05 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9473 558 792 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520H136-F1-model_v4 DNA mismatch repair protein MutS 0.9898 10 176 GO:0005524
GO:0006298
GO:0030983
AF-D5LU65-F1-model_v4 Methyl-directed mismatch repair protein 0.9864 570 738 GO:0005524
GO:0005829
GO:0006298
GO:0030983
GO:0140664
AF-A0A1B1GFK4-F1-model_v4 DNA mismatch repair protein MutS 0.984 590 770 GO:0005524
GO:0005829
GO:0006298
GO:0030983
GO:0140664
AF-K1U212-F1-model_v4 DNA mismatch repair protein MutS domain protein 0.9796 587 759 GO:0005524
GO:0005829
GO:0006298
GO:0030983
GO:0140664
AF-A0A3P7KV04-F1-model_v4 DNA mismatch repair proteins mutS family domain-containing protein 0.9784 603 727 GO:0005524
GO:0005634
GO:0005739
GO:0006298
GO:0030983
GO:0043504
GO:0140664

Map