F478689

General Info

Members Datasets Scaffolds Average Seq Length
743 283 743 266

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10092291|Ga0207697_100922912
Length 303
Sequence MLSPQEGRLRFFRRKNDRPRRRFRRGVYLLPSLLTMGNMFCGYACVVYAMRGEFETAAPFIGFAVVIDGLDGRIARMTGTTSAFGVEFDSLADIISFGIAPAILSFAWGLQSLGRLGWAAGFMFVACAAMRLARFNIQSASGGDKRYFVGMPSPAAAAIPAATVYAYPVGLYDYRAALPALAMVIVPAILMVSTIRFRSFKTIDSQGRKPYTVLIFVAAGIMLIATHPRFMLVAIAYVYLASAFVGLAITRFRHRGERGGDSAAAVRTLGLDESAFGHISTGGGASLEYLEGKQLPGLVALEA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 3.9
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000102 3300003203 Bacteria 37824
2 JGI25406J46586_10001270 3300003203 Bacteria 11843
3 Ga0065712_10035779 3300005290 Unclassified 1095
4 Ga0065712_10074717 3300005290 Bacteria 4027
5 Ga0065712_10191071 3300005290 Bacteria 1148
6 Ga0065715_10034415 3300005293 Bacteria 1518
7 Ga0065715_10177504 3300005293 Bacteria 1500
8 Ga0065707_10006338 3300005295 Bacteria 5414
9 Ga0065707_10102536 3300005295 Unclassified 2799
10 Ga0065707_10234770 3300005295 Bacteria 1176
11 Ga0070676_10001391 3300005328 Bacteria 12217
12 Ga0070683_100000817 3300005329 Bacteria 23098
13 Ga0070683_100191479 3300005329 Bacteria 1942
14 Ga0070683_100711358 3300005329 Bacteria 962
15 Ga0070690_100257833 3300005330 Bacteria 1236
16 Ga0070670_100003221 3300005331 Bacteria 13474
17 Ga0070670_100010107 3300005331 Bacteria 8050
18 Ga0070670_100046518 3300005331 Bacteria 3731
19 Ga0070670_100316080 3300005331 Unclassified 1368
20 Ga0068869_100233032 3300005334 Bacteria 1464
21 Ga0070666_10022404 3300005335 Bacteria 4102
22 Ga0070666_10029165 3300005335 Bacteria 3625
23 Ga0070666_10040134 3300005335 Bacteria 3123
24 Ga0070666_10090472 3300005335 Unclassified 2102
25 Ga0070680_100095629 3300005336 Bacteria 2463
26 Ga0068868_100304200 3300005338 Bacteria 1355
27 Ga0068868_100410341 3300005338 Bacteria 1171
28 Ga0070660_100005272 3300005339 Bacteria 8938
29 Ga0070689_100027236 3300005340 Bacteria 4308
30 Ga0070689_100163578 3300005340 Bacteria 1800
31 Ga0070691_10001127 3300005341 Bacteria 11104
32 Ga0070661_100019679 3300005344 Bacteria 4811
33 Ga0070669_100000133 3300005353 Bacteria 67886
34 Ga0070669_100101340 3300005353 Bacteria 2172
35 Ga0070669_100174654 3300005353 Unclassified 1677
36 Ga0070669_100242317 3300005353 Bacteria 1433
37 Ga0070675_100001153 3300005354 Bacteria 19086
38 Ga0070675_100004794 3300005354 Bacteria 10316
39 Ga0070675_100010814 3300005354 Bacteria 7136
40 Ga0070675_100070461 3300005354 Bacteria 2898
41 Ga0070675_100112217 3300005354 Unclassified 2308
42 Ga0070675_100177522 3300005354 Unclassified 1840
43 Ga0070675_100181715 3300005354 Bacteria 1819
44 Ga0070671_100005021 3300005355 Bacteria 10550
45 Ga0070671_100159686 3300005355 Bacteria 1905
46 Ga0070674_100010617 3300005356 Bacteria 5576
47 Ga0070674_100023397 3300005356 Unclassified 3999
48 Ga0070674_100070301 3300005356 Bacteria 2473
49 Ga0070674_100080860 3300005356 Unclassified 2321
50 Ga0070673_100109853 3300005364 Bacteria 2285
51 Ga0070673_100164797 3300005364 Bacteria 1887
52 Ga0070673_100252463 3300005364 Unclassified 1538
53 Ga0070688_100048886 3300005365 Bacteria 2630
54 Ga0070688_100062324 3300005365 Bacteria 2360
55 Ga0070659_100248468 3300005366 Bacteria 1474
56 Ga0070667_100012544 3300005367 Bacteria 7009
57 Ga0070667_100065911 3300005367 Bacteria 3076
58 Ga0070667_100210948 3300005367 Bacteria 1726
59 Ga0070667_100550813 3300005367 Bacteria 1060
60 Ga0070703_10019261 3300005406 Bacteria 1978
61 Ga0070713_100042202 3300005436 Bacteria 3722
62 Ga0070711_100051768 3300005439 Bacteria 2822
63 Ga0070700_100003178 3300005441 Bacteria 8437
64 Ga0070700_100388440 3300005441 Bacteria 1046
65 Ga0070694_100334196 3300005444 Bacteria 1170
66 Ga0070708_100059068 3300005445 Bacteria 3418
67 Ga0070708_100107666 3300005445 Bacteria 2559
68 Ga0070662_100079056 3300005457 Bacteria 2445
69 Ga0070662_100320538 3300005457 Unclassified 1264
70 Ga0070681_10018543 3300005458 Bacteria 6957
71 Ga0070681_10317944 3300005458 Bacteria 1466
72 Ga0068867_100104894 3300005459 Bacteria 2164
73 Ga0068867_100213604 3300005459 Bacteria 1551
74 Ga0068867_100224345 3300005459 Bacteria 1516
75 Ga0068867_100255688 3300005459 Bacteria 1426
76 Ga0070685_10264827 3300005466 Bacteria 1145
77 Ga0070706_100231467 3300005467 Bacteria 1725
78 Ga0070706_100313175 3300005467 Bacteria 1464
79 Ga0070707_100155083 3300005468 Bacteria 2231
80 Ga0070707_100300062 3300005468 Bacteria 1561
81 Ga0070698_100005321 3300005471 Bacteria 14088
82 Ga0070698_100115766 3300005471 Bacteria 2645
83 Ga0070698_100342982 3300005471 Unclassified 1425
84 Ga0070698_100363061 3300005471 Unclassified 1380
85 Ga0070698_100419282 3300005471 Bacteria 1273
86 Ga0070699_100001247 3300005518 Bacteria 23450
87 Ga0070699_100003994 3300005518 Bacteria 13034
88 Ga0070699_100011273 3300005518 Bacteria 7723
89 Ga0070699_100107057 3300005518 Bacteria 2453
90 Ga0070699_100448884 3300005518 Bacteria 1169
91 Ga0070679_100257179 3300005530 Bacteria 1701
92 Ga0070684_100000538 3300005535 Bacteria 26032
93 Ga0070697_100024877 3300005536 Bacteria 4769
94 Ga0070697_100452978 3300005536 Bacteria 1118
95 Ga0070697_100647031 3300005536 Bacteria 931
96 Ga0070672_100006875 3300005543 Bacteria 7688
97 Ga0070672_100011885 3300005543 Bacteria 6085
98 Ga0070672_100029428 3300005543 Bacteria 4119
99 Ga0070695_100010728 3300005545 Bacteria 5474
100 Ga0070696_100011361 3300005546 Bacteria 5964
101 Ga0070696_100032166 3300005546 Bacteria 3599
102 Ga0070665_100003845 3300005548 Bacteria 15892
103 Ga0070665_100008381 3300005548 Bacteria 10457
104 Ga0070665_100307911 3300005548 Unclassified 1587
105 Ga0070704_100007278 3300005549 Bacteria 6583
106 Ga0070704_100022532 3300005549 Bacteria 4101
107 Ga0070704_100068140 3300005549 Bacteria 2573
108 Ga0070704_100435765 3300005549 Bacteria 1125
109 Ga0068855_100165946 3300005563 Bacteria 2503
110 Ga0068855_100956441 3300005563 Bacteria 902
111 Ga0070664_100000055 3300005564 Bacteria 69107
112 Ga0070664_100168983 3300005564 Bacteria 1939
113 Ga0070664_100193954 3300005564 Unclassified 1810
114 Ga0070664_100590950 3300005564 Bacteria 1029
115 Ga0068857_100005431 3300005577 Bacteria 10868
116 Ga0068856_100059321 3300005614 Bacteria 3780
117 Ga0070702_100004635 3300005615 Bacteria 6304
118 Ga0070702_100063997 3300005615 Bacteria 2150
119 Ga0068859_100110287 3300005617 Bacteria 2813
120 Ga0068859_100422501 3300005617 Bacteria 1429
121 Ga0068859_100728165 3300005617 Bacteria 1082
122 Ga0068859_100744051 3300005617 Bacteria 1069
123 Ga0068864_100072431 3300005618 Bacteria 3003
124 Ga0068864_100320109 3300005618 Bacteria 1457
125 Ga0068866_10018276 3300005718 Bacteria 3167
126 Ga0068866_10035182 3300005718 Bacteria 2444
127 Ga0068861_100201088 3300005719 Bacteria 1672
128 Ga0068861_100686806 3300005719 Bacteria 950
129 Ga0068863_100006039 3300005841 Bacteria 11882
130 Ga0068863_100123229 3300005841 Bacteria 2473
131 Ga0068863_100171661 3300005841 Unclassified 2080
132 Ga0068858_100006490 3300005842 Bacteria 11386
133 Ga0068858_100041636 3300005842 Bacteria 4259
134 Ga0068858_100453749 3300005842 Bacteria 1236
135 Ga0068858_100657725 3300005842 Unclassified 1018
136 Ga0068860_100354736 3300005843 Unclassified 1444
137 Ga0068860_100451700 3300005843 Unclassified 1278
138 Ga0068862_100010418 3300005844 Bacteria 7676
139 Ga0068862_100012785 3300005844 Bacteria 6946
140 Ga0068862_100022777 3300005844 Bacteria 5242
141 Ga0068862_100111224 3300005844 Bacteria 2404
142 Ga0068862_100473276 3300005844 Bacteria 1185
143 Ga0068862_100671793 3300005844 Bacteria 1001
144 Ga0081455_10087723 3300005937 Bacteria 2531
145 Ga0081538_10086064 3300005981 Bacteria 1647
146 Ga0081539_10000056 3300005985 Bacteria 256522
147 Ga0081539_10000460 3300005985 Bacteria 86291
148 Ga0081539_10002890 3300005985 Bacteria 22768
149 Ga0081539_10005654 3300005985 Bacteria 12559
150 Ga0070717_10032580 3300006028 Bacteria 4200
151 Ga0075432_10120310 3300006058 Bacteria 986
152 Ga0070712_100380983 3300006175 Bacteria 1161
153 Ga0070712_100394968 3300006175 Bacteria 1141
154 Ga0097621_100001602 3300006237 Bacteria 15489
155 Ga0097621_100022608 3300006237 Bacteria 4883
156 Ga0097621_100362606 3300006237 Bacteria 1291
157 Ga0068871_100001058 3300006358 Bacteria 18456
158 Ga0068871_100010489 3300006358 Bacteria 6765
159 Ga0068871_100023609 3300006358 Bacteria 4760
160 Ga0068871_100131307 3300006358 Bacteria 2124
161 Ga0075428_100002186 3300006844 Bacteria 21167
162 Ga0075428_100005718 3300006844 Bacteria 13821
163 Ga0075428_100011036 3300006844 Bacteria 10048
164 Ga0075428_100031720 3300006844 Bacteria 5837
165 Ga0075428_100060471 3300006844 Bacteria 4148
166 Ga0075428_100062370 3300006844 Bacteria 4081
167 Ga0075428_100326143 3300006844 Bacteria 1649
168 Ga0075428_100505090 3300006844 Bacteria 1293
169 Ga0075430_100045130 3300006846 Bacteria 3724
170 Ga0075430_100048673 3300006846 Bacteria 3579
171 Ga0075430_100114609 3300006846 Bacteria 2246
172 Ga0075431_100023216 3300006847 Bacteria 6345
173 Ga0075431_100027376 3300006847 Bacteria 5848
174 Ga0075431_100029078 3300006847 Bacteria 5686
175 Ga0075431_100191920 3300006847 Bacteria 2093
176 Ga0075431_100241669 3300006847 Bacteria 1837
177 Ga0075431_100244848 3300006847 Bacteria 1823
178 Ga0075433_10007559 3300006852 Bacteria 8619
179 Ga0075433_10008654 3300006852 Bacteria 8120
180 Ga0075433_10057421 3300006852 Bacteria 3402
181 Ga0075433_10064437 3300006852 Unclassified 3213
182 Ga0075433_10123407 3300006852 Bacteria 2301
183 Ga0075433_10130784 3300006852 Bacteria 2230
184 Ga0075433_10313673 3300006852 Unclassified 1388
185 Ga0075434_100004203 3300006871 Bacteria 12904
186 Ga0075434_100007606 3300006871 Bacteria 10031
187 Ga0075434_100008966 3300006871 Bacteria 9316
188 Ga0075434_100013351 3300006871 Bacteria 7813
189 Ga0075434_100058394 3300006871 Unclassified 3834
190 Ga0075434_100163053 3300006871 Bacteria 2249
191 Ga0075434_100223029 3300006871 Bacteria 1905
192 Ga0075434_100399228 3300006871 Bacteria 1396
193 Ga0075429_100036803 3300006880 Bacteria 4259
194 Ga0075429_100105364 3300006880 Bacteria 2463
195 Ga0075429_100494191 3300006880 Bacteria 1072
196 Ga0068865_100038766 3300006881 Bacteria 3227
197 Ga0068865_100185971 3300006881 Bacteria 1603
198 Ga0075436_100009574 3300006914 Bacteria 6632
199 Ga0075436_100010634 3300006914 Bacteria 6311
200 Ga0075436_100021620 3300006914 Bacteria 4416
201 Ga0075436_100099327 3300006914 Bacteria 2026
202 Ga0075436_100209645 3300006914 Bacteria 1381
203 Ga0097620_100110288 3300006931 Bacteria 2813
204 Ga0097620_100385265 3300006931 Bacteria 1497
205 Ga0097620_100422497 3300006931 Bacteria 1429
206 Ga0097620_100728244 3300006931 Bacteria 1082
207 Ga0097620_100744040 3300006931 Bacteria 1069
208 Ga0075435_100000882 3300007076 Bacteria 18834
209 Ga0075435_100000891 3300007076 Bacteria 18771
210 Ga0075435_100004221 3300007076 Bacteria 9866
211 Ga0075435_100022979 3300007076 Bacteria 4815
212 Ga0075435_100234705 3300007076 Bacteria 1559
213 Ga0075435_100257637 3300007076 Bacteria 1486
214 Ga0075435_100324701 3300007076 Unclassified 1317
215 Ga0099794_10158440 3300007265 Bacteria 1151
216 Ga0105240_10164668 3300009093 Unclassified 2631
217 Ga0105240_10300646 3300009093 Unclassified 1836
218 Ga0111539_10000056 3300009094 Bacteria 114878
219 Ga0111539_10000859 3300009094 Bacteria 39627
220 Ga0111539_10001720 3300009094 Bacteria 29144
221 Ga0111539_10003211 3300009094 Bacteria 21614
222 Ga0111539_10009925 3300009094 Bacteria 12011
223 Ga0111539_10010192 3300009094 Bacteria 11843
224 Ga0111539_10017296 3300009094 Bacteria 8923
225 Ga0111539_10020554 3300009094 Bacteria 8132
226 Ga0111539_10082634 3300009094 Bacteria 3778
227 Ga0111539_10578297 3300009094 Bacteria 1308
228 Ga0105245_10004376 3300009098 Bacteria 12501
229 Ga0105245_10138173 3300009098 Bacteria 2292
230 Ga0105245_10280353 3300009098 Bacteria 1629
231 Ga0105245_10679886 3300009098 Bacteria 1061
232 Ga0105247_10006881 3300009101 Bacteria 7008
233 Ga0105247_10020925 3300009101 Bacteria 3936
234 Ga0114129_10001088 3300009147 Bacteria 35659
235 Ga0114129_10001107 3300009147 Bacteria 35478
236 Ga0114129_10003691 3300009147 Bacteria 21558
237 Ga0114129_10009647 3300009147 Bacteria 13775
238 Ga0114129_10019564 3300009147 Bacteria 9638
239 Ga0114129_10024941 3300009147 Bacteria 8478
240 Ga0114129_10031424 3300009147 Bacteria 7505
241 Ga0114129_10032450 3300009147 Bacteria 7381
242 Ga0114129_10039491 3300009147 Bacteria 6654
243 Ga0114129_10061566 3300009147 Bacteria 5245
244 Ga0114129_10063061 3300009147 Bacteria 5177
245 Ga0114129_10107306 3300009147 Bacteria 3857
246 Ga0114129_10197116 3300009147 Bacteria 2730
247 Ga0114129_10294020 3300009147 Bacteria 2167
248 Ga0114129_10299448 3300009147 Bacteria 2144
249 Ga0114129_10302602 3300009147 Bacteria 2131
250 Ga0114129_10356105 3300009147 Bacteria 1938
251 Ga0114129_10719821 3300009147 Bacteria 1281
252 Ga0105243_10023292 3300009148 Bacteria 4713
253 Ga0105243_10048211 3300009148 Bacteria 3357
254 Ga0105242_10006554 3300009176 Bacteria 8964
255 Ga0105242_10018083 3300009176 Bacteria 5505
256 Ga0105242_10032160 3300009176 Bacteria 4194
257 Ga0105248_10004335 3300009177 Bacteria 15688
258 Ga0105248_10010331 3300009177 Bacteria 10275
259 Ga0105248_10070756 3300009177 Bacteria 3918
260 Ga0105248_10125684 3300009177 Bacteria 2893
261 Ga0105248_10143775 3300009177 Bacteria 2691
262 Ga0105248_10268535 3300009177 Bacteria 1921
263 Ga0105248_10387226 3300009177 Bacteria 1574
264 Ga0105249_10009355 3300009553 Bacteria 8572
265 Ga0105249_10139015 3300009553 Unclassified 2327
266 Ga0105249_10374552 3300009553 Bacteria 1448
267 Ga0105249_10435656 3300009553 Bacteria 1347
268 Ga0105249_10491788 3300009553 Bacteria 1271
269 Ga0105249_10726042 3300009553 Bacteria 1055
270 Ga0105246_10308663 3300011119 Bacteria 1280
271 Ga0157370_10381811 3300013104 Unclassified 1298
272 Ga0157374_10102744 3300013296 Bacteria 2742
273 Ga0157374_10148787 3300013296 Unclassified 2276
274 Ga0157374_10205485 3300013296 Unclassified 1930
275 Ga0157374_10355621 3300013296 Unclassified 1456
276 Ga0157374_10597305 3300013296 Bacteria 1113
277 Ga0157378_10004256 3300013297 Bacteria 12618
278 Ga0163162_10011971 3300013306 Bacteria 8460
279 Ga0163162_10023452 3300013306 Bacteria 6090
280 Ga0163162_10228405 3300013306 Unclassified 1991
281 Ga0157375_10026946 3300013308 Bacteria 5365
282 Ga0157375_10147079 3300013308 Bacteria 2488
283 Ga0157375_10241843 3300013308 Unclassified 1965
284 Ga0157375_10288976 3300013308 Bacteria 1802
285 Ga0157375_10739610 3300013308 Bacteria 1135
286 Ga0163163_10003686 3300014325 Bacteria 13039
287 Ga0163163_10004927 3300014325 Bacteria 11482
288 Ga0163163_10007255 3300014325 Bacteria 9772
289 Ga0163163_10042063 3300014325 Bacteria 4472
290 Ga0163163_10149964 3300014325 Bacteria 2376
291 Ga0163163_10455868 3300014325 Bacteria 1339
292 Ga0163163_10697006 3300014325 Bacteria 1079
293 Ga0157380_10019621 3300014326 Bacteria 5040
294 Ga0157380_10034652 3300014326 Bacteria 3895
295 Ga0157380_10035864 3300014326 Bacteria 3833
296 Ga0157380_10079759 3300014326 Bacteria 2674
297 Ga0157380_10128583 3300014326 Bacteria 2158
298 Ga0157380_10216956 3300014326 Unclassified 1709
299 Ga0157380_10379905 3300014326 Bacteria 1333
300 Ga0157377_10083411 3300014745 Bacteria 1873
301 Ga0157379_10010887 3300014968 Bacteria 7928
302 Ga0157379_10010953 3300014968 Bacteria 7907
303 Ga0157379_10045850 3300014968 Bacteria 3902
304 Ga0157379_10115397 3300014968 Bacteria 2414
305 Ga0157379_10701888 3300014968 Unclassified 950
306 Ga0157376_10015903 3300014969 Bacteria 5699
307 Ga0157376_10022680 3300014969 Bacteria 4899
308 Ga0157376_10045543 3300014969 Bacteria 3613
309 Ga0163161_10048567 3300017792 Bacteria 3065
310 Ga0207697_10092291 3300025315 Bacteria 1284
311 Ga0207653_10031741 3300025885 Bacteria 1707
312 Ga0207642_10023708 3300025899 Bacteria 2455
313 Ga0207710_10041537 3300025900 Bacteria 2040
314 Ga0207688_10061123 3300025901 Unclassified 2123
315 Ga0207688_10079821 3300025901 Bacteria 1867
316 Ga0207680_10023673 3300025903 Bacteria 3358
317 Ga0207680_10036350 3300025903 Bacteria 2836
318 Ga0207680_10119936 3300025903 Bacteria 1718
319 Ga0207699_10086755 3300025906 Bacteria 1955
320 Ga0207645_10001380 3300025907 Bacteria 19933
321 Ga0207645_10037612 3300025907 Bacteria 3105
322 Ga0207643_10143862 3300025908 Unclassified 1426
323 Ga0207705_10033198 3300025909 Bacteria 3687
324 Ga0207654_10325028 3300025911 Bacteria 1052
325 Ga0207695_10226191 3300025913 Bacteria 1777
326 Ga0207663_10306540 3300025916 Bacteria 1188
327 Ga0207660_10097210 3300025917 Bacteria 2194
328 Ga0207662_10101101 3300025918 Unclassified 1786
329 Ga0207662_10215621 3300025918 Bacteria 1248
330 Ga0207657_10009485 3300025919 Bacteria 9777
331 Ga0207657_10236179 3300025919 Unclassified 1461
332 Ga0207649_10011364 3300025920 Bacteria 4909
333 Ga0207649_10241249 3300025920 Bacteria 1297
334 Ga0207646_10247832 3300025922 Bacteria 1609
335 Ga0207681_10005004 3300025923 Bacteria 8144
336 Ga0207681_10066405 3300025923 Bacteria 2497
337 Ga0207681_10097568 3300025923 Bacteria 2113
338 Ga0207650_10006970 3300025925 Bacteria 7704
339 Ga0207650_10019729 3300025925 Bacteria 4742
340 Ga0207650_10043796 3300025925 Bacteria 3287
341 Ga0207650_10082910 3300025925 Bacteria 2435
342 Ga0207650_10094237 3300025925 Bacteria 2293
343 Ga0207659_10004183 3300025926 Bacteria 8715
344 Ga0207659_10005133 3300025926 Bacteria 7939
345 Ga0207659_10083328 3300025926 Bacteria 2370
346 Ga0207659_10228636 3300025926 Unclassified 1499
347 Ga0207687_10029369 3300025927 Bacteria 3698
348 Ga0207687_10161943 3300025927 Bacteria 1718
349 Ga0207700_10032324 3300025928 Bacteria 3731
350 Ga0207700_10648351 3300025928 Bacteria 941
351 Ga0207644_10104966 3300025931 Bacteria 2128
352 Ga0207690_10261065 3300025932 Bacteria 1342
353 Ga0207706_10160430 3300025933 Bacteria 1977
354 Ga0207706_10172769 3300025933 Unclassified 1899
355 Ga0207706_10312518 3300025933 Bacteria 1368
356 Ga0207686_10014334 3300025934 Bacteria 4409
357 Ga0207686_10022505 3300025934 Unclassified 3631
358 Ga0207686_10088463 3300025934 Bacteria 2039
359 Ga0207686_10107313 3300025934 Unclassified 1876
360 Ga0207686_10343342 3300025934 Bacteria 1122
361 Ga0207709_10017498 3300025935 Bacteria 4000
362 Ga0207670_10060496 3300025936 Bacteria 2581
363 Ga0207670_10096988 3300025936 Bacteria 2098
364 Ga0207670_10219544 3300025936 Bacteria 1454
365 Ga0207670_10260658 3300025936 Unclassified 1344
366 Ga0207669_10006658 3300025937 Bacteria 5296
367 Ga0207669_10008229 3300025937 Bacteria 4887
368 Ga0207669_10035488 3300025937 Bacteria 2838
369 Ga0207669_10071619 3300025937 Unclassified 2179
370 Ga0207669_10091392 3300025937 Bacteria 1983
371 Ga0207704_10003158 3300025938 Bacteria 7453
372 Ga0207704_10036800 3300025938 Bacteria 2819
373 Ga0207691_10032110 3300025940 Bacteria 4898
374 Ga0207691_10088955 3300025940 Bacteria 2769
375 Ga0207691_10107626 3300025940 Bacteria 2482
376 Ga0207691_10148359 3300025940 Bacteria 2063
377 Ga0207711_10007046 3300025941 Bacteria 9418
378 Ga0207711_10044421 3300025941 Bacteria 3793
379 Ga0207711_10075311 3300025941 Bacteria 2937
380 Ga0207711_10107390 3300025941 Bacteria 2478
381 Ga0207711_10147206 3300025941 Bacteria 2122
382 Ga0207711_10157278 3300025941 Unclassified 2055
383 Ga0207661_10001501 3300025944 Bacteria 15811
384 Ga0207679_10001458 3300025945 Bacteria 14838
385 Ga0207679_10122786 3300025945 Bacteria 2070
386 Ga0207679_10150112 3300025945 Bacteria 1895
387 Ga0207679_10273842 3300025945 Bacteria 1445
388 Ga0207679_10295590 3300025945 Unclassified 1394
389 Ga0207651_10029304 3300025960 Bacteria 3486
390 Ga0207651_10046090 3300025960 Bacteria 2929
391 Ga0207651_10071150 3300025960 Bacteria 2464
392 Ga0207651_10238027 3300025960 Bacteria 1482
393 Ga0207712_10086580 3300025961 Bacteria 2295
394 Ga0207712_10138647 3300025961 Unclassified 1863
395 Ga0207712_10508016 3300025961 Bacteria 1031
396 Ga0207668_10125344 3300025972 Bacteria 1952
397 Ga0207668_10481189 3300025972 Unclassified 1065
398 Ga0207658_10015751 3300025986 Bacteria 5191
399 Ga0207677_10034933 3300026023 Bacteria 3260
400 Ga0207677_10070270 3300026023 Bacteria 2467
401 Ga0207703_10023663 3300026035 Bacteria 4830
402 Ga0207703_10035090 3300026035 Bacteria 3985
403 Ga0207703_10123775 3300026035 Bacteria 2223
404 Ga0207703_10330691 3300026035 Bacteria 1398
405 Ga0207639_10409940 3300026041 Bacteria 1223
406 Ga0207708_10006725 3300026075 Bacteria 8505
407 Ga0207708_10034853 3300026075 Bacteria 3829
408 Ga0207708_10041274 3300026075 Bacteria 3517
409 Ga0207708_10227457 3300026075 Bacteria 1496
410 Ga0207702_10042141 3300026078 Bacteria 3829
411 Ga0207641_10000874 3300026088 Bacteria 31545
412 Ga0207641_10230548 3300026088 Unclassified 1721
413 Ga0207641_10242143 3300026088 Bacteria 1681
414 Ga0207641_10323540 3300026088 Bacteria 1463
415 Ga0207641_10395264 3300026088 Bacteria 1326
416 Ga0207641_10412655 3300026088 Bacteria 1299
417 Ga0207648_10005825 3300026089 Bacteria 12341
418 Ga0207648_10017841 3300026089 Bacteria 6441
419 Ga0207648_10176945 3300026089 Bacteria 1887
420 Ga0207676_10016713 3300026095 Bacteria 5313
421 Ga0207676_10145700 3300026095 Bacteria 2034
422 Ga0207674_10012913 3300026116 Bacteria 9315
423 Ga0207674_10225293 3300026116 Bacteria 1823
424 Ga0207674_10345810 3300026116 Bacteria 1438
425 Ga0207675_100026496 3300026118 Bacteria 5397
426 Ga0207675_100209493 3300026118 Bacteria 1874
427 Ga0207675_100233121 3300026118 Bacteria 1777
428 Ga0207675_100568234 3300026118 Bacteria 1135
429 Ga0207675_100646857 3300026118 Bacteria 1063
430 Ga0207683_10093400 3300026121 Bacteria 2681
431 Ga0207683_10105498 3300026121 Bacteria 2519
432 Ga0207683_10388268 3300026121 Bacteria 1283
433 Ga0207683_10606568 3300026121 Bacteria 1013
434 Ga0209983_1043645 3300027665 Bacteria 973
435 Ga0209966_1020529 3300027695 Bacteria 1280
436 Ga0207428_10001587 3300027907 Bacteria 23675
437 Ga0207428_10002778 3300027907 Bacteria 17388
438 Ga0207428_10009231 3300027907 Bacteria 8860
439 Ga0207428_10017669 3300027907 Bacteria 6116
440 Ga0207428_10074718 3300027907 Bacteria 2657
441 Ga0207428_10326699 3300027907 Bacteria 1132
442 Ga0268266_10011268 3300028379 Bacteria 7780
443 Ga0268266_10024583 3300028379 Bacteria 5124
444 Ga0268266_10142951 3300028379 Unclassified 2148
445 Ga0268265_10002942 3300028380 Bacteria 12477
446 Ga0268265_10066836 3300028380 Bacteria 2780
447 Ga0268265_10343517 3300028380 Unclassified 1360
448 Ga0268265_10355242 3300028380 Bacteria 1339
449 Ga0268264_10037638 3300028381 Bacteria 3989
450 Ga0268264_10283519 3300028381 Bacteria 1553
451 Ga0268264_10510400 3300028381 Bacteria 1174
452 Ga0307408_100003069 3300031548 Bacteria 11521
453 Ga0307408_100140882 3300031548 Bacteria 1893
454 Ga0265314_10047503 3300031711 Bacteria 3020
455 Ga0307405_10012845 3300031731 Bacteria 4449
456 Ga0307413_10005027 3300031824 Bacteria 5839
457 Ga0307413_10136253 3300031824 Bacteria 1689
458 Ga0307410_10002629 3300031852 Bacteria 8747
459 Ga0307410_10044118 3300031852 Bacteria 2959
460 Ga0307410_10155319 3300031852 Bacteria 1708
461 Ga0307406_10578976 3300031901 Bacteria 922
462 Ga0307407_10023785 3300031903 Bacteria 3201
463 Ga0307407_10095160 3300031903 Bacteria 1835
464 Ga0307412_10019531 3300031911 Bacteria 4106
465 Ga0307409_100017600 3300031995 Bacteria 4771
466 Ga0307409_100023507 3300031995 Bacteria 4273
467 Ga0307409_100045578 3300031995 Bacteria 3311
468 Ga0307416_100003678 3300032002 Bacteria 9082
469 Ga0307416_100012528 3300032002 Bacteria 5717
470 Ga0307416_100103285 3300032002 Bacteria 2488
471 Ga0307416_100763459 3300032002 Bacteria 1060
472 Ga0307411_10030399 3300032005 Bacteria 3310
473 Ga0307411_10056469 3300032005 Bacteria 2588
474 Ga0307411_10155534 3300032005 Bacteria 1705
475 Ga0307411_10302940 3300032005 Bacteria 1282
476 Ga0307415_100004220 3300032126 Bacteria 7426
477 Ga0307415_100055135 3300032126 Bacteria 2718
478 Ga0373923_0212544 3300035111 Unclassified 897
479 Ga0373941_0028270 3300035115 Bacteria 1645
480 Ga0373954_0024502 3300035118 Bacteria 2752
481 Ga0373956_0045445 3300035119 Bacteria 1960
482 Ga0373956_0190113 3300035119 Bacteria 972
483 Ga0373960_0091831 3300035121 Bacteria 972
484 Ga0373955_0088197 3300035172 Bacteria 1764
485 Ga0373935_0285550 3300035692 Bacteria 1163
486 Ga0373933_0236715 3300035724 Bacteria 1174
487 Ga0373947_0080509 3300035725 Unclassified 2015
488 Ga0373937_0034126 3300036401 Bacteria 4627
489 Ga0373937_0150704 3300036401 Bacteria 2178
490 Ga0373937_0237607 3300036401 Bacteria 1716
491 Ga0373937_0543995 3300036401 Bacteria 1103
492 Ga0373925_0156271 3300037068 Unclassified 1794
493 Ga0395905_0887226 3300037471 Bacteria 795
494 Ga0436365_1761119 3300039437 Bacteria 3100
495 Ga0439445_0005286 3300042004 Bacteria 2941
496 Ga0450896_018283 3300042133 Bacteria 1015
497 Ga0439435_0071568 3300042436 Bacteria 1027
498 Ga0439444_0012206 3300042437 Bacteria 1405
499 Ga0451577_0050378 3300042876 Bacteria 3717
500 Ga0466963_0327295 3300044694 Bacteria 1078
501 Ga0451576_0651285 3300045051 Bacteria 1107
502 Ga0495592_0180230 3300046454 Bacteria 1439
503 Ga0495592_0285344 3300046454 Bacteria 1078
504 Ga0495592_0405176 3300046454 Bacteria 863
505 Ga0495629_0144155 3300046459 Bacteria 1657
506 Ga0495629_0268602 3300046459 Unclassified 1172
507 Ga0495638_0012596 3300046460 Bacteria 5788
508 Ga0495580_0113936 3300046472 Bacteria 1878
509 Ga0495582_0143344 3300046473 Bacteria 1355
510 Ga0495582_0330502 3300046473 Bacteria 877
511 Ga0495639_0017082 3300046475 Bacteria 3151
512 Ga0495608_0004495 3300046511 Bacteria 9957
513 Ga0495618_0037993 3300046514 Bacteria 3025
514 Ga0495618_0274435 3300046514 Bacteria 1053
515 Ga0495628_0111838 3300046516 Bacteria 2100
516 Ga0495630_0001930 3300046517 Bacteria 14456
517 Ga0495640_0093916 3300046533 Bacteria 1976
518 Ga0495640_0217234 3300046533 Unclassified 1207
519 Ga0495587_0091826 3300046536 Bacteria 1753
520 Ga0495621_0054270 3300046539 Bacteria 1440
521 Ga0495645_0005546 3300046543 Bacteria 8678
522 Ga0495645_0036348 3300046543 Bacteria 3590
523 Ga0495645_0065833 3300046543 Bacteria 2621
524 Ga0495667_0226272 3300046559 Bacteria 1193
525 Ga0495656_0019720 3300046615 Bacteria 2606
526 Ga0495634_0211363 3300046642 Unclassified 1201
527 Ga0495635_0227618 3300046663 Bacteria 1260
528 Ga0495659_0059484 3300046664 Bacteria 1408
529 Ga0495659_0117336 3300046664 Bacteria 1044
530 Ga0495599_0033717 3300046678 Bacteria 3218
531 Ga0495646_0274091 3300046680 Bacteria 898
532 Ga0495647_0098923 3300046681 Unclassified 1206
533 Ga0495658_0081177 3300046683 Bacteria 1903
534 Ga0495658_0087196 3300046683 Bacteria 1843
535 Ga0495658_0099743 3300046683 Bacteria 1732
536 Ga0495669_0062038 3300046684 Bacteria 1693
537 Ga0495613_0001961 3300046689 Bacteria 15620
538 Ga0495600_0112261 3300046809 Bacteria 1775
539 Ga0495581_0133480 3300047315 Bacteria 1447
540 Ga0495674_0009533 3300047319 Bacteria 9220
541 Ga0495674_0098068 3300047319 Bacteria 2496
542 Ga0495674_0355281 3300047319 Bacteria 1189
543 Ga0495672_0316726 3300047320 Bacteria 734
544 Ga0495680_0111683 3300047322 Bacteria 2025
545 Ga0495680_0174893 3300047322 Unclassified 1553
546 Ga0495684_0000706 3300047471 Bacteria 26822
547 Ga0495684_0171790 3300047471 Unclassified 1612
548 Ga0496101_0192788 3300048904 Bacteria 1573
549 Ga0496102_0573908 3300048905 Unclassified 1051
550 Ga0496104_0001736 3300048907 Bacteria 18816
551 Ga0496104_0015490 3300048907 Bacteria 6904
552 Ga0496104_0090266 3300048907 Bacteria 2928
553 Ga0496105_0043932 3300048908 Bacteria 3685
554 Ga0496105_0084627 3300048908 Bacteria 2620
555 Ga0496105_0148553 3300048908 Bacteria 1927
556 Ga0496106_0290803 3300048909 Bacteria 1310
557 Ga0496107_0128451 3300048910 Unclassified 1870
558 Ga0496107_0483186 3300048910 Bacteria 919
559 Ga0496108_0001282 3300048911 Bacteria 19690
560 Ga0496108_0017260 3300048911 Bacteria 5904
561 Ga0496108_0024219 3300048911 Bacteria 4998
562 Ga0496109_0000572 3300048912 Bacteria 30775
563 Ga0496110_0004885 3300048913 Bacteria 10459
564 Ga0496111_0052625 3300048914 Bacteria 2940
565 Ga0496112_0000217 3300048915 Bacteria 37074
566 Ga0496112_0073309 3300048915 Bacteria 3384
567 Ga0496112_0125946 3300048915 Bacteria 2532
568 Ga0496112_0160133 3300048915 Bacteria 2217
569 Ga0496113_0635890 3300048916 Bacteria 854
570 Ga0496114_0009455 3300048917 Bacteria 7737
571 Ga0496114_0011512 3300048917 Bacteria 7070
572 Ga0496114_0139250 3300048917 Bacteria 2100
573 Ga0496114_0173708 3300048917 Bacteria 1879
574 Ga0496114_0288846 3300048917 Bacteria 1447
575 Ga0496114_0305030 3300048917 Bacteria 1406
576 Ga0496115_0419542 3300048918 Bacteria 1084
577 Ga0501299_012749 3300049522 Bacteria 1440
578 Ga0501031_0541451 3300049568 Bacteria 750
579 Ga0501033_0222196 3300049570 Bacteria 1344
580 Ga0501034_0006269 3300049571 Bacteria 12796
581 Ga0501034_0084636 3300049571 Bacteria 3173
582 Ga0501036_0010569 3300049572 Bacteria 7626
583 Ga0501036_0022140 3300049572 Bacteria 5346
584 Ga0501036_0078021 3300049572 Bacteria 2802
585 Ga0501036_0212555 3300049572 Bacteria 1625
586 Ga0501036_0366776 3300049572 Bacteria 1202
587 Ga0501038_0024753 3300049574 Bacteria 5351
588 Ga0501038_0187283 3300049574 Bacteria 1667
589 Ga0501039_0007645 3300049575 Bacteria 8251
590 Ga0501039_0107254 3300049575 Bacteria 2182
591 Ga0501039_0258759 3300049575 Bacteria 1368
592 Ga0501039_0716506 3300049575 Unclassified 782
593 Ga0501040_0030417 3300049576 Bacteria 3647
594 Ga0501040_0033282 3300049576 Unclassified 3491
595 Ga0501040_0184162 3300049576 Unclassified 1481
596 Ga0501040_0283175 3300049576 Bacteria 1184
597 Ga0501040_0476603 3300049576 Bacteria 899
598 Ga0501041_0033256 3300049577 Unclassified 3119
599 Ga0501042_0006369 3300049578 Bacteria 7652
600 Ga0501042_0008326 3300049578 Bacteria 6837
601 Ga0501042_0009658 3300049578 Bacteria 6442
602 Ga0501043_0145217 3300049579 Bacteria 1858
603 Ga0501043_0312872 3300049579 Bacteria 1198
604 Ga0501046_0005903 3300049580 Bacteria 10911
605 Ga0501046_0029504 3300049580 Unclassified 4459
606 Ga0501046_0165786 3300049580 Unclassified 1660
607 Ga0501047_0029457 3300049581 Bacteria 5293
608 Ga0501048_0063705 3300049582 Bacteria 2607
609 Ga0501048_0128729 3300049582 Bacteria 1790
610 Ga0501068_0086409 3300049584 Bacteria 1931
611 Ga0501071_0015337 3300049587 Bacteria 5259
612 Ga0501071_0125959 3300049587 Bacteria 1901
613 Ga0501071_0172943 3300049587 Bacteria 1617
614 Ga0501071_0514774 3300049587 Bacteria 918
615 Ga0501072_0006046 3300049588 Bacteria 9235
616 Ga0501072_0020504 3300049588 Bacteria 5123
617 Ga0501072_0064809 3300049588 Unclassified 2881
618 Ga0501072_0102220 3300049588 Bacteria 2278
619 Ga0501073_0093489 3300049589 Bacteria 2089
620 Ga0501073_0175769 3300049589 Bacteria 1482
621 Ga0501074_0060883 3300049590 Unclassified 2720
622 Ga0501074_0078777 3300049590 Unclassified 2365
623 Ga0501075_0002228 3300049591 Bacteria 12848
624 Ga0501075_0093886 3300049591 Unclassified 2277
625 Ga0501076_0010605 3300049592 Bacteria 6842
626 Ga0501076_0020279 3300049592 Bacteria 5087
627 Ga0501076_0052101 3300049592 Bacteria 3241
628 Ga0501076_0301845 3300049592 Bacteria 1313
629 Ga0501077_0127506 3300049593 Bacteria 1613
630 Ga0501079_0002242 3300049741 Bacteria 13955
631 Ga0501079_0003457 3300049741 Bacteria 11606
632 Ga0501079_0050995 3300049741 Bacteria 3194
633 Ga0501079_0086679 3300049741 Unclassified 2424
634 Ga0501079_0443393 3300049741 Bacteria 1019
635 Ga0501080_0029168 3300049742 Bacteria 5137
636 Ga0501080_0096892 3300049742 Unclassified 2739
637 Ga0501081_0001120 3300049743 Bacteria 16126
638 Ga0501081_0006124 3300049743 Bacteria 7796
639 Ga0501081_0014867 3300049743 Bacteria 5135
640 Ga0501081_0078720 3300049743 Bacteria 2305
641 Ga0501081_0175645 3300049743 Unclassified 1548
642 Ga0501083_0147228 3300049744 Bacteria 1542
643 Ga0501283_007915 3300049779 Bacteria 1522
644 Ga0501035_0280331 3300049822 Bacteria 1409
645 Ga0501044_0001331 3300049823 Bacteria 29040
646 Ga0501045_0003086 3300049824 Bacteria 11386
647 Ga0501045_0158363 3300049824 Bacteria 1685
648 nmdc:mga05p37_101049_c1 3300050507 Bacteria 2131
649 nmdc:mga05p37_147_c1 3300050507 Bacteria 66379
650 nmdc:mga05p37_184987_c1 3300050507 Bacteria 2533
651 nmdc:mga05p37_19809_c1 3300050507 Bacteria 8140
652 nmdc:mga05p37_23544_c1 3300050507 Bacteria 7472
653 nmdc:mga05p37_236015_c1 3300050507 Bacteria 2201
654 nmdc:mga05p37_25178_c1 3300050507 Bacteria 7236
655 nmdc:mga05p37_263070_c1 3300050507 Bacteria 2064
656 nmdc:mga05p37_29369_c1 3300050507 Bacteria 6710
657 nmdc:mga05p37_32697_c1 3300050507 Bacteria 6364
658 nmdc:mga05p37_38271_c1 3300050507 Bacteria 5883
659 nmdc:mga05p37_406621_c1 3300050507 Bacteria 1588
660 nmdc:mga05p37_439744_c1 3300050507 Bacteria 1513
661 nmdc:mga05p37_56245_c1 3300050507 Bacteria 4843
662 nmdc:mga05p37_66288_c2 3300050507 Bacteria 3612
663 nmdc:mga05p37_96537_c1 3300050507 Bacteria 3641
664 nmdc:mga09592_119792_c1 3300050508 Bacteria 2260
665 nmdc:mga09592_13838_c1 3300050508 Bacteria 6592
666 nmdc:mga09592_169873_c1 3300050508 Bacteria 1885
667 nmdc:mga09592_194387_c1 3300050508 Bacteria 1756
668 nmdc:mga09592_273161_c1 3300050508 Bacteria 1466
669 nmdc:mga09592_275333_c1 3300050508 Unclassified 1460
670 nmdc:mga09592_55909_c1 3300050508 Bacteria 3335
671 nmdc:mga0qj67_212115_c1 3300050509 Bacteria 1573
672 nmdc:mga0qj67_330959_c1 3300050509 Bacteria 1232
673 nmdc:mga0qj67_41255_c1 3300050509 Bacteria 3629
674 nmdc:mga0qj67_62513_c1 3300050509 Unclassified 2959
675 nmdc:mga0qj67_67328_c1 3300050509 Bacteria 2853
676 nmdc:mga06r32_166886_c1 3300050510 Bacteria 2185
677 nmdc:mga06r32_290387_c1 3300050510 Bacteria 1622
678 nmdc:mga06r32_37159_c1 3300050510 Bacteria 4606
679 nmdc:mga06r32_61562_c1 3300050510 Bacteria 3613
680 nmdc:mga06r32_635240_c1 3300050510 Bacteria 1037
681 nmdc:mga06r32_68021_c1 3300050510 Bacteria 3440
682 nmdc:mga06r32_923498_c1 3300050510 Bacteria 828
683 nmdc:mga06r32_9806_c1 3300050510 Bacteria 8641
684 nmdc:mga08y16_10005_c1 3300050511 Bacteria 9951
685 nmdc:mga08y16_1311_c1 3300050511 Bacteria 24756
686 nmdc:mga08y16_13505_c1 3300050511 Bacteria 8593
687 nmdc:mga08y16_17989_c1 3300050511 Bacteria 7444
688 nmdc:mga08y16_259387_c1 3300050511 Unclassified 1795
689 nmdc:mga08y16_46638_c1 3300050511 Bacteria 4537
690 nmdc:mga08y16_54506_c1 3300050511 Bacteria 4178
691 nmdc:mga08y16_6338_c1 3300050511 Bacteria 12410
692 nmdc:mga0n895_1546_c1 3300050512 Bacteria 17272
693 nmdc:mga0n895_16945_c1 3300050512 Bacteria 6702
694 nmdc:mga0n895_18893_c1 3300050512 Bacteria 6391
695 nmdc:mga0n895_20068_c1 3300050512 Bacteria 6223
696 nmdc:mga0n895_25177_c1 3300050512 Bacteria 5619
697 nmdc:mga0n895_293502_c1 3300050512 Bacteria 1648
698 nmdc:mga0n895_389765_c1 3300050512 Bacteria 1409
699 nmdc:mga0n895_409903_c1 3300050512 Unclassified 1370
700 nmdc:mga0n895_49412_c1 3300050512 Bacteria 4120
701 nmdc:mga0n895_6302_c1 3300050512 Bacteria 10060
702 nmdc:mga0rr50_269_c1 3300050513 Bacteria 28252
703 nmdc:mga0rr50_28813_c1 3300050513 Bacteria 3908
704 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
705 nmdc:mga08x19_11357_c1 3300050514 Bacteria 5362
706 nmdc:mga08x19_137813_c1 3300050514 Bacteria 1646
707 nmdc:mga08x19_186080_c1 3300050514 Bacteria 1419
708 nmdc:mga08x19_284359_c1 3300050514 Bacteria 1147
709 nmdc:mga08x19_72231_c1 3300050514 Bacteria 2251
710 nmdc:mga08x19_98098_c1 3300050514 Bacteria 1941
711 nmdc:mga0a205_139575_c1 3300050515 Bacteria 2324
712 nmdc:mga0a205_168886_c1 3300050515 Unclassified 2083
713 nmdc:mga0a205_263565_c1 3300050515 Bacteria 1601
714 nmdc:mga0a205_3043_c1 3300050515 Bacteria 11795
715 nmdc:mga0a205_45515_c1 3300050515 Bacteria 4231
716 nmdc:mga0a205_86586_c1 3300050515 Bacteria 3026
717 Ga0495601_0011013 3300053077 Bacteria 5403
718 Ga0495601_0016458 3300053077 Bacteria 4481
719 Ga0495601_0167382 3300053077 Bacteria 1436
720 Ga0495601_0287397 3300053077 Bacteria 1072
721 Ga0495655_0084016 3300053083 Unclassified 916
722 Ga0495595_0004955 3300053084 Bacteria 5370
723 Ga0495619_0001998 3300053085 Bacteria 13574
724 Ga0495619_0019632 3300053085 Bacteria 4298
725 Ga0495619_0020723 3300053085 Bacteria 4192
726 Ga0495619_0108077 3300053085 Bacteria 1898
727 Ga0500641_0004710 3300053096 Bacteria 4821
728 Ga0501084_0001942 3300054114 Bacteria 16511
729 Ga0501084_0005447 3300054114 Bacteria 10438
730 Ga0501084_0386222 3300054114 Bacteria 1183
731 Ga0590071_000059 3300059421 Bacteria 29361
732 Ga0590071_005255 3300059421 Bacteria 3121
733 Ga0590074_000705 3300059423 Bacteria 5095
734 Ga0590075_000234 3300059424 Bacteria 15531
735 Ga0590077_000247 3300059426 Bacteria 15383
736 Ga0590077_008969 3300059426 Bacteria 2047
737 Ga0501082_0000835 3300060353 Bacteria 27110
738 Ga0501082_0084198 3300060353 Bacteria 2743
739 Ga0501082_0249576 3300060353 Bacteria 1544
740 Ga0530510_0002033 3300061734 Bacteria 13901
741 Ga0530510_0010913 3300061734 Bacteria 6373
742 Ga0530510_0052050 3300061734 Bacteria 2959
743 Ga0530510_0062494 3300061734 Unclassified 2696

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025932 Ga0207690_10261065 Ga0207690_102610652 200
2 3300049575 Ga0501039_0716506 Ga0501039_0716506_84_764 201
3 3300027695 Ga0209966_1020529 Ga0209966_10205292 204
4 3300049522 Ga0501299_012749 Ga0501299_012749_521_1309 204
5 3300049568 Ga0501031_0541451 Ga0501031_0541451_18_701 209
6 3300053077 Ga0495601_0287397 Ga0495601_0287397_43_765 210
7 3300046681 Ga0495647_0098923 Ga0495647_0098923_162_989 215
8 3300047320 Ga0495672_0316726 Ga0495672_0316726_30_716 215
9 3300026121 Ga0207683_10388268 Ga0207683_103882682 216
10 3300049587 Ga0501071_0514774 Ga0501071_0514774_186_893 216
11 3300005331 Ga0070670_100003221 Ga0070670_1000032217 217
12 3300005577 Ga0068857_100005431 Ga0068857_1000054317 217
13 3300009553 Ga0105249_10726042 Ga0105249_107260422 217
14 3300014326 Ga0157380_10034652 Ga0157380_100346522 217
15 3300025925 Ga0207650_10043796 Ga0207650_100437965 217
16 3300026116 Ga0207674_10012913 Ga0207674_100129132 217
17 3300028380 Ga0268265_10343517 Ga0268265_103435171 217
18 3300031995 Ga0307409_100017600 Ga0307409_1000176006 217
19 3300032002 Ga0307416_100003678 Ga0307416_1000036785 217
20 3300032002 Ga0307416_100103285 Ga0307416_1001032852 217
21 3300032005 Ga0307411_10302940 Ga0307411_103029402 217
22 3300032126 Ga0307415_100055135 Ga0307415_1000551352 217
23 3300042133 Ga0450896_018283 Ga0450896_018283_160_984 217
24 3300042436 Ga0439435_0071568 Ga0439435_0071568_103_927 217
25 3300049779 Ga0501283_007915 Ga0501283_007915_599_1426 217
26 3300005543 Ga0070672_100011885 Ga0070672_1000118852 218
27 3300006852 Ga0075433_10008654 Ga0075433_100086542 218
28 3300006871 Ga0075434_100008966 Ga0075434_1000089665 218
29 3300006914 Ga0075436_100009574 Ga0075436_1000095743 218
30 3300007076 Ga0075435_100004221 Ga0075435_1000042212 218
31 3300025920 Ga0207649_10241249 Ga0207649_102412492 218
32 3300025945 Ga0207679_10122786 Ga0207679_101227862 218
33 3300026121 Ga0207683_10606568 Ga0207683_106065681 218
34 3300050514 nmdc:mga08x19_137813_c1 nmdc:mga08x19_137813_c1_194_1030 218
35 3300050515 nmdc:mga0a205_86586_c1 nmdc:mga0a205_86586_c1_538_1377 218
36 3300009098 Ga0105245_10679886 Ga0105245_106798861 219
37 3300025936 Ga0207670_10260658 Ga0207670_102606582 219
38 3300050508 nmdc:mga09592_119792_c1 nmdc:mga09592_119792_c1_50_802 219
39 3300053096 Ga0500641_0004710 Ga0500641_0004710_1705_2481 219
40 3300005295 Ga0065707_10102536 Ga0065707_101025364 220
41 3300005353 Ga0070669_100000133 Ga0070669_10000013334 220
42 3300005353 Ga0070669_100174654 Ga0070669_1001746542 220
43 3300005354 Ga0070675_100112217 Ga0070675_1001122171 220
44 3300005549 Ga0070704_100435765 Ga0070704_1004357651 220
45 3300005564 Ga0070664_100193954 Ga0070664_1001939542 220
46 3300005844 Ga0068862_100022777 Ga0068862_1000227772 220
47 3300006844 Ga0075428_100011036 Ga0075428_1000110365 220
48 3300009094 Ga0111539_10000859 Ga0111539_100008598 220
49 3300009553 Ga0105249_10009355 Ga0105249_100093556 220
50 3300013306 Ga0163162_10228405 Ga0163162_102284053 220
51 3300014745 Ga0157377_10083411 Ga0157377_100834112 220
52 3300025901 Ga0207688_10061123 Ga0207688_100611234 220
53 3300025923 Ga0207681_10005004 Ga0207681_100050042 220
54 3300025940 Ga0207691_10148359 Ga0207691_101483592 220
55 3300025945 Ga0207679_10295590 Ga0207679_102955902 220
56 3300025961 Ga0207712_10086580 Ga0207712_100865802 220
57 3300026075 Ga0207708_10034853 Ga0207708_100348532 220
58 3300026116 Ga0207674_10225293 Ga0207674_102252932 220
59 3300027907 Ga0207428_10017669 Ga0207428_100176692 220
60 3300028380 Ga0268265_10066836 Ga0268265_100668362 220
61 3300050508 nmdc:mga09592_275333_c1 nmdc:mga09592_275333_c1_372_1193 220
62 3300050511 nmdc:mga08y16_46638_c1 nmdc:mga08y16_46638_c1_1560_2381 220
63 3300005458 Ga0070681_10018543 Ga0070681_100185433 221
64 3300009094 Ga0111539_10082634 Ga0111539_100826342 221
65 3300014326 Ga0157380_10079759 Ga0157380_100797591 221
66 3300031711 Ga0265314_10047503 Ga0265314_100475034 221
67 3300037471 Ga0395905_0887226 Ga0395905_0887226_44_778 221
68 3300050511 nmdc:mga08y16_13505_c1 nmdc:mga08y16_13505_c1_2170_2940 221
69 3300009147 Ga0114129_10302602 Ga0114129_103026021 222
70 3300031824 Ga0307413_10136253 Ga0307413_101362532 222
71 3300031852 Ga0307410_10002629 Ga0307410_100026299 222
72 3300031903 Ga0307407_10023785 Ga0307407_100237853 222
73 3300031995 Ga0307409_100045578 Ga0307409_1000455782 222
74 3300032005 Ga0307411_10155534 Ga0307411_101555342 222
75 3300045051 Ga0451576_0651285 Ga0451576_0651285_40_777 222
76 3300049741 Ga0501079_0443393 Ga0501079_0443393_67_903 222
77 3300049743 Ga0501081_0078720 Ga0501081_0078720_553_1389 222
78 3300050507 nmdc:mga05p37_101049_c1 nmdc:mga05p37_101049_c1_1342_2082 222
79 3300050510 nmdc:mga06r32_37159_c1 nmdc:mga06r32_37159_c1_20_793 222
80 3300005445 Ga0070708_100059068 Ga0070708_1000590681 223
81 3300009147 Ga0114129_10003691 Ga0114129_1000369123 223
82 3300046516 Ga0495628_0111838 Ga0495628_0111838_708_1457 223
83 3300050507 nmdc:mga05p37_38271_c1 nmdc:mga05p37_38271_c1_2668_3465 223
84 3300053085 Ga0495619_0020723 Ga0495619_0020723_2438_3187 223
85 3300005459 Ga0068867_100255688 Ga0068867_1002556882 224
86 3300005468 Ga0070707_100155083 Ga0070707_1001550832 224
87 3300005536 Ga0070697_100647031 Ga0070697_1006470311 224
88 3300006844 Ga0075428_100002186 Ga0075428_1000021866 224
89 3300006847 Ga0075431_100191920 Ga0075431_1001919202 224
90 3300006880 Ga0075429_100036803 Ga0075429_1000368032 224
91 3300009147 Ga0114129_10032450 Ga0114129_100324502 224
92 3300025925 Ga0207650_10094237 Ga0207650_100942371 224
93 3300050507 nmdc:mga05p37_66288_c2 nmdc:mga05p37_66288_c2_2672_3496 224
94 3300050508 nmdc:mga09592_13838_c1 nmdc:mga09592_13838_c1_3417_4241 224
95 3300050510 nmdc:mga06r32_68021_c1 nmdc:mga06r32_68021_c1_1666_2490 224
96 3300005354 Ga0070675_100010814 Ga0070675_1000108143 225
97 3300006844 Ga0075428_100505090 Ga0075428_1005050902 225
98 3300009147 Ga0114129_10039491 Ga0114129_100394912 225
99 3300009177 Ga0105248_10143775 Ga0105248_101437751 225
100 3300025923 Ga0207681_10066405 Ga0207681_100664052 225
101 3300025926 Ga0207659_10083328 Ga0207659_100833284 225
102 3300025937 Ga0207669_10006658 Ga0207669_100066586 225
103 3300026088 Ga0207641_10412655 Ga0207641_104126551 225
104 3300026121 Ga0207683_10105498 Ga0207683_101054982 225
105 3300027907 Ga0207428_10074718 Ga0207428_100747182 225
106 3300031852 Ga0307410_10155319 Ga0307410_101553192 225
107 3300046454 Ga0495592_0405176 Ga0495592_0405176_67_816 225
108 3300049576 Ga0501040_0283175 Ga0501040_0283175_302_1120 225
109 3300050510 nmdc:mga06r32_923498_c1 nmdc:mga06r32_923498_c1_13_744 226
110 3300053084 Ga0495595_0004955 Ga0495595_0004955_3159_3953 226
111 3300053085 Ga0495619_0019632 Ga0495619_0019632_1083_1877 226
112 3300009147 Ga0114129_10356105 Ga0114129_103561052 227
113 3300049571 Ga0501034_0006269 Ga0501034_0006269_10534_11343 227
114 3300049572 Ga0501036_0366776 Ga0501036_0366776_358_1167 227
115 3300049579 Ga0501043_0145217 Ga0501043_0145217_850_1659 227
116 3300049581 Ga0501047_0029457 Ga0501047_0029457_1559_2368 227
117 3300049823 Ga0501044_0001331 Ga0501044_0001331_22566_23375 227
118 3300053077 Ga0495601_0016458 Ga0495601_0016458_3698_4456 227
119 3300005290 Ga0065712_10074717 Ga0065712_100747172 228
120 3300005344 Ga0070661_100019679 Ga0070661_1000196796 228
121 3300005406 Ga0070703_10019261 Ga0070703_100192613 228
122 3300005549 Ga0070704_100068140 Ga0070704_1000681402 228
123 3300005564 Ga0070664_100000055 Ga0070664_10000005557 228
124 3300009147 Ga0114129_10107306 Ga0114129_101073065 228
125 3300025885 Ga0207653_10031741 Ga0207653_100317412 228
126 3300025920 Ga0207649_10011364 Ga0207649_100113643 228
127 3300025925 Ga0207650_10006970 Ga0207650_100069706 228
128 3300025940 Ga0207691_10088955 Ga0207691_100889553 228
129 3300025944 Ga0207661_10001501 Ga0207661_100015016 228
130 3300025945 Ga0207679_10001458 Ga0207679_100014587 228
131 3300042004 Ga0439445_0005286 Ga0439445_0005286_429_1199 228
132 3300050507 nmdc:mga05p37_29369_c1 nmdc:mga05p37_29369_c1_2523_3281 228
133 3300050508 nmdc:mga09592_194387_c1 nmdc:mga09592_194387_c1_320_1078 228
134 3300050515 nmdc:mga0a205_263565_c1 nmdc:mga0a205_263565_c1_315_1073 228
135 3300005844 Ga0068862_100473276 Ga0068862_1004732762 229
136 3300025901 Ga0207688_10079821 Ga0207688_100798212 229
137 3300025972 Ga0207668_10481189 Ga0207668_104811892 229
138 3300035111 Ga0373923_0212544 Ga0373923_0212544_100_867 229
139 3300036401 Ga0373937_0543995 Ga0373937_0543995_150_917 229
140 3300046454 Ga0495592_0180230 Ga0495592_0180230_277_1044 229
141 3300046459 Ga0495629_0144155 Ga0495629_0144155_563_1330 229
142 3300046472 Ga0495580_0113936 Ga0495580_0113936_766_1533 229
143 3300046473 Ga0495582_0143344 Ga0495582_0143344_115_951 229
144 3300046511 Ga0495608_0004495 Ga0495608_0004495_8571_9338 229
145 3300046514 Ga0495618_0037993 Ga0495618_0037993_201_968 229
146 3300046517 Ga0495630_0001930 Ga0495630_0001930_9567_10334 229
147 3300046533 Ga0495640_0093916 Ga0495640_0093916_1175_1942 229
148 3300046543 Ga0495645_0065833 Ga0495645_0065833_472_1239 229
149 3300046642 Ga0495634_0211363 Ga0495634_0211363_372_1175 229
150 3300046678 Ga0495599_0033717 Ga0495599_0033717_1508_2275 229
151 3300046683 Ga0495658_0099743 Ga0495658_0099743_331_1167 229
152 3300046689 Ga0495613_0001961 Ga0495613_0001961_5296_6063 229
153 3300046809 Ga0495600_0112261 Ga0495600_0112261_909_1712 229
154 3300047315 Ga0495581_0133480 Ga0495581_0133480_413_1180 229
155 3300047319 Ga0495674_0009533 Ga0495674_0009533_1273_2040 229
156 3300047322 Ga0495680_0111683 Ga0495680_0111683_839_1606 229
157 3300047322 Ga0495680_0174893 Ga0495680_0174893_547_1350 229
158 3300047471 Ga0495684_0000706 Ga0495684_0000706_16407_17174 229
159 3300049570 Ga0501033_0222196 Ga0501033_0222196_400_1194 229
160 3300049572 Ga0501036_0212555 Ga0501036_0212555_289_1083 229
161 3300049575 Ga0501039_0107254 Ga0501039_0107254_550_1344 229
162 3300049576 Ga0501040_0033282 Ga0501040_0033282_288_1082 229
163 3300049577 Ga0501041_0033256 Ga0501041_0033256_928_1722 229
164 3300049578 Ga0501042_0006369 Ga0501042_0006369_3930_4724 229
165 3300049579 Ga0501043_0312872 Ga0501043_0312872_13_807 229
166 3300049580 Ga0501046_0029504 Ga0501046_0029504_2399_3193 229
167 3300049582 Ga0501048_0063705 Ga0501048_0063705_741_1535 229
168 3300049587 Ga0501071_0125959 Ga0501071_0125959_453_1247 229
169 3300049588 Ga0501072_0064809 Ga0501072_0064809_580_1374 229
170 3300049589 Ga0501073_0175769 Ga0501073_0175769_651_1445 229
171 3300049590 Ga0501074_0060883 Ga0501074_0060883_1792_2586 229
172 3300049591 Ga0501075_0093886 Ga0501075_0093886_232_1026 229
173 3300049592 Ga0501076_0020279 Ga0501076_0020279_3771_4565 229
174 3300049741 Ga0501079_0003457 Ga0501079_0003457_7095_7889 229
175 3300049742 Ga0501080_0096892 Ga0501080_0096892_1230_2024 229
176 3300049743 Ga0501081_0014867 Ga0501081_0014867_64_858 229
177 3300053077 Ga0495601_0011013 Ga0495601_0011013_1830_2597 229
178 3300053085 Ga0495619_0001998 Ga0495619_0001998_10449_11216 229
179 3300054114 Ga0501084_0005447 Ga0501084_0005447_6326_7120 229
180 3300060353 Ga0501082_0249576 Ga0501082_0249576_580_1374 229
181 3300061734 Ga0530510_0062494 Ga0530510_0062494_18_812 229
182 3300005436 Ga0070713_100042202 Ga0070713_1000422023 230
183 3300005548 Ga0070665_100003845 Ga0070665_1000038458 230
184 3300006028 Ga0070717_10032580 Ga0070717_100325802 230
185 3300006237 Ga0097621_100022608 Ga0097621_1000226086 230
186 3300006358 Ga0068871_100023609 Ga0068871_1000236096 230
187 3300006881 Ga0068865_100038766 Ga0068865_1000387665 230
188 3300009094 Ga0111539_10000056 Ga0111539_1000005668 230
189 3300011119 Ga0105246_10308663 Ga0105246_103086632 230
190 3300014326 Ga0157380_10128583 Ga0157380_101285832 230
191 3300014968 Ga0157379_10701888 Ga0157379_107018881 230
192 3300014969 Ga0157376_10022680 Ga0157376_100226806 230
193 3300014969 Ga0157376_10045543 Ga0157376_100455432 230
194 3300025928 Ga0207700_10032324 Ga0207700_100323242 230
195 3300025934 Ga0207686_10088463 Ga0207686_100884632 230
196 3300025938 Ga0207704_10003158 Ga0207704_100031582 230
197 3300025941 Ga0207711_10157278 Ga0207711_101572782 230
198 3300026089 Ga0207648_10176945 Ga0207648_101769453 230
199 3300026121 Ga0207683_10093400 Ga0207683_100934001 230
200 3300027907 Ga0207428_10002778 Ga0207428_100027785 230
201 3300028379 Ga0268266_10142951 Ga0268266_101429512 230
202 3300048917 Ga0496114_0139250 Ga0496114_0139250_277_1125 230
203 3300050511 nmdc:mga08y16_1311_c1 nmdc:mga08y16_1311_c1_20471_21328 230
204 3300053083 Ga0495655_0084016 Ga0495655_0084016_23_781 230
205 3300005295 Ga0065707_10006338 Ga0065707_100063382 231
206 3300005617 Ga0068859_100422501 Ga0068859_1004225012 231
207 3300005843 Ga0068860_100451700 Ga0068860_1004517002 231
208 3300006844 Ga0075428_100031720 Ga0075428_1000317202 231
209 3300006844 Ga0075428_100326143 Ga0075428_1003261431 231
210 3300006846 Ga0075430_100114609 Ga0075430_1001146092 231
211 3300006931 Ga0097620_100422497 Ga0097620_1004224972 231
212 3300009094 Ga0111539_10010192 Ga0111539_100101927 231
213 3300009147 Ga0114129_10019564 Ga0114129_100195646 231
214 3300009147 Ga0114129_10063061 Ga0114129_100630612 231
215 3300009148 Ga0105243_10023292 Ga0105243_100232923 231
216 3300009553 Ga0105249_10491788 Ga0105249_104917882 231
217 3300014326 Ga0157380_10035864 Ga0157380_100358644 231
218 3300025918 Ga0207662_10101101 Ga0207662_101011012 231
219 3300025923 Ga0207681_10097568 Ga0207681_100975683 231
220 3300025961 Ga0207712_10138647 Ga0207712_101386472 231
221 3300026088 Ga0207641_10323540 Ga0207641_103235402 231
222 3300027907 Ga0207428_10326699 Ga0207428_103266992 231
223 3300039437 Ga0436365_1761119 Ga0436365_1761119_944_1732 231
224 3300050507 nmdc:mga05p37_406621_c1 nmdc:mga05p37_406621_c1_609_1448 231
225 3300050507 nmdc:mga05p37_439744_c1 nmdc:mga05p37_439744_c1_510_1346 231
226 3300050509 nmdc:mga0qj67_67328_c1 nmdc:mga0qj67_67328_c1_271_1110 231
227 3300050511 nmdc:mga08y16_17989_c1 nmdc:mga08y16_17989_c1_4645_5484 231
228 3300005335 Ga0070666_10022404 Ga0070666_100224042 232
229 3300005354 Ga0070675_100070461 Ga0070675_1000704612 232
230 3300005471 Ga0070698_100342982 Ga0070698_1003429821 232
231 3300005543 Ga0070672_100029428 Ga0070672_1000294282 232
232 3300005618 Ga0068864_100072431 Ga0068864_1000724312 232
233 3300006237 Ga0097621_100362606 Ga0097621_1003626062 232
234 3300006358 Ga0068871_100131307 Ga0068871_1001313074 232
235 3300006844 Ga0075428_100062370 Ga0075428_1000623702 232
236 3300006846 Ga0075430_100045130 Ga0075430_1000451305 232
237 3300006847 Ga0075431_100029078 Ga0075431_1000290785 232
238 3300006914 Ga0075436_100099327 Ga0075436_1000993273 232
239 3300009094 Ga0111539_10020554 Ga0111539_100205545 232
240 3300013297 Ga0157378_10004256 Ga0157378_100042567 232
241 3300013308 Ga0157375_10739610 Ga0157375_107396101 232
242 3300025926 Ga0207659_10004183 Ga0207659_100041833 232
243 3300025960 Ga0207651_10029304 Ga0207651_100293042 232
244 3300026095 Ga0207676_10145700 Ga0207676_101457002 232
245 3300032005 Ga0307411_10056469 Ga0307411_100564694 232
246 3300042876 Ga0451577_0050378 Ga0451577_0050378_25_858 232
247 3300046539 Ga0495621_0054270 Ga0495621_0054270_371_1207 232
248 3300046615 Ga0495656_0019720 Ga0495656_0019720_308_1144 232
249 3300046664 Ga0495659_0059484 Ga0495659_0059484_223_996 232
250 3300049592 Ga0501076_0052101 Ga0501076_0052101_50_802 232
251 3300049824 Ga0501045_0158363 Ga0501045_0158363_918_1670 232
252 3300050509 nmdc:mga0qj67_212115_c1 nmdc:mga0qj67_212115_c1_543_1352 232
253 3300050514 nmdc:mga08x19_11357_c1 nmdc:mga08x19_11357_c1_4001_4837 232
254 3300054114 Ga0501084_0386222 Ga0501084_0386222_25_834 232
255 3300005293 Ga0065715_10034415 Ga0065715_100344151 233
256 3300005842 Ga0068858_100453749 Ga0068858_1004537491 233
257 3300005843 Ga0068860_100354736 Ga0068860_1003547361 233
258 3300006852 Ga0075433_10064437 Ga0075433_100644371 233
259 3300007076 Ga0075435_100257637 Ga0075435_1002576372 233
260 3300009147 Ga0114129_10197116 Ga0114129_101971162 233
261 3300009177 Ga0105248_10387226 Ga0105248_103872262 233
262 3300025919 Ga0207657_10236179 Ga0207657_102361792 233
263 3300026035 Ga0207703_10330691 Ga0207703_103306912 233
264 3300028381 Ga0268264_10283519 Ga0268264_102835192 233
265 3300042437 Ga0439444_0012206 Ga0439444_0012206_561_1343 233
266 3300050507 nmdc:mga05p37_184987_c1 nmdc:mga05p37_184987_c1_238_1056 233
267 3300050507 nmdc:mga05p37_23544_c1 nmdc:mga05p37_23544_c1_544_1407 233
268 3300050515 nmdc:mga0a205_45515_c1 nmdc:mga0a205_45515_c1_2113_2934 233
269 3300005290 Ga0065712_10035779 Ga0065712_100357792 234
270 3300005335 Ga0070666_10029165 Ga0070666_100291652 234
271 3300005340 Ga0070689_100163578 Ga0070689_1001635782 234
272 3300005364 Ga0070673_100109853 Ga0070673_1001098532 234
273 3300005365 Ga0070688_100048886 Ga0070688_1000488864 234
274 3300005367 Ga0070667_100210948 Ga0070667_1002109482 234
275 3300005457 Ga0070662_100079056 Ga0070662_1000790562 234
276 3300005518 Ga0070699_100448884 Ga0070699_1004488841 234
277 3300005564 Ga0070664_100168983 Ga0070664_1001689832 234
278 3300005618 Ga0068864_100320109 Ga0068864_1003201092 234
279 3300005841 Ga0068863_100123229 Ga0068863_1001232292 234
280 3300005844 Ga0068862_100671793 Ga0068862_1006717932 234
281 3300006175 Ga0070712_100394968 Ga0070712_1003949682 234
282 3300006358 Ga0068871_100010489 Ga0068871_1000104893 234
283 3300006852 Ga0075433_10057421 Ga0075433_100574212 234
284 3300006871 Ga0075434_100013351 Ga0075434_1000133512 234
285 3300006881 Ga0068865_100185971 Ga0068865_1001859712 234
286 3300009147 Ga0114129_10299448 Ga0114129_102994482 234
287 3300009148 Ga0105243_10048211 Ga0105243_100482115 234
288 3300009176 Ga0105242_10018083 Ga0105242_100180833 234
289 3300009177 Ga0105248_10070756 Ga0105248_100707563 234
290 3300009553 Ga0105249_10435656 Ga0105249_104356562 234
291 3300013296 Ga0157374_10102744 Ga0157374_101027444 234
292 3300013308 Ga0157375_10026946 Ga0157375_100269462 234
293 3300017792 Ga0163161_10048567 Ga0163161_100485672 234
294 3300025903 Ga0207680_10023673 Ga0207680_100236732 234
295 3300025903 Ga0207680_10119936 Ga0207680_101199361 234
296 3300025907 Ga0207645_10037612 Ga0207645_100376122 234
297 3300025911 Ga0207654_10325028 Ga0207654_103250282 234
298 3300025928 Ga0207700_10648351 Ga0207700_106483511 234
299 3300025934 Ga0207686_10343342 Ga0207686_103433422 234
300 3300025936 Ga0207670_10219544 Ga0207670_102195442 234
301 3300025945 Ga0207679_10273842 Ga0207679_102738422 234
302 3300026088 Ga0207641_10242143 Ga0207641_102421432 234
303 3300026088 Ga0207641_10395264 Ga0207641_103952641 234
304 3300048904 Ga0496101_0192788 Ga0496101_0192788_145_948 234
305 3300048907 Ga0496104_0015490 Ga0496104_0015490_1512_2312 234
306 3300048909 Ga0496106_0290803 Ga0496106_0290803_121_924 234
307 3300048910 Ga0496107_0128451 Ga0496107_0128451_539_1342 234
308 3300048910 Ga0496107_0483186 Ga0496107_0483186_67_831 234
309 3300048911 Ga0496108_0017260 Ga0496108_0017260_3719_4522 234
310 3300048917 Ga0496114_0009455 Ga0496114_0009455_3128_3928 234
311 3300048917 Ga0496114_0011512 Ga0496114_0011512_2569_3372 234
312 3300049743 Ga0501081_0175645 Ga0501081_0175645_174_962 234
313 3300049744 Ga0501083_0147228 Ga0501083_0147228_25_813 234
314 3300050507 nmdc:mga05p37_236015_c1 nmdc:mga05p37_236015_c1_319_1251 234
315 3300050509 nmdc:mga0qj67_330959_c1 nmdc:mga0qj67_330959_c1_119_973 234
316 3300050512 nmdc:mga0n895_25177_c1 nmdc:mga0n895_25177_c1_3274_4107 234
317 3300005459 Ga0068867_100104894 Ga0068867_1001048941 235
318 3300005471 Ga0070698_100363061 Ga0070698_1003630611 235
319 3300005545 Ga0070695_100010728 Ga0070695_1000107283 235
320 3300006880 Ga0075429_100105364 Ga0075429_1001053643 235
321 3300009094 Ga0111539_10017296 Ga0111539_100172963 235
322 3300009147 Ga0114129_10001107 Ga0114129_100011078 235
323 3300025903 Ga0207680_10036350 Ga0207680_100363502 235
324 3300046475 Ga0495639_0017082 Ga0495639_0017082_228_1025 235
325 3300046543 Ga0495645_0036348 Ga0495645_0036348_643_1440 235
326 3300047471 Ga0495684_0171790 Ga0495684_0171790_521_1318 235
327 3300050507 nmdc:mga05p37_147_c1 nmdc:mga05p37_147_c1_11745_12536 235
328 3300050508 nmdc:mga09592_169873_c1 nmdc:mga09592_169873_c1_523_1314 235
329 3300050512 nmdc:mga0n895_409903_c1 nmdc:mga0n895_409903_c1_419_1243 235
330 3300005548 Ga0070665_100008381 Ga0070665_1000083817 236
331 3300005718 Ga0068866_10035182 Ga0068866_100351822 236
332 3300006237 Ga0097621_100001602 Ga0097621_10000160213 236
333 3300006358 Ga0068871_100001058 Ga0068871_10000105812 236
334 3300006880 Ga0075429_100494191 Ga0075429_1004941911 236
335 3300006914 Ga0075436_100021620 Ga0075436_1000216202 236
336 3300007265 Ga0099794_10158440 Ga0099794_101584401 236
337 3300009098 Ga0105245_10004376 Ga0105245_100043766 236
338 3300009177 Ga0105248_10268535 Ga0105248_102685352 236
339 3300013308 Ga0157375_10241843 Ga0157375_102418432 236
340 3300014969 Ga0157376_10015903 Ga0157376_100159032 236
341 3300025927 Ga0207687_10029369 Ga0207687_100293692 236
342 3300025934 Ga0207686_10014334 Ga0207686_100143342 236
343 3300025937 Ga0207669_10035488 Ga0207669_100354882 236
344 3300025938 Ga0207704_10036800 Ga0207704_100368004 236
345 3300025940 Ga0207691_10107626 Ga0207691_101076262 236
346 3300025941 Ga0207711_10075311 Ga0207711_100753112 236
347 3300025960 Ga0207651_10046090 Ga0207651_100460902 236
348 3300026023 Ga0207677_10034933 Ga0207677_100349332 236
349 3300026035 Ga0207703_10023663 Ga0207703_100236632 236
350 3300026089 Ga0207648_10017841 Ga0207648_100178414 236
351 3300028379 Ga0268266_10011268 Ga0268266_100112687 236
352 3300046664 Ga0495659_0117336 Ga0495659_0117336_19_873 236
353 3300048908 Ga0496105_0148553 Ga0496105_0148553_286_1080 236
354 3300048916 Ga0496113_0635890 Ga0496113_0635890_50_844 236
355 3300048917 Ga0496114_0173708 Ga0496114_0173708_260_1054 236
356 3300049572 Ga0501036_0022140 Ga0501036_0022140_3984_4778 236
357 3300049574 Ga0501038_0024753 Ga0501038_0024753_1483_2277 236
358 3300049575 Ga0501039_0258759 Ga0501039_0258759_540_1334 236
359 3300049576 Ga0501040_0030417 Ga0501040_0030417_2079_2873 236
360 3300049578 Ga0501042_0008326 Ga0501042_0008326_2510_3304 236
361 3300049580 Ga0501046_0005903 Ga0501046_0005903_1436_2230 236
362 3300049584 Ga0501068_0086409 Ga0501068_0086409_348_1142 236
363 3300049587 Ga0501071_0015337 Ga0501071_0015337_3387_4181 236
364 3300049588 Ga0501072_0006046 Ga0501072_0006046_966_1760 236
365 3300049591 Ga0501075_0002228 Ga0501075_0002228_864_1658 236
366 3300049592 Ga0501076_0010605 Ga0501076_0010605_5454_6248 236
367 3300049593 Ga0501077_0127506 Ga0501077_0127506_679_1473 236
368 3300049741 Ga0501079_0002242 Ga0501079_0002242_2009_2803 236
369 3300049742 Ga0501080_0029168 Ga0501080_0029168_1026_1820 236
370 3300049743 Ga0501081_0001120 Ga0501081_0001120_11054_11848 236
371 3300049824 Ga0501045_0003086 Ga0501045_0003086_1383_2177 236
372 3300050508 nmdc:mga09592_273161_c1 nmdc:mga09592_273161_c1_240_1019 236
373 3300050514 nmdc:mga08x19_72231_c1 nmdc:mga08x19_72231_c1_695_1519 236
374 3300054114 Ga0501084_0001942 Ga0501084_0001942_14955_15749 236
375 3300059421 Ga0590071_005255 Ga0590071_005255_313_1233 236
376 3300060353 Ga0501082_0000835 Ga0501082_0000835_6972_7766 236
377 3300061734 Ga0530510_0002033 Ga0530510_0002033_429_1223 236
378 3300005329 Ga0070683_100191479 Ga0070683_1001914792 237
379 3300005340 Ga0070689_100027236 Ga0070689_1000272362 237
380 3300005354 Ga0070675_100177522 Ga0070675_1001775222 237
381 3300005356 Ga0070674_100023397 Ga0070674_1000233973 237
382 3300005365 Ga0070688_100062324 Ga0070688_1000623243 237
383 3300005457 Ga0070662_100320538 Ga0070662_1003205382 237
384 3300005466 Ga0070685_10264827 Ga0070685_102648272 237
385 3300005536 Ga0070697_100024877 Ga0070697_1000248773 237
386 3300005614 Ga0068856_100059321 Ga0068856_1000593212 237
387 3300009093 Ga0105240_10164668 Ga0105240_101646683 237
388 3300013104 Ga0157370_10381811 Ga0157370_103818111 237
389 3300025926 Ga0207659_10228636 Ga0207659_102286362 237
390 3300025933 Ga0207706_10172769 Ga0207706_101727692 237
391 3300025936 Ga0207670_10096988 Ga0207670_100969883 237
392 3300026078 Ga0207702_10042141 Ga0207702_100421412 237
393 3300031548 Ga0307408_100003069 Ga0307408_1000030695 237
394 3300031548 Ga0307408_100140882 Ga0307408_1001408822 237
395 3300031731 Ga0307405_10012845 Ga0307405_100128452 237
396 3300031824 Ga0307413_10005027 Ga0307413_100050272 237
397 3300031852 Ga0307410_10044118 Ga0307410_100441182 237
398 3300031901 Ga0307406_10578976 Ga0307406_105789761 237
399 3300031903 Ga0307407_10095160 Ga0307407_100951602 237
400 3300031911 Ga0307412_10019531 Ga0307412_100195316 237
401 3300031995 Ga0307409_100023507 Ga0307409_1000235074 237
402 3300032002 Ga0307416_100012528 Ga0307416_1000125282 237
403 3300032002 Ga0307416_100763459 Ga0307416_1007634592 237
404 3300032005 Ga0307411_10030399 Ga0307411_100303992 237
405 3300032126 Ga0307415_100004220 Ga0307415_1000042202 237
406 3300035119 Ga0373956_0190113 Ga0373956_0190113_39_833 237
407 3300048905 Ga0496102_0573908 Ga0496102_0573908_70_942 237
408 3300049571 Ga0501034_0084636 Ga0501034_0084636_1133_1942 237
409 3300049574 Ga0501038_0187283 Ga0501038_0187283_623_1402 237
410 3300049576 Ga0501040_0476603 Ga0501040_0476603_64_843 237
411 3300049588 Ga0501072_0102220 Ga0501072_0102220_1287_2066 237
412 3300049592 Ga0501076_0301845 Ga0501076_0301845_312_1118 237
413 3300049741 Ga0501079_0050995 Ga0501079_0050995_932_1711 237
414 3300049743 Ga0501081_0006124 Ga0501081_0006124_5880_6659 237
415 3300060353 Ga0501082_0084198 Ga0501082_0084198_18_797 237
416 3300061734 Ga0530510_0052050 Ga0530510_0052050_105_884 237
417 3300005290 Ga0065712_10191071 Ga0065712_101910712 238
418 3300005353 Ga0070669_100242317 Ga0070669_1002423172 238
419 3300005459 Ga0068867_100224345 Ga0068867_1002243451 238
420 3300005841 Ga0068863_100171661 Ga0068863_1001716612 238
421 3300005937 Ga0081455_10087723 Ga0081455_100877231 238
422 3300005985 Ga0081539_10005654 Ga0081539_100056542 238
423 3300014326 Ga0157380_10216956 Ga0157380_102169562 238
424 3300025933 Ga0207706_10160430 Ga0207706_101604302 238
425 3300026088 Ga0207641_10230548 Ga0207641_102305481 238
426 3300035692 Ga0373935_0285550 Ga0373935_0285550_37_870 238
427 3300005467 Ga0070706_100231467 Ga0070706_1002314671 239
428 3300005471 Ga0070698_100005321 Ga0070698_1000053217 239
429 3300005518 Ga0070699_100003994 Ga0070699_1000039946 239
430 3300005546 Ga0070696_100032166 Ga0070696_1000321662 239
431 3300005549 Ga0070704_100022532 Ga0070704_1000225323 239
432 3300007076 Ga0075435_100234705 Ga0075435_1002347052 239
433 3300009094 Ga0111539_10578297 Ga0111539_105782971 239
434 3300027665 Ga0209983_1043645 Ga0209983_10436451 239
435 3300044694 Ga0466963_0327295 Ga0466963_0327295_84_896 239
436 3300050512 nmdc:mga0n895_49412_c1 nmdc:mga0n895_49412_c1_2367_3182 239
437 3300050513 nmdc:mga0rr50_28813_c1 nmdc:mga0rr50_28813_c1_2100_2915 239
438 3300005467 Ga0070706_100313175 Ga0070706_1003131752 240
439 3300005981 Ga0081538_10086064 Ga0081538_100860642 240
440 3300006847 Ga0075431_100241669 Ga0075431_1002416692 240
441 3300006871 Ga0075434_100163053 Ga0075434_1001630532 240
442 3300009147 Ga0114129_10001088 Ga0114129_100010887 240
443 3300025935 Ga0207709_10017498 Ga0207709_100174986 240
444 3300050507 nmdc:mga05p37_96537_c1 nmdc:mga05p37_96537_c1_281_1132 240
445 3300050510 nmdc:mga06r32_9806_c1 nmdc:mga06r32_9806_c1_67_870 240
446 3300050512 nmdc:mga0n895_18893_c1 nmdc:mga0n895_18893_c1_4030_4866 240
447 3300050515 nmdc:mga0a205_3043_c1 nmdc:mga0a205_3043_c1_3254_4090 240
448 3300005330 Ga0070690_100257833 Ga0070690_1002578332 241
449 3300005719 Ga0068861_100686806 Ga0068861_1006868061 241
450 3300006175 Ga0070712_100380983 Ga0070712_1003809832 241
451 3300013308 Ga0157375_10147079 Ga0157375_101470794 241
452 3300014325 Ga0163163_10042063 Ga0163163_100420635 241
453 3300014968 Ga0157379_10010953 Ga0157379_100109536 241
454 3300025934 Ga0207686_10107313 Ga0207686_101073132 241
455 3300025941 Ga0207711_10147206 Ga0207711_101472064 241
456 3300026118 Ga0207675_100568234 Ga0207675_1005682342 241
457 3300046454 Ga0495592_0285344 Ga0495592_0285344_213_1049 241
458 3300046683 Ga0495658_0081177 Ga0495658_0081177_91_927 241
459 3300047319 Ga0495674_0355281 Ga0495674_0355281_325_1161 241
460 3300049572 Ga0501036_0078021 Ga0501036_0078021_956_1792 241
461 3300049587 Ga0501071_0172943 Ga0501071_0172943_686_1522 241
462 3300005354 Ga0070675_100001153 Ga0070675_1000011537 242
463 3300005356 Ga0070674_100080860 Ga0070674_1000808601 242
464 3300005439 Ga0070711_100051768 Ga0070711_1000517683 242
465 3300005842 Ga0068858_100006490 Ga0068858_1000064908 242
466 3300006852 Ga0075433_10007559 Ga0075433_100075595 242
467 3300006871 Ga0075434_100399228 Ga0075434_1003992282 242
468 3300006931 Ga0097620_100385265 Ga0097620_1003852652 242
469 3300009101 Ga0105247_10006881 Ga0105247_100068816 242
470 3300014326 Ga0157380_10019621 Ga0157380_100196216 242
471 3300014968 Ga0157379_10010887 Ga0157379_100108877 242
472 3300025916 Ga0207663_10306540 Ga0207663_103065402 242
473 3300025961 Ga0207712_10508016 Ga0207712_105080161 242
474 3300026035 Ga0207703_10035090 Ga0207703_100350904 242
475 3300026118 Ga0207675_100209493 Ga0207675_1002094932 242
476 3300005518 Ga0070699_100001247 Ga0070699_1000012476 243
477 3300005564 Ga0070664_100590950 Ga0070664_1005909502 243
478 3300006914 Ga0075436_100010634 Ga0075436_1000106343 243
479 3300049589 Ga0501073_0093489 Ga0501073_0093489_41_979 243
480 3300050514 nmdc:mga08x19_98098_c1 nmdc:mga08x19_98098_c1_731_1564 243
481 3300059421 Ga0590071_000059 Ga0590071_000059_2700_3599 243
482 3300059423 Ga0590074_000705 Ga0590074_000705_3179_4042 243
483 3300059424 Ga0590075_000234 Ga0590075_000234_13092_13955 243
484 3300059426 Ga0590077_000247 Ga0590077_000247_13516_14379 243
485 3300005459 Ga0068867_100213604 Ga0068867_1002136042 244
486 3300006871 Ga0075434_100007606 Ga0075434_1000076063 244
487 3300006914 Ga0075436_100209645 Ga0075436_1002096452 244
488 3300009098 Ga0105245_10138173 Ga0105245_101381732 244
489 3300025927 Ga0207687_10161943 Ga0207687_101619432 244
490 3300046460 Ga0495638_0012596 Ga0495638_0012596_1644_2492 244
491 3300048907 Ga0496104_0090266 Ga0496104_0090266_1339_2169 244
492 3300048908 Ga0496105_0084627 Ga0496105_0084627_829_1659 244
493 3300048915 Ga0496112_0125946 Ga0496112_0125946_33_863 244
494 3300048915 Ga0496112_0160133 Ga0496112_0160133_1006_1836 244
495 3300050512 nmdc:mga0n895_6302_c1 nmdc:mga0n895_6302_c1_3858_4670 244
496 3300050514 nmdc:mga08x19_186080_c1 nmdc:mga08x19_186080_c1_83_919 244
497 3300005329 Ga0070683_100711358 Ga0070683_1007113581 245
498 3300005331 Ga0070670_100316080 Ga0070670_1003160802 245
499 3300005334 Ga0068869_100233032 Ga0068869_1002330322 245
500 3300005335 Ga0070666_10090472 Ga0070666_100904724 245
501 3300005338 Ga0068868_100410341 Ga0068868_1004103411 245
502 3300005339 Ga0070660_100005272 Ga0070660_1000052722 245
503 3300005366 Ga0070659_100248468 Ga0070659_1002484682 245
504 3300005444 Ga0070694_100334196 Ga0070694_1003341961 245
505 3300005445 Ga0070708_100107666 Ga0070708_1001076662 245
506 3300005530 Ga0070679_100257179 Ga0070679_1002571792 245
507 3300005548 Ga0070665_100307911 Ga0070665_1003079112 245
508 3300005563 Ga0068855_100165946 Ga0068855_1001659462 245
509 3300005617 Ga0068859_100744051 Ga0068859_1007440512 245
510 3300005842 Ga0068858_100041636 Ga0068858_1000416362 245
511 3300006931 Ga0097620_100744040 Ga0097620_1007440401 245
512 3300007076 Ga0075435_100000891 Ga0075435_10000089110 245
513 3300009098 Ga0105245_10280353 Ga0105245_102803532 245
514 3300009101 Ga0105247_10020925 Ga0105247_100209252 245
515 3300009176 Ga0105242_10006554 Ga0105242_100065544 245
516 3300009177 Ga0105248_10004335 Ga0105248_100043356 245
517 3300009553 Ga0105249_10139015 Ga0105249_101390151 245
518 3300009553 Ga0105249_10374552 Ga0105249_103745521 245
519 3300013296 Ga0157374_10148787 Ga0157374_101487872 245
520 3300013296 Ga0157374_10205485 Ga0157374_102054852 245
521 3300013306 Ga0163162_10023452 Ga0163162_100234523 245
522 3300014325 Ga0163163_10007255 Ga0163163_100072555 245
523 3300014325 Ga0163163_10149964 Ga0163163_101499642 245
524 3300014325 Ga0163163_10455868 Ga0163163_104558682 245
525 3300014968 Ga0157379_10045850 Ga0157379_100458504 245
526 3300014968 Ga0157379_10115397 Ga0157379_101153972 245
527 3300025900 Ga0207710_10041537 Ga0207710_100415372 245
528 3300025909 Ga0207705_10033198 Ga0207705_100331982 245
529 3300025913 Ga0207695_10226191 Ga0207695_102261912 245
530 3300025917 Ga0207660_10097210 Ga0207660_100972102 245
531 3300025919 Ga0207657_10009485 Ga0207657_100094852 245
532 3300025934 Ga0207686_10022505 Ga0207686_100225053 245
533 3300025941 Ga0207711_10107390 Ga0207711_101073902 245
534 3300025945 Ga0207679_10150112 Ga0207679_101501123 245
535 3300026023 Ga0207677_10070270 Ga0207677_100702703 245
536 3300026035 Ga0207703_10123775 Ga0207703_101237752 245
537 3300026116 Ga0207674_10345810 Ga0207674_103458102 245
538 3300028379 Ga0268266_10024583 Ga0268266_100245831 245
539 3300035118 Ga0373954_0024502 Ga0373954_0024502_247_1074 245
540 3300035119 Ga0373956_0045445 Ga0373956_0045445_447_1274 245
541 3300035172 Ga0373955_0088197 Ga0373955_0088197_820_1647 245
542 3300035724 Ga0373933_0236715 Ga0373933_0236715_216_1046 245
543 3300036401 Ga0373937_0034126 Ga0373937_0034126_3765_4592 245
544 3300036401 Ga0373937_0237607 Ga0373937_0237607_656_1492 245
545 3300046459 Ga0495629_0268602 Ga0495629_0268602_32_859 245
546 3300046533 Ga0495640_0217234 Ga0495640_0217234_321_1151 245
547 3300046536 Ga0495587_0091826 Ga0495587_0091826_705_1532 245
548 3300046543 Ga0495645_0005546 Ga0495645_0005546_4883_5710 245
549 3300046559 Ga0495667_0226272 Ga0495667_0226272_142_969 245
550 3300046663 Ga0495635_0227618 Ga0495635_0227618_286_1113 245
551 3300046680 Ga0495646_0274091 Ga0495646_0274091_16_843 245
552 3300046683 Ga0495658_0087196 Ga0495658_0087196_700_1527 245
553 3300047319 Ga0495674_0098068 Ga0495674_0098068_761_1588 245
554 3300048911 Ga0496108_0024219 Ga0496108_0024219_3621_4448 245
555 3300048915 Ga0496112_0073309 Ga0496112_0073309_2250_3077 245
556 3300048917 Ga0496114_0288846 Ga0496114_0288846_231_1058 245
557 3300048917 Ga0496114_0305030 Ga0496114_0305030_186_1013 245
558 3300048918 Ga0496115_0419542 Ga0496115_0419542_61_888 245
559 3300050512 nmdc:mga0n895_20068_c1 nmdc:mga0n895_20068_c1_1470_2312 245
560 3300050513 nmdc:mga0rr50_269_c1 nmdc:mga0rr50_269_c1_22144_22986 245
561 3300053077 Ga0495601_0167382 Ga0495601_0167382_295_1122 245
562 3300053085 Ga0495619_0108077 Ga0495619_0108077_939_1769 245
563 3300005293 Ga0065715_10177504 Ga0065715_101775042 246
564 3300005328 Ga0070676_10001391 Ga0070676_100013916 246
565 3300005329 Ga0070683_100000817 Ga0070683_1000008175 246
566 3300005331 Ga0070670_100010107 Ga0070670_1000101072 246
567 3300005335 Ga0070666_10040134 Ga0070666_100401343 246
568 3300005338 Ga0068868_100304200 Ga0068868_1003042001 246
569 3300005341 Ga0070691_10001127 Ga0070691_100011276 246
570 3300005353 Ga0070669_100101340 Ga0070669_1001013402 246
571 3300005355 Ga0070671_100005021 Ga0070671_1000050217 246
572 3300005355 Ga0070671_100159686 Ga0070671_1001596862 246
573 3300005356 Ga0070674_100010617 Ga0070674_1000106173 246
574 3300005364 Ga0070673_100164797 Ga0070673_1001647972 246
575 3300005364 Ga0070673_100252463 Ga0070673_1002524632 246
576 3300005367 Ga0070667_100012544 Ga0070667_1000125446 246
577 3300005367 Ga0070667_100065911 Ga0070667_1000659113 246
578 3300005441 Ga0070700_100003178 Ga0070700_1000031782 246
579 3300005441 Ga0070700_100388440 Ga0070700_1003884402 246
580 3300005535 Ga0070684_100000538 Ga0070684_1000005388 246
581 3300005543 Ga0070672_100006875 Ga0070672_1000068756 246
582 3300005546 Ga0070696_100011361 Ga0070696_1000113615 246
583 3300005549 Ga0070704_100007278 Ga0070704_1000072783 246
584 3300005563 Ga0068855_100956441 Ga0068855_1009564411 246
585 3300005615 Ga0070702_100004635 Ga0070702_1000046352 246
586 3300005617 Ga0068859_100728165 Ga0068859_1007281652 246
587 3300005718 Ga0068866_10018276 Ga0068866_100182765 246
588 3300005719 Ga0068861_100201088 Ga0068861_1002010882 246
589 3300005841 Ga0068863_100006039 Ga0068863_1000060394 246
590 3300005842 Ga0068858_100657725 Ga0068858_1006577252 246
591 3300005844 Ga0068862_100010418 Ga0068862_1000104183 246
592 3300005844 Ga0068862_100012785 Ga0068862_1000127853 246
593 3300005844 Ga0068862_100111224 Ga0068862_1001112242 246
594 3300006058 Ga0075432_10120310 Ga0075432_101203101 246
595 3300006844 Ga0075428_100005718 Ga0075428_1000057182 246
596 3300006847 Ga0075431_100027376 Ga0075431_1000273764 246
597 3300006847 Ga0075431_100244848 Ga0075431_1002448482 246
598 3300006871 Ga0075434_100223029 Ga0075434_1002230292 246
599 3300006931 Ga0097620_100728244 Ga0097620_1007282442 246
600 3300007076 Ga0075435_100022979 Ga0075435_1000229792 246
601 3300007076 Ga0075435_100324701 Ga0075435_1003247011 246
602 3300009093 Ga0105240_10300646 Ga0105240_103006462 246
603 3300009094 Ga0111539_10003211 Ga0111539_1000321111 246
604 3300009147 Ga0114129_10009647 Ga0114129_100096478 246
605 3300009176 Ga0105242_10032160 Ga0105242_100321602 246
606 3300009177 Ga0105248_10010331 Ga0105248_100103315 246
607 3300013296 Ga0157374_10355621 Ga0157374_103556213 246
608 3300013306 Ga0163162_10011971 Ga0163162_100119716 246
609 3300013308 Ga0157375_10288976 Ga0157375_102889762 246
610 3300014325 Ga0163163_10003686 Ga0163163_100036869 246
611 3300025899 Ga0207642_10023708 Ga0207642_100237082 246
612 3300025906 Ga0207699_10086755 Ga0207699_100867553 246
613 3300025907 Ga0207645_10001380 Ga0207645_100013806 246
614 3300025918 Ga0207662_10215621 Ga0207662_102156212 246
615 3300025926 Ga0207659_10005133 Ga0207659_100051336 246
616 3300025931 Ga0207644_10104966 Ga0207644_101049663 246
617 3300025933 Ga0207706_10312518 Ga0207706_103125182 246
618 3300025936 Ga0207670_10060496 Ga0207670_100604963 246
619 3300025937 Ga0207669_10008229 Ga0207669_100082296 246
620 3300025940 Ga0207691_10032110 Ga0207691_100321106 246
621 3300025941 Ga0207711_10007046 Ga0207711_100070464 246
622 3300025960 Ga0207651_10071150 Ga0207651_100711503 246
623 3300025960 Ga0207651_10238027 Ga0207651_102380272 246
624 3300025972 Ga0207668_10125344 Ga0207668_101253443 246
625 3300025986 Ga0207658_10015751 Ga0207658_100157511 246
626 3300026041 Ga0207639_10409940 Ga0207639_104099402 246
627 3300026075 Ga0207708_10006725 Ga0207708_100067256 246
628 3300026075 Ga0207708_10041274 Ga0207708_100412746 246
629 3300026075 Ga0207708_10227457 Ga0207708_102274572 246
630 3300026088 Ga0207641_10000874 Ga0207641_100008746 246
631 3300026089 Ga0207648_10005825 Ga0207648_100058256 246
632 3300026118 Ga0207675_100026496 Ga0207675_1000264962 246
633 3300026118 Ga0207675_100646857 Ga0207675_1006468571 246
634 3300027907 Ga0207428_10009231 Ga0207428_100092312 246
635 3300028380 Ga0268265_10002942 Ga0268265_100029427 246
636 3300028380 Ga0268265_10355242 Ga0268265_103552422 246
637 3300028381 Ga0268264_10037638 Ga0268264_100376383 246
638 3300035115 Ga0373941_0028270 Ga0373941_0028270_734_1570 246
639 3300035121 Ga0373960_0091831 Ga0373960_0091831_25_861 246
640 3300048907 Ga0496104_0001736 Ga0496104_0001736_2757_3578 246
641 3300048908 Ga0496105_0043932 Ga0496105_0043932_2332_3153 246
642 3300048911 Ga0496108_0001282 Ga0496108_0001282_1654_2475 246
643 3300048912 Ga0496109_0000572 Ga0496109_0000572_13724_14545 246
644 3300048913 Ga0496110_0004885 Ga0496110_0004885_9463_10284 246
645 3300048914 Ga0496111_0052625 Ga0496111_0052625_995_1816 246
646 3300048915 Ga0496112_0000217 Ga0496112_0000217_15389_16210 246
647 3300050507 nmdc:mga05p37_32697_c1 nmdc:mga05p37_32697_c1_5148_5969 246
648 3300050510 nmdc:mga06r32_290387_c1 nmdc:mga06r32_290387_c1_185_1006 246
649 3300050510 nmdc:mga06r32_61562_c1 nmdc:mga06r32_61562_c1_1104_1952 246
650 3300050511 nmdc:mga08y16_10005_c1 nmdc:mga08y16_10005_c1_7904_8788 246
651 3300050511 nmdc:mga08y16_54506_c1 nmdc:mga08y16_54506_c1_2428_3261 246
652 3300050512 nmdc:mga0n895_293502_c1 nmdc:mga0n895_293502_c1_291_1127 246
653 3300050514 nmdc:mga08x19_284359_c1 nmdc:mga08x19_284359_c1_74_931 246
654 3300005356 Ga0070674_100070301 Ga0070674_1000703012 247
655 3300005468 Ga0070707_100300062 Ga0070707_1003000622 247
656 3300005471 Ga0070698_100115766 Ga0070698_1001157661 247
657 3300005471 Ga0070698_100419282 Ga0070698_1004192821 247
658 3300005518 Ga0070699_100107057 Ga0070699_1001070574 247
659 3300005536 Ga0070697_100452978 Ga0070697_1004529782 247
660 3300006844 Ga0075428_100060471 Ga0075428_1000604712 247
661 3300006852 Ga0075433_10123407 Ga0075433_101234073 247
662 3300006852 Ga0075433_10313673 Ga0075433_103136731 247
663 3300006871 Ga0075434_100058394 Ga0075434_1000583943 247
664 3300009147 Ga0114129_10024941 Ga0114129_100249416 247
665 3300009147 Ga0114129_10031424 Ga0114129_100314246 247
666 3300009147 Ga0114129_10294020 Ga0114129_102940203 247
667 3300009147 Ga0114129_10719821 Ga0114129_107198212 247
668 3300009177 Ga0105248_10125684 Ga0105248_101256845 247
669 3300025922 Ga0207646_10247832 Ga0207646_102478322 247
670 3300025937 Ga0207669_10071619 Ga0207669_100716194 247
671 3300025941 Ga0207711_10044421 Ga0207711_100444212 247
672 3300028381 Ga0268264_10510400 Ga0268264_105104002 247
673 3300046684 Ga0495669_0062038 Ga0495669_0062038_138_977 247
674 3300050507 nmdc:mga05p37_19809_c1 nmdc:mga05p37_19809_c1_2044_2883 247
675 3300050507 nmdc:mga05p37_25178_c1 nmdc:mga05p37_25178_c1_4835_5674 247
676 3300050507 nmdc:mga05p37_56245_c1 nmdc:mga05p37_56245_c1_1970_2809 247
677 3300050512 nmdc:mga0n895_16945_c1 nmdc:mga0n895_16945_c1_2426_3265 247
678 3300050512 nmdc:mga0n895_389765_c1 nmdc:mga0n895_389765_c1_191_1042 247
679 3300050515 nmdc:mga0a205_139575_c1 nmdc:mga0a205_139575_c1_1094_1933 247
680 3300050515 nmdc:mga0a205_168886_c1 nmdc:mga0a205_168886_c1_428_1267 247
681 3300006871 Ga0075434_100004203 Ga0075434_1000042039 248
682 3300007076 Ga0075435_100000882 Ga0075435_1000008826 248
683 3300025937 Ga0207669_10091392 Ga0207669_100913923 248
684 3300035725 Ga0373947_0080509 Ga0373947_0080509_261_1106 248
685 3300036401 Ga0373937_0150704 Ga0373937_0150704_151_996 248
686 3300037068 Ga0373925_0156271 Ga0373925_0156271_650_1495 248
687 3300046473 Ga0495582_0330502 Ga0495582_0330502_21_866 248
688 3300050510 nmdc:mga06r32_635240_c1 nmdc:mga06r32_635240_c1_36_872 248
689 3300050512 nmdc:mga0n895_1546_c1 nmdc:mga0n895_1546_c1_6580_7428 248
690 3300050513 nmdc:mga0rr50_8_c1 nmdc:mga0rr50_8_c1_188158_189006 248
691 3300005458 Ga0070681_10317944 Ga0070681_103179441 249
692 3300005615 Ga0070702_100063997 Ga0070702_1000639973 249
693 3300014325 Ga0163163_10004927 Ga0163163_100049274 249
694 3300025315 Ga0207697_10092291 Ga0207697_100922912 249
695 3300025925 Ga0207650_10082910 Ga0207650_100829103 249
696 3300026095 Ga0207676_10016713 Ga0207676_100167135 249
697 3300046514 Ga0495618_0274435 Ga0495618_0274435_19_867 249
698 3300050508 nmdc:mga09592_55909_c1 nmdc:mga09592_55909_c1_2500_3312 249
699 3300050509 nmdc:mga0qj67_62513_c1 nmdc:mga0qj67_62513_c1_1833_2672 249
700 3300005354 Ga0070675_100004794 Ga0070675_1000047943 250
701 3300005617 Ga0068859_100110287 Ga0068859_1001102875 250
702 3300006852 Ga0075433_10130784 Ga0075433_101307842 250
703 3300006931 Ga0097620_100110288 Ga0097620_1001102885 250
704 3300005331 Ga0070670_100046518 Ga0070670_1000465186 251
705 3300005336 Ga0070680_100095629 Ga0070680_1000956292 251
706 3300005354 Ga0070675_100181715 Ga0070675_1001817152 251
707 3300013296 Ga0157374_10597305 Ga0157374_105973052 251
708 3300014325 Ga0163163_10697006 Ga0163163_106970062 251
709 3300025925 Ga0207650_10019729 Ga0207650_100197297 251
710 3300049572 Ga0501036_0010569 Ga0501036_0010569_6774_7583 251
711 3300049575 Ga0501039_0007645 Ga0501039_0007645_6024_6833 251
712 3300049576 Ga0501040_0184162 Ga0501040_0184162_619_1428 251
713 3300049578 Ga0501042_0009658 Ga0501042_0009658_782_1591 251
714 3300049580 Ga0501046_0165786 Ga0501046_0165786_688_1497 251
715 3300049582 Ga0501048_0128729 Ga0501048_0128729_847_1656 251
716 3300049588 Ga0501072_0020504 Ga0501072_0020504_346_1155 251
717 3300049590 Ga0501074_0078777 Ga0501074_0078777_368_1177 251
718 3300049741 Ga0501079_0086679 Ga0501079_0086679_15_824 251
719 3300049822 Ga0501035_0280331 Ga0501035_0280331_485_1294 251
720 3300061734 Ga0530510_0010913 Ga0530510_0010913_4032_4841 251
721 3300009094 Ga0111539_10001720 Ga0111539_1000172011 252
722 3300009147 Ga0114129_10061566 Ga0114129_100615662 252
723 3300027907 Ga0207428_10001587 Ga0207428_100015879 252
724 3300050507 nmdc:mga05p37_263070_c1 nmdc:mga05p37_263070_c1_467_1327 252
725 3300050510 nmdc:mga06r32_166886_c1 nmdc:mga06r32_166886_c1_1004_1864 252
726 3300050511 nmdc:mga08y16_6338_c1 nmdc:mga08y16_6338_c1_5874_6734 252
727 3300006846 Ga0075430_100048673 Ga0075430_1000486735 254
728 3300006847 Ga0075431_100023216 Ga0075431_1000232162 254
729 3300050509 nmdc:mga0qj67_41255_c1 nmdc:mga0qj67_41255_c1_1822_2679 254
730 3300059426 Ga0590077_008969 Ga0590077_008969_139_996 254
731 3300005367 Ga0070667_100550813 Ga0070667_1005508131 255
732 3300014326 Ga0157380_10379905 Ga0157380_103799052 255
733 3300026118 Ga0207675_100233121 Ga0207675_1002331212 255
734 3300003203 JGI25406J46586_10000102 JGI25406J46586_1000010226 256
735 3300003203 JGI25406J46586_10001270 JGI25406J46586_100012705 256
736 3300005295 Ga0065707_10234770 Ga0065707_102347701 256
737 3300005518 Ga0070699_100011273 Ga0070699_1000112732 256
738 3300005985 Ga0081539_10000056 Ga0081539_10000056112 256
739 3300005985 Ga0081539_10000460 Ga0081539_1000046054 256
740 3300005985 Ga0081539_10002890 Ga0081539_1000289022 256
741 3300009094 Ga0111539_10009925 Ga0111539_100099258 256
742 3300025908 Ga0207643_10143862 Ga0207643_101438622 256
743 3300050511 nmdc:mga08y16_259387_c1 nmdc:mga08y16_259387_c1_606_1448 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00162

PGK

Phosphoglycerate kinase

256

293

0.96

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

28

193

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7896 18 229
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7677 18 229
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.7335 24 183
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.7035 24 184
6wm5-assembly1.cif.gz_C structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.6852 20 186
ID Description Score Start End Superfamily
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8972 14 190 1.20.120.1760
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8801 9 190 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8651 23 163 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8419 23 186 1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8308 14 190 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A832EXD2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9883 19 107 GO:0008654
GO:0016020
GO:0016780
AF-A0A7C7K264-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9534 20 130 GO:0008654
GO:0016020
GO:0016780
AF-A0A382IQ04-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9445 18 132 GO:0008654
GO:0016020
GO:0016780
AF-A0A497CZS9-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9393 20 130 GO:0008654
GO:0016020
GO:0016780
AF-A0A545T1Z0-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9344 21 234 GO:0003882
GO:0008654
GO:0012505
GO:0016020

Feature Viewer

pLDDT pTM Quality
78.13 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map