F478679

General Info

Members Datasets Scaffolds Average Seq Length
743 334 1486 138

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10013324|Ga0081455_100133249
Length 138
Sequence MNQRVTLITLGYRDFERARDFYTGLGWKIGWTDDDVIFFQAGDMIFAVWDRAKLAEDSGVQDSGGWGGVTLGHNVRTVKEVDDILERATAAGATIARAGDRRPWGGYSGIFVDPEGHPWEVAQNPAWTVHDDGSVSLD

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
107 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
108 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
331 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 9.42
Rhizosphere 88.83
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10013324 3300005937 Bacteria 8135
2 ARcpr5yngRDRAFT_c007031 3300000043 Bacteria 1000
3 ARSoilOldRDRAFT_c006488 3300000044 Bacteria 982
4 LJQas_1002915 3300000549 Bacteria 2328
5 JGI25404J52841_10062807 3300003659 Bacteria 778
6 Ga0070658_10017030 3300005327 Bacteria 5816
7 Ga0070658_10126711 3300005327 Bacteria 2126
8 Ga0070658_10221404 3300005327 Bacteria 1601
9 Ga0070658_10350737 3300005327 Bacteria 1263
10 Ga0070658_10749461 3300005327 Bacteria 848
11 Ga0070683_100001509 3300005329 Bacteria 17973
12 Ga0070683_100021412 3300005329 Bacteria 5771
13 Ga0070683_100040070 3300005329 Bacteria 4304
14 Ga0070683_100053073 3300005329 Bacteria 3756
15 Ga0070683_100105765 3300005329 Bacteria 2653
16 Ga0070683_100216616 3300005329 Bacteria 1819
17 Ga0070690_100294353 3300005330 Bacteria 1162
18 Ga0070670_100453426 3300005331 Bacteria 1137
19 Ga0070666_10972323 3300005335 Bacteria 629
20 Ga0070680_100006313 3300005336 Bacteria 9003
21 Ga0070680_100013154 3300005336 Bacteria 6443
22 Ga0070680_100013720 3300005336 Bacteria 6319
23 Ga0070680_100129210 3300005336 Bacteria 2113
24 Ga0070682_100007038 3300005337 Bacteria 6329
25 Ga0070682_100013418 3300005337 Bacteria 4712
26 Ga0070682_100101732 3300005337 Bacteria 1898
27 Ga0068868_100044198 3300005338 Bacteria 3483
28 Ga0068868_100100660 3300005338 Bacteria 2338
29 Ga0068868_100131521 3300005338 Bacteria 2048
30 Ga0068868_100229743 3300005338 Bacteria 1556
31 Ga0068868_100599768 3300005338 Unclassified 976
32 Ga0070660_100019951 3300005339 Bacteria 4918
33 Ga0070660_100112764 3300005339 Bacteria 2165
34 Ga0070660_100221050 3300005339 Bacteria 1539
35 Ga0070660_100760870 3300005339 Bacteria 814
36 Ga0070689_100006876 3300005340 Bacteria 7913
37 Ga0070689_100167728 3300005340 Unclassified 1778
38 Ga0070691_10000003 3300005341 Bacteria 86538
39 Ga0070691_10000348 3300005341 Bacteria 16483
40 Ga0070691_10027616 3300005341 Bacteria 2649
41 Ga0070691_10079954 3300005341 Bacteria 1599
42 Ga0070691_10165686 3300005341 Bacteria 1142
43 Ga0070691_10481332 3300005341 Unclassified 714
44 Ga0070687_100041593 3300005343 Bacteria 2323
45 Ga0070661_100158792 3300005344 Bacteria 1712
46 Ga0070661_100173578 3300005344 Bacteria 1638
47 Ga0070692_10079695 3300005345 Bacteria 1761
48 Ga0070692_10170679 3300005345 Bacteria 1254
49 Ga0070668_100074683 3300005347 Bacteria 2645
50 Ga0070668_100150309 3300005347 Bacteria 1883
51 Ga0070668_100221789 3300005347 Bacteria 1560
52 Ga0070668_101433903 3300005347 Bacteria 630
53 Ga0070669_100974607 3300005353 Bacteria 727
54 Ga0070669_101349009 3300005353 Bacteria 618
55 Ga0070675_100014932 3300005354 Bacteria 6133
56 Ga0070671_100013011 3300005355 Bacteria 6706
57 Ga0070674_100000021 3300005356 Bacteria 87134
58 Ga0070674_100000075 3300005356 Bacteria 45822
59 Ga0070674_100018177 3300005356 Bacteria 4439
60 Ga0070673_100019016 3300005364 Bacteria 4926
61 Ga0070673_100296199 3300005364 Bacteria 1423
62 Ga0070688_100008521 3300005365 Bacteria 5569
63 Ga0070659_100035556 3300005366 Bacteria 3879
64 Ga0070659_100072397 3300005366 Bacteria 2742
65 Ga0070659_100091819 3300005366 Bacteria 2434
66 Ga0070659_100289840 3300005366 Bacteria 1363
67 Ga0070703_10023303 3300005406 Bacteria 1823
68 Ga0070703_10036680 3300005406 Bacteria 1508
69 Ga0070703_10360237 3300005406 Bacteria 623
70 Ga0070709_10100029 3300005434 Bacteria 1930
71 Ga0070709_10127919 3300005434 Unclassified 1730
72 Ga0070714_100231422 3300005435 Bacteria 1703
73 Ga0070714_100966720 3300005435 Bacteria 828
74 Ga0070714_100989311 3300005435 Bacteria 818
75 Ga0070713_100360506 3300005436 Unclassified 1351
76 Ga0070710_10030359 3300005437 Bacteria 2907
77 Ga0070710_10114115 3300005437 Bacteria 1627
78 Ga0070701_10019328 3300005438 Bacteria 3216
79 Ga0070711_100020206 3300005439 Bacteria 4288
80 Ga0070711_100095062 3300005439 Bacteria 2156
81 Ga0070711_100180048 3300005439 Bacteria 1618
82 Ga0070705_100006991 3300005440 Bacteria 5549
83 Ga0070705_100159412 3300005440 Bacteria 1506
84 Ga0070705_100919661 3300005440 Bacteria 705
85 Ga0070700_100115333 3300005441 Bacteria 1792
86 Ga0070700_100361581 3300005441 Bacteria 1079
87 Ga0070700_100769123 3300005441 Bacteria 772
88 Ga0070694_100245145 3300005444 Bacteria 1353
89 Ga0070708_100023312 3300005445 Bacteria 5262
90 Ga0070663_100013956 3300005455 Bacteria 5142
91 Ga0070663_100298525 3300005455 Bacteria 1289
92 Ga0070663_100535320 3300005455 Bacteria 977
93 Ga0070663_101682194 3300005455 Unclassified 567
94 Ga0070678_100028740 3300005456 Bacteria 3797
95 Ga0070678_100049405 3300005456 Bacteria 3035
96 Ga0070678_100840066 3300005456 Bacteria 836
97 Ga0070662_100276112 3300005457 Bacteria 1359
98 Ga0070662_100463696 3300005457 Bacteria 1053
99 Ga0070681_10007063 3300005458 Bacteria 10934
100 Ga0070681_10012531 3300005458 Bacteria 8415
101 Ga0070681_10058509 3300005458 Bacteria 3834
102 Ga0070681_10074946 3300005458 Bacteria 3344
103 Ga0068867_100015156 3300005459 Bacteria 5466
104 Ga0070685_10003993 3300005466 Bacteria 7453
105 Ga0070706_100744629 3300005467 Bacteria 908
106 Ga0070706_101010420 3300005467 Unclassified 767
107 Ga0070698_100004541 3300005471 Bacteria 15252
108 Ga0070698_100405084 3300005471 Bacteria 1297
109 Ga0070698_100438133 3300005471 Unclassified 1242
110 Ga0070698_101632331 3300005471 Bacteria 597
111 Ga0070699_100315728 3300005518 Bacteria 1404
112 Ga0070679_100002708 3300005530 Bacteria 16130
113 Ga0070679_100017844 3300005530 Bacteria 6873
114 Ga0070679_100081124 3300005530 Bacteria 3233
115 Ga0070679_100164873 3300005530 Bacteria 2190
116 Ga0070679_100270870 3300005530 Bacteria 1652
117 Ga0070684_100014651 3300005535 Bacteria 6359
118 Ga0070684_100026571 3300005535 Bacteria 4879
119 Ga0070684_100040655 3300005535 Bacteria 4005
120 Ga0070684_100042151 3300005535 Bacteria 3939
121 Ga0070684_100047696 3300005535 Bacteria 3713
122 Ga0070684_100249987 3300005535 Bacteria 1620
123 Ga0070697_100209603 3300005536 Bacteria 1659
124 Ga0068853_100084188 3300005539 Bacteria 2786
125 Ga0068853_100207258 3300005539 Bacteria 1786
126 Ga0068853_100269951 3300005539 Bacteria 1566
127 Ga0070672_100016458 3300005543 Bacteria 5294
128 Ga0070686_100008258 3300005544 Bacteria 5829
129 Ga0070696_100021184 3300005546 Bacteria 4407
130 Ga0070696_100148632 3300005546 Bacteria 1718
131 Ga0070696_100299831 3300005546 Bacteria 1230
132 Ga0070696_100894979 3300005546 Bacteria 736
133 Ga0070693_100012061 3300005547 Bacteria 4365
134 Ga0070693_100033729 3300005547 Bacteria 2827
135 Ga0070693_100072375 3300005547 Bacteria 2033
136 Ga0070665_100055388 3300005548 Bacteria 3977
137 Ga0070704_100031041 3300005549 Bacteria 3588
138 Ga0070704_100082238 3300005549 Bacteria 2374
139 Ga0068855_100018101 3300005563 Bacteria 8466
140 Ga0068855_100496381 3300005563 Bacteria 1327
141 Ga0068855_100887024 3300005563 Bacteria 943
142 Ga0070664_100010946 3300005564 Bacteria 7357
143 Ga0070664_100026584 3300005564 Bacteria 4802
144 Ga0070664_100429415 3300005564 Bacteria 1211
145 Ga0068857_100053012 3300005577 Bacteria 3599
146 Ga0068857_100132623 3300005577 Bacteria 2247
147 Ga0068857_100255706 3300005577 Bacteria 1607
148 Ga0068854_100065103 3300005578 Bacteria 2649
149 Ga0068856_100008174 3300005614 Bacteria 10205
150 Ga0068856_100025180 3300005614 Bacteria 5797
151 Ga0068856_100225423 3300005614 Bacteria 1890
152 Ga0070702_100039986 3300005615 Bacteria 2620
153 Ga0070702_100151644 3300005615 Bacteria 1488
154 Ga0070702_100152002 3300005615 Bacteria 1487
155 Ga0070702_100821735 3300005615 Bacteria 721
156 Ga0068859_100554834 3300005617 Unclassified 1243
157 Ga0068864_100000023 3300005618 Bacteria 257064
158 Ga0068864_100138434 3300005618 Bacteria 2194
159 Ga0068866_10000007 3300005718 Bacteria 121729
160 Ga0068866_10000469 3300005718 Bacteria 18473
161 Ga0068866_10011837 3300005718 Bacteria 3788
162 Ga0068861_100053969 3300005719 Bacteria 3060
163 Ga0068861_100481459 3300005719 Bacteria 1118
164 Ga0068851_10058051 3300005834 Bacteria 1977
165 Ga0068870_10037558 3300005840 Bacteria 2497
166 Ga0068863_100000110 3300005841 Bacteria 86415
167 Ga0068863_100015554 3300005841 Bacteria 7310
168 Ga0068858_100049353 3300005842 Bacteria 3897
169 Ga0068860_100008112 3300005843 Bacteria 10459
170 Ga0068860_100259784 3300005843 Bacteria 1692
171 Ga0068862_100553100 3300005844 Bacteria 1099
172 Ga0081455_10017645 3300005937 Bacteria 6832
173 Ga0081455_10077197 3300005937 Bacteria 2741
174 Ga0081455_10089031 3300005937 Unclassified 2506
175 Ga0081455_10100270 3300005937 Bacteria 2327
176 Ga0081455_10138387 3300005937 Bacteria 1894
177 Ga0081455_10168460 3300005937 Unclassified 1671
178 Ga0081455_10372263 3300005937 Bacteria 1001
179 Ga0081538_10000187 3300005981 Bacteria 67952
180 Ga0081538_10000505 3300005981 Bacteria 43641
181 Ga0081538_10010349 3300005981 Bacteria 7653
182 Ga0081538_10303785 3300005981 Bacteria 585
183 Ga0081540_1009639 3300005983 Bacteria 6638
184 Ga0081539_10005383 3300005985 Bacteria 13100
185 Ga0081539_10018229 3300005985 Bacteria 4882
186 Ga0070717_10664630 3300006028 Bacteria 946
187 Ga0070717_10780907 3300006028 Unclassified 869
188 Ga0075365_10108408 3300006038 Bacteria 1907
189 Ga0075365_10924884 3300006038 Bacteria 615
190 Ga0075363_100065651 3300006048 Bacteria 1962
191 Ga0075432_10002585 3300006058 Bacteria 6043
192 Ga0075432_10030104 3300006058 Bacteria 1876
193 Ga0070715_10000003 3300006163 Bacteria 345282
194 Ga0070716_100056142 3300006173 Bacteria 2257
195 Ga0070712_100026426 3300006175 Bacteria 3866
196 Ga0070712_100039384 3300006175 Bacteria 3234
197 Ga0070712_100048646 3300006175 Bacteria 2940
198 Ga0070712_100350108 3300006175 Bacteria 1209
199 Ga0070712_100377334 3300006175 Bacteria 1166
200 Ga0075367_10224590 3300006178 Bacteria 1176
201 Ga0097621_100159095 3300006237 Bacteria 1941
202 Ga0075428_100003425 3300006844 Bacteria 17353
203 Ga0075428_101091516 3300006844 Bacteria 843
204 Ga0075431_100170645 3300006847 Unclassified 2235
205 Ga0075431_100236169 3300006847 Bacteria 1861
206 Ga0075433_10000595 3300006852 Bacteria 24004
207 Ga0075434_101288232 3300006871 Bacteria 742
208 Ga0075429_100416141 3300006880 Bacteria 1177
209 Ga0068865_100074382 3300006881 Bacteria 2419
210 Ga0097620_100554766 3300006931 Unclassified 1243
211 Ga0105240_10021329 3300009093 Bacteria 8617
212 Ga0111539_10027583 3300009094 Bacteria 6935
213 Ga0111539_10240937 3300009094 Bacteria 2106
214 Ga0105245_10000574 3300009098 Bacteria 33386
215 Ga0105245_10022144 3300009098 Bacteria 5580
216 Ga0105245_10376373 3300009098 Bacteria 1413
217 Ga0105245_10746819 3300009098 Bacteria 1014
218 Ga0105245_11461654 3300009098 Bacteria 734
219 Ga0105245_12057464 3300009098 Bacteria 625
220 Ga0105247_10029540 3300009101 Bacteria 3322
221 Ga0114129_10017784 3300009147 Bacteria 10123
222 Ga0114129_10138011 3300009147 Bacteria 3345
223 Ga0114129_10481490 3300009147 Bacteria 1624
224 Ga0105243_10111802 3300009148 Bacteria 2287
225 Ga0105243_10182966 3300009148 Bacteria 1824
226 Ga0105243_10438025 3300009148 Bacteria 1223
227 Ga0105243_10624448 3300009148 Bacteria 1041
228 Ga0105243_10772348 3300009148 Bacteria 944
229 Ga0105241_10940843 3300009174 Bacteria 805
230 Ga0105242_10006926 3300009176 Bacteria 8746
231 Ga0105242_10011195 3300009176 Bacteria 6892
232 Ga0105242_10026995 3300009176 Bacteria 4554
233 Ga0105248_10032424 3300009177 Bacteria 5838
234 Ga0105237_10151002 3300009545 Bacteria 2320
235 Ga0105249_10208700 3300009553 Bacteria 1915
236 Ga0105249_10265535 3300009553 Bacteria 1707
237 Ga0105249_10837757 3300009553 Unclassified 985
238 Ga0105239_10028568 3300010375 Bacteria 6132
239 Ga0105239_10148039 3300010375 Bacteria 2620
240 Ga0105239_10186656 3300010375 Bacteria 2320
241 Ga0105239_10379763 3300010375 Bacteria 1597
242 Ga0105239_10426927 3300010375 Bacteria 1502
243 Ga0105239_10992693 3300010375 Unclassified 965
244 Ga0105239_11217520 3300010375 Bacteria 868
245 Ga0105246_10224323 3300011119 Unclassified 1475
246 Ga0157343_1015309 3300012488 Bacteria 639
247 Ga0157322_1011236 3300012490 Bacteria 735
248 Ga0157347_1023119 3300012502 Bacteria 739
249 Ga0157373_10245716 3300013100 Bacteria 1265
250 Ga0157371_10252831 3300013102 Bacteria 1269
251 Ga0157370_10011970 3300013104 Bacteria 9044
252 Ga0157370_10053606 3300013104 Bacteria 3845
253 Ga0157370_10315857 3300013104 Bacteria 1442
254 Ga0157369_10000068 3300013105 Bacteria 144274
255 Ga0157369_10025480 3300013105 Bacteria 6567
256 Ga0157369_10309525 3300013105 Bacteria 1643
257 Ga0157369_11354785 3300013105 Bacteria 725
258 Ga0157369_11558133 3300013105 Bacteria 672
259 Ga0157369_12126938 3300013105 Bacteria 569
260 Ga0157374_10006301 3300013296 Bacteria 10058
261 Ga0157374_10106059 3300013296 Bacteria 2699
262 Ga0157374_10368907 3300013296 Bacteria 1428
263 Ga0157378_10351205 3300013297 Bacteria 1440
264 Ga0157378_11210532 3300013297 Bacteria 795
265 Ga0157378_12078093 3300013297 Bacteria 618
266 Ga0163162_10242531 3300013306 Bacteria 1933
267 Ga0157372_10024289 3300013307 Bacteria 6581
268 Ga0157375_10118321 3300013308 Bacteria 2756
269 Ga0157375_10206461 3300013308 Bacteria 2121
270 Ga0157380_10001131 3300014326 Bacteria 17215
271 Ga0157380_10024306 3300014326 Bacteria 4584
272 Ga0157377_10007417 3300014745 Bacteria 5295
273 Ga0157377_10025339 3300014745 Bacteria 3163
274 Ga0157377_10161824 3300014745 Bacteria 1393
275 Ga0157377_10634999 3300014745 Bacteria 766
276 Ga0157379_10020837 3300014968 Bacteria 5803
277 Ga0157376_10045971 3300014969 Bacteria 3597
278 Ga0163161_10317022 3300017792 Bacteria 1232
279 Ga0206356_10964721 3300020070 Bacteria 1280
280 Ga0206356_11725412 3300020070 Bacteria 1027
281 Ga0206353_10696096 3300020082 Bacteria 2420
282 Ga0206353_11776508 3300020082 Bacteria 4509
283 Ga0224712_10159539 3300022467 Bacteria 1005
284 Ga0207653_10008149 3300025885 Bacteria 3265
285 Ga0207653_10048770 3300025885 Bacteria 1404
286 Ga0207692_10172935 3300025898 Unclassified 1253
287 Ga0207692_10249464 3300025898 Bacteria 1063
288 Ga0207642_10000008 3300025899 Bacteria 132651
289 Ga0207642_10000181 3300025899 Bacteria 18196
290 Ga0207642_10003777 3300025899 Bacteria 4820
291 Ga0207642_11013165 3300025899 Bacteria 535
292 Ga0207688_10048174 3300025901 Bacteria 2381
293 Ga0207647_10051439 3300025904 Bacteria 2546
294 Ga0207685_10000003 3300025905 Bacteria 344527
295 Ga0207685_10374018 3300025905 Bacteria 724
296 Ga0207645_10079731 3300025907 Bacteria 2098
297 Ga0207643_10022326 3300025908 Bacteria 3483
298 Ga0207643_10354001 3300025908 Bacteria 922
299 Ga0207705_10143589 3300025909 Bacteria 1784
300 Ga0207684_10403189 3300025910 Unclassified 1176
301 Ga0207707_10027006 3300025912 Bacteria 5017
302 Ga0207707_10128248 3300025912 Bacteria 2218
303 Ga0207707_10138412 3300025912 Bacteria 2129
304 Ga0207707_10284626 3300025912 Bacteria 1431
305 Ga0207693_10018802 3300025915 Bacteria 5498
306 Ga0207693_10024860 3300025915 Bacteria 4751
307 Ga0207693_10039249 3300025915 Bacteria 3728
308 Ga0207693_10069855 3300025915 Bacteria 2748
309 Ga0207663_10014762 3300025916 Bacteria 4290
310 Ga0207663_10182698 3300025916 Bacteria 1499
311 Ga0207663_10588492 3300025916 Bacteria 873
312 Ga0207660_10026788 3300025917 Bacteria 3928
313 Ga0207660_10080756 3300025917 Bacteria 2388
314 Ga0207660_10161646 3300025917 Bacteria 1728
315 Ga0207660_10203935 3300025917 Bacteria 1545
316 Ga0207662_10044033 3300025918 Bacteria 2634
317 Ga0207662_10155468 3300025918 Bacteria 1457
318 Ga0207657_10000150 3300025919 Bacteria 70716
319 Ga0207657_10073331 3300025919 Bacteria 2893
320 Ga0207657_10107629 3300025919 Bacteria 2306
321 Ga0207649_10030733 3300025920 Bacteria 3184
322 Ga0207649_10060542 3300025920 Bacteria 2380
323 Ga0207649_10141908 3300025920 Bacteria 1645
324 Ga0207652_10019183 3300025921 Bacteria 5620
325 Ga0207652_10108374 3300025921 Bacteria 2461
326 Ga0207652_10412451 3300025921 Bacteria 1218
327 Ga0207646_11710775 3300025922 Bacteria 540
328 Ga0207681_10061629 3300025923 Bacteria 2580
329 Ga0207681_10947872 3300025923 Bacteria 721
330 Ga0207650_10623257 3300025925 Unclassified 908
331 Ga0207687_10000025 3300025927 Bacteria 175177
332 Ga0207687_10003925 3300025927 Bacteria 9961
333 Ga0207687_10080436 3300025927 Bacteria 2352
334 Ga0207664_10870035 3300025929 Bacteria 810
335 Ga0207644_10107014 3300025931 Bacteria 2109
336 Ga0207690_10063749 3300025932 Bacteria 2514
337 Ga0207690_10101708 3300025932 Bacteria 2053
338 Ga0207690_10243472 3300025932 Bacteria 1386
339 Ga0207690_10274405 3300025932 Bacteria 1311
340 Ga0207690_10559039 3300025932 Bacteria 931
341 Ga0207706_10060598 3300025933 Bacteria 3333
342 Ga0207706_10114658 3300025933 Bacteria 2370
343 Ga0207706_10591333 3300025933 Unclassified 954
344 Ga0207686_10000066 3300025934 Bacteria 95095
345 Ga0207686_10004392 3300025934 Bacteria 7562
346 Ga0207686_10303127 3300025934 Bacteria 1187
347 Ga0207709_10008399 3300025935 Bacteria 5712
348 Ga0207709_10101087 3300025935 Bacteria 1906
349 Ga0207709_10418638 3300025935 Bacteria 1028
350 Ga0207709_10846623 3300025935 Bacteria 741
351 Ga0207670_10252709 3300025936 Bacteria 1363
352 Ga0207669_10000032 3300025937 Bacteria 82757
353 Ga0207669_10000091 3300025937 Bacteria 45833
354 Ga0207669_10612310 3300025937 Bacteria 886
355 Ga0207704_10197718 3300025938 Bacteria 1468
356 Ga0207665_10487140 3300025939 Unclassified 951
357 Ga0207691_10034853 3300025940 Bacteria 4677
358 Ga0207711_10092313 3300025941 Bacteria 2664
359 Ga0207661_10006253 3300025944 Bacteria 8420
360 Ga0207661_10040368 3300025944 Bacteria 3668
361 Ga0207661_10068690 3300025944 Bacteria 2886
362 Ga0207661_10130735 3300025944 Bacteria 2150
363 Ga0207661_10320382 3300025944 Bacteria 1393
364 Ga0207679_10004838 3300025945 Bacteria 8398
365 Ga0207679_10016107 3300025945 Bacteria 4958
366 Ga0207679_10061346 3300025945 Bacteria 2799
367 Ga0207679_10397086 3300025945 Bacteria 1212
368 Ga0207679_10583291 3300025945 Bacteria 1006
369 Ga0207667_10125978 3300025949 Bacteria 2638
370 Ga0207667_10549852 3300025949 Bacteria 1168
371 Ga0207651_10164631 3300025960 Bacteria 1742
372 Ga0207712_10126149 3300025961 Bacteria 1943
373 Ga0207712_10196598 3300025961 Bacteria 1596
374 Ga0207668_10062442 3300025972 Bacteria 2623
375 Ga0207668_10137892 3300025972 Bacteria 1872
376 Ga0207668_10360038 3300025972 Bacteria 1219
377 Ga0207640_10754043 3300025981 Bacteria 839
378 Ga0207658_10156307 3300025986 Bacteria 1864
379 Ga0207677_10091958 3300026023 Bacteria 2208
380 Ga0207677_10117809 3300026023 Bacteria 1991
381 Ga0207677_10132103 3300026023 Bacteria 1897
382 Ga0207639_10067252 3300026041 Bacteria 2788
383 Ga0207639_10511664 3300026041 Bacteria 1098
384 Ga0207678_10062389 3300026067 Bacteria 3204
385 Ga0207678_10087128 3300026067 Bacteria 2669
386 Ga0207678_10379745 3300026067 Bacteria 1221
387 Ga0207678_10628061 3300026067 Unclassified 943
388 Ga0207708_10084087 3300026075 Bacteria 2447
389 Ga0207708_10161138 3300026075 Bacteria 1772
390 Ga0207708_10221454 3300026075 Bacteria 1516
391 Ga0207708_10366271 3300026075 Bacteria 1185
392 Ga0207702_10015687 3300026078 Bacteria 6272
393 Ga0207702_10058763 3300026078 Bacteria 3273
394 Ga0207702_10098679 3300026078 Bacteria 2573
395 Ga0207641_10000065 3300026088 Bacteria 156066
396 Ga0207641_10089456 3300026088 Bacteria 2691
397 Ga0207648_10013821 3300026089 Bacteria 7489
398 Ga0207676_10000025 3300026095 Bacteria 261714
399 Ga0207676_11339062 3300026095 Archaea 711
400 Ga0207674_10007123 3300026116 Bacteria 13065
401 Ga0207674_10058169 3300026116 Bacteria 3918
402 Ga0207674_10066019 3300026116 Bacteria 3646
403 Ga0207675_100172048 3300026118 Bacteria 2071
404 Ga0207675_100452449 3300026118 Bacteria 1272
405 Ga0207675_100977145 3300026118 Bacteria 865
406 Ga0207683_10048378 3300026121 Bacteria 3724
407 Ga0207683_10112034 3300026121 Bacteria 2444
408 Ga0207698_10108578 3300026142 Bacteria 2320
409 Ga0207698_10742312 3300026142 Bacteria 980
410 Ga0209998_10005119 3300027717 Bacteria 2754
411 Ga0207428_10002844 3300027907 Bacteria 17183
412 Ga0207428_10006702 3300027907 Bacteria 10577
413 Ga0268266_10466180 3300028379 Bacteria 1202
414 Ga0268265_10359251 3300028380 Bacteria 1333
415 Ga0268265_11020596 3300028380 Bacteria 818
416 Ga0268264_10004592 3300028381 Bacteria 11736
417 Ga0268264_11508485 3300028381 Bacteria 683
418 Ga0265316_10734235 3300031344 Bacteria 695
419 Ga0307405_11362940 3300031731 Bacteria 619
420 Ga0307405_11637840 3300031731 Bacteria 569
421 Ga0307415_100184925 3300032126 Bacteria 1639
422 Ga0373950_0013869 3300034818 Bacteria 1350
423 Ga0373958_0040430 3300034819 Bacteria 951
424 Ga0373940_0187926 3300035088 Bacteria 674
425 Ga0373949_0018145 3300035090 Bacteria 1593
426 Ga0373952_0003267 3300035092 Bacteria 2919
427 Ga0373939_0075420 3300035114 Bacteria 1108
428 Ga0373956_0156566 3300035119 Bacteria 1073
429 Ga0373956_0444215 3300035119 Bacteria 619
430 Ga0373960_0009372 3300035121 Bacteria 2370
431 Ga0373946_0063739 3300035171 Bacteria 1575
432 Ga0373955_0746334 3300035172 Unclassified 601
433 Ga0373961_0039857 3300035241 Bacteria 1351
434 Ga0373962_0012747 3300035242 Bacteria 2123
435 Ga0373931_0023741 3300035691 Bacteria 3098
436 Ga0373931_0044352 3300035691 Bacteria 2345
437 Ga0373935_0291686 3300035692 Bacteria 1151
438 Ga0373947_0091253 3300035725 Bacteria 1900
439 Ga0373947_0546722 3300035725 Bacteria 788
440 Ga0373937_0032638 3300036401 Bacteria 4723
441 Ga0395899_0064785 3300037312 Bacteria 2686
442 Ga0395899_0649664 3300037312 Bacteria 667
443 Ga0395900_0024421 3300037418 Bacteria 6189
444 Ga0395898_0051929 3300037466 Bacteria 4006
445 Ga0395898_0512292 3300037466 Bacteria 1141
446 Ga0395905_0265667 3300037471 Bacteria 1601
447 Ga0395901_0049746 3300038443 Bacteria 4355
448 Ga0395901_0067725 3300038443 Bacteria 3719
449 Ga0436360_0998903 3300039438 Unclassified 902
450 Ga0436361_0921822 3300039447 Bacteria 580
451 Ga0451807_0619992 3300041486 Bacteria 965
452 Ga0451839_0208429 3300041496 Bacteria 1412
453 Ga0451849_0576143 3300041505 Bacteria 1187
454 Ga0451849_1322835 3300041505 Bacteria 578
455 Ga0451853_1844353 3300041512 Bacteria 2166
456 Ga0466965_0303727 3300044683 Bacteria 866
457 Ga0466963_0000257 3300044694 Bacteria 23311
458 Ga0466963_0008793 3300044694 Bacteria 6066
459 Ga0466963_0225822 3300044694 Bacteria 1312
460 Ga0466963_0254106 3300044694 Bacteria 1233
461 Ga0466963_0456945 3300044694 Unclassified 901
462 Ga0466971_0024025 3300044719 Bacteria 2718
463 Ga0466971_0311625 3300044719 Bacteria 757
464 Ga0466968_0232180 3300044735 Bacteria 872
465 Ga0466957_0113383 3300044842 Bacteria 1721
466 Ga0466960_0128699 3300044901 Bacteria 1334
467 Ga0466958_0094545 3300045836 Bacteria 1852
468 Ga0466967_0000849 3300045976 Bacteria 16201
469 Ga0466967_0023712 3300045976 Bacteria 5033
470 Ga0466967_0035511 3300045976 Bacteria 4245
471 Ga0466967_0154283 3300045976 Bacteria 2149
472 Ga0495603_0004890 3300046455 Bacteria 8013
473 Ga0495603_0197471 3300046455 Bacteria 1163
474 Ga0495603_0434819 3300046455 Bacteria 752
475 Ga0495629_0038252 3300046459 Bacteria 3380
476 Ga0495629_0182592 3300046459 Bacteria 1454
477 Ga0495641_0024794 3300046461 Bacteria 2954
478 Ga0495641_0252876 3300046461 Bacteria 792
479 Ga0495641_0329765 3300046461 Unclassified 689
480 Ga0495651_0176768 3300046462 Bacteria 1515
481 Ga0495653_0024537 3300046463 Bacteria 4858
482 Ga0495653_0450138 3300046463 Bacteria 810
483 Ga0495653_0602614 3300046463 Bacteria 675
484 Ga0495582_0000006 3300046473 Bacteria 140434
485 Ga0495662_0000178 3300046476 Bacteria 25519
486 Ga0495662_0360982 3300046476 Bacteria 714
487 Ga0495664_0205324 3300046477 Bacteria 1194
488 Ga0495594_0000001 3300046499 Bacteria 293051
489 Ga0495608_0000042 3300046511 Bacteria 115906
490 Ga0495608_0003416 3300046511 Bacteria 11374
491 Ga0495618_0000142 3300046514 Bacteria 51147
492 Ga0495628_0000265 3300046516 Bacteria 46703
493 Ga0495628_0112394 3300046516 Bacteria 2094
494 Ga0495628_0405455 3300046516 Bacteria 995
495 Ga0495628_0928845 3300046516 Unclassified 602
496 Ga0495630_0003329 3300046517 Bacteria 11191
497 Ga0495630_0069730 3300046517 Bacteria 2645
498 Ga0495630_0189547 3300046517 Bacteria 1569
499 Ga0495630_0590225 3300046517 Bacteria 852
500 Ga0495644_0005280 3300046523 Bacteria 5046
501 Ga0495652_0000009 3300046529 Bacteria 311000
502 Ga0495652_0236518 3300046529 Bacteria 1362
503 Ga0495665_0383443 3300046531 Bacteria 714
504 Ga0495640_0054057 3300046533 Bacteria 2752
505 Ga0495640_0113919 3300046533 Bacteria 1764
506 Ga0495640_0222465 3300046533 Unclassified 1190
507 Ga0495640_0252277 3300046533 Bacteria 1105
508 Ga0495640_0743670 3300046533 Bacteria 587
509 Ga0495586_0042119 3300046535 Bacteria 2459
510 Ga0495586_0389164 3300046535 Bacteria 802
511 Ga0495598_0012729 3300046537 Unclassified 2072
512 Ga0495609_0345667 3300046538 Bacteria 601
513 Ga0495645_0000636 3300046543 Bacteria 24169
514 Ga0495622_0000033 3300046557 Bacteria 124162
515 Ga0495633_0128957 3300046558 Unclassified 1170
516 Ga0495667_0084602 3300046559 Bacteria 2059
517 Ga0495656_0001098 3300046615 Bacteria 8772
518 Ga0495656_0310745 3300046615 Bacteria 810
519 Ga0495634_0000951 3300046642 Bacteria 27343
520 Ga0495634_0065361 3300046642 Bacteria 2411
521 Ga0495634_0076408 3300046642 Bacteria 2198
522 Ga0495635_0013966 3300046663 Bacteria 5620
523 Ga0495635_0093100 3300046663 Bacteria 2061
524 Ga0495635_0136344 3300046663 Bacteria 1672
525 Ga0495657_0000040 3300046675 Bacteria 115899
526 Ga0495657_0167648 3300046675 Bacteria 1354
527 Ga0495599_0155541 3300046678 Bacteria 1415
528 Ga0495646_0464055 3300046680 Unclassified 653
529 Ga0495658_0000027 3300046683 Bacteria 74322
530 Ga0495658_0003607 3300046683 Bacteria 7664
531 Ga0495658_0357137 3300046683 Bacteria 929
532 Ga0495613_0000190 3300046689 Bacteria 60696
533 Ga0495613_0083810 3300046689 Bacteria 2315
534 Ga0495613_0099980 3300046689 Bacteria 2095
535 Ga0495613_0108999 3300046689 Unclassified 1997
536 Ga0495624_0846766 3300046690 Bacteria 539
537 Ga0495670_0001313 3300046691 Bacteria 12115
538 Ga0495589_0205522 3300046794 Bacteria 928
539 Ga0495600_0027309 3300046809 Bacteria 3688
540 Ga0495600_0561084 3300046809 Unclassified 697
541 Ga0495604_0278658 3300047317 Bacteria 1130
542 Ga0495674_0000961 3300047319 Bacteria 27559
543 Ga0495674_0024134 3300047319 Bacteria 5595
544 Ga0495676_0000624 3300047321 Bacteria 29322
545 Ga0495680_0186383 3300047322 Unclassified 1495
546 Ga0495680_0436578 3300047322 Bacteria 898
547 Ga0495675_0000051 3300047444 Bacteria 80375
548 Ga0495685_020745 3300047447 Bacteria 2259
549 Ga0495684_0100321 3300047471 Bacteria 2189
550 Ga0495684_0244869 3300047471 Bacteria 1306
551 Ga0495684_0439898 3300047471 Bacteria 908
552 Ga0495602_0035577 3300048088 Bacteria 4643
553 Ga0495602_0241302 3300048088 Unclassified 1352
554 Ga0495602_0507500 3300048088 Bacteria 842
555 Ga0495614_0293437 3300048089 Bacteria 750
556 Ga0496100_0000028 3300048903 Bacteria 113912
557 Ga0496100_0000494 3300048903 Bacteria 19033
558 Ga0496100_0034089 3300048903 Bacteria 3191
559 Ga0496100_0093134 3300048903 Bacteria 2061
560 Ga0496100_0794996 3300048903 Bacteria 741
561 Ga0496101_0000005 3300048904 Bacteria 331455
562 Ga0496101_0005803 3300048904 Bacteria 7895
563 Ga0496101_0011485 3300048904 Bacteria 5879
564 Ga0496101_0125992 3300048904 Bacteria 1940
565 Ga0496101_1214134 3300048904 Unclassified 591
566 Ga0496102_0211014 3300048905 Bacteria 1831
567 Ga0496102_0402876 3300048905 Bacteria 1286
568 Ga0496102_0969174 3300048905 Bacteria 771
569 Ga0496103_0149251 3300048906 Bacteria 1497
570 Ga0496103_0273086 3300048906 Bacteria 1088
571 Ga0496104_0057715 3300048907 Bacteria 3673
572 Ga0496104_0112658 3300048907 Bacteria 2609
573 Ga0496104_0362504 3300048907 Unclassified 1362
574 Ga0496105_0020770 3300048908 Bacteria 5309
575 Ga0496105_0098296 3300048908 Bacteria 2417
576 Ga0496106_0000070 3300048909 Bacteria 82770
577 Ga0496106_0007024 3300048909 Bacteria 8314
578 Ga0496106_1072146 3300048909 Bacteria 632
579 Ga0496107_0000004 3300048910 Bacteria 297680
580 Ga0496107_0023262 3300048910 Bacteria 4381
581 Ga0496107_0181592 3300048910 Bacteria 1562
582 Ga0496108_0000042 3300048911 Bacteria 146397
583 Ga0496108_0000178 3300048911 Bacteria 58913
584 Ga0496108_0006044 3300048911 Bacteria 9798
585 Ga0496108_0401968 3300048911 Bacteria 1196
586 Ga0496108_0406929 3300048911 Unclassified 1188
587 Ga0496108_0527443 3300048911 Bacteria 1031
588 Ga0496108_0921649 3300048911 Unclassified 749
589 Ga0496108_1103178 3300048911 Bacteria 674
590 Ga0496109_0000034 3300048912 Bacteria 160397
591 Ga0496109_0001026 3300048912 Bacteria 23100
592 Ga0496109_0019302 3300048912 Bacteria 6007
593 Ga0496109_0065044 3300048912 Bacteria 3338
594 Ga0496109_0114859 3300048912 Bacteria 2505
595 Ga0496109_0164981 3300048912 Bacteria 2076
596 Ga0496109_0687450 3300048912 Bacteria 960
597 Ga0496109_1552656 3300048912 Bacteria 597
598 Ga0496109_1668171 3300048912 Bacteria 571
599 Ga0496110_0001400 3300048913 Bacteria 17436
600 Ga0496110_0009055 3300048913 Bacteria 8033
601 Ga0496110_0079121 3300048913 Bacteria 2926
602 Ga0496110_0520384 3300048913 Bacteria 1082
603 Ga0496111_0018771 3300048914 Bacteria 4793
604 Ga0496111_0024449 3300048914 Bacteria 4253
605 Ga0496111_0206086 3300048914 Bacteria 1461
606 Ga0496111_0551107 3300048914 Bacteria 846
607 Ga0496111_0855393 3300048914 Unclassified 656
608 Ga0496112_0225156 3300048915 Bacteria 1831
609 Ga0496112_0247159 3300048915 Bacteria 1736
610 Ga0496112_0332443 3300048915 Bacteria 1463
611 Ga0496113_0031100 3300048916 Bacteria 3871
612 Ga0496113_0050214 3300048916 Bacteria 3109
613 Ga0496113_0101178 3300048916 Bacteria 2234
614 Ga0496113_0244795 3300048916 Unclassified 1431
615 Ga0496114_0010460 3300048917 Bacteria 7383
616 Ga0496114_0043152 3300048917 Bacteria 3740
617 Ga0496114_0298013 3300048917 Bacteria 1423
618 Ga0496114_0399967 3300048917 Bacteria 1216
619 Ga0496114_0543362 3300048917 Unclassified 1027
620 Ga0496114_0723927 3300048917 Bacteria 871
621 Ga0496114_0762983 3300048917 Bacteria 845
622 Ga0496115_0000035 3300048918 Bacteria 134475
623 Ga0496115_0009485 3300048918 Bacteria 7228
624 Ga0496115_0901071 3300048918 Bacteria 682
625 Ga0501031_0013798 3300049568 Bacteria 5268
626 Ga0501031_0049134 3300049568 Bacteria 2749
627 Ga0501031_0162638 3300049568 Bacteria 1459
628 Ga0501033_0082392 3300049570 Bacteria 2359
629 Ga0501036_1138984 3300049572 Bacteria 637
630 Ga0501038_0097750 3300049574 Bacteria 2449
631 Ga0501038_0248104 3300049574 Bacteria 1411
632 Ga0501039_0029803 3300049575 Bacteria 4204
633 Ga0501040_0025952 3300049576 Bacteria 3942
634 Ga0501040_0134139 3300049576 Bacteria 1742
635 Ga0501040_0658031 3300049576 Bacteria 757
636 Ga0501041_0040460 3300049577 Bacteria 2829
637 Ga0501041_0138119 3300049577 Bacteria 1519
638 Ga0501042_0128666 3300049578 Bacteria 1824
639 Ga0501042_1050155 3300049578 Bacteria 594
640 Ga0501043_0052184 3300049579 Bacteria 3213
641 Ga0501043_0390279 3300049579 Bacteria 1053
642 Ga0501046_0131478 3300049580 Bacteria 1898
643 Ga0501046_0145807 3300049580 Bacteria 1788
644 Ga0501046_0211207 3300049580 Bacteria 1441
645 Ga0501047_0810344 3300049581 Bacteria 751
646 Ga0501048_0145480 3300049582 Bacteria 1676
647 Ga0501048_0780038 3300049582 Unclassified 686
648 Ga0501048_1234449 3300049582 Bacteria 537
649 Ga0501067_0659594 3300049583 Bacteria 587
650 Ga0501068_0020041 3300049584 Bacteria 3892
651 Ga0501068_0391901 3300049584 Unclassified 895
652 Ga0501069_0022975 3300049585 Bacteria 3396
653 Ga0501069_0051502 3300049585 Bacteria 2291
654 Ga0501069_0114604 3300049585 Unclassified 1537
655 Ga0501069_0559885 3300049585 Unclassified 684
656 Ga0501069_0627606 3300049585 Bacteria 646
657 Ga0501069_0771041 3300049585 Bacteria 582
658 Ga0501070_0098240 3300049586 Bacteria 2422
659 Ga0501070_0767978 3300049586 Bacteria 759
660 Ga0501070_1103647 3300049586 Bacteria 612
661 Ga0501071_0004935 3300049587 Bacteria 8517
662 Ga0501071_0538109 3300049587 Bacteria 897
663 Ga0501071_0563162 3300049587 Unclassified 875
664 Ga0501072_0039699 3300049588 Bacteria 3695
665 Ga0501072_0147261 3300049588 Bacteria 1877
666 Ga0501072_0349737 3300049588 Bacteria 1173
667 Ga0501074_0011452 3300049590 Bacteria 6452
668 Ga0501074_1070654 3300049590 Unclassified 566
669 Ga0501075_0015792 3300049591 Bacteria 5427
670 Ga0501075_0045389 3300049591 Bacteria 3298
671 Ga0501075_0079068 3300049591 Unclassified 2489
672 Ga0501075_0165138 3300049591 Bacteria 1689
673 Ga0501075_1379899 3300049591 Bacteria 534
674 Ga0501076_0029109 3300049592 Bacteria 4293
675 Ga0501076_0137281 3300049592 Bacteria 1986
676 Ga0501076_0279476 3300049592 Bacteria 1367
677 Ga0501077_0001513 3300049593 Bacteria 14008
678 Ga0501077_0049464 3300049593 Bacteria 2672
679 Ga0501077_0599123 3300049593 Bacteria 708
680 Ga0501201_055435 3300049651 Bacteria 503
681 Ga0501079_0001010 3300049741 Bacteria 19499
682 Ga0501079_0011769 3300049741 Bacteria 6681
683 Ga0501079_0321574 3300049741 Bacteria 1211
684 Ga0501079_1003282 3300049741 Bacteria 658
685 Ga0501080_0024684 3300049742 Bacteria 5574
686 Ga0501081_0008231 3300049743 Bacteria 6770
687 Ga0501081_0053777 3300049743 Bacteria 2780
688 Ga0501081_0211337 3300049743 Bacteria 1409
689 Ga0501081_1247355 3300049743 Bacteria 563
690 Ga0501083_0026799 3300049744 Bacteria 3982
691 Ga0501083_1001207 3300049744 Bacteria 544
692 Ga0501035_1127170 3300049822 Bacteria 612
693 Ga0501035_1231396 3300049822 Archaea 580
694 Ga0501045_0160412 3300049824 Bacteria 1674
695 Ga0501045_0339888 3300049824 Bacteria 1117
696 Ga0501045_0621369 3300049824 Bacteria 799
697 Ga0501045_0749941 3300049824 Unclassified 719
698 Ga0501045_1118403 3300049824 Unclassified 576
699 nmdc:mga03n38_70901_c1 3300050490 Bacteria 1613
700 nmdc:mga00v17_269220_c1 3300050491 Unclassified 1105
701 nmdc:mga00v17_834265_c1 3300050491 Bacteria 586
702 nmdc:mga0yw44_861594_c1 3300050492 Bacteria 615
703 nmdc:mga06z11_305284_c1 3300050494 Bacteria 947
704 nmdc:mga05p37_319967_c1 3300050507 Unclassified 1836
705 nmdc:mga05p37_390070_c1 3300050507 Bacteria 1629
706 nmdc:mga05p37_7989_c1 3300050507 Bacteria 12489
707 nmdc:mga09592_1491587_c1 3300050508 Bacteria 550
708 nmdc:mga09592_17120_c1 3300050508 Bacteria 5934
709 nmdc:mga0qj67_477011_c1 3300050509 Bacteria 1004
710 nmdc:mga06r32_502117_c1 3300050510 Bacteria 1190
711 nmdc:mga06r32_85671_c1 3300050510 Bacteria 3072
712 nmdc:mga08y16_279694_c1 3300050511 Bacteria 1722
713 nmdc:mga08y16_48026_c1 3300050511 Bacteria 4468
714 nmdc:mga0n895_715830_c1 3300050512 Bacteria 996
715 nmdc:mga0a205_101990_c1 3300050515 Bacteria 2768
716 nmdc:mga0a205_438077_c1 3300050515 Bacteria 1168
717 nmdc:mga0a205_491_c1 3300050515 Bacteria 30978
718 Ga0495601_0028274 3300053077 Bacteria 3472
719 Ga0495601_0263457 3300053077 Bacteria 1125
720 Ga0495601_0288136 3300053077 Bacteria 1070
721 Ga0495612_0107315 3300053078 Bacteria 1193
722 Ga0495655_0001070 3300053083 Bacteria 4231
723 Ga0495595_0000009 3300053084 Bacteria 193039
724 Ga0495595_0365096 3300053084 Bacteria 730
725 Ga0495595_0507547 3300053084 Unclassified 615
726 Ga0495619_0000057 3300053085 Bacteria 93948
727 Ga0495619_0000347 3300053085 Bacteria 32351
728 Ga0495619_0004222 3300053085 Bacteria 9167
729 Ga0495619_0017332 3300053085 Bacteria 4561
730 Ga0495619_0042576 3300053085 Bacteria 2974
731 Ga0495619_0790048 3300053085 Bacteria 642
732 Ga0501084_0015982 3300054114 Bacteria 6229
733 Ga0501084_0065877 3300054114 Bacteria 3031
734 Ga0590075_014461 3300059424 Bacteria 1930
735 Ga0590077_088851 3300059426 Bacteria 716
736 Ga0501082_0014032 3300060353 Bacteria 6892
737 Ga0501082_0157329 3300060353 Bacteria 1974
738 Ga0466962_0307312 3300061719 Bacteria 785
739 Ga0530510_0028215 3300061734 Bacteria 4024
740 Ga0530510_0183344 3300061734 Bacteria 1553
741 Ga0530510_0244158 3300061734 Bacteria 1337
742 Ga0530510_0294047 3300061734 Bacteria 1215
743 Ga0530510_0881758 3300061734 Bacteria 684
744 Ga0081455_10013324
745 ARcpr5yngRDRAFT_c007031
746 ARSoilOldRDRAFT_c006488
747 LJQas_1002915
748 JGI25404J52841_10062807
749 Ga0070658_10017030
750 Ga0070658_10126711
751 Ga0070658_10221404
752 Ga0070658_10350737
753 Ga0070658_10749461
754 Ga0070683_100001509
755 Ga0070683_100021412
756 Ga0070683_100040070
757 Ga0070683_100053073
758 Ga0070683_100105765
759 Ga0070683_100216616
760 Ga0070690_100294353
761 Ga0070670_100453426
762 Ga0070666_10972323
763 Ga0070680_100006313
764 Ga0070680_100013154
765 Ga0070680_100013720
766 Ga0070680_100129210
767 Ga0070682_100007038
768 Ga0070682_100013418
769 Ga0070682_100101732
770 Ga0068868_100044198
771 Ga0068868_100100660
772 Ga0068868_100131521
773 Ga0068868_100229743
774 Ga0068868_100599768
775 Ga0070660_100019951
776 Ga0070660_100112764
777 Ga0070660_100221050
778 Ga0070660_100760870
779 Ga0070689_100006876
780 Ga0070689_100167728
781 Ga0070691_10000003
782 Ga0070691_10000348
783 Ga0070691_10027616
784 Ga0070691_10079954
785 Ga0070691_10165686
786 Ga0070691_10481332
787 Ga0070687_100041593
788 Ga0070661_100158792
789 Ga0070661_100173578
790 Ga0070692_10079695
791 Ga0070692_10170679
792 Ga0070668_100074683
793 Ga0070668_100150309
794 Ga0070668_100221789
795 Ga0070668_101433903
796 Ga0070669_100974607
797 Ga0070669_101349009
798 Ga0070675_100014932
799 Ga0070671_100013011
800 Ga0070674_100000021
801 Ga0070674_100000075
802 Ga0070674_100018177
803 Ga0070673_100019016
804 Ga0070673_100296199
805 Ga0070688_100008521
806 Ga0070659_100035556
807 Ga0070659_100072397
808 Ga0070659_100091819
809 Ga0070659_100289840
810 Ga0070703_10023303
811 Ga0070703_10036680
812 Ga0070703_10360237
813 Ga0070709_10100029
814 Ga0070709_10127919
815 Ga0070714_100231422
816 Ga0070714_100966720
817 Ga0070714_100989311
818 Ga0070713_100360506
819 Ga0070710_10030359
820 Ga0070710_10114115
821 Ga0070701_10019328
822 Ga0070711_100020206
823 Ga0070711_100095062
824 Ga0070711_100180048
825 Ga0070705_100006991
826 Ga0070705_100159412
827 Ga0070705_100919661
828 Ga0070700_100115333
829 Ga0070700_100361581
830 Ga0070700_100769123
831 Ga0070694_100245145
832 Ga0070708_100023312
833 Ga0070663_100013956
834 Ga0070663_100298525
835 Ga0070663_100535320
836 Ga0070663_101682194
837 Ga0070678_100028740
838 Ga0070678_100049405
839 Ga0070678_100840066
840 Ga0070662_100276112
841 Ga0070662_100463696
842 Ga0070681_10007063
843 Ga0070681_10012531
844 Ga0070681_10058509
845 Ga0070681_10074946
846 Ga0068867_100015156
847 Ga0070685_10003993
848 Ga0070706_100744629
849 Ga0070706_101010420
850 Ga0070698_100004541
851 Ga0070698_100405084
852 Ga0070698_100438133
853 Ga0070698_101632331
854 Ga0070699_100315728
855 Ga0070679_100002708
856 Ga0070679_100017844
857 Ga0070679_100081124
858 Ga0070679_100164873
859 Ga0070679_100270870
860 Ga0070684_100014651
861 Ga0070684_100026571
862 Ga0070684_100040655
863 Ga0070684_100042151
864 Ga0070684_100047696
865 Ga0070684_100249987
866 Ga0070697_100209603
867 Ga0068853_100084188
868 Ga0068853_100207258
869 Ga0068853_100269951
870 Ga0070672_100016458
871 Ga0070686_100008258
872 Ga0070696_100021184
873 Ga0070696_100148632
874 Ga0070696_100299831
875 Ga0070696_100894979
876 Ga0070693_100012061
877 Ga0070693_100033729
878 Ga0070693_100072375
879 Ga0070665_100055388
880 Ga0070704_100031041
881 Ga0070704_100082238
882 Ga0068855_100018101
883 Ga0068855_100496381
884 Ga0068855_100887024
885 Ga0070664_100010946
886 Ga0070664_100026584
887 Ga0070664_100429415
888 Ga0068857_100053012
889 Ga0068857_100132623
890 Ga0068857_100255706
891 Ga0068854_100065103
892 Ga0068856_100008174
893 Ga0068856_100025180
894 Ga0068856_100225423
895 Ga0070702_100039986
896 Ga0070702_100151644
897 Ga0070702_100152002
898 Ga0070702_100821735
899 Ga0068859_100554834
900 Ga0068864_100000023
901 Ga0068864_100138434
902 Ga0068866_10000007
903 Ga0068866_10000469
904 Ga0068866_10011837
905 Ga0068861_100053969
906 Ga0068861_100481459
907 Ga0068851_10058051
908 Ga0068870_10037558
909 Ga0068863_100000110
910 Ga0068863_100015554
911 Ga0068858_100049353
912 Ga0068860_100008112
913 Ga0068860_100259784
914 Ga0068862_100553100
915 Ga0081455_10017645
916 Ga0081455_10077197
917 Ga0081455_10089031
918 Ga0081455_10100270
919 Ga0081455_10138387
920 Ga0081455_10168460
921 Ga0081455_10372263
922 Ga0081538_10000187
923 Ga0081538_10000505
924 Ga0081538_10010349
925 Ga0081538_10303785
926 Ga0081540_1009639
927 Ga0081539_10005383
928 Ga0081539_10018229
929 Ga0070717_10664630
930 Ga0070717_10780907
931 Ga0075365_10108408
932 Ga0075365_10924884
933 Ga0075363_100065651
934 Ga0075432_10002585
935 Ga0075432_10030104
936 Ga0070715_10000003
937 Ga0070716_100056142
938 Ga0070712_100026426
939 Ga0070712_100039384
940 Ga0070712_100048646
941 Ga0070712_100350108
942 Ga0070712_100377334
943 Ga0075367_10224590
944 Ga0097621_100159095
945 Ga0075428_100003425
946 Ga0075428_101091516
947 Ga0075431_100170645
948 Ga0075431_100236169
949 Ga0075433_10000595
950 Ga0075434_101288232
951 Ga0075429_100416141
952 Ga0068865_100074382
953 Ga0097620_100554766
954 Ga0105240_10021329
955 Ga0111539_10027583
956 Ga0111539_10240937
957 Ga0105245_10000574
958 Ga0105245_10022144
959 Ga0105245_10376373
960 Ga0105245_10746819
961 Ga0105245_11461654
962 Ga0105245_12057464
963 Ga0105247_10029540
964 Ga0114129_10017784
965 Ga0114129_10138011
966 Ga0114129_10481490
967 Ga0105243_10111802
968 Ga0105243_10182966
969 Ga0105243_10438025
970 Ga0105243_10624448
971 Ga0105243_10772348
972 Ga0105241_10940843
973 Ga0105242_10006926
974 Ga0105242_10011195
975 Ga0105242_10026995
976 Ga0105248_10032424
977 Ga0105237_10151002
978 Ga0105249_10208700
979 Ga0105249_10265535
980 Ga0105249_10837757
981 Ga0105239_10028568
982 Ga0105239_10148039
983 Ga0105239_10186656
984 Ga0105239_10379763
985 Ga0105239_10426927
986 Ga0105239_10992693
987 Ga0105239_11217520
988 Ga0105246_10224323
989 Ga0157343_1015309
990 Ga0157322_1011236
991 Ga0157347_1023119
992 Ga0157373_10245716
993 Ga0157371_10252831
994 Ga0157370_10011970
995 Ga0157370_10053606
996 Ga0157370_10315857
997 Ga0157369_10000068
998 Ga0157369_10025480
999 Ga0157369_10309525
1000 Ga0157369_11354785
1001 Ga0157369_11558133
1002 Ga0157369_12126938
1003 Ga0157374_10006301
1004 Ga0157374_10106059
1005 Ga0157374_10368907
1006 Ga0157378_10351205
1007 Ga0157378_11210532
1008 Ga0157378_12078093
1009 Ga0163162_10242531
1010 Ga0157372_10024289
1011 Ga0157375_10118321
1012 Ga0157375_10206461
1013 Ga0157380_10001131
1014 Ga0157380_10024306
1015 Ga0157377_10007417
1016 Ga0157377_10025339
1017 Ga0157377_10161824
1018 Ga0157377_10634999
1019 Ga0157379_10020837
1020 Ga0157376_10045971
1021 Ga0163161_10317022
1022 Ga0206356_10964721
1023 Ga0206356_11725412
1024 Ga0206353_10696096
1025 Ga0206353_11776508
1026 Ga0224712_10159539
1027 Ga0207653_10008149
1028 Ga0207653_10048770
1029 Ga0207692_10172935
1030 Ga0207692_10249464
1031 Ga0207642_10000008
1032 Ga0207642_10000181
1033 Ga0207642_10003777
1034 Ga0207642_11013165
1035 Ga0207688_10048174
1036 Ga0207647_10051439
1037 Ga0207685_10000003
1038 Ga0207685_10374018
1039 Ga0207645_10079731
1040 Ga0207643_10022326
1041 Ga0207643_10354001
1042 Ga0207705_10143589
1043 Ga0207684_10403189
1044 Ga0207707_10027006
1045 Ga0207707_10128248
1046 Ga0207707_10138412
1047 Ga0207707_10284626
1048 Ga0207693_10018802
1049 Ga0207693_10024860
1050 Ga0207693_10039249
1051 Ga0207693_10069855
1052 Ga0207663_10014762
1053 Ga0207663_10182698
1054 Ga0207663_10588492
1055 Ga0207660_10026788
1056 Ga0207660_10080756
1057 Ga0207660_10161646
1058 Ga0207660_10203935
1059 Ga0207662_10044033
1060 Ga0207662_10155468
1061 Ga0207657_10000150
1062 Ga0207657_10073331
1063 Ga0207657_10107629
1064 Ga0207649_10030733
1065 Ga0207649_10060542
1066 Ga0207649_10141908
1067 Ga0207652_10019183
1068 Ga0207652_10108374
1069 Ga0207652_10412451
1070 Ga0207646_11710775
1071 Ga0207681_10061629
1072 Ga0207681_10947872
1073 Ga0207650_10623257
1074 Ga0207687_10000025
1075 Ga0207687_10003925
1076 Ga0207687_10080436
1077 Ga0207664_10870035
1078 Ga0207644_10107014
1079 Ga0207690_10063749
1080 Ga0207690_10101708
1081 Ga0207690_10243472
1082 Ga0207690_10274405
1083 Ga0207690_10559039
1084 Ga0207706_10060598
1085 Ga0207706_10114658
1086 Ga0207706_10591333
1087 Ga0207686_10000066
1088 Ga0207686_10004392
1089 Ga0207686_10303127
1090 Ga0207709_10008399
1091 Ga0207709_10101087
1092 Ga0207709_10418638
1093 Ga0207709_10846623
1094 Ga0207670_10252709
1095 Ga0207669_10000032
1096 Ga0207669_10000091
1097 Ga0207669_10612310
1098 Ga0207704_10197718
1099 Ga0207665_10487140
1100 Ga0207691_10034853
1101 Ga0207711_10092313
1102 Ga0207661_10006253
1103 Ga0207661_10040368
1104 Ga0207661_10068690
1105 Ga0207661_10130735
1106 Ga0207661_10320382
1107 Ga0207679_10004838
1108 Ga0207679_10016107
1109 Ga0207679_10061346
1110 Ga0207679_10397086
1111 Ga0207679_10583291
1112 Ga0207667_10125978
1113 Ga0207667_10549852
1114 Ga0207651_10164631
1115 Ga0207712_10126149
1116 Ga0207712_10196598
1117 Ga0207668_10062442
1118 Ga0207668_10137892
1119 Ga0207668_10360038
1120 Ga0207640_10754043
1121 Ga0207658_10156307
1122 Ga0207677_10091958
1123 Ga0207677_10117809
1124 Ga0207677_10132103
1125 Ga0207639_10067252
1126 Ga0207639_10511664
1127 Ga0207678_10062389
1128 Ga0207678_10087128
1129 Ga0207678_10379745
1130 Ga0207678_10628061
1131 Ga0207708_10084087
1132 Ga0207708_10161138
1133 Ga0207708_10221454
1134 Ga0207708_10366271
1135 Ga0207702_10015687
1136 Ga0207702_10058763
1137 Ga0207702_10098679
1138 Ga0207641_10000065
1139 Ga0207641_10089456
1140 Ga0207648_10013821
1141 Ga0207676_10000025
1142 Ga0207676_11339062
1143 Ga0207674_10007123
1144 Ga0207674_10058169
1145 Ga0207674_10066019
1146 Ga0207675_100172048
1147 Ga0207675_100452449
1148 Ga0207675_100977145
1149 Ga0207683_10048378
1150 Ga0207683_10112034
1151 Ga0207698_10108578
1152 Ga0207698_10742312
1153 Ga0209998_10005119
1154 Ga0207428_10002844
1155 Ga0207428_10006702
1156 Ga0268266_10466180
1157 Ga0268265_10359251
1158 Ga0268265_11020596
1159 Ga0268264_10004592
1160 Ga0268264_11508485
1161 Ga0265316_10734235
1162 Ga0307405_11362940
1163 Ga0307405_11637840
1164 Ga0307415_100184925
1165 Ga0373950_0013869
1166 Ga0373958_0040430
1167 Ga0373940_0187926
1168 Ga0373949_0018145
1169 Ga0373952_0003267
1170 Ga0373939_0075420
1171 Ga0373956_0156566
1172 Ga0373956_0444215
1173 Ga0373960_0009372
1174 Ga0373946_0063739
1175 Ga0373955_0746334
1176 Ga0373961_0039857
1177 Ga0373962_0012747
1178 Ga0373931_0023741
1179 Ga0373931_0044352
1180 Ga0373935_0291686
1181 Ga0373947_0091253
1182 Ga0373947_0546722
1183 Ga0373937_0032638
1184 Ga0395899_0064785
1185 Ga0395899_0649664
1186 Ga0395900_0024421
1187 Ga0395898_0051929
1188 Ga0395898_0512292
1189 Ga0395905_0265667
1190 Ga0395901_0049746
1191 Ga0395901_0067725
1192 Ga0436360_0998903
1193 Ga0436361_0921822
1194 Ga0451807_0619992
1195 Ga0451839_0208429
1196 Ga0451849_0576143
1197 Ga0451849_1322835
1198 Ga0451853_1844353
1199 Ga0466965_0303727
1200 Ga0466963_0000257
1201 Ga0466963_0008793
1202 Ga0466963_0225822
1203 Ga0466963_0254106
1204 Ga0466963_0456945
1205 Ga0466971_0024025
1206 Ga0466971_0311625
1207 Ga0466968_0232180
1208 Ga0466957_0113383
1209 Ga0466960_0128699
1210 Ga0466958_0094545
1211 Ga0466967_0000849
1212 Ga0466967_0023712
1213 Ga0466967_0035511
1214 Ga0466967_0154283
1215 Ga0495603_0004890
1216 Ga0495603_0197471
1217 Ga0495603_0434819
1218 Ga0495629_0038252
1219 Ga0495629_0182592
1220 Ga0495641_0024794
1221 Ga0495641_0252876
1222 Ga0495641_0329765
1223 Ga0495651_0176768
1224 Ga0495653_0024537
1225 Ga0495653_0450138
1226 Ga0495653_0602614
1227 Ga0495582_0000006
1228 Ga0495662_0000178
1229 Ga0495662_0360982
1230 Ga0495664_0205324
1231 Ga0495594_0000001
1232 Ga0495608_0000042
1233 Ga0495608_0003416
1234 Ga0495618_0000142
1235 Ga0495628_0000265
1236 Ga0495628_0112394
1237 Ga0495628_0405455
1238 Ga0495628_0928845
1239 Ga0495630_0003329
1240 Ga0495630_0069730
1241 Ga0495630_0189547
1242 Ga0495630_0590225
1243 Ga0495644_0005280
1244 Ga0495652_0000009
1245 Ga0495652_0236518
1246 Ga0495665_0383443
1247 Ga0495640_0054057
1248 Ga0495640_0113919
1249 Ga0495640_0222465
1250 Ga0495640_0252277
1251 Ga0495640_0743670
1252 Ga0495586_0042119
1253 Ga0495586_0389164
1254 Ga0495598_0012729
1255 Ga0495609_0345667
1256 Ga0495645_0000636
1257 Ga0495622_0000033
1258 Ga0495633_0128957
1259 Ga0495667_0084602
1260 Ga0495656_0001098
1261 Ga0495656_0310745
1262 Ga0495634_0000951
1263 Ga0495634_0065361
1264 Ga0495634_0076408
1265 Ga0495635_0013966
1266 Ga0495635_0093100
1267 Ga0495635_0136344
1268 Ga0495657_0000040
1269 Ga0495657_0167648
1270 Ga0495599_0155541
1271 Ga0495646_0464055
1272 Ga0495658_0000027
1273 Ga0495658_0003607
1274 Ga0495658_0357137
1275 Ga0495613_0000190
1276 Ga0495613_0083810
1277 Ga0495613_0099980
1278 Ga0495613_0108999
1279 Ga0495624_0846766
1280 Ga0495670_0001313
1281 Ga0495589_0205522
1282 Ga0495600_0027309
1283 Ga0495600_0561084
1284 Ga0495604_0278658
1285 Ga0495674_0000961
1286 Ga0495674_0024134
1287 Ga0495676_0000624
1288 Ga0495680_0186383
1289 Ga0495680_0436578
1290 Ga0495675_0000051
1291 Ga0495685_020745
1292 Ga0495684_0100321
1293 Ga0495684_0244869
1294 Ga0495684_0439898
1295 Ga0495602_0035577
1296 Ga0495602_0241302
1297 Ga0495602_0507500
1298 Ga0495614_0293437
1299 Ga0496100_0000028
1300 Ga0496100_0000494
1301 Ga0496100_0034089
1302 Ga0496100_0093134
1303 Ga0496100_0794996
1304 Ga0496101_0000005
1305 Ga0496101_0005803
1306 Ga0496101_0011485
1307 Ga0496101_0125992
1308 Ga0496101_1214134
1309 Ga0496102_0211014
1310 Ga0496102_0402876
1311 Ga0496102_0969174
1312 Ga0496103_0149251
1313 Ga0496103_0273086
1314 Ga0496104_0057715
1315 Ga0496104_0112658
1316 Ga0496104_0362504
1317 Ga0496105_0020770
1318 Ga0496105_0098296
1319 Ga0496106_0000070
1320 Ga0496106_0007024
1321 Ga0496106_1072146
1322 Ga0496107_0000004
1323 Ga0496107_0023262
1324 Ga0496107_0181592
1325 Ga0496108_0000042
1326 Ga0496108_0000178
1327 Ga0496108_0006044
1328 Ga0496108_0401968
1329 Ga0496108_0406929
1330 Ga0496108_0527443
1331 Ga0496108_0921649
1332 Ga0496108_1103178
1333 Ga0496109_0000034
1334 Ga0496109_0001026
1335 Ga0496109_0019302
1336 Ga0496109_0065044
1337 Ga0496109_0114859
1338 Ga0496109_0164981
1339 Ga0496109_0687450
1340 Ga0496109_1552656
1341 Ga0496109_1668171
1342 Ga0496110_0001400
1343 Ga0496110_0009055
1344 Ga0496110_0079121
1345 Ga0496110_0520384
1346 Ga0496111_0018771
1347 Ga0496111_0024449
1348 Ga0496111_0206086
1349 Ga0496111_0551107
1350 Ga0496111_0855393
1351 Ga0496112_0225156
1352 Ga0496112_0247159
1353 Ga0496112_0332443
1354 Ga0496113_0031100
1355 Ga0496113_0050214
1356 Ga0496113_0101178
1357 Ga0496113_0244795
1358 Ga0496114_0010460
1359 Ga0496114_0043152
1360 Ga0496114_0298013
1361 Ga0496114_0399967
1362 Ga0496114_0543362
1363 Ga0496114_0723927
1364 Ga0496114_0762983
1365 Ga0496115_0000035
1366 Ga0496115_0009485
1367 Ga0496115_0901071
1368 Ga0501031_0013798
1369 Ga0501031_0049134
1370 Ga0501031_0162638
1371 Ga0501033_0082392
1372 Ga0501036_1138984
1373 Ga0501038_0097750
1374 Ga0501038_0248104
1375 Ga0501039_0029803
1376 Ga0501040_0025952
1377 Ga0501040_0134139
1378 Ga0501040_0658031
1379 Ga0501041_0040460
1380 Ga0501041_0138119
1381 Ga0501042_0128666
1382 Ga0501042_1050155
1383 Ga0501043_0052184
1384 Ga0501043_0390279
1385 Ga0501046_0131478
1386 Ga0501046_0145807
1387 Ga0501046_0211207
1388 Ga0501047_0810344
1389 Ga0501048_0145480
1390 Ga0501048_0780038
1391 Ga0501048_1234449
1392 Ga0501067_0659594
1393 Ga0501068_0020041
1394 Ga0501068_0391901
1395 Ga0501069_0022975
1396 Ga0501069_0051502
1397 Ga0501069_0114604
1398 Ga0501069_0559885
1399 Ga0501069_0627606
1400 Ga0501069_0771041
1401 Ga0501070_0098240
1402 Ga0501070_0767978
1403 Ga0501070_1103647
1404 Ga0501071_0004935
1405 Ga0501071_0538109
1406 Ga0501071_0563162
1407 Ga0501072_0039699
1408 Ga0501072_0147261
1409 Ga0501072_0349737
1410 Ga0501074_0011452
1411 Ga0501074_1070654
1412 Ga0501075_0015792
1413 Ga0501075_0045389
1414 Ga0501075_0079068
1415 Ga0501075_0165138
1416 Ga0501075_1379899
1417 Ga0501076_0029109
1418 Ga0501076_0137281
1419 Ga0501076_0279476
1420 Ga0501077_0001513
1421 Ga0501077_0049464
1422 Ga0501077_0599123
1423 Ga0501201_055435
1424 Ga0501079_0001010
1425 Ga0501079_0011769
1426 Ga0501079_0321574
1427 Ga0501079_1003282
1428 Ga0501080_0024684
1429 Ga0501081_0008231
1430 Ga0501081_0053777
1431 Ga0501081_0211337
1432 Ga0501081_1247355
1433 Ga0501083_0026799
1434 Ga0501083_1001207
1435 Ga0501035_1127170
1436 Ga0501035_1231396
1437 Ga0501045_0160412
1438 Ga0501045_0339888
1439 Ga0501045_0621369
1440 Ga0501045_0749941
1441 Ga0501045_1118403
1442 nmdc:mga03n38_70901_c1
1443 nmdc:mga00v17_269220_c1
1444 nmdc:mga00v17_834265_c1
1445 nmdc:mga0yw44_861594_c1
1446 nmdc:mga06z11_305284_c1
1447 nmdc:mga05p37_319967_c1
1448 nmdc:mga05p37_390070_c1
1449 nmdc:mga05p37_7989_c1
1450 nmdc:mga09592_1491587_c1
1451 nmdc:mga09592_17120_c1
1452 nmdc:mga0qj67_477011_c1
1453 nmdc:mga06r32_502117_c1
1454 nmdc:mga06r32_85671_c1
1455 nmdc:mga08y16_279694_c1
1456 nmdc:mga08y16_48026_c1
1457 nmdc:mga0n895_715830_c1
1458 nmdc:mga0a205_101990_c1
1459 nmdc:mga0a205_438077_c1
1460 nmdc:mga0a205_491_c1
1461 Ga0495601_0028274
1462 Ga0495601_0263457
1463 Ga0495601_0288136
1464 Ga0495612_0107315
1465 Ga0495655_0001070
1466 Ga0495595_0000009
1467 Ga0495595_0365096
1468 Ga0495595_0507547
1469 Ga0495619_0000057
1470 Ga0495619_0000347
1471 Ga0495619_0004222
1472 Ga0495619_0017332
1473 Ga0495619_0042576
1474 Ga0495619_0790048
1475 Ga0501084_0015982
1476 Ga0501084_0065877
1477 Ga0590075_014461
1478 Ga0590077_088851
1479 Ga0501082_0014032
1480 Ga0501082_0157329
1481 Ga0466962_0307312
1482 Ga0530510_0028215
1483 Ga0530510_0183344
1484 Ga0530510_0244158
1485 Ga0530510_0294047
1486 Ga0530510_0881758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

121

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

122

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8203 7 124
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.813 3 124
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7896 3 124
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.7878 7 124
4rt5-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase protein from planctomyces limnophilus dsm 3776 0.7667 5 124
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8615 71 122 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8603 71 124 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8119 71 134 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8094 73 125 3.30.720.110
3rheA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8041 7 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A431R9P7-F1-model_v4 VOC family protein 0.9991 73 126
AF-A0A537NX92-F1-model_v4 VOC family protein 0.9961 75 126
AF-A0A4S1FN10-F1-model_v4 VOC family protein 0.9957 71 126
AF-N9MQE2-F1-model_v4 VOC domain-containing protein 0.9901 71 126
AF-A0A7W0G7P7-F1-model_v4 VOC family protein 0.99 74 138

Map