F478689
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 283 | 743 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300025315|Ga0207697_10092291|Ga0207697_100922912 |
| Length | 303 |
| Sequence | MLSPQEGRLRFFRRKNDRPRRRFRRGVYLLPSLLTMGNMFCGYACVVYAMRGEFETAAPFIGFAVVIDGLDGRIARMTGTTSAFGVEFDSLADIISFGIAPAILSFAWGLQSLGRLGWAAGFMFVACAAMRLARFNIQSASGGDKRYFVGMPSPAAAAIPAATVYAYPVGLYDYRAALPALAMVIVPAILMVSTIRFRSFKTIDSQGRKPYTVLIFVAAGIMLIATHPRFMLVAIAYVYLASAFVGLAITRFRHRGERGGDSAAAVRTLGLDESAFGHISTGGGASLEYLEGKQLPGLVALEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 182 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 183 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 184 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 234 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 277 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 280 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 281 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 3.9 |
| Rhizosphere | 95.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000102 | 3300003203 | Bacteria | 37824 |
| 2 | JGI25406J46586_10001270 | 3300003203 | Bacteria | 11843 |
| 3 | Ga0065712_10035779 | 3300005290 | Unclassified | 1095 |
| 4 | Ga0065712_10074717 | 3300005290 | Bacteria | 4027 |
| 5 | Ga0065712_10191071 | 3300005290 | Bacteria | 1148 |
| 6 | Ga0065715_10034415 | 3300005293 | Bacteria | 1518 |
| 7 | Ga0065715_10177504 | 3300005293 | Bacteria | 1500 |
| 8 | Ga0065707_10006338 | 3300005295 | Bacteria | 5414 |
| 9 | Ga0065707_10102536 | 3300005295 | Unclassified | 2799 |
| 10 | Ga0065707_10234770 | 3300005295 | Bacteria | 1176 |
| 11 | Ga0070676_10001391 | 3300005328 | Bacteria | 12217 |
| 12 | Ga0070683_100000817 | 3300005329 | Bacteria | 23098 |
| 13 | Ga0070683_100191479 | 3300005329 | Bacteria | 1942 |
| 14 | Ga0070683_100711358 | 3300005329 | Bacteria | 962 |
| 15 | Ga0070690_100257833 | 3300005330 | Bacteria | 1236 |
| 16 | Ga0070670_100003221 | 3300005331 | Bacteria | 13474 |
| 17 | Ga0070670_100010107 | 3300005331 | Bacteria | 8050 |
| 18 | Ga0070670_100046518 | 3300005331 | Bacteria | 3731 |
| 19 | Ga0070670_100316080 | 3300005331 | Unclassified | 1368 |
| 20 | Ga0068869_100233032 | 3300005334 | Bacteria | 1464 |
| 21 | Ga0070666_10022404 | 3300005335 | Bacteria | 4102 |
| 22 | Ga0070666_10029165 | 3300005335 | Bacteria | 3625 |
| 23 | Ga0070666_10040134 | 3300005335 | Bacteria | 3123 |
| 24 | Ga0070666_10090472 | 3300005335 | Unclassified | 2102 |
| 25 | Ga0070680_100095629 | 3300005336 | Bacteria | 2463 |
| 26 | Ga0068868_100304200 | 3300005338 | Bacteria | 1355 |
| 27 | Ga0068868_100410341 | 3300005338 | Bacteria | 1171 |
| 28 | Ga0070660_100005272 | 3300005339 | Bacteria | 8938 |
| 29 | Ga0070689_100027236 | 3300005340 | Bacteria | 4308 |
| 30 | Ga0070689_100163578 | 3300005340 | Bacteria | 1800 |
| 31 | Ga0070691_10001127 | 3300005341 | Bacteria | 11104 |
| 32 | Ga0070661_100019679 | 3300005344 | Bacteria | 4811 |
| 33 | Ga0070669_100000133 | 3300005353 | Bacteria | 67886 |
| 34 | Ga0070669_100101340 | 3300005353 | Bacteria | 2172 |
| 35 | Ga0070669_100174654 | 3300005353 | Unclassified | 1677 |
| 36 | Ga0070669_100242317 | 3300005353 | Bacteria | 1433 |
| 37 | Ga0070675_100001153 | 3300005354 | Bacteria | 19086 |
| 38 | Ga0070675_100004794 | 3300005354 | Bacteria | 10316 |
| 39 | Ga0070675_100010814 | 3300005354 | Bacteria | 7136 |
| 40 | Ga0070675_100070461 | 3300005354 | Bacteria | 2898 |
| 41 | Ga0070675_100112217 | 3300005354 | Unclassified | 2308 |
| 42 | Ga0070675_100177522 | 3300005354 | Unclassified | 1840 |
| 43 | Ga0070675_100181715 | 3300005354 | Bacteria | 1819 |
| 44 | Ga0070671_100005021 | 3300005355 | Bacteria | 10550 |
| 45 | Ga0070671_100159686 | 3300005355 | Bacteria | 1905 |
| 46 | Ga0070674_100010617 | 3300005356 | Bacteria | 5576 |
| 47 | Ga0070674_100023397 | 3300005356 | Unclassified | 3999 |
| 48 | Ga0070674_100070301 | 3300005356 | Bacteria | 2473 |
| 49 | Ga0070674_100080860 | 3300005356 | Unclassified | 2321 |
| 50 | Ga0070673_100109853 | 3300005364 | Bacteria | 2285 |
| 51 | Ga0070673_100164797 | 3300005364 | Bacteria | 1887 |
| 52 | Ga0070673_100252463 | 3300005364 | Unclassified | 1538 |
| 53 | Ga0070688_100048886 | 3300005365 | Bacteria | 2630 |
| 54 | Ga0070688_100062324 | 3300005365 | Bacteria | 2360 |
| 55 | Ga0070659_100248468 | 3300005366 | Bacteria | 1474 |
| 56 | Ga0070667_100012544 | 3300005367 | Bacteria | 7009 |
| 57 | Ga0070667_100065911 | 3300005367 | Bacteria | 3076 |
| 58 | Ga0070667_100210948 | 3300005367 | Bacteria | 1726 |
| 59 | Ga0070667_100550813 | 3300005367 | Bacteria | 1060 |
| 60 | Ga0070703_10019261 | 3300005406 | Bacteria | 1978 |
| 61 | Ga0070713_100042202 | 3300005436 | Bacteria | 3722 |
| 62 | Ga0070711_100051768 | 3300005439 | Bacteria | 2822 |
| 63 | Ga0070700_100003178 | 3300005441 | Bacteria | 8437 |
| 64 | Ga0070700_100388440 | 3300005441 | Bacteria | 1046 |
| 65 | Ga0070694_100334196 | 3300005444 | Bacteria | 1170 |
| 66 | Ga0070708_100059068 | 3300005445 | Bacteria | 3418 |
| 67 | Ga0070708_100107666 | 3300005445 | Bacteria | 2559 |
| 68 | Ga0070662_100079056 | 3300005457 | Bacteria | 2445 |
| 69 | Ga0070662_100320538 | 3300005457 | Unclassified | 1264 |
| 70 | Ga0070681_10018543 | 3300005458 | Bacteria | 6957 |
| 71 | Ga0070681_10317944 | 3300005458 | Bacteria | 1466 |
| 72 | Ga0068867_100104894 | 3300005459 | Bacteria | 2164 |
| 73 | Ga0068867_100213604 | 3300005459 | Bacteria | 1551 |
| 74 | Ga0068867_100224345 | 3300005459 | Bacteria | 1516 |
| 75 | Ga0068867_100255688 | 3300005459 | Bacteria | 1426 |
| 76 | Ga0070685_10264827 | 3300005466 | Bacteria | 1145 |
| 77 | Ga0070706_100231467 | 3300005467 | Bacteria | 1725 |
| 78 | Ga0070706_100313175 | 3300005467 | Bacteria | 1464 |
| 79 | Ga0070707_100155083 | 3300005468 | Bacteria | 2231 |
| 80 | Ga0070707_100300062 | 3300005468 | Bacteria | 1561 |
| 81 | Ga0070698_100005321 | 3300005471 | Bacteria | 14088 |
| 82 | Ga0070698_100115766 | 3300005471 | Bacteria | 2645 |
| 83 | Ga0070698_100342982 | 3300005471 | Unclassified | 1425 |
| 84 | Ga0070698_100363061 | 3300005471 | Unclassified | 1380 |
| 85 | Ga0070698_100419282 | 3300005471 | Bacteria | 1273 |
| 86 | Ga0070699_100001247 | 3300005518 | Bacteria | 23450 |
| 87 | Ga0070699_100003994 | 3300005518 | Bacteria | 13034 |
| 88 | Ga0070699_100011273 | 3300005518 | Bacteria | 7723 |
| 89 | Ga0070699_100107057 | 3300005518 | Bacteria | 2453 |
| 90 | Ga0070699_100448884 | 3300005518 | Bacteria | 1169 |
| 91 | Ga0070679_100257179 | 3300005530 | Bacteria | 1701 |
| 92 | Ga0070684_100000538 | 3300005535 | Bacteria | 26032 |
| 93 | Ga0070697_100024877 | 3300005536 | Bacteria | 4769 |
| 94 | Ga0070697_100452978 | 3300005536 | Bacteria | 1118 |
| 95 | Ga0070697_100647031 | 3300005536 | Bacteria | 931 |
| 96 | Ga0070672_100006875 | 3300005543 | Bacteria | 7688 |
| 97 | Ga0070672_100011885 | 3300005543 | Bacteria | 6085 |
| 98 | Ga0070672_100029428 | 3300005543 | Bacteria | 4119 |
| 99 | Ga0070695_100010728 | 3300005545 | Bacteria | 5474 |
| 100 | Ga0070696_100011361 | 3300005546 | Bacteria | 5964 |
| 101 | Ga0070696_100032166 | 3300005546 | Bacteria | 3599 |
| 102 | Ga0070665_100003845 | 3300005548 | Bacteria | 15892 |
| 103 | Ga0070665_100008381 | 3300005548 | Bacteria | 10457 |
| 104 | Ga0070665_100307911 | 3300005548 | Unclassified | 1587 |
| 105 | Ga0070704_100007278 | 3300005549 | Bacteria | 6583 |
| 106 | Ga0070704_100022532 | 3300005549 | Bacteria | 4101 |
| 107 | Ga0070704_100068140 | 3300005549 | Bacteria | 2573 |
| 108 | Ga0070704_100435765 | 3300005549 | Bacteria | 1125 |
| 109 | Ga0068855_100165946 | 3300005563 | Bacteria | 2503 |
| 110 | Ga0068855_100956441 | 3300005563 | Bacteria | 902 |
| 111 | Ga0070664_100000055 | 3300005564 | Bacteria | 69107 |
| 112 | Ga0070664_100168983 | 3300005564 | Bacteria | 1939 |
| 113 | Ga0070664_100193954 | 3300005564 | Unclassified | 1810 |
| 114 | Ga0070664_100590950 | 3300005564 | Bacteria | 1029 |
| 115 | Ga0068857_100005431 | 3300005577 | Bacteria | 10868 |
| 116 | Ga0068856_100059321 | 3300005614 | Bacteria | 3780 |
| 117 | Ga0070702_100004635 | 3300005615 | Bacteria | 6304 |
| 118 | Ga0070702_100063997 | 3300005615 | Bacteria | 2150 |
| 119 | Ga0068859_100110287 | 3300005617 | Bacteria | 2813 |
| 120 | Ga0068859_100422501 | 3300005617 | Bacteria | 1429 |
| 121 | Ga0068859_100728165 | 3300005617 | Bacteria | 1082 |
| 122 | Ga0068859_100744051 | 3300005617 | Bacteria | 1069 |
| 123 | Ga0068864_100072431 | 3300005618 | Bacteria | 3003 |
| 124 | Ga0068864_100320109 | 3300005618 | Bacteria | 1457 |
| 125 | Ga0068866_10018276 | 3300005718 | Bacteria | 3167 |
| 126 | Ga0068866_10035182 | 3300005718 | Bacteria | 2444 |
| 127 | Ga0068861_100201088 | 3300005719 | Bacteria | 1672 |
| 128 | Ga0068861_100686806 | 3300005719 | Bacteria | 950 |
| 129 | Ga0068863_100006039 | 3300005841 | Bacteria | 11882 |
| 130 | Ga0068863_100123229 | 3300005841 | Bacteria | 2473 |
| 131 | Ga0068863_100171661 | 3300005841 | Unclassified | 2080 |
| 132 | Ga0068858_100006490 | 3300005842 | Bacteria | 11386 |
| 133 | Ga0068858_100041636 | 3300005842 | Bacteria | 4259 |
| 134 | Ga0068858_100453749 | 3300005842 | Bacteria | 1236 |
| 135 | Ga0068858_100657725 | 3300005842 | Unclassified | 1018 |
| 136 | Ga0068860_100354736 | 3300005843 | Unclassified | 1444 |
| 137 | Ga0068860_100451700 | 3300005843 | Unclassified | 1278 |
| 138 | Ga0068862_100010418 | 3300005844 | Bacteria | 7676 |
| 139 | Ga0068862_100012785 | 3300005844 | Bacteria | 6946 |
| 140 | Ga0068862_100022777 | 3300005844 | Bacteria | 5242 |
| 141 | Ga0068862_100111224 | 3300005844 | Bacteria | 2404 |
| 142 | Ga0068862_100473276 | 3300005844 | Bacteria | 1185 |
| 143 | Ga0068862_100671793 | 3300005844 | Bacteria | 1001 |
| 144 | Ga0081455_10087723 | 3300005937 | Bacteria | 2531 |
| 145 | Ga0081538_10086064 | 3300005981 | Bacteria | 1647 |
| 146 | Ga0081539_10000056 | 3300005985 | Bacteria | 256522 |
| 147 | Ga0081539_10000460 | 3300005985 | Bacteria | 86291 |
| 148 | Ga0081539_10002890 | 3300005985 | Bacteria | 22768 |
| 149 | Ga0081539_10005654 | 3300005985 | Bacteria | 12559 |
| 150 | Ga0070717_10032580 | 3300006028 | Bacteria | 4200 |
| 151 | Ga0075432_10120310 | 3300006058 | Bacteria | 986 |
| 152 | Ga0070712_100380983 | 3300006175 | Bacteria | 1161 |
| 153 | Ga0070712_100394968 | 3300006175 | Bacteria | 1141 |
| 154 | Ga0097621_100001602 | 3300006237 | Bacteria | 15489 |
| 155 | Ga0097621_100022608 | 3300006237 | Bacteria | 4883 |
| 156 | Ga0097621_100362606 | 3300006237 | Bacteria | 1291 |
| 157 | Ga0068871_100001058 | 3300006358 | Bacteria | 18456 |
| 158 | Ga0068871_100010489 | 3300006358 | Bacteria | 6765 |
| 159 | Ga0068871_100023609 | 3300006358 | Bacteria | 4760 |
| 160 | Ga0068871_100131307 | 3300006358 | Bacteria | 2124 |
| 161 | Ga0075428_100002186 | 3300006844 | Bacteria | 21167 |
| 162 | Ga0075428_100005718 | 3300006844 | Bacteria | 13821 |
| 163 | Ga0075428_100011036 | 3300006844 | Bacteria | 10048 |
| 164 | Ga0075428_100031720 | 3300006844 | Bacteria | 5837 |
| 165 | Ga0075428_100060471 | 3300006844 | Bacteria | 4148 |
| 166 | Ga0075428_100062370 | 3300006844 | Bacteria | 4081 |
| 167 | Ga0075428_100326143 | 3300006844 | Bacteria | 1649 |
| 168 | Ga0075428_100505090 | 3300006844 | Bacteria | 1293 |
| 169 | Ga0075430_100045130 | 3300006846 | Bacteria | 3724 |
| 170 | Ga0075430_100048673 | 3300006846 | Bacteria | 3579 |
| 171 | Ga0075430_100114609 | 3300006846 | Bacteria | 2246 |
| 172 | Ga0075431_100023216 | 3300006847 | Bacteria | 6345 |
| 173 | Ga0075431_100027376 | 3300006847 | Bacteria | 5848 |
| 174 | Ga0075431_100029078 | 3300006847 | Bacteria | 5686 |
| 175 | Ga0075431_100191920 | 3300006847 | Bacteria | 2093 |
| 176 | Ga0075431_100241669 | 3300006847 | Bacteria | 1837 |
| 177 | Ga0075431_100244848 | 3300006847 | Bacteria | 1823 |
| 178 | Ga0075433_10007559 | 3300006852 | Bacteria | 8619 |
| 179 | Ga0075433_10008654 | 3300006852 | Bacteria | 8120 |
| 180 | Ga0075433_10057421 | 3300006852 | Bacteria | 3402 |
| 181 | Ga0075433_10064437 | 3300006852 | Unclassified | 3213 |
| 182 | Ga0075433_10123407 | 3300006852 | Bacteria | 2301 |
| 183 | Ga0075433_10130784 | 3300006852 | Bacteria | 2230 |
| 184 | Ga0075433_10313673 | 3300006852 | Unclassified | 1388 |
| 185 | Ga0075434_100004203 | 3300006871 | Bacteria | 12904 |
| 186 | Ga0075434_100007606 | 3300006871 | Bacteria | 10031 |
| 187 | Ga0075434_100008966 | 3300006871 | Bacteria | 9316 |
| 188 | Ga0075434_100013351 | 3300006871 | Bacteria | 7813 |
| 189 | Ga0075434_100058394 | 3300006871 | Unclassified | 3834 |
| 190 | Ga0075434_100163053 | 3300006871 | Bacteria | 2249 |
| 191 | Ga0075434_100223029 | 3300006871 | Bacteria | 1905 |
| 192 | Ga0075434_100399228 | 3300006871 | Bacteria | 1396 |
| 193 | Ga0075429_100036803 | 3300006880 | Bacteria | 4259 |
| 194 | Ga0075429_100105364 | 3300006880 | Bacteria | 2463 |
| 195 | Ga0075429_100494191 | 3300006880 | Bacteria | 1072 |
| 196 | Ga0068865_100038766 | 3300006881 | Bacteria | 3227 |
| 197 | Ga0068865_100185971 | 3300006881 | Bacteria | 1603 |
| 198 | Ga0075436_100009574 | 3300006914 | Bacteria | 6632 |
| 199 | Ga0075436_100010634 | 3300006914 | Bacteria | 6311 |
| 200 | Ga0075436_100021620 | 3300006914 | Bacteria | 4416 |
| 201 | Ga0075436_100099327 | 3300006914 | Bacteria | 2026 |
| 202 | Ga0075436_100209645 | 3300006914 | Bacteria | 1381 |
| 203 | Ga0097620_100110288 | 3300006931 | Bacteria | 2813 |
| 204 | Ga0097620_100385265 | 3300006931 | Bacteria | 1497 |
| 205 | Ga0097620_100422497 | 3300006931 | Bacteria | 1429 |
| 206 | Ga0097620_100728244 | 3300006931 | Bacteria | 1082 |
| 207 | Ga0097620_100744040 | 3300006931 | Bacteria | 1069 |
| 208 | Ga0075435_100000882 | 3300007076 | Bacteria | 18834 |
| 209 | Ga0075435_100000891 | 3300007076 | Bacteria | 18771 |
| 210 | Ga0075435_100004221 | 3300007076 | Bacteria | 9866 |
| 211 | Ga0075435_100022979 | 3300007076 | Bacteria | 4815 |
| 212 | Ga0075435_100234705 | 3300007076 | Bacteria | 1559 |
| 213 | Ga0075435_100257637 | 3300007076 | Bacteria | 1486 |
| 214 | Ga0075435_100324701 | 3300007076 | Unclassified | 1317 |
| 215 | Ga0099794_10158440 | 3300007265 | Bacteria | 1151 |
| 216 | Ga0105240_10164668 | 3300009093 | Unclassified | 2631 |
| 217 | Ga0105240_10300646 | 3300009093 | Unclassified | 1836 |
| 218 | Ga0111539_10000056 | 3300009094 | Bacteria | 114878 |
| 219 | Ga0111539_10000859 | 3300009094 | Bacteria | 39627 |
| 220 | Ga0111539_10001720 | 3300009094 | Bacteria | 29144 |
| 221 | Ga0111539_10003211 | 3300009094 | Bacteria | 21614 |
| 222 | Ga0111539_10009925 | 3300009094 | Bacteria | 12011 |
| 223 | Ga0111539_10010192 | 3300009094 | Bacteria | 11843 |
| 224 | Ga0111539_10017296 | 3300009094 | Bacteria | 8923 |
| 225 | Ga0111539_10020554 | 3300009094 | Bacteria | 8132 |
| 226 | Ga0111539_10082634 | 3300009094 | Bacteria | 3778 |
| 227 | Ga0111539_10578297 | 3300009094 | Bacteria | 1308 |
| 228 | Ga0105245_10004376 | 3300009098 | Bacteria | 12501 |
| 229 | Ga0105245_10138173 | 3300009098 | Bacteria | 2292 |
| 230 | Ga0105245_10280353 | 3300009098 | Bacteria | 1629 |
| 231 | Ga0105245_10679886 | 3300009098 | Bacteria | 1061 |
| 232 | Ga0105247_10006881 | 3300009101 | Bacteria | 7008 |
| 233 | Ga0105247_10020925 | 3300009101 | Bacteria | 3936 |
| 234 | Ga0114129_10001088 | 3300009147 | Bacteria | 35659 |
| 235 | Ga0114129_10001107 | 3300009147 | Bacteria | 35478 |
| 236 | Ga0114129_10003691 | 3300009147 | Bacteria | 21558 |
| 237 | Ga0114129_10009647 | 3300009147 | Bacteria | 13775 |
| 238 | Ga0114129_10019564 | 3300009147 | Bacteria | 9638 |
| 239 | Ga0114129_10024941 | 3300009147 | Bacteria | 8478 |
| 240 | Ga0114129_10031424 | 3300009147 | Bacteria | 7505 |
| 241 | Ga0114129_10032450 | 3300009147 | Bacteria | 7381 |
| 242 | Ga0114129_10039491 | 3300009147 | Bacteria | 6654 |
| 243 | Ga0114129_10061566 | 3300009147 | Bacteria | 5245 |
| 244 | Ga0114129_10063061 | 3300009147 | Bacteria | 5177 |
| 245 | Ga0114129_10107306 | 3300009147 | Bacteria | 3857 |
| 246 | Ga0114129_10197116 | 3300009147 | Bacteria | 2730 |
| 247 | Ga0114129_10294020 | 3300009147 | Bacteria | 2167 |
| 248 | Ga0114129_10299448 | 3300009147 | Bacteria | 2144 |
| 249 | Ga0114129_10302602 | 3300009147 | Bacteria | 2131 |
| 250 | Ga0114129_10356105 | 3300009147 | Bacteria | 1938 |
| 251 | Ga0114129_10719821 | 3300009147 | Bacteria | 1281 |
| 252 | Ga0105243_10023292 | 3300009148 | Bacteria | 4713 |
| 253 | Ga0105243_10048211 | 3300009148 | Bacteria | 3357 |
| 254 | Ga0105242_10006554 | 3300009176 | Bacteria | 8964 |
| 255 | Ga0105242_10018083 | 3300009176 | Bacteria | 5505 |
| 256 | Ga0105242_10032160 | 3300009176 | Bacteria | 4194 |
| 257 | Ga0105248_10004335 | 3300009177 | Bacteria | 15688 |
| 258 | Ga0105248_10010331 | 3300009177 | Bacteria | 10275 |
| 259 | Ga0105248_10070756 | 3300009177 | Bacteria | 3918 |
| 260 | Ga0105248_10125684 | 3300009177 | Bacteria | 2893 |
| 261 | Ga0105248_10143775 | 3300009177 | Bacteria | 2691 |
| 262 | Ga0105248_10268535 | 3300009177 | Bacteria | 1921 |
| 263 | Ga0105248_10387226 | 3300009177 | Bacteria | 1574 |
| 264 | Ga0105249_10009355 | 3300009553 | Bacteria | 8572 |
| 265 | Ga0105249_10139015 | 3300009553 | Unclassified | 2327 |
| 266 | Ga0105249_10374552 | 3300009553 | Bacteria | 1448 |
| 267 | Ga0105249_10435656 | 3300009553 | Bacteria | 1347 |
| 268 | Ga0105249_10491788 | 3300009553 | Bacteria | 1271 |
| 269 | Ga0105249_10726042 | 3300009553 | Bacteria | 1055 |
| 270 | Ga0105246_10308663 | 3300011119 | Bacteria | 1280 |
| 271 | Ga0157370_10381811 | 3300013104 | Unclassified | 1298 |
| 272 | Ga0157374_10102744 | 3300013296 | Bacteria | 2742 |
| 273 | Ga0157374_10148787 | 3300013296 | Unclassified | 2276 |
| 274 | Ga0157374_10205485 | 3300013296 | Unclassified | 1930 |
| 275 | Ga0157374_10355621 | 3300013296 | Unclassified | 1456 |
| 276 | Ga0157374_10597305 | 3300013296 | Bacteria | 1113 |
| 277 | Ga0157378_10004256 | 3300013297 | Bacteria | 12618 |
| 278 | Ga0163162_10011971 | 3300013306 | Bacteria | 8460 |
| 279 | Ga0163162_10023452 | 3300013306 | Bacteria | 6090 |
| 280 | Ga0163162_10228405 | 3300013306 | Unclassified | 1991 |
| 281 | Ga0157375_10026946 | 3300013308 | Bacteria | 5365 |
| 282 | Ga0157375_10147079 | 3300013308 | Bacteria | 2488 |
| 283 | Ga0157375_10241843 | 3300013308 | Unclassified | 1965 |
| 284 | Ga0157375_10288976 | 3300013308 | Bacteria | 1802 |
| 285 | Ga0157375_10739610 | 3300013308 | Bacteria | 1135 |
| 286 | Ga0163163_10003686 | 3300014325 | Bacteria | 13039 |
| 287 | Ga0163163_10004927 | 3300014325 | Bacteria | 11482 |
| 288 | Ga0163163_10007255 | 3300014325 | Bacteria | 9772 |
| 289 | Ga0163163_10042063 | 3300014325 | Bacteria | 4472 |
| 290 | Ga0163163_10149964 | 3300014325 | Bacteria | 2376 |
| 291 | Ga0163163_10455868 | 3300014325 | Bacteria | 1339 |
| 292 | Ga0163163_10697006 | 3300014325 | Bacteria | 1079 |
| 293 | Ga0157380_10019621 | 3300014326 | Bacteria | 5040 |
| 294 | Ga0157380_10034652 | 3300014326 | Bacteria | 3895 |
| 295 | Ga0157380_10035864 | 3300014326 | Bacteria | 3833 |
| 296 | Ga0157380_10079759 | 3300014326 | Bacteria | 2674 |
| 297 | Ga0157380_10128583 | 3300014326 | Bacteria | 2158 |
| 298 | Ga0157380_10216956 | 3300014326 | Unclassified | 1709 |
| 299 | Ga0157380_10379905 | 3300014326 | Bacteria | 1333 |
| 300 | Ga0157377_10083411 | 3300014745 | Bacteria | 1873 |
| 301 | Ga0157379_10010887 | 3300014968 | Bacteria | 7928 |
| 302 | Ga0157379_10010953 | 3300014968 | Bacteria | 7907 |
| 303 | Ga0157379_10045850 | 3300014968 | Bacteria | 3902 |
| 304 | Ga0157379_10115397 | 3300014968 | Bacteria | 2414 |
| 305 | Ga0157379_10701888 | 3300014968 | Unclassified | 950 |
| 306 | Ga0157376_10015903 | 3300014969 | Bacteria | 5699 |
| 307 | Ga0157376_10022680 | 3300014969 | Bacteria | 4899 |
| 308 | Ga0157376_10045543 | 3300014969 | Bacteria | 3613 |
| 309 | Ga0163161_10048567 | 3300017792 | Bacteria | 3065 |
| 310 | Ga0207697_10092291 | 3300025315 | Bacteria | 1284 |
| 311 | Ga0207653_10031741 | 3300025885 | Bacteria | 1707 |
| 312 | Ga0207642_10023708 | 3300025899 | Bacteria | 2455 |
| 313 | Ga0207710_10041537 | 3300025900 | Bacteria | 2040 |
| 314 | Ga0207688_10061123 | 3300025901 | Unclassified | 2123 |
| 315 | Ga0207688_10079821 | 3300025901 | Bacteria | 1867 |
| 316 | Ga0207680_10023673 | 3300025903 | Bacteria | 3358 |
| 317 | Ga0207680_10036350 | 3300025903 | Bacteria | 2836 |
| 318 | Ga0207680_10119936 | 3300025903 | Bacteria | 1718 |
| 319 | Ga0207699_10086755 | 3300025906 | Bacteria | 1955 |
| 320 | Ga0207645_10001380 | 3300025907 | Bacteria | 19933 |
| 321 | Ga0207645_10037612 | 3300025907 | Bacteria | 3105 |
| 322 | Ga0207643_10143862 | 3300025908 | Unclassified | 1426 |
| 323 | Ga0207705_10033198 | 3300025909 | Bacteria | 3687 |
| 324 | Ga0207654_10325028 | 3300025911 | Bacteria | 1052 |
| 325 | Ga0207695_10226191 | 3300025913 | Bacteria | 1777 |
| 326 | Ga0207663_10306540 | 3300025916 | Bacteria | 1188 |
| 327 | Ga0207660_10097210 | 3300025917 | Bacteria | 2194 |
| 328 | Ga0207662_10101101 | 3300025918 | Unclassified | 1786 |
| 329 | Ga0207662_10215621 | 3300025918 | Bacteria | 1248 |
| 330 | Ga0207657_10009485 | 3300025919 | Bacteria | 9777 |
| 331 | Ga0207657_10236179 | 3300025919 | Unclassified | 1461 |
| 332 | Ga0207649_10011364 | 3300025920 | Bacteria | 4909 |
| 333 | Ga0207649_10241249 | 3300025920 | Bacteria | 1297 |
| 334 | Ga0207646_10247832 | 3300025922 | Bacteria | 1609 |
| 335 | Ga0207681_10005004 | 3300025923 | Bacteria | 8144 |
| 336 | Ga0207681_10066405 | 3300025923 | Bacteria | 2497 |
| 337 | Ga0207681_10097568 | 3300025923 | Bacteria | 2113 |
| 338 | Ga0207650_10006970 | 3300025925 | Bacteria | 7704 |
| 339 | Ga0207650_10019729 | 3300025925 | Bacteria | 4742 |
| 340 | Ga0207650_10043796 | 3300025925 | Bacteria | 3287 |
| 341 | Ga0207650_10082910 | 3300025925 | Bacteria | 2435 |
| 342 | Ga0207650_10094237 | 3300025925 | Bacteria | 2293 |
| 343 | Ga0207659_10004183 | 3300025926 | Bacteria | 8715 |
| 344 | Ga0207659_10005133 | 3300025926 | Bacteria | 7939 |
| 345 | Ga0207659_10083328 | 3300025926 | Bacteria | 2370 |
| 346 | Ga0207659_10228636 | 3300025926 | Unclassified | 1499 |
| 347 | Ga0207687_10029369 | 3300025927 | Bacteria | 3698 |
| 348 | Ga0207687_10161943 | 3300025927 | Bacteria | 1718 |
| 349 | Ga0207700_10032324 | 3300025928 | Bacteria | 3731 |
| 350 | Ga0207700_10648351 | 3300025928 | Bacteria | 941 |
| 351 | Ga0207644_10104966 | 3300025931 | Bacteria | 2128 |
| 352 | Ga0207690_10261065 | 3300025932 | Bacteria | 1342 |
| 353 | Ga0207706_10160430 | 3300025933 | Bacteria | 1977 |
| 354 | Ga0207706_10172769 | 3300025933 | Unclassified | 1899 |
| 355 | Ga0207706_10312518 | 3300025933 | Bacteria | 1368 |
| 356 | Ga0207686_10014334 | 3300025934 | Bacteria | 4409 |
| 357 | Ga0207686_10022505 | 3300025934 | Unclassified | 3631 |
| 358 | Ga0207686_10088463 | 3300025934 | Bacteria | 2039 |
| 359 | Ga0207686_10107313 | 3300025934 | Unclassified | 1876 |
| 360 | Ga0207686_10343342 | 3300025934 | Bacteria | 1122 |
| 361 | Ga0207709_10017498 | 3300025935 | Bacteria | 4000 |
| 362 | Ga0207670_10060496 | 3300025936 | Bacteria | 2581 |
| 363 | Ga0207670_10096988 | 3300025936 | Bacteria | 2098 |
| 364 | Ga0207670_10219544 | 3300025936 | Bacteria | 1454 |
| 365 | Ga0207670_10260658 | 3300025936 | Unclassified | 1344 |
| 366 | Ga0207669_10006658 | 3300025937 | Bacteria | 5296 |
| 367 | Ga0207669_10008229 | 3300025937 | Bacteria | 4887 |
| 368 | Ga0207669_10035488 | 3300025937 | Bacteria | 2838 |
| 369 | Ga0207669_10071619 | 3300025937 | Unclassified | 2179 |
| 370 | Ga0207669_10091392 | 3300025937 | Bacteria | 1983 |
| 371 | Ga0207704_10003158 | 3300025938 | Bacteria | 7453 |
| 372 | Ga0207704_10036800 | 3300025938 | Bacteria | 2819 |
| 373 | Ga0207691_10032110 | 3300025940 | Bacteria | 4898 |
| 374 | Ga0207691_10088955 | 3300025940 | Bacteria | 2769 |
| 375 | Ga0207691_10107626 | 3300025940 | Bacteria | 2482 |
| 376 | Ga0207691_10148359 | 3300025940 | Bacteria | 2063 |
| 377 | Ga0207711_10007046 | 3300025941 | Bacteria | 9418 |
| 378 | Ga0207711_10044421 | 3300025941 | Bacteria | 3793 |
| 379 | Ga0207711_10075311 | 3300025941 | Bacteria | 2937 |
| 380 | Ga0207711_10107390 | 3300025941 | Bacteria | 2478 |
| 381 | Ga0207711_10147206 | 3300025941 | Bacteria | 2122 |
| 382 | Ga0207711_10157278 | 3300025941 | Unclassified | 2055 |
| 383 | Ga0207661_10001501 | 3300025944 | Bacteria | 15811 |
| 384 | Ga0207679_10001458 | 3300025945 | Bacteria | 14838 |
| 385 | Ga0207679_10122786 | 3300025945 | Bacteria | 2070 |
| 386 | Ga0207679_10150112 | 3300025945 | Bacteria | 1895 |
| 387 | Ga0207679_10273842 | 3300025945 | Bacteria | 1445 |
| 388 | Ga0207679_10295590 | 3300025945 | Unclassified | 1394 |
| 389 | Ga0207651_10029304 | 3300025960 | Bacteria | 3486 |
| 390 | Ga0207651_10046090 | 3300025960 | Bacteria | 2929 |
| 391 | Ga0207651_10071150 | 3300025960 | Bacteria | 2464 |
| 392 | Ga0207651_10238027 | 3300025960 | Bacteria | 1482 |
| 393 | Ga0207712_10086580 | 3300025961 | Bacteria | 2295 |
| 394 | Ga0207712_10138647 | 3300025961 | Unclassified | 1863 |
| 395 | Ga0207712_10508016 | 3300025961 | Bacteria | 1031 |
| 396 | Ga0207668_10125344 | 3300025972 | Bacteria | 1952 |
| 397 | Ga0207668_10481189 | 3300025972 | Unclassified | 1065 |
| 398 | Ga0207658_10015751 | 3300025986 | Bacteria | 5191 |
| 399 | Ga0207677_10034933 | 3300026023 | Bacteria | 3260 |
| 400 | Ga0207677_10070270 | 3300026023 | Bacteria | 2467 |
| 401 | Ga0207703_10023663 | 3300026035 | Bacteria | 4830 |
| 402 | Ga0207703_10035090 | 3300026035 | Bacteria | 3985 |
| 403 | Ga0207703_10123775 | 3300026035 | Bacteria | 2223 |
| 404 | Ga0207703_10330691 | 3300026035 | Bacteria | 1398 |
| 405 | Ga0207639_10409940 | 3300026041 | Bacteria | 1223 |
| 406 | Ga0207708_10006725 | 3300026075 | Bacteria | 8505 |
| 407 | Ga0207708_10034853 | 3300026075 | Bacteria | 3829 |
| 408 | Ga0207708_10041274 | 3300026075 | Bacteria | 3517 |
| 409 | Ga0207708_10227457 | 3300026075 | Bacteria | 1496 |
| 410 | Ga0207702_10042141 | 3300026078 | Bacteria | 3829 |
| 411 | Ga0207641_10000874 | 3300026088 | Bacteria | 31545 |
| 412 | Ga0207641_10230548 | 3300026088 | Unclassified | 1721 |
| 413 | Ga0207641_10242143 | 3300026088 | Bacteria | 1681 |
| 414 | Ga0207641_10323540 | 3300026088 | Bacteria | 1463 |
| 415 | Ga0207641_10395264 | 3300026088 | Bacteria | 1326 |
| 416 | Ga0207641_10412655 | 3300026088 | Bacteria | 1299 |
| 417 | Ga0207648_10005825 | 3300026089 | Bacteria | 12341 |
| 418 | Ga0207648_10017841 | 3300026089 | Bacteria | 6441 |
| 419 | Ga0207648_10176945 | 3300026089 | Bacteria | 1887 |
| 420 | Ga0207676_10016713 | 3300026095 | Bacteria | 5313 |
| 421 | Ga0207676_10145700 | 3300026095 | Bacteria | 2034 |
| 422 | Ga0207674_10012913 | 3300026116 | Bacteria | 9315 |
| 423 | Ga0207674_10225293 | 3300026116 | Bacteria | 1823 |
| 424 | Ga0207674_10345810 | 3300026116 | Bacteria | 1438 |
| 425 | Ga0207675_100026496 | 3300026118 | Bacteria | 5397 |
| 426 | Ga0207675_100209493 | 3300026118 | Bacteria | 1874 |
| 427 | Ga0207675_100233121 | 3300026118 | Bacteria | 1777 |
| 428 | Ga0207675_100568234 | 3300026118 | Bacteria | 1135 |
| 429 | Ga0207675_100646857 | 3300026118 | Bacteria | 1063 |
| 430 | Ga0207683_10093400 | 3300026121 | Bacteria | 2681 |
| 431 | Ga0207683_10105498 | 3300026121 | Bacteria | 2519 |
| 432 | Ga0207683_10388268 | 3300026121 | Bacteria | 1283 |
| 433 | Ga0207683_10606568 | 3300026121 | Bacteria | 1013 |
| 434 | Ga0209983_1043645 | 3300027665 | Bacteria | 973 |
| 435 | Ga0209966_1020529 | 3300027695 | Bacteria | 1280 |
| 436 | Ga0207428_10001587 | 3300027907 | Bacteria | 23675 |
| 437 | Ga0207428_10002778 | 3300027907 | Bacteria | 17388 |
| 438 | Ga0207428_10009231 | 3300027907 | Bacteria | 8860 |
| 439 | Ga0207428_10017669 | 3300027907 | Bacteria | 6116 |
| 440 | Ga0207428_10074718 | 3300027907 | Bacteria | 2657 |
| 441 | Ga0207428_10326699 | 3300027907 | Bacteria | 1132 |
| 442 | Ga0268266_10011268 | 3300028379 | Bacteria | 7780 |
| 443 | Ga0268266_10024583 | 3300028379 | Bacteria | 5124 |
| 444 | Ga0268266_10142951 | 3300028379 | Unclassified | 2148 |
| 445 | Ga0268265_10002942 | 3300028380 | Bacteria | 12477 |
| 446 | Ga0268265_10066836 | 3300028380 | Bacteria | 2780 |
| 447 | Ga0268265_10343517 | 3300028380 | Unclassified | 1360 |
| 448 | Ga0268265_10355242 | 3300028380 | Bacteria | 1339 |
| 449 | Ga0268264_10037638 | 3300028381 | Bacteria | 3989 |
| 450 | Ga0268264_10283519 | 3300028381 | Bacteria | 1553 |
| 451 | Ga0268264_10510400 | 3300028381 | Bacteria | 1174 |
| 452 | Ga0307408_100003069 | 3300031548 | Bacteria | 11521 |
| 453 | Ga0307408_100140882 | 3300031548 | Bacteria | 1893 |
| 454 | Ga0265314_10047503 | 3300031711 | Bacteria | 3020 |
| 455 | Ga0307405_10012845 | 3300031731 | Bacteria | 4449 |
| 456 | Ga0307413_10005027 | 3300031824 | Bacteria | 5839 |
| 457 | Ga0307413_10136253 | 3300031824 | Bacteria | 1689 |
| 458 | Ga0307410_10002629 | 3300031852 | Bacteria | 8747 |
| 459 | Ga0307410_10044118 | 3300031852 | Bacteria | 2959 |
| 460 | Ga0307410_10155319 | 3300031852 | Bacteria | 1708 |
| 461 | Ga0307406_10578976 | 3300031901 | Bacteria | 922 |
| 462 | Ga0307407_10023785 | 3300031903 | Bacteria | 3201 |
| 463 | Ga0307407_10095160 | 3300031903 | Bacteria | 1835 |
| 464 | Ga0307412_10019531 | 3300031911 | Bacteria | 4106 |
| 465 | Ga0307409_100017600 | 3300031995 | Bacteria | 4771 |
| 466 | Ga0307409_100023507 | 3300031995 | Bacteria | 4273 |
| 467 | Ga0307409_100045578 | 3300031995 | Bacteria | 3311 |
| 468 | Ga0307416_100003678 | 3300032002 | Bacteria | 9082 |
| 469 | Ga0307416_100012528 | 3300032002 | Bacteria | 5717 |
| 470 | Ga0307416_100103285 | 3300032002 | Bacteria | 2488 |
| 471 | Ga0307416_100763459 | 3300032002 | Bacteria | 1060 |
| 472 | Ga0307411_10030399 | 3300032005 | Bacteria | 3310 |
| 473 | Ga0307411_10056469 | 3300032005 | Bacteria | 2588 |
| 474 | Ga0307411_10155534 | 3300032005 | Bacteria | 1705 |
| 475 | Ga0307411_10302940 | 3300032005 | Bacteria | 1282 |
| 476 | Ga0307415_100004220 | 3300032126 | Bacteria | 7426 |
| 477 | Ga0307415_100055135 | 3300032126 | Bacteria | 2718 |
| 478 | Ga0373923_0212544 | 3300035111 | Unclassified | 897 |
| 479 | Ga0373941_0028270 | 3300035115 | Bacteria | 1645 |
| 480 | Ga0373954_0024502 | 3300035118 | Bacteria | 2752 |
| 481 | Ga0373956_0045445 | 3300035119 | Bacteria | 1960 |
| 482 | Ga0373956_0190113 | 3300035119 | Bacteria | 972 |
| 483 | Ga0373960_0091831 | 3300035121 | Bacteria | 972 |
| 484 | Ga0373955_0088197 | 3300035172 | Bacteria | 1764 |
| 485 | Ga0373935_0285550 | 3300035692 | Bacteria | 1163 |
| 486 | Ga0373933_0236715 | 3300035724 | Bacteria | 1174 |
| 487 | Ga0373947_0080509 | 3300035725 | Unclassified | 2015 |
| 488 | Ga0373937_0034126 | 3300036401 | Bacteria | 4627 |
| 489 | Ga0373937_0150704 | 3300036401 | Bacteria | 2178 |
| 490 | Ga0373937_0237607 | 3300036401 | Bacteria | 1716 |
| 491 | Ga0373937_0543995 | 3300036401 | Bacteria | 1103 |
| 492 | Ga0373925_0156271 | 3300037068 | Unclassified | 1794 |
| 493 | Ga0395905_0887226 | 3300037471 | Bacteria | 795 |
| 494 | Ga0436365_1761119 | 3300039437 | Bacteria | 3100 |
| 495 | Ga0439445_0005286 | 3300042004 | Bacteria | 2941 |
| 496 | Ga0450896_018283 | 3300042133 | Bacteria | 1015 |
| 497 | Ga0439435_0071568 | 3300042436 | Bacteria | 1027 |
| 498 | Ga0439444_0012206 | 3300042437 | Bacteria | 1405 |
| 499 | Ga0451577_0050378 | 3300042876 | Bacteria | 3717 |
| 500 | Ga0466963_0327295 | 3300044694 | Bacteria | 1078 |
| 501 | Ga0451576_0651285 | 3300045051 | Bacteria | 1107 |
| 502 | Ga0495592_0180230 | 3300046454 | Bacteria | 1439 |
| 503 | Ga0495592_0285344 | 3300046454 | Bacteria | 1078 |
| 504 | Ga0495592_0405176 | 3300046454 | Bacteria | 863 |
| 505 | Ga0495629_0144155 | 3300046459 | Bacteria | 1657 |
| 506 | Ga0495629_0268602 | 3300046459 | Unclassified | 1172 |
| 507 | Ga0495638_0012596 | 3300046460 | Bacteria | 5788 |
| 508 | Ga0495580_0113936 | 3300046472 | Bacteria | 1878 |
| 509 | Ga0495582_0143344 | 3300046473 | Bacteria | 1355 |
| 510 | Ga0495582_0330502 | 3300046473 | Bacteria | 877 |
| 511 | Ga0495639_0017082 | 3300046475 | Bacteria | 3151 |
| 512 | Ga0495608_0004495 | 3300046511 | Bacteria | 9957 |
| 513 | Ga0495618_0037993 | 3300046514 | Bacteria | 3025 |
| 514 | Ga0495618_0274435 | 3300046514 | Bacteria | 1053 |
| 515 | Ga0495628_0111838 | 3300046516 | Bacteria | 2100 |
| 516 | Ga0495630_0001930 | 3300046517 | Bacteria | 14456 |
| 517 | Ga0495640_0093916 | 3300046533 | Bacteria | 1976 |
| 518 | Ga0495640_0217234 | 3300046533 | Unclassified | 1207 |
| 519 | Ga0495587_0091826 | 3300046536 | Bacteria | 1753 |
| 520 | Ga0495621_0054270 | 3300046539 | Bacteria | 1440 |
| 521 | Ga0495645_0005546 | 3300046543 | Bacteria | 8678 |
| 522 | Ga0495645_0036348 | 3300046543 | Bacteria | 3590 |
| 523 | Ga0495645_0065833 | 3300046543 | Bacteria | 2621 |
| 524 | Ga0495667_0226272 | 3300046559 | Bacteria | 1193 |
| 525 | Ga0495656_0019720 | 3300046615 | Bacteria | 2606 |
| 526 | Ga0495634_0211363 | 3300046642 | Unclassified | 1201 |
| 527 | Ga0495635_0227618 | 3300046663 | Bacteria | 1260 |
| 528 | Ga0495659_0059484 | 3300046664 | Bacteria | 1408 |
| 529 | Ga0495659_0117336 | 3300046664 | Bacteria | 1044 |
| 530 | Ga0495599_0033717 | 3300046678 | Bacteria | 3218 |
| 531 | Ga0495646_0274091 | 3300046680 | Bacteria | 898 |
| 532 | Ga0495647_0098923 | 3300046681 | Unclassified | 1206 |
| 533 | Ga0495658_0081177 | 3300046683 | Bacteria | 1903 |
| 534 | Ga0495658_0087196 | 3300046683 | Bacteria | 1843 |
| 535 | Ga0495658_0099743 | 3300046683 | Bacteria | 1732 |
| 536 | Ga0495669_0062038 | 3300046684 | Bacteria | 1693 |
| 537 | Ga0495613_0001961 | 3300046689 | Bacteria | 15620 |
| 538 | Ga0495600_0112261 | 3300046809 | Bacteria | 1775 |
| 539 | Ga0495581_0133480 | 3300047315 | Bacteria | 1447 |
| 540 | Ga0495674_0009533 | 3300047319 | Bacteria | 9220 |
| 541 | Ga0495674_0098068 | 3300047319 | Bacteria | 2496 |
| 542 | Ga0495674_0355281 | 3300047319 | Bacteria | 1189 |
| 543 | Ga0495672_0316726 | 3300047320 | Bacteria | 734 |
| 544 | Ga0495680_0111683 | 3300047322 | Bacteria | 2025 |
| 545 | Ga0495680_0174893 | 3300047322 | Unclassified | 1553 |
| 546 | Ga0495684_0000706 | 3300047471 | Bacteria | 26822 |
| 547 | Ga0495684_0171790 | 3300047471 | Unclassified | 1612 |
| 548 | Ga0496101_0192788 | 3300048904 | Bacteria | 1573 |
| 549 | Ga0496102_0573908 | 3300048905 | Unclassified | 1051 |
| 550 | Ga0496104_0001736 | 3300048907 | Bacteria | 18816 |
| 551 | Ga0496104_0015490 | 3300048907 | Bacteria | 6904 |
| 552 | Ga0496104_0090266 | 3300048907 | Bacteria | 2928 |
| 553 | Ga0496105_0043932 | 3300048908 | Bacteria | 3685 |
| 554 | Ga0496105_0084627 | 3300048908 | Bacteria | 2620 |
| 555 | Ga0496105_0148553 | 3300048908 | Bacteria | 1927 |
| 556 | Ga0496106_0290803 | 3300048909 | Bacteria | 1310 |
| 557 | Ga0496107_0128451 | 3300048910 | Unclassified | 1870 |
| 558 | Ga0496107_0483186 | 3300048910 | Bacteria | 919 |
| 559 | Ga0496108_0001282 | 3300048911 | Bacteria | 19690 |
| 560 | Ga0496108_0017260 | 3300048911 | Bacteria | 5904 |
| 561 | Ga0496108_0024219 | 3300048911 | Bacteria | 4998 |
| 562 | Ga0496109_0000572 | 3300048912 | Bacteria | 30775 |
| 563 | Ga0496110_0004885 | 3300048913 | Bacteria | 10459 |
| 564 | Ga0496111_0052625 | 3300048914 | Bacteria | 2940 |
| 565 | Ga0496112_0000217 | 3300048915 | Bacteria | 37074 |
| 566 | Ga0496112_0073309 | 3300048915 | Bacteria | 3384 |
| 567 | Ga0496112_0125946 | 3300048915 | Bacteria | 2532 |
| 568 | Ga0496112_0160133 | 3300048915 | Bacteria | 2217 |
| 569 | Ga0496113_0635890 | 3300048916 | Bacteria | 854 |
| 570 | Ga0496114_0009455 | 3300048917 | Bacteria | 7737 |
| 571 | Ga0496114_0011512 | 3300048917 | Bacteria | 7070 |
| 572 | Ga0496114_0139250 | 3300048917 | Bacteria | 2100 |
| 573 | Ga0496114_0173708 | 3300048917 | Bacteria | 1879 |
| 574 | Ga0496114_0288846 | 3300048917 | Bacteria | 1447 |
| 575 | Ga0496114_0305030 | 3300048917 | Bacteria | 1406 |
| 576 | Ga0496115_0419542 | 3300048918 | Bacteria | 1084 |
| 577 | Ga0501299_012749 | 3300049522 | Bacteria | 1440 |
| 578 | Ga0501031_0541451 | 3300049568 | Bacteria | 750 |
| 579 | Ga0501033_0222196 | 3300049570 | Bacteria | 1344 |
| 580 | Ga0501034_0006269 | 3300049571 | Bacteria | 12796 |
| 581 | Ga0501034_0084636 | 3300049571 | Bacteria | 3173 |
| 582 | Ga0501036_0010569 | 3300049572 | Bacteria | 7626 |
| 583 | Ga0501036_0022140 | 3300049572 | Bacteria | 5346 |
| 584 | Ga0501036_0078021 | 3300049572 | Bacteria | 2802 |
| 585 | Ga0501036_0212555 | 3300049572 | Bacteria | 1625 |
| 586 | Ga0501036_0366776 | 3300049572 | Bacteria | 1202 |
| 587 | Ga0501038_0024753 | 3300049574 | Bacteria | 5351 |
| 588 | Ga0501038_0187283 | 3300049574 | Bacteria | 1667 |
| 589 | Ga0501039_0007645 | 3300049575 | Bacteria | 8251 |
| 590 | Ga0501039_0107254 | 3300049575 | Bacteria | 2182 |
| 591 | Ga0501039_0258759 | 3300049575 | Bacteria | 1368 |
| 592 | Ga0501039_0716506 | 3300049575 | Unclassified | 782 |
| 593 | Ga0501040_0030417 | 3300049576 | Bacteria | 3647 |
| 594 | Ga0501040_0033282 | 3300049576 | Unclassified | 3491 |
| 595 | Ga0501040_0184162 | 3300049576 | Unclassified | 1481 |
| 596 | Ga0501040_0283175 | 3300049576 | Bacteria | 1184 |
| 597 | Ga0501040_0476603 | 3300049576 | Bacteria | 899 |
| 598 | Ga0501041_0033256 | 3300049577 | Unclassified | 3119 |
| 599 | Ga0501042_0006369 | 3300049578 | Bacteria | 7652 |
| 600 | Ga0501042_0008326 | 3300049578 | Bacteria | 6837 |
| 601 | Ga0501042_0009658 | 3300049578 | Bacteria | 6442 |
| 602 | Ga0501043_0145217 | 3300049579 | Bacteria | 1858 |
| 603 | Ga0501043_0312872 | 3300049579 | Bacteria | 1198 |
| 604 | Ga0501046_0005903 | 3300049580 | Bacteria | 10911 |
| 605 | Ga0501046_0029504 | 3300049580 | Unclassified | 4459 |
| 606 | Ga0501046_0165786 | 3300049580 | Unclassified | 1660 |
| 607 | Ga0501047_0029457 | 3300049581 | Bacteria | 5293 |
| 608 | Ga0501048_0063705 | 3300049582 | Bacteria | 2607 |
| 609 | Ga0501048_0128729 | 3300049582 | Bacteria | 1790 |
| 610 | Ga0501068_0086409 | 3300049584 | Bacteria | 1931 |
| 611 | Ga0501071_0015337 | 3300049587 | Bacteria | 5259 |
| 612 | Ga0501071_0125959 | 3300049587 | Bacteria | 1901 |
| 613 | Ga0501071_0172943 | 3300049587 | Bacteria | 1617 |
| 614 | Ga0501071_0514774 | 3300049587 | Bacteria | 918 |
| 615 | Ga0501072_0006046 | 3300049588 | Bacteria | 9235 |
| 616 | Ga0501072_0020504 | 3300049588 | Bacteria | 5123 |
| 617 | Ga0501072_0064809 | 3300049588 | Unclassified | 2881 |
| 618 | Ga0501072_0102220 | 3300049588 | Bacteria | 2278 |
| 619 | Ga0501073_0093489 | 3300049589 | Bacteria | 2089 |
| 620 | Ga0501073_0175769 | 3300049589 | Bacteria | 1482 |
| 621 | Ga0501074_0060883 | 3300049590 | Unclassified | 2720 |
| 622 | Ga0501074_0078777 | 3300049590 | Unclassified | 2365 |
| 623 | Ga0501075_0002228 | 3300049591 | Bacteria | 12848 |
| 624 | Ga0501075_0093886 | 3300049591 | Unclassified | 2277 |
| 625 | Ga0501076_0010605 | 3300049592 | Bacteria | 6842 |
| 626 | Ga0501076_0020279 | 3300049592 | Bacteria | 5087 |
| 627 | Ga0501076_0052101 | 3300049592 | Bacteria | 3241 |
| 628 | Ga0501076_0301845 | 3300049592 | Bacteria | 1313 |
| 629 | Ga0501077_0127506 | 3300049593 | Bacteria | 1613 |
| 630 | Ga0501079_0002242 | 3300049741 | Bacteria | 13955 |
| 631 | Ga0501079_0003457 | 3300049741 | Bacteria | 11606 |
| 632 | Ga0501079_0050995 | 3300049741 | Bacteria | 3194 |
| 633 | Ga0501079_0086679 | 3300049741 | Unclassified | 2424 |
| 634 | Ga0501079_0443393 | 3300049741 | Bacteria | 1019 |
| 635 | Ga0501080_0029168 | 3300049742 | Bacteria | 5137 |
| 636 | Ga0501080_0096892 | 3300049742 | Unclassified | 2739 |
| 637 | Ga0501081_0001120 | 3300049743 | Bacteria | 16126 |
| 638 | Ga0501081_0006124 | 3300049743 | Bacteria | 7796 |
| 639 | Ga0501081_0014867 | 3300049743 | Bacteria | 5135 |
| 640 | Ga0501081_0078720 | 3300049743 | Bacteria | 2305 |
| 641 | Ga0501081_0175645 | 3300049743 | Unclassified | 1548 |
| 642 | Ga0501083_0147228 | 3300049744 | Bacteria | 1542 |
| 643 | Ga0501283_007915 | 3300049779 | Bacteria | 1522 |
| 644 | Ga0501035_0280331 | 3300049822 | Bacteria | 1409 |
| 645 | Ga0501044_0001331 | 3300049823 | Bacteria | 29040 |
| 646 | Ga0501045_0003086 | 3300049824 | Bacteria | 11386 |
| 647 | Ga0501045_0158363 | 3300049824 | Bacteria | 1685 |
| 648 | nmdc:mga05p37_101049_c1 | 3300050507 | Bacteria | 2131 |
| 649 | nmdc:mga05p37_147_c1 | 3300050507 | Bacteria | 66379 |
| 650 | nmdc:mga05p37_184987_c1 | 3300050507 | Bacteria | 2533 |
| 651 | nmdc:mga05p37_19809_c1 | 3300050507 | Bacteria | 8140 |
| 652 | nmdc:mga05p37_23544_c1 | 3300050507 | Bacteria | 7472 |
| 653 | nmdc:mga05p37_236015_c1 | 3300050507 | Bacteria | 2201 |
| 654 | nmdc:mga05p37_25178_c1 | 3300050507 | Bacteria | 7236 |
| 655 | nmdc:mga05p37_263070_c1 | 3300050507 | Bacteria | 2064 |
| 656 | nmdc:mga05p37_29369_c1 | 3300050507 | Bacteria | 6710 |
| 657 | nmdc:mga05p37_32697_c1 | 3300050507 | Bacteria | 6364 |
| 658 | nmdc:mga05p37_38271_c1 | 3300050507 | Bacteria | 5883 |
| 659 | nmdc:mga05p37_406621_c1 | 3300050507 | Bacteria | 1588 |
| 660 | nmdc:mga05p37_439744_c1 | 3300050507 | Bacteria | 1513 |
| 661 | nmdc:mga05p37_56245_c1 | 3300050507 | Bacteria | 4843 |
| 662 | nmdc:mga05p37_66288_c2 | 3300050507 | Bacteria | 3612 |
| 663 | nmdc:mga05p37_96537_c1 | 3300050507 | Bacteria | 3641 |
| 664 | nmdc:mga09592_119792_c1 | 3300050508 | Bacteria | 2260 |
| 665 | nmdc:mga09592_13838_c1 | 3300050508 | Bacteria | 6592 |
| 666 | nmdc:mga09592_169873_c1 | 3300050508 | Bacteria | 1885 |
| 667 | nmdc:mga09592_194387_c1 | 3300050508 | Bacteria | 1756 |
| 668 | nmdc:mga09592_273161_c1 | 3300050508 | Bacteria | 1466 |
| 669 | nmdc:mga09592_275333_c1 | 3300050508 | Unclassified | 1460 |
| 670 | nmdc:mga09592_55909_c1 | 3300050508 | Bacteria | 3335 |
| 671 | nmdc:mga0qj67_212115_c1 | 3300050509 | Bacteria | 1573 |
| 672 | nmdc:mga0qj67_330959_c1 | 3300050509 | Bacteria | 1232 |
| 673 | nmdc:mga0qj67_41255_c1 | 3300050509 | Bacteria | 3629 |
| 674 | nmdc:mga0qj67_62513_c1 | 3300050509 | Unclassified | 2959 |
| 675 | nmdc:mga0qj67_67328_c1 | 3300050509 | Bacteria | 2853 |
| 676 | nmdc:mga06r32_166886_c1 | 3300050510 | Bacteria | 2185 |
| 677 | nmdc:mga06r32_290387_c1 | 3300050510 | Bacteria | 1622 |
| 678 | nmdc:mga06r32_37159_c1 | 3300050510 | Bacteria | 4606 |
| 679 | nmdc:mga06r32_61562_c1 | 3300050510 | Bacteria | 3613 |
| 680 | nmdc:mga06r32_635240_c1 | 3300050510 | Bacteria | 1037 |
| 681 | nmdc:mga06r32_68021_c1 | 3300050510 | Bacteria | 3440 |
| 682 | nmdc:mga06r32_923498_c1 | 3300050510 | Bacteria | 828 |
| 683 | nmdc:mga06r32_9806_c1 | 3300050510 | Bacteria | 8641 |
| 684 | nmdc:mga08y16_10005_c1 | 3300050511 | Bacteria | 9951 |
| 685 | nmdc:mga08y16_1311_c1 | 3300050511 | Bacteria | 24756 |
| 686 | nmdc:mga08y16_13505_c1 | 3300050511 | Bacteria | 8593 |
| 687 | nmdc:mga08y16_17989_c1 | 3300050511 | Bacteria | 7444 |
| 688 | nmdc:mga08y16_259387_c1 | 3300050511 | Unclassified | 1795 |
| 689 | nmdc:mga08y16_46638_c1 | 3300050511 | Bacteria | 4537 |
| 690 | nmdc:mga08y16_54506_c1 | 3300050511 | Bacteria | 4178 |
| 691 | nmdc:mga08y16_6338_c1 | 3300050511 | Bacteria | 12410 |
| 692 | nmdc:mga0n895_1546_c1 | 3300050512 | Bacteria | 17272 |
| 693 | nmdc:mga0n895_16945_c1 | 3300050512 | Bacteria | 6702 |
| 694 | nmdc:mga0n895_18893_c1 | 3300050512 | Bacteria | 6391 |
| 695 | nmdc:mga0n895_20068_c1 | 3300050512 | Bacteria | 6223 |
| 696 | nmdc:mga0n895_25177_c1 | 3300050512 | Bacteria | 5619 |
| 697 | nmdc:mga0n895_293502_c1 | 3300050512 | Bacteria | 1648 |
| 698 | nmdc:mga0n895_389765_c1 | 3300050512 | Bacteria | 1409 |
| 699 | nmdc:mga0n895_409903_c1 | 3300050512 | Unclassified | 1370 |
| 700 | nmdc:mga0n895_49412_c1 | 3300050512 | Bacteria | 4120 |
| 701 | nmdc:mga0n895_6302_c1 | 3300050512 | Bacteria | 10060 |
| 702 | nmdc:mga0rr50_269_c1 | 3300050513 | Bacteria | 28252 |
| 703 | nmdc:mga0rr50_28813_c1 | 3300050513 | Bacteria | 3908 |
| 704 | nmdc:mga0rr50_8_c1 | 3300050513 | Bacteria | 271775 |
| 705 | nmdc:mga08x19_11357_c1 | 3300050514 | Bacteria | 5362 |
| 706 | nmdc:mga08x19_137813_c1 | 3300050514 | Bacteria | 1646 |
| 707 | nmdc:mga08x19_186080_c1 | 3300050514 | Bacteria | 1419 |
| 708 | nmdc:mga08x19_284359_c1 | 3300050514 | Bacteria | 1147 |
| 709 | nmdc:mga08x19_72231_c1 | 3300050514 | Bacteria | 2251 |
| 710 | nmdc:mga08x19_98098_c1 | 3300050514 | Bacteria | 1941 |
| 711 | nmdc:mga0a205_139575_c1 | 3300050515 | Bacteria | 2324 |
| 712 | nmdc:mga0a205_168886_c1 | 3300050515 | Unclassified | 2083 |
| 713 | nmdc:mga0a205_263565_c1 | 3300050515 | Bacteria | 1601 |
| 714 | nmdc:mga0a205_3043_c1 | 3300050515 | Bacteria | 11795 |
| 715 | nmdc:mga0a205_45515_c1 | 3300050515 | Bacteria | 4231 |
| 716 | nmdc:mga0a205_86586_c1 | 3300050515 | Bacteria | 3026 |
| 717 | Ga0495601_0011013 | 3300053077 | Bacteria | 5403 |
| 718 | Ga0495601_0016458 | 3300053077 | Bacteria | 4481 |
| 719 | Ga0495601_0167382 | 3300053077 | Bacteria | 1436 |
| 720 | Ga0495601_0287397 | 3300053077 | Bacteria | 1072 |
| 721 | Ga0495655_0084016 | 3300053083 | Unclassified | 916 |
| 722 | Ga0495595_0004955 | 3300053084 | Bacteria | 5370 |
| 723 | Ga0495619_0001998 | 3300053085 | Bacteria | 13574 |
| 724 | Ga0495619_0019632 | 3300053085 | Bacteria | 4298 |
| 725 | Ga0495619_0020723 | 3300053085 | Bacteria | 4192 |
| 726 | Ga0495619_0108077 | 3300053085 | Bacteria | 1898 |
| 727 | Ga0500641_0004710 | 3300053096 | Bacteria | 4821 |
| 728 | Ga0501084_0001942 | 3300054114 | Bacteria | 16511 |
| 729 | Ga0501084_0005447 | 3300054114 | Bacteria | 10438 |
| 730 | Ga0501084_0386222 | 3300054114 | Bacteria | 1183 |
| 731 | Ga0590071_000059 | 3300059421 | Bacteria | 29361 |
| 732 | Ga0590071_005255 | 3300059421 | Bacteria | 3121 |
| 733 | Ga0590074_000705 | 3300059423 | Bacteria | 5095 |
| 734 | Ga0590075_000234 | 3300059424 | Bacteria | 15531 |
| 735 | Ga0590077_000247 | 3300059426 | Bacteria | 15383 |
| 736 | Ga0590077_008969 | 3300059426 | Bacteria | 2047 |
| 737 | Ga0501082_0000835 | 3300060353 | Bacteria | 27110 |
| 738 | Ga0501082_0084198 | 3300060353 | Bacteria | 2743 |
| 739 | Ga0501082_0249576 | 3300060353 | Bacteria | 1544 |
| 740 | Ga0530510_0002033 | 3300061734 | Bacteria | 13901 |
| 741 | Ga0530510_0010913 | 3300061734 | Bacteria | 6373 |
| 742 | Ga0530510_0052050 | 3300061734 | Bacteria | 2959 |
| 743 | Ga0530510_0062494 | 3300061734 | Unclassified | 2696 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025932 | Ga0207690_10261065 | Ga0207690_102610652 | 200 |
| 2 | 3300049575 | Ga0501039_0716506 | Ga0501039_0716506_84_764 | 201 |
| 3 | 3300027695 | Ga0209966_1020529 | Ga0209966_10205292 | 204 |
| 4 | 3300049522 | Ga0501299_012749 | Ga0501299_012749_521_1309 | 204 |
| 5 | 3300049568 | Ga0501031_0541451 | Ga0501031_0541451_18_701 | 209 |
| 6 | 3300053077 | Ga0495601_0287397 | Ga0495601_0287397_43_765 | 210 |
| 7 | 3300046681 | Ga0495647_0098923 | Ga0495647_0098923_162_989 | 215 |
| 8 | 3300047320 | Ga0495672_0316726 | Ga0495672_0316726_30_716 | 215 |
| 9 | 3300026121 | Ga0207683_10388268 | Ga0207683_103882682 | 216 |
| 10 | 3300049587 | Ga0501071_0514774 | Ga0501071_0514774_186_893 | 216 |
| 11 | 3300005331 | Ga0070670_100003221 | Ga0070670_1000032217 | 217 |
| 12 | 3300005577 | Ga0068857_100005431 | Ga0068857_1000054317 | 217 |
| 13 | 3300009553 | Ga0105249_10726042 | Ga0105249_107260422 | 217 |
| 14 | 3300014326 | Ga0157380_10034652 | Ga0157380_100346522 | 217 |
| 15 | 3300025925 | Ga0207650_10043796 | Ga0207650_100437965 | 217 |
| 16 | 3300026116 | Ga0207674_10012913 | Ga0207674_100129132 | 217 |
| 17 | 3300028380 | Ga0268265_10343517 | Ga0268265_103435171 | 217 |
| 18 | 3300031995 | Ga0307409_100017600 | Ga0307409_1000176006 | 217 |
| 19 | 3300032002 | Ga0307416_100003678 | Ga0307416_1000036785 | 217 |
| 20 | 3300032002 | Ga0307416_100103285 | Ga0307416_1001032852 | 217 |
| 21 | 3300032005 | Ga0307411_10302940 | Ga0307411_103029402 | 217 |
| 22 | 3300032126 | Ga0307415_100055135 | Ga0307415_1000551352 | 217 |
| 23 | 3300042133 | Ga0450896_018283 | Ga0450896_018283_160_984 | 217 |
| 24 | 3300042436 | Ga0439435_0071568 | Ga0439435_0071568_103_927 | 217 |
| 25 | 3300049779 | Ga0501283_007915 | Ga0501283_007915_599_1426 | 217 |
| 26 | 3300005543 | Ga0070672_100011885 | Ga0070672_1000118852 | 218 |
| 27 | 3300006852 | Ga0075433_10008654 | Ga0075433_100086542 | 218 |
| 28 | 3300006871 | Ga0075434_100008966 | Ga0075434_1000089665 | 218 |
| 29 | 3300006914 | Ga0075436_100009574 | Ga0075436_1000095743 | 218 |
| 30 | 3300007076 | Ga0075435_100004221 | Ga0075435_1000042212 | 218 |
| 31 | 3300025920 | Ga0207649_10241249 | Ga0207649_102412492 | 218 |
| 32 | 3300025945 | Ga0207679_10122786 | Ga0207679_101227862 | 218 |
| 33 | 3300026121 | Ga0207683_10606568 | Ga0207683_106065681 | 218 |
| 34 | 3300050514 | nmdc:mga08x19_137813_c1 | nmdc:mga08x19_137813_c1_194_1030 | 218 |
| 35 | 3300050515 | nmdc:mga0a205_86586_c1 | nmdc:mga0a205_86586_c1_538_1377 | 218 |
| 36 | 3300009098 | Ga0105245_10679886 | Ga0105245_106798861 | 219 |
| 37 | 3300025936 | Ga0207670_10260658 | Ga0207670_102606582 | 219 |
| 38 | 3300050508 | nmdc:mga09592_119792_c1 | nmdc:mga09592_119792_c1_50_802 | 219 |
| 39 | 3300053096 | Ga0500641_0004710 | Ga0500641_0004710_1705_2481 | 219 |
| 40 | 3300005295 | Ga0065707_10102536 | Ga0065707_101025364 | 220 |
| 41 | 3300005353 | Ga0070669_100000133 | Ga0070669_10000013334 | 220 |
| 42 | 3300005353 | Ga0070669_100174654 | Ga0070669_1001746542 | 220 |
| 43 | 3300005354 | Ga0070675_100112217 | Ga0070675_1001122171 | 220 |
| 44 | 3300005549 | Ga0070704_100435765 | Ga0070704_1004357651 | 220 |
| 45 | 3300005564 | Ga0070664_100193954 | Ga0070664_1001939542 | 220 |
| 46 | 3300005844 | Ga0068862_100022777 | Ga0068862_1000227772 | 220 |
| 47 | 3300006844 | Ga0075428_100011036 | Ga0075428_1000110365 | 220 |
| 48 | 3300009094 | Ga0111539_10000859 | Ga0111539_100008598 | 220 |
| 49 | 3300009553 | Ga0105249_10009355 | Ga0105249_100093556 | 220 |
| 50 | 3300013306 | Ga0163162_10228405 | Ga0163162_102284053 | 220 |
| 51 | 3300014745 | Ga0157377_10083411 | Ga0157377_100834112 | 220 |
| 52 | 3300025901 | Ga0207688_10061123 | Ga0207688_100611234 | 220 |
| 53 | 3300025923 | Ga0207681_10005004 | Ga0207681_100050042 | 220 |
| 54 | 3300025940 | Ga0207691_10148359 | Ga0207691_101483592 | 220 |
| 55 | 3300025945 | Ga0207679_10295590 | Ga0207679_102955902 | 220 |
| 56 | 3300025961 | Ga0207712_10086580 | Ga0207712_100865802 | 220 |
| 57 | 3300026075 | Ga0207708_10034853 | Ga0207708_100348532 | 220 |
| 58 | 3300026116 | Ga0207674_10225293 | Ga0207674_102252932 | 220 |
| 59 | 3300027907 | Ga0207428_10017669 | Ga0207428_100176692 | 220 |
| 60 | 3300028380 | Ga0268265_10066836 | Ga0268265_100668362 | 220 |
| 61 | 3300050508 | nmdc:mga09592_275333_c1 | nmdc:mga09592_275333_c1_372_1193 | 220 |
| 62 | 3300050511 | nmdc:mga08y16_46638_c1 | nmdc:mga08y16_46638_c1_1560_2381 | 220 |
| 63 | 3300005458 | Ga0070681_10018543 | Ga0070681_100185433 | 221 |
| 64 | 3300009094 | Ga0111539_10082634 | Ga0111539_100826342 | 221 |
| 65 | 3300014326 | Ga0157380_10079759 | Ga0157380_100797591 | 221 |
| 66 | 3300031711 | Ga0265314_10047503 | Ga0265314_100475034 | 221 |
| 67 | 3300037471 | Ga0395905_0887226 | Ga0395905_0887226_44_778 | 221 |
| 68 | 3300050511 | nmdc:mga08y16_13505_c1 | nmdc:mga08y16_13505_c1_2170_2940 | 221 |
| 69 | 3300009147 | Ga0114129_10302602 | Ga0114129_103026021 | 222 |
| 70 | 3300031824 | Ga0307413_10136253 | Ga0307413_101362532 | 222 |
| 71 | 3300031852 | Ga0307410_10002629 | Ga0307410_100026299 | 222 |
| 72 | 3300031903 | Ga0307407_10023785 | Ga0307407_100237853 | 222 |
| 73 | 3300031995 | Ga0307409_100045578 | Ga0307409_1000455782 | 222 |
| 74 | 3300032005 | Ga0307411_10155534 | Ga0307411_101555342 | 222 |
| 75 | 3300045051 | Ga0451576_0651285 | Ga0451576_0651285_40_777 | 222 |
| 76 | 3300049741 | Ga0501079_0443393 | Ga0501079_0443393_67_903 | 222 |
| 77 | 3300049743 | Ga0501081_0078720 | Ga0501081_0078720_553_1389 | 222 |
| 78 | 3300050507 | nmdc:mga05p37_101049_c1 | nmdc:mga05p37_101049_c1_1342_2082 | 222 |
| 79 | 3300050510 | nmdc:mga06r32_37159_c1 | nmdc:mga06r32_37159_c1_20_793 | 222 |
| 80 | 3300005445 | Ga0070708_100059068 | Ga0070708_1000590681 | 223 |
| 81 | 3300009147 | Ga0114129_10003691 | Ga0114129_1000369123 | 223 |
| 82 | 3300046516 | Ga0495628_0111838 | Ga0495628_0111838_708_1457 | 223 |
| 83 | 3300050507 | nmdc:mga05p37_38271_c1 | nmdc:mga05p37_38271_c1_2668_3465 | 223 |
| 84 | 3300053085 | Ga0495619_0020723 | Ga0495619_0020723_2438_3187 | 223 |
| 85 | 3300005459 | Ga0068867_100255688 | Ga0068867_1002556882 | 224 |
| 86 | 3300005468 | Ga0070707_100155083 | Ga0070707_1001550832 | 224 |
| 87 | 3300005536 | Ga0070697_100647031 | Ga0070697_1006470311 | 224 |
| 88 | 3300006844 | Ga0075428_100002186 | Ga0075428_1000021866 | 224 |
| 89 | 3300006847 | Ga0075431_100191920 | Ga0075431_1001919202 | 224 |
| 90 | 3300006880 | Ga0075429_100036803 | Ga0075429_1000368032 | 224 |
| 91 | 3300009147 | Ga0114129_10032450 | Ga0114129_100324502 | 224 |
| 92 | 3300025925 | Ga0207650_10094237 | Ga0207650_100942371 | 224 |
| 93 | 3300050507 | nmdc:mga05p37_66288_c2 | nmdc:mga05p37_66288_c2_2672_3496 | 224 |
| 94 | 3300050508 | nmdc:mga09592_13838_c1 | nmdc:mga09592_13838_c1_3417_4241 | 224 |
| 95 | 3300050510 | nmdc:mga06r32_68021_c1 | nmdc:mga06r32_68021_c1_1666_2490 | 224 |
| 96 | 3300005354 | Ga0070675_100010814 | Ga0070675_1000108143 | 225 |
| 97 | 3300006844 | Ga0075428_100505090 | Ga0075428_1005050902 | 225 |
| 98 | 3300009147 | Ga0114129_10039491 | Ga0114129_100394912 | 225 |
| 99 | 3300009177 | Ga0105248_10143775 | Ga0105248_101437751 | 225 |
| 100 | 3300025923 | Ga0207681_10066405 | Ga0207681_100664052 | 225 |
| 101 | 3300025926 | Ga0207659_10083328 | Ga0207659_100833284 | 225 |
| 102 | 3300025937 | Ga0207669_10006658 | Ga0207669_100066586 | 225 |
| 103 | 3300026088 | Ga0207641_10412655 | Ga0207641_104126551 | 225 |
| 104 | 3300026121 | Ga0207683_10105498 | Ga0207683_101054982 | 225 |
| 105 | 3300027907 | Ga0207428_10074718 | Ga0207428_100747182 | 225 |
| 106 | 3300031852 | Ga0307410_10155319 | Ga0307410_101553192 | 225 |
| 107 | 3300046454 | Ga0495592_0405176 | Ga0495592_0405176_67_816 | 225 |
| 108 | 3300049576 | Ga0501040_0283175 | Ga0501040_0283175_302_1120 | 225 |
| 109 | 3300050510 | nmdc:mga06r32_923498_c1 | nmdc:mga06r32_923498_c1_13_744 | 226 |
| 110 | 3300053084 | Ga0495595_0004955 | Ga0495595_0004955_3159_3953 | 226 |
| 111 | 3300053085 | Ga0495619_0019632 | Ga0495619_0019632_1083_1877 | 226 |
| 112 | 3300009147 | Ga0114129_10356105 | Ga0114129_103561052 | 227 |
| 113 | 3300049571 | Ga0501034_0006269 | Ga0501034_0006269_10534_11343 | 227 |
| 114 | 3300049572 | Ga0501036_0366776 | Ga0501036_0366776_358_1167 | 227 |
| 115 | 3300049579 | Ga0501043_0145217 | Ga0501043_0145217_850_1659 | 227 |
| 116 | 3300049581 | Ga0501047_0029457 | Ga0501047_0029457_1559_2368 | 227 |
| 117 | 3300049823 | Ga0501044_0001331 | Ga0501044_0001331_22566_23375 | 227 |
| 118 | 3300053077 | Ga0495601_0016458 | Ga0495601_0016458_3698_4456 | 227 |
| 119 | 3300005290 | Ga0065712_10074717 | Ga0065712_100747172 | 228 |
| 120 | 3300005344 | Ga0070661_100019679 | Ga0070661_1000196796 | 228 |
| 121 | 3300005406 | Ga0070703_10019261 | Ga0070703_100192613 | 228 |
| 122 | 3300005549 | Ga0070704_100068140 | Ga0070704_1000681402 | 228 |
| 123 | 3300005564 | Ga0070664_100000055 | Ga0070664_10000005557 | 228 |
| 124 | 3300009147 | Ga0114129_10107306 | Ga0114129_101073065 | 228 |
| 125 | 3300025885 | Ga0207653_10031741 | Ga0207653_100317412 | 228 |
| 126 | 3300025920 | Ga0207649_10011364 | Ga0207649_100113643 | 228 |
| 127 | 3300025925 | Ga0207650_10006970 | Ga0207650_100069706 | 228 |
| 128 | 3300025940 | Ga0207691_10088955 | Ga0207691_100889553 | 228 |
| 129 | 3300025944 | Ga0207661_10001501 | Ga0207661_100015016 | 228 |
| 130 | 3300025945 | Ga0207679_10001458 | Ga0207679_100014587 | 228 |
| 131 | 3300042004 | Ga0439445_0005286 | Ga0439445_0005286_429_1199 | 228 |
| 132 | 3300050507 | nmdc:mga05p37_29369_c1 | nmdc:mga05p37_29369_c1_2523_3281 | 228 |
| 133 | 3300050508 | nmdc:mga09592_194387_c1 | nmdc:mga09592_194387_c1_320_1078 | 228 |
| 134 | 3300050515 | nmdc:mga0a205_263565_c1 | nmdc:mga0a205_263565_c1_315_1073 | 228 |
| 135 | 3300005844 | Ga0068862_100473276 | Ga0068862_1004732762 | 229 |
| 136 | 3300025901 | Ga0207688_10079821 | Ga0207688_100798212 | 229 |
| 137 | 3300025972 | Ga0207668_10481189 | Ga0207668_104811892 | 229 |
| 138 | 3300035111 | Ga0373923_0212544 | Ga0373923_0212544_100_867 | 229 |
| 139 | 3300036401 | Ga0373937_0543995 | Ga0373937_0543995_150_917 | 229 |
| 140 | 3300046454 | Ga0495592_0180230 | Ga0495592_0180230_277_1044 | 229 |
| 141 | 3300046459 | Ga0495629_0144155 | Ga0495629_0144155_563_1330 | 229 |
| 142 | 3300046472 | Ga0495580_0113936 | Ga0495580_0113936_766_1533 | 229 |
| 143 | 3300046473 | Ga0495582_0143344 | Ga0495582_0143344_115_951 | 229 |
| 144 | 3300046511 | Ga0495608_0004495 | Ga0495608_0004495_8571_9338 | 229 |
| 145 | 3300046514 | Ga0495618_0037993 | Ga0495618_0037993_201_968 | 229 |
| 146 | 3300046517 | Ga0495630_0001930 | Ga0495630_0001930_9567_10334 | 229 |
| 147 | 3300046533 | Ga0495640_0093916 | Ga0495640_0093916_1175_1942 | 229 |
| 148 | 3300046543 | Ga0495645_0065833 | Ga0495645_0065833_472_1239 | 229 |
| 149 | 3300046642 | Ga0495634_0211363 | Ga0495634_0211363_372_1175 | 229 |
| 150 | 3300046678 | Ga0495599_0033717 | Ga0495599_0033717_1508_2275 | 229 |
| 151 | 3300046683 | Ga0495658_0099743 | Ga0495658_0099743_331_1167 | 229 |
| 152 | 3300046689 | Ga0495613_0001961 | Ga0495613_0001961_5296_6063 | 229 |
| 153 | 3300046809 | Ga0495600_0112261 | Ga0495600_0112261_909_1712 | 229 |
| 154 | 3300047315 | Ga0495581_0133480 | Ga0495581_0133480_413_1180 | 229 |
| 155 | 3300047319 | Ga0495674_0009533 | Ga0495674_0009533_1273_2040 | 229 |
| 156 | 3300047322 | Ga0495680_0111683 | Ga0495680_0111683_839_1606 | 229 |
| 157 | 3300047322 | Ga0495680_0174893 | Ga0495680_0174893_547_1350 | 229 |
| 158 | 3300047471 | Ga0495684_0000706 | Ga0495684_0000706_16407_17174 | 229 |
| 159 | 3300049570 | Ga0501033_0222196 | Ga0501033_0222196_400_1194 | 229 |
| 160 | 3300049572 | Ga0501036_0212555 | Ga0501036_0212555_289_1083 | 229 |
| 161 | 3300049575 | Ga0501039_0107254 | Ga0501039_0107254_550_1344 | 229 |
| 162 | 3300049576 | Ga0501040_0033282 | Ga0501040_0033282_288_1082 | 229 |
| 163 | 3300049577 | Ga0501041_0033256 | Ga0501041_0033256_928_1722 | 229 |
| 164 | 3300049578 | Ga0501042_0006369 | Ga0501042_0006369_3930_4724 | 229 |
| 165 | 3300049579 | Ga0501043_0312872 | Ga0501043_0312872_13_807 | 229 |
| 166 | 3300049580 | Ga0501046_0029504 | Ga0501046_0029504_2399_3193 | 229 |
| 167 | 3300049582 | Ga0501048_0063705 | Ga0501048_0063705_741_1535 | 229 |
| 168 | 3300049587 | Ga0501071_0125959 | Ga0501071_0125959_453_1247 | 229 |
| 169 | 3300049588 | Ga0501072_0064809 | Ga0501072_0064809_580_1374 | 229 |
| 170 | 3300049589 | Ga0501073_0175769 | Ga0501073_0175769_651_1445 | 229 |
| 171 | 3300049590 | Ga0501074_0060883 | Ga0501074_0060883_1792_2586 | 229 |
| 172 | 3300049591 | Ga0501075_0093886 | Ga0501075_0093886_232_1026 | 229 |
| 173 | 3300049592 | Ga0501076_0020279 | Ga0501076_0020279_3771_4565 | 229 |
| 174 | 3300049741 | Ga0501079_0003457 | Ga0501079_0003457_7095_7889 | 229 |
| 175 | 3300049742 | Ga0501080_0096892 | Ga0501080_0096892_1230_2024 | 229 |
| 176 | 3300049743 | Ga0501081_0014867 | Ga0501081_0014867_64_858 | 229 |
| 177 | 3300053077 | Ga0495601_0011013 | Ga0495601_0011013_1830_2597 | 229 |
| 178 | 3300053085 | Ga0495619_0001998 | Ga0495619_0001998_10449_11216 | 229 |
| 179 | 3300054114 | Ga0501084_0005447 | Ga0501084_0005447_6326_7120 | 229 |
| 180 | 3300060353 | Ga0501082_0249576 | Ga0501082_0249576_580_1374 | 229 |
| 181 | 3300061734 | Ga0530510_0062494 | Ga0530510_0062494_18_812 | 229 |
| 182 | 3300005436 | Ga0070713_100042202 | Ga0070713_1000422023 | 230 |
| 183 | 3300005548 | Ga0070665_100003845 | Ga0070665_1000038458 | 230 |
| 184 | 3300006028 | Ga0070717_10032580 | Ga0070717_100325802 | 230 |
| 185 | 3300006237 | Ga0097621_100022608 | Ga0097621_1000226086 | 230 |
| 186 | 3300006358 | Ga0068871_100023609 | Ga0068871_1000236096 | 230 |
| 187 | 3300006881 | Ga0068865_100038766 | Ga0068865_1000387665 | 230 |
| 188 | 3300009094 | Ga0111539_10000056 | Ga0111539_1000005668 | 230 |
| 189 | 3300011119 | Ga0105246_10308663 | Ga0105246_103086632 | 230 |
| 190 | 3300014326 | Ga0157380_10128583 | Ga0157380_101285832 | 230 |
| 191 | 3300014968 | Ga0157379_10701888 | Ga0157379_107018881 | 230 |
| 192 | 3300014969 | Ga0157376_10022680 | Ga0157376_100226806 | 230 |
| 193 | 3300014969 | Ga0157376_10045543 | Ga0157376_100455432 | 230 |
| 194 | 3300025928 | Ga0207700_10032324 | Ga0207700_100323242 | 230 |
| 195 | 3300025934 | Ga0207686_10088463 | Ga0207686_100884632 | 230 |
| 196 | 3300025938 | Ga0207704_10003158 | Ga0207704_100031582 | 230 |
| 197 | 3300025941 | Ga0207711_10157278 | Ga0207711_101572782 | 230 |
| 198 | 3300026089 | Ga0207648_10176945 | Ga0207648_101769453 | 230 |
| 199 | 3300026121 | Ga0207683_10093400 | Ga0207683_100934001 | 230 |
| 200 | 3300027907 | Ga0207428_10002778 | Ga0207428_100027785 | 230 |
| 201 | 3300028379 | Ga0268266_10142951 | Ga0268266_101429512 | 230 |
| 202 | 3300048917 | Ga0496114_0139250 | Ga0496114_0139250_277_1125 | 230 |
| 203 | 3300050511 | nmdc:mga08y16_1311_c1 | nmdc:mga08y16_1311_c1_20471_21328 | 230 |
| 204 | 3300053083 | Ga0495655_0084016 | Ga0495655_0084016_23_781 | 230 |
| 205 | 3300005295 | Ga0065707_10006338 | Ga0065707_100063382 | 231 |
| 206 | 3300005617 | Ga0068859_100422501 | Ga0068859_1004225012 | 231 |
| 207 | 3300005843 | Ga0068860_100451700 | Ga0068860_1004517002 | 231 |
| 208 | 3300006844 | Ga0075428_100031720 | Ga0075428_1000317202 | 231 |
| 209 | 3300006844 | Ga0075428_100326143 | Ga0075428_1003261431 | 231 |
| 210 | 3300006846 | Ga0075430_100114609 | Ga0075430_1001146092 | 231 |
| 211 | 3300006931 | Ga0097620_100422497 | Ga0097620_1004224972 | 231 |
| 212 | 3300009094 | Ga0111539_10010192 | Ga0111539_100101927 | 231 |
| 213 | 3300009147 | Ga0114129_10019564 | Ga0114129_100195646 | 231 |
| 214 | 3300009147 | Ga0114129_10063061 | Ga0114129_100630612 | 231 |
| 215 | 3300009148 | Ga0105243_10023292 | Ga0105243_100232923 | 231 |
| 216 | 3300009553 | Ga0105249_10491788 | Ga0105249_104917882 | 231 |
| 217 | 3300014326 | Ga0157380_10035864 | Ga0157380_100358644 | 231 |
| 218 | 3300025918 | Ga0207662_10101101 | Ga0207662_101011012 | 231 |
| 219 | 3300025923 | Ga0207681_10097568 | Ga0207681_100975683 | 231 |
| 220 | 3300025961 | Ga0207712_10138647 | Ga0207712_101386472 | 231 |
| 221 | 3300026088 | Ga0207641_10323540 | Ga0207641_103235402 | 231 |
| 222 | 3300027907 | Ga0207428_10326699 | Ga0207428_103266992 | 231 |
| 223 | 3300039437 | Ga0436365_1761119 | Ga0436365_1761119_944_1732 | 231 |
| 224 | 3300050507 | nmdc:mga05p37_406621_c1 | nmdc:mga05p37_406621_c1_609_1448 | 231 |
| 225 | 3300050507 | nmdc:mga05p37_439744_c1 | nmdc:mga05p37_439744_c1_510_1346 | 231 |
| 226 | 3300050509 | nmdc:mga0qj67_67328_c1 | nmdc:mga0qj67_67328_c1_271_1110 | 231 |
| 227 | 3300050511 | nmdc:mga08y16_17989_c1 | nmdc:mga08y16_17989_c1_4645_5484 | 231 |
| 228 | 3300005335 | Ga0070666_10022404 | Ga0070666_100224042 | 232 |
| 229 | 3300005354 | Ga0070675_100070461 | Ga0070675_1000704612 | 232 |
| 230 | 3300005471 | Ga0070698_100342982 | Ga0070698_1003429821 | 232 |
| 231 | 3300005543 | Ga0070672_100029428 | Ga0070672_1000294282 | 232 |
| 232 | 3300005618 | Ga0068864_100072431 | Ga0068864_1000724312 | 232 |
| 233 | 3300006237 | Ga0097621_100362606 | Ga0097621_1003626062 | 232 |
| 234 | 3300006358 | Ga0068871_100131307 | Ga0068871_1001313074 | 232 |
| 235 | 3300006844 | Ga0075428_100062370 | Ga0075428_1000623702 | 232 |
| 236 | 3300006846 | Ga0075430_100045130 | Ga0075430_1000451305 | 232 |
| 237 | 3300006847 | Ga0075431_100029078 | Ga0075431_1000290785 | 232 |
| 238 | 3300006914 | Ga0075436_100099327 | Ga0075436_1000993273 | 232 |
| 239 | 3300009094 | Ga0111539_10020554 | Ga0111539_100205545 | 232 |
| 240 | 3300013297 | Ga0157378_10004256 | Ga0157378_100042567 | 232 |
| 241 | 3300013308 | Ga0157375_10739610 | Ga0157375_107396101 | 232 |
| 242 | 3300025926 | Ga0207659_10004183 | Ga0207659_100041833 | 232 |
| 243 | 3300025960 | Ga0207651_10029304 | Ga0207651_100293042 | 232 |
| 244 | 3300026095 | Ga0207676_10145700 | Ga0207676_101457002 | 232 |
| 245 | 3300032005 | Ga0307411_10056469 | Ga0307411_100564694 | 232 |
| 246 | 3300042876 | Ga0451577_0050378 | Ga0451577_0050378_25_858 | 232 |
| 247 | 3300046539 | Ga0495621_0054270 | Ga0495621_0054270_371_1207 | 232 |
| 248 | 3300046615 | Ga0495656_0019720 | Ga0495656_0019720_308_1144 | 232 |
| 249 | 3300046664 | Ga0495659_0059484 | Ga0495659_0059484_223_996 | 232 |
| 250 | 3300049592 | Ga0501076_0052101 | Ga0501076_0052101_50_802 | 232 |
| 251 | 3300049824 | Ga0501045_0158363 | Ga0501045_0158363_918_1670 | 232 |
| 252 | 3300050509 | nmdc:mga0qj67_212115_c1 | nmdc:mga0qj67_212115_c1_543_1352 | 232 |
| 253 | 3300050514 | nmdc:mga08x19_11357_c1 | nmdc:mga08x19_11357_c1_4001_4837 | 232 |
| 254 | 3300054114 | Ga0501084_0386222 | Ga0501084_0386222_25_834 | 232 |
| 255 | 3300005293 | Ga0065715_10034415 | Ga0065715_100344151 | 233 |
| 256 | 3300005842 | Ga0068858_100453749 | Ga0068858_1004537491 | 233 |
| 257 | 3300005843 | Ga0068860_100354736 | Ga0068860_1003547361 | 233 |
| 258 | 3300006852 | Ga0075433_10064437 | Ga0075433_100644371 | 233 |
| 259 | 3300007076 | Ga0075435_100257637 | Ga0075435_1002576372 | 233 |
| 260 | 3300009147 | Ga0114129_10197116 | Ga0114129_101971162 | 233 |
| 261 | 3300009177 | Ga0105248_10387226 | Ga0105248_103872262 | 233 |
| 262 | 3300025919 | Ga0207657_10236179 | Ga0207657_102361792 | 233 |
| 263 | 3300026035 | Ga0207703_10330691 | Ga0207703_103306912 | 233 |
| 264 | 3300028381 | Ga0268264_10283519 | Ga0268264_102835192 | 233 |
| 265 | 3300042437 | Ga0439444_0012206 | Ga0439444_0012206_561_1343 | 233 |
| 266 | 3300050507 | nmdc:mga05p37_184987_c1 | nmdc:mga05p37_184987_c1_238_1056 | 233 |
| 267 | 3300050507 | nmdc:mga05p37_23544_c1 | nmdc:mga05p37_23544_c1_544_1407 | 233 |
| 268 | 3300050515 | nmdc:mga0a205_45515_c1 | nmdc:mga0a205_45515_c1_2113_2934 | 233 |
| 269 | 3300005290 | Ga0065712_10035779 | Ga0065712_100357792 | 234 |
| 270 | 3300005335 | Ga0070666_10029165 | Ga0070666_100291652 | 234 |
| 271 | 3300005340 | Ga0070689_100163578 | Ga0070689_1001635782 | 234 |
| 272 | 3300005364 | Ga0070673_100109853 | Ga0070673_1001098532 | 234 |
| 273 | 3300005365 | Ga0070688_100048886 | Ga0070688_1000488864 | 234 |
| 274 | 3300005367 | Ga0070667_100210948 | Ga0070667_1002109482 | 234 |
| 275 | 3300005457 | Ga0070662_100079056 | Ga0070662_1000790562 | 234 |
| 276 | 3300005518 | Ga0070699_100448884 | Ga0070699_1004488841 | 234 |
| 277 | 3300005564 | Ga0070664_100168983 | Ga0070664_1001689832 | 234 |
| 278 | 3300005618 | Ga0068864_100320109 | Ga0068864_1003201092 | 234 |
| 279 | 3300005841 | Ga0068863_100123229 | Ga0068863_1001232292 | 234 |
| 280 | 3300005844 | Ga0068862_100671793 | Ga0068862_1006717932 | 234 |
| 281 | 3300006175 | Ga0070712_100394968 | Ga0070712_1003949682 | 234 |
| 282 | 3300006358 | Ga0068871_100010489 | Ga0068871_1000104893 | 234 |
| 283 | 3300006852 | Ga0075433_10057421 | Ga0075433_100574212 | 234 |
| 284 | 3300006871 | Ga0075434_100013351 | Ga0075434_1000133512 | 234 |
| 285 | 3300006881 | Ga0068865_100185971 | Ga0068865_1001859712 | 234 |
| 286 | 3300009147 | Ga0114129_10299448 | Ga0114129_102994482 | 234 |
| 287 | 3300009148 | Ga0105243_10048211 | Ga0105243_100482115 | 234 |
| 288 | 3300009176 | Ga0105242_10018083 | Ga0105242_100180833 | 234 |
| 289 | 3300009177 | Ga0105248_10070756 | Ga0105248_100707563 | 234 |
| 290 | 3300009553 | Ga0105249_10435656 | Ga0105249_104356562 | 234 |
| 291 | 3300013296 | Ga0157374_10102744 | Ga0157374_101027444 | 234 |
| 292 | 3300013308 | Ga0157375_10026946 | Ga0157375_100269462 | 234 |
| 293 | 3300017792 | Ga0163161_10048567 | Ga0163161_100485672 | 234 |
| 294 | 3300025903 | Ga0207680_10023673 | Ga0207680_100236732 | 234 |
| 295 | 3300025903 | Ga0207680_10119936 | Ga0207680_101199361 | 234 |
| 296 | 3300025907 | Ga0207645_10037612 | Ga0207645_100376122 | 234 |
| 297 | 3300025911 | Ga0207654_10325028 | Ga0207654_103250282 | 234 |
| 298 | 3300025928 | Ga0207700_10648351 | Ga0207700_106483511 | 234 |
| 299 | 3300025934 | Ga0207686_10343342 | Ga0207686_103433422 | 234 |
| 300 | 3300025936 | Ga0207670_10219544 | Ga0207670_102195442 | 234 |
| 301 | 3300025945 | Ga0207679_10273842 | Ga0207679_102738422 | 234 |
| 302 | 3300026088 | Ga0207641_10242143 | Ga0207641_102421432 | 234 |
| 303 | 3300026088 | Ga0207641_10395264 | Ga0207641_103952641 | 234 |
| 304 | 3300048904 | Ga0496101_0192788 | Ga0496101_0192788_145_948 | 234 |
| 305 | 3300048907 | Ga0496104_0015490 | Ga0496104_0015490_1512_2312 | 234 |
| 306 | 3300048909 | Ga0496106_0290803 | Ga0496106_0290803_121_924 | 234 |
| 307 | 3300048910 | Ga0496107_0128451 | Ga0496107_0128451_539_1342 | 234 |
| 308 | 3300048910 | Ga0496107_0483186 | Ga0496107_0483186_67_831 | 234 |
| 309 | 3300048911 | Ga0496108_0017260 | Ga0496108_0017260_3719_4522 | 234 |
| 310 | 3300048917 | Ga0496114_0009455 | Ga0496114_0009455_3128_3928 | 234 |
| 311 | 3300048917 | Ga0496114_0011512 | Ga0496114_0011512_2569_3372 | 234 |
| 312 | 3300049743 | Ga0501081_0175645 | Ga0501081_0175645_174_962 | 234 |
| 313 | 3300049744 | Ga0501083_0147228 | Ga0501083_0147228_25_813 | 234 |
| 314 | 3300050507 | nmdc:mga05p37_236015_c1 | nmdc:mga05p37_236015_c1_319_1251 | 234 |
| 315 | 3300050509 | nmdc:mga0qj67_330959_c1 | nmdc:mga0qj67_330959_c1_119_973 | 234 |
| 316 | 3300050512 | nmdc:mga0n895_25177_c1 | nmdc:mga0n895_25177_c1_3274_4107 | 234 |
| 317 | 3300005459 | Ga0068867_100104894 | Ga0068867_1001048941 | 235 |
| 318 | 3300005471 | Ga0070698_100363061 | Ga0070698_1003630611 | 235 |
| 319 | 3300005545 | Ga0070695_100010728 | Ga0070695_1000107283 | 235 |
| 320 | 3300006880 | Ga0075429_100105364 | Ga0075429_1001053643 | 235 |
| 321 | 3300009094 | Ga0111539_10017296 | Ga0111539_100172963 | 235 |
| 322 | 3300009147 | Ga0114129_10001107 | Ga0114129_100011078 | 235 |
| 323 | 3300025903 | Ga0207680_10036350 | Ga0207680_100363502 | 235 |
| 324 | 3300046475 | Ga0495639_0017082 | Ga0495639_0017082_228_1025 | 235 |
| 325 | 3300046543 | Ga0495645_0036348 | Ga0495645_0036348_643_1440 | 235 |
| 326 | 3300047471 | Ga0495684_0171790 | Ga0495684_0171790_521_1318 | 235 |
| 327 | 3300050507 | nmdc:mga05p37_147_c1 | nmdc:mga05p37_147_c1_11745_12536 | 235 |
| 328 | 3300050508 | nmdc:mga09592_169873_c1 | nmdc:mga09592_169873_c1_523_1314 | 235 |
| 329 | 3300050512 | nmdc:mga0n895_409903_c1 | nmdc:mga0n895_409903_c1_419_1243 | 235 |
| 330 | 3300005548 | Ga0070665_100008381 | Ga0070665_1000083817 | 236 |
| 331 | 3300005718 | Ga0068866_10035182 | Ga0068866_100351822 | 236 |
| 332 | 3300006237 | Ga0097621_100001602 | Ga0097621_10000160213 | 236 |
| 333 | 3300006358 | Ga0068871_100001058 | Ga0068871_10000105812 | 236 |
| 334 | 3300006880 | Ga0075429_100494191 | Ga0075429_1004941911 | 236 |
| 335 | 3300006914 | Ga0075436_100021620 | Ga0075436_1000216202 | 236 |
| 336 | 3300007265 | Ga0099794_10158440 | Ga0099794_101584401 | 236 |
| 337 | 3300009098 | Ga0105245_10004376 | Ga0105245_100043766 | 236 |
| 338 | 3300009177 | Ga0105248_10268535 | Ga0105248_102685352 | 236 |
| 339 | 3300013308 | Ga0157375_10241843 | Ga0157375_102418432 | 236 |
| 340 | 3300014969 | Ga0157376_10015903 | Ga0157376_100159032 | 236 |
| 341 | 3300025927 | Ga0207687_10029369 | Ga0207687_100293692 | 236 |
| 342 | 3300025934 | Ga0207686_10014334 | Ga0207686_100143342 | 236 |
| 343 | 3300025937 | Ga0207669_10035488 | Ga0207669_100354882 | 236 |
| 344 | 3300025938 | Ga0207704_10036800 | Ga0207704_100368004 | 236 |
| 345 | 3300025940 | Ga0207691_10107626 | Ga0207691_101076262 | 236 |
| 346 | 3300025941 | Ga0207711_10075311 | Ga0207711_100753112 | 236 |
| 347 | 3300025960 | Ga0207651_10046090 | Ga0207651_100460902 | 236 |
| 348 | 3300026023 | Ga0207677_10034933 | Ga0207677_100349332 | 236 |
| 349 | 3300026035 | Ga0207703_10023663 | Ga0207703_100236632 | 236 |
| 350 | 3300026089 | Ga0207648_10017841 | Ga0207648_100178414 | 236 |
| 351 | 3300028379 | Ga0268266_10011268 | Ga0268266_100112687 | 236 |
| 352 | 3300046664 | Ga0495659_0117336 | Ga0495659_0117336_19_873 | 236 |
| 353 | 3300048908 | Ga0496105_0148553 | Ga0496105_0148553_286_1080 | 236 |
| 354 | 3300048916 | Ga0496113_0635890 | Ga0496113_0635890_50_844 | 236 |
| 355 | 3300048917 | Ga0496114_0173708 | Ga0496114_0173708_260_1054 | 236 |
| 356 | 3300049572 | Ga0501036_0022140 | Ga0501036_0022140_3984_4778 | 236 |
| 357 | 3300049574 | Ga0501038_0024753 | Ga0501038_0024753_1483_2277 | 236 |
| 358 | 3300049575 | Ga0501039_0258759 | Ga0501039_0258759_540_1334 | 236 |
| 359 | 3300049576 | Ga0501040_0030417 | Ga0501040_0030417_2079_2873 | 236 |
| 360 | 3300049578 | Ga0501042_0008326 | Ga0501042_0008326_2510_3304 | 236 |
| 361 | 3300049580 | Ga0501046_0005903 | Ga0501046_0005903_1436_2230 | 236 |
| 362 | 3300049584 | Ga0501068_0086409 | Ga0501068_0086409_348_1142 | 236 |
| 363 | 3300049587 | Ga0501071_0015337 | Ga0501071_0015337_3387_4181 | 236 |
| 364 | 3300049588 | Ga0501072_0006046 | Ga0501072_0006046_966_1760 | 236 |
| 365 | 3300049591 | Ga0501075_0002228 | Ga0501075_0002228_864_1658 | 236 |
| 366 | 3300049592 | Ga0501076_0010605 | Ga0501076_0010605_5454_6248 | 236 |
| 367 | 3300049593 | Ga0501077_0127506 | Ga0501077_0127506_679_1473 | 236 |
| 368 | 3300049741 | Ga0501079_0002242 | Ga0501079_0002242_2009_2803 | 236 |
| 369 | 3300049742 | Ga0501080_0029168 | Ga0501080_0029168_1026_1820 | 236 |
| 370 | 3300049743 | Ga0501081_0001120 | Ga0501081_0001120_11054_11848 | 236 |
| 371 | 3300049824 | Ga0501045_0003086 | Ga0501045_0003086_1383_2177 | 236 |
| 372 | 3300050508 | nmdc:mga09592_273161_c1 | nmdc:mga09592_273161_c1_240_1019 | 236 |
| 373 | 3300050514 | nmdc:mga08x19_72231_c1 | nmdc:mga08x19_72231_c1_695_1519 | 236 |
| 374 | 3300054114 | Ga0501084_0001942 | Ga0501084_0001942_14955_15749 | 236 |
| 375 | 3300059421 | Ga0590071_005255 | Ga0590071_005255_313_1233 | 236 |
| 376 | 3300060353 | Ga0501082_0000835 | Ga0501082_0000835_6972_7766 | 236 |
| 377 | 3300061734 | Ga0530510_0002033 | Ga0530510_0002033_429_1223 | 236 |
| 378 | 3300005329 | Ga0070683_100191479 | Ga0070683_1001914792 | 237 |
| 379 | 3300005340 | Ga0070689_100027236 | Ga0070689_1000272362 | 237 |
| 380 | 3300005354 | Ga0070675_100177522 | Ga0070675_1001775222 | 237 |
| 381 | 3300005356 | Ga0070674_100023397 | Ga0070674_1000233973 | 237 |
| 382 | 3300005365 | Ga0070688_100062324 | Ga0070688_1000623243 | 237 |
| 383 | 3300005457 | Ga0070662_100320538 | Ga0070662_1003205382 | 237 |
| 384 | 3300005466 | Ga0070685_10264827 | Ga0070685_102648272 | 237 |
| 385 | 3300005536 | Ga0070697_100024877 | Ga0070697_1000248773 | 237 |
| 386 | 3300005614 | Ga0068856_100059321 | Ga0068856_1000593212 | 237 |
| 387 | 3300009093 | Ga0105240_10164668 | Ga0105240_101646683 | 237 |
| 388 | 3300013104 | Ga0157370_10381811 | Ga0157370_103818111 | 237 |
| 389 | 3300025926 | Ga0207659_10228636 | Ga0207659_102286362 | 237 |
| 390 | 3300025933 | Ga0207706_10172769 | Ga0207706_101727692 | 237 |
| 391 | 3300025936 | Ga0207670_10096988 | Ga0207670_100969883 | 237 |
| 392 | 3300026078 | Ga0207702_10042141 | Ga0207702_100421412 | 237 |
| 393 | 3300031548 | Ga0307408_100003069 | Ga0307408_1000030695 | 237 |
| 394 | 3300031548 | Ga0307408_100140882 | Ga0307408_1001408822 | 237 |
| 395 | 3300031731 | Ga0307405_10012845 | Ga0307405_100128452 | 237 |
| 396 | 3300031824 | Ga0307413_10005027 | Ga0307413_100050272 | 237 |
| 397 | 3300031852 | Ga0307410_10044118 | Ga0307410_100441182 | 237 |
| 398 | 3300031901 | Ga0307406_10578976 | Ga0307406_105789761 | 237 |
| 399 | 3300031903 | Ga0307407_10095160 | Ga0307407_100951602 | 237 |
| 400 | 3300031911 | Ga0307412_10019531 | Ga0307412_100195316 | 237 |
| 401 | 3300031995 | Ga0307409_100023507 | Ga0307409_1000235074 | 237 |
| 402 | 3300032002 | Ga0307416_100012528 | Ga0307416_1000125282 | 237 |
| 403 | 3300032002 | Ga0307416_100763459 | Ga0307416_1007634592 | 237 |
| 404 | 3300032005 | Ga0307411_10030399 | Ga0307411_100303992 | 237 |
| 405 | 3300032126 | Ga0307415_100004220 | Ga0307415_1000042202 | 237 |
| 406 | 3300035119 | Ga0373956_0190113 | Ga0373956_0190113_39_833 | 237 |
| 407 | 3300048905 | Ga0496102_0573908 | Ga0496102_0573908_70_942 | 237 |
| 408 | 3300049571 | Ga0501034_0084636 | Ga0501034_0084636_1133_1942 | 237 |
| 409 | 3300049574 | Ga0501038_0187283 | Ga0501038_0187283_623_1402 | 237 |
| 410 | 3300049576 | Ga0501040_0476603 | Ga0501040_0476603_64_843 | 237 |
| 411 | 3300049588 | Ga0501072_0102220 | Ga0501072_0102220_1287_2066 | 237 |
| 412 | 3300049592 | Ga0501076_0301845 | Ga0501076_0301845_312_1118 | 237 |
| 413 | 3300049741 | Ga0501079_0050995 | Ga0501079_0050995_932_1711 | 237 |
| 414 | 3300049743 | Ga0501081_0006124 | Ga0501081_0006124_5880_6659 | 237 |
| 415 | 3300060353 | Ga0501082_0084198 | Ga0501082_0084198_18_797 | 237 |
| 416 | 3300061734 | Ga0530510_0052050 | Ga0530510_0052050_105_884 | 237 |
| 417 | 3300005290 | Ga0065712_10191071 | Ga0065712_101910712 | 238 |
| 418 | 3300005353 | Ga0070669_100242317 | Ga0070669_1002423172 | 238 |
| 419 | 3300005459 | Ga0068867_100224345 | Ga0068867_1002243451 | 238 |
| 420 | 3300005841 | Ga0068863_100171661 | Ga0068863_1001716612 | 238 |
| 421 | 3300005937 | Ga0081455_10087723 | Ga0081455_100877231 | 238 |
| 422 | 3300005985 | Ga0081539_10005654 | Ga0081539_100056542 | 238 |
| 423 | 3300014326 | Ga0157380_10216956 | Ga0157380_102169562 | 238 |
| 424 | 3300025933 | Ga0207706_10160430 | Ga0207706_101604302 | 238 |
| 425 | 3300026088 | Ga0207641_10230548 | Ga0207641_102305481 | 238 |
| 426 | 3300035692 | Ga0373935_0285550 | Ga0373935_0285550_37_870 | 238 |
| 427 | 3300005467 | Ga0070706_100231467 | Ga0070706_1002314671 | 239 |
| 428 | 3300005471 | Ga0070698_100005321 | Ga0070698_1000053217 | 239 |
| 429 | 3300005518 | Ga0070699_100003994 | Ga0070699_1000039946 | 239 |
| 430 | 3300005546 | Ga0070696_100032166 | Ga0070696_1000321662 | 239 |
| 431 | 3300005549 | Ga0070704_100022532 | Ga0070704_1000225323 | 239 |
| 432 | 3300007076 | Ga0075435_100234705 | Ga0075435_1002347052 | 239 |
| 433 | 3300009094 | Ga0111539_10578297 | Ga0111539_105782971 | 239 |
| 434 | 3300027665 | Ga0209983_1043645 | Ga0209983_10436451 | 239 |
| 435 | 3300044694 | Ga0466963_0327295 | Ga0466963_0327295_84_896 | 239 |
| 436 | 3300050512 | nmdc:mga0n895_49412_c1 | nmdc:mga0n895_49412_c1_2367_3182 | 239 |
| 437 | 3300050513 | nmdc:mga0rr50_28813_c1 | nmdc:mga0rr50_28813_c1_2100_2915 | 239 |
| 438 | 3300005467 | Ga0070706_100313175 | Ga0070706_1003131752 | 240 |
| 439 | 3300005981 | Ga0081538_10086064 | Ga0081538_100860642 | 240 |
| 440 | 3300006847 | Ga0075431_100241669 | Ga0075431_1002416692 | 240 |
| 441 | 3300006871 | Ga0075434_100163053 | Ga0075434_1001630532 | 240 |
| 442 | 3300009147 | Ga0114129_10001088 | Ga0114129_100010887 | 240 |
| 443 | 3300025935 | Ga0207709_10017498 | Ga0207709_100174986 | 240 |
| 444 | 3300050507 | nmdc:mga05p37_96537_c1 | nmdc:mga05p37_96537_c1_281_1132 | 240 |
| 445 | 3300050510 | nmdc:mga06r32_9806_c1 | nmdc:mga06r32_9806_c1_67_870 | 240 |
| 446 | 3300050512 | nmdc:mga0n895_18893_c1 | nmdc:mga0n895_18893_c1_4030_4866 | 240 |
| 447 | 3300050515 | nmdc:mga0a205_3043_c1 | nmdc:mga0a205_3043_c1_3254_4090 | 240 |
| 448 | 3300005330 | Ga0070690_100257833 | Ga0070690_1002578332 | 241 |
| 449 | 3300005719 | Ga0068861_100686806 | Ga0068861_1006868061 | 241 |
| 450 | 3300006175 | Ga0070712_100380983 | Ga0070712_1003809832 | 241 |
| 451 | 3300013308 | Ga0157375_10147079 | Ga0157375_101470794 | 241 |
| 452 | 3300014325 | Ga0163163_10042063 | Ga0163163_100420635 | 241 |
| 453 | 3300014968 | Ga0157379_10010953 | Ga0157379_100109536 | 241 |
| 454 | 3300025934 | Ga0207686_10107313 | Ga0207686_101073132 | 241 |
| 455 | 3300025941 | Ga0207711_10147206 | Ga0207711_101472064 | 241 |
| 456 | 3300026118 | Ga0207675_100568234 | Ga0207675_1005682342 | 241 |
| 457 | 3300046454 | Ga0495592_0285344 | Ga0495592_0285344_213_1049 | 241 |
| 458 | 3300046683 | Ga0495658_0081177 | Ga0495658_0081177_91_927 | 241 |
| 459 | 3300047319 | Ga0495674_0355281 | Ga0495674_0355281_325_1161 | 241 |
| 460 | 3300049572 | Ga0501036_0078021 | Ga0501036_0078021_956_1792 | 241 |
| 461 | 3300049587 | Ga0501071_0172943 | Ga0501071_0172943_686_1522 | 241 |
| 462 | 3300005354 | Ga0070675_100001153 | Ga0070675_1000011537 | 242 |
| 463 | 3300005356 | Ga0070674_100080860 | Ga0070674_1000808601 | 242 |
| 464 | 3300005439 | Ga0070711_100051768 | Ga0070711_1000517683 | 242 |
| 465 | 3300005842 | Ga0068858_100006490 | Ga0068858_1000064908 | 242 |
| 466 | 3300006852 | Ga0075433_10007559 | Ga0075433_100075595 | 242 |
| 467 | 3300006871 | Ga0075434_100399228 | Ga0075434_1003992282 | 242 |
| 468 | 3300006931 | Ga0097620_100385265 | Ga0097620_1003852652 | 242 |
| 469 | 3300009101 | Ga0105247_10006881 | Ga0105247_100068816 | 242 |
| 470 | 3300014326 | Ga0157380_10019621 | Ga0157380_100196216 | 242 |
| 471 | 3300014968 | Ga0157379_10010887 | Ga0157379_100108877 | 242 |
| 472 | 3300025916 | Ga0207663_10306540 | Ga0207663_103065402 | 242 |
| 473 | 3300025961 | Ga0207712_10508016 | Ga0207712_105080161 | 242 |
| 474 | 3300026035 | Ga0207703_10035090 | Ga0207703_100350904 | 242 |
| 475 | 3300026118 | Ga0207675_100209493 | Ga0207675_1002094932 | 242 |
| 476 | 3300005518 | Ga0070699_100001247 | Ga0070699_1000012476 | 243 |
| 477 | 3300005564 | Ga0070664_100590950 | Ga0070664_1005909502 | 243 |
| 478 | 3300006914 | Ga0075436_100010634 | Ga0075436_1000106343 | 243 |
| 479 | 3300049589 | Ga0501073_0093489 | Ga0501073_0093489_41_979 | 243 |
| 480 | 3300050514 | nmdc:mga08x19_98098_c1 | nmdc:mga08x19_98098_c1_731_1564 | 243 |
| 481 | 3300059421 | Ga0590071_000059 | Ga0590071_000059_2700_3599 | 243 |
| 482 | 3300059423 | Ga0590074_000705 | Ga0590074_000705_3179_4042 | 243 |
| 483 | 3300059424 | Ga0590075_000234 | Ga0590075_000234_13092_13955 | 243 |
| 484 | 3300059426 | Ga0590077_000247 | Ga0590077_000247_13516_14379 | 243 |
| 485 | 3300005459 | Ga0068867_100213604 | Ga0068867_1002136042 | 244 |
| 486 | 3300006871 | Ga0075434_100007606 | Ga0075434_1000076063 | 244 |
| 487 | 3300006914 | Ga0075436_100209645 | Ga0075436_1002096452 | 244 |
| 488 | 3300009098 | Ga0105245_10138173 | Ga0105245_101381732 | 244 |
| 489 | 3300025927 | Ga0207687_10161943 | Ga0207687_101619432 | 244 |
| 490 | 3300046460 | Ga0495638_0012596 | Ga0495638_0012596_1644_2492 | 244 |
| 491 | 3300048907 | Ga0496104_0090266 | Ga0496104_0090266_1339_2169 | 244 |
| 492 | 3300048908 | Ga0496105_0084627 | Ga0496105_0084627_829_1659 | 244 |
| 493 | 3300048915 | Ga0496112_0125946 | Ga0496112_0125946_33_863 | 244 |
| 494 | 3300048915 | Ga0496112_0160133 | Ga0496112_0160133_1006_1836 | 244 |
| 495 | 3300050512 | nmdc:mga0n895_6302_c1 | nmdc:mga0n895_6302_c1_3858_4670 | 244 |
| 496 | 3300050514 | nmdc:mga08x19_186080_c1 | nmdc:mga08x19_186080_c1_83_919 | 244 |
| 497 | 3300005329 | Ga0070683_100711358 | Ga0070683_1007113581 | 245 |
| 498 | 3300005331 | Ga0070670_100316080 | Ga0070670_1003160802 | 245 |
| 499 | 3300005334 | Ga0068869_100233032 | Ga0068869_1002330322 | 245 |
| 500 | 3300005335 | Ga0070666_10090472 | Ga0070666_100904724 | 245 |
| 501 | 3300005338 | Ga0068868_100410341 | Ga0068868_1004103411 | 245 |
| 502 | 3300005339 | Ga0070660_100005272 | Ga0070660_1000052722 | 245 |
| 503 | 3300005366 | Ga0070659_100248468 | Ga0070659_1002484682 | 245 |
| 504 | 3300005444 | Ga0070694_100334196 | Ga0070694_1003341961 | 245 |
| 505 | 3300005445 | Ga0070708_100107666 | Ga0070708_1001076662 | 245 |
| 506 | 3300005530 | Ga0070679_100257179 | Ga0070679_1002571792 | 245 |
| 507 | 3300005548 | Ga0070665_100307911 | Ga0070665_1003079112 | 245 |
| 508 | 3300005563 | Ga0068855_100165946 | Ga0068855_1001659462 | 245 |
| 509 | 3300005617 | Ga0068859_100744051 | Ga0068859_1007440512 | 245 |
| 510 | 3300005842 | Ga0068858_100041636 | Ga0068858_1000416362 | 245 |
| 511 | 3300006931 | Ga0097620_100744040 | Ga0097620_1007440401 | 245 |
| 512 | 3300007076 | Ga0075435_100000891 | Ga0075435_10000089110 | 245 |
| 513 | 3300009098 | Ga0105245_10280353 | Ga0105245_102803532 | 245 |
| 514 | 3300009101 | Ga0105247_10020925 | Ga0105247_100209252 | 245 |
| 515 | 3300009176 | Ga0105242_10006554 | Ga0105242_100065544 | 245 |
| 516 | 3300009177 | Ga0105248_10004335 | Ga0105248_100043356 | 245 |
| 517 | 3300009553 | Ga0105249_10139015 | Ga0105249_101390151 | 245 |
| 518 | 3300009553 | Ga0105249_10374552 | Ga0105249_103745521 | 245 |
| 519 | 3300013296 | Ga0157374_10148787 | Ga0157374_101487872 | 245 |
| 520 | 3300013296 | Ga0157374_10205485 | Ga0157374_102054852 | 245 |
| 521 | 3300013306 | Ga0163162_10023452 | Ga0163162_100234523 | 245 |
| 522 | 3300014325 | Ga0163163_10007255 | Ga0163163_100072555 | 245 |
| 523 | 3300014325 | Ga0163163_10149964 | Ga0163163_101499642 | 245 |
| 524 | 3300014325 | Ga0163163_10455868 | Ga0163163_104558682 | 245 |
| 525 | 3300014968 | Ga0157379_10045850 | Ga0157379_100458504 | 245 |
| 526 | 3300014968 | Ga0157379_10115397 | Ga0157379_101153972 | 245 |
| 527 | 3300025900 | Ga0207710_10041537 | Ga0207710_100415372 | 245 |
| 528 | 3300025909 | Ga0207705_10033198 | Ga0207705_100331982 | 245 |
| 529 | 3300025913 | Ga0207695_10226191 | Ga0207695_102261912 | 245 |
| 530 | 3300025917 | Ga0207660_10097210 | Ga0207660_100972102 | 245 |
| 531 | 3300025919 | Ga0207657_10009485 | Ga0207657_100094852 | 245 |
| 532 | 3300025934 | Ga0207686_10022505 | Ga0207686_100225053 | 245 |
| 533 | 3300025941 | Ga0207711_10107390 | Ga0207711_101073902 | 245 |
| 534 | 3300025945 | Ga0207679_10150112 | Ga0207679_101501123 | 245 |
| 535 | 3300026023 | Ga0207677_10070270 | Ga0207677_100702703 | 245 |
| 536 | 3300026035 | Ga0207703_10123775 | Ga0207703_101237752 | 245 |
| 537 | 3300026116 | Ga0207674_10345810 | Ga0207674_103458102 | 245 |
| 538 | 3300028379 | Ga0268266_10024583 | Ga0268266_100245831 | 245 |
| 539 | 3300035118 | Ga0373954_0024502 | Ga0373954_0024502_247_1074 | 245 |
| 540 | 3300035119 | Ga0373956_0045445 | Ga0373956_0045445_447_1274 | 245 |
| 541 | 3300035172 | Ga0373955_0088197 | Ga0373955_0088197_820_1647 | 245 |
| 542 | 3300035724 | Ga0373933_0236715 | Ga0373933_0236715_216_1046 | 245 |
| 543 | 3300036401 | Ga0373937_0034126 | Ga0373937_0034126_3765_4592 | 245 |
| 544 | 3300036401 | Ga0373937_0237607 | Ga0373937_0237607_656_1492 | 245 |
| 545 | 3300046459 | Ga0495629_0268602 | Ga0495629_0268602_32_859 | 245 |
| 546 | 3300046533 | Ga0495640_0217234 | Ga0495640_0217234_321_1151 | 245 |
| 547 | 3300046536 | Ga0495587_0091826 | Ga0495587_0091826_705_1532 | 245 |
| 548 | 3300046543 | Ga0495645_0005546 | Ga0495645_0005546_4883_5710 | 245 |
| 549 | 3300046559 | Ga0495667_0226272 | Ga0495667_0226272_142_969 | 245 |
| 550 | 3300046663 | Ga0495635_0227618 | Ga0495635_0227618_286_1113 | 245 |
| 551 | 3300046680 | Ga0495646_0274091 | Ga0495646_0274091_16_843 | 245 |
| 552 | 3300046683 | Ga0495658_0087196 | Ga0495658_0087196_700_1527 | 245 |
| 553 | 3300047319 | Ga0495674_0098068 | Ga0495674_0098068_761_1588 | 245 |
| 554 | 3300048911 | Ga0496108_0024219 | Ga0496108_0024219_3621_4448 | 245 |
| 555 | 3300048915 | Ga0496112_0073309 | Ga0496112_0073309_2250_3077 | 245 |
| 556 | 3300048917 | Ga0496114_0288846 | Ga0496114_0288846_231_1058 | 245 |
| 557 | 3300048917 | Ga0496114_0305030 | Ga0496114_0305030_186_1013 | 245 |
| 558 | 3300048918 | Ga0496115_0419542 | Ga0496115_0419542_61_888 | 245 |
| 559 | 3300050512 | nmdc:mga0n895_20068_c1 | nmdc:mga0n895_20068_c1_1470_2312 | 245 |
| 560 | 3300050513 | nmdc:mga0rr50_269_c1 | nmdc:mga0rr50_269_c1_22144_22986 | 245 |
| 561 | 3300053077 | Ga0495601_0167382 | Ga0495601_0167382_295_1122 | 245 |
| 562 | 3300053085 | Ga0495619_0108077 | Ga0495619_0108077_939_1769 | 245 |
| 563 | 3300005293 | Ga0065715_10177504 | Ga0065715_101775042 | 246 |
| 564 | 3300005328 | Ga0070676_10001391 | Ga0070676_100013916 | 246 |
| 565 | 3300005329 | Ga0070683_100000817 | Ga0070683_1000008175 | 246 |
| 566 | 3300005331 | Ga0070670_100010107 | Ga0070670_1000101072 | 246 |
| 567 | 3300005335 | Ga0070666_10040134 | Ga0070666_100401343 | 246 |
| 568 | 3300005338 | Ga0068868_100304200 | Ga0068868_1003042001 | 246 |
| 569 | 3300005341 | Ga0070691_10001127 | Ga0070691_100011276 | 246 |
| 570 | 3300005353 | Ga0070669_100101340 | Ga0070669_1001013402 | 246 |
| 571 | 3300005355 | Ga0070671_100005021 | Ga0070671_1000050217 | 246 |
| 572 | 3300005355 | Ga0070671_100159686 | Ga0070671_1001596862 | 246 |
| 573 | 3300005356 | Ga0070674_100010617 | Ga0070674_1000106173 | 246 |
| 574 | 3300005364 | Ga0070673_100164797 | Ga0070673_1001647972 | 246 |
| 575 | 3300005364 | Ga0070673_100252463 | Ga0070673_1002524632 | 246 |
| 576 | 3300005367 | Ga0070667_100012544 | Ga0070667_1000125446 | 246 |
| 577 | 3300005367 | Ga0070667_100065911 | Ga0070667_1000659113 | 246 |
| 578 | 3300005441 | Ga0070700_100003178 | Ga0070700_1000031782 | 246 |
| 579 | 3300005441 | Ga0070700_100388440 | Ga0070700_1003884402 | 246 |
| 580 | 3300005535 | Ga0070684_100000538 | Ga0070684_1000005388 | 246 |
| 581 | 3300005543 | Ga0070672_100006875 | Ga0070672_1000068756 | 246 |
| 582 | 3300005546 | Ga0070696_100011361 | Ga0070696_1000113615 | 246 |
| 583 | 3300005549 | Ga0070704_100007278 | Ga0070704_1000072783 | 246 |
| 584 | 3300005563 | Ga0068855_100956441 | Ga0068855_1009564411 | 246 |
| 585 | 3300005615 | Ga0070702_100004635 | Ga0070702_1000046352 | 246 |
| 586 | 3300005617 | Ga0068859_100728165 | Ga0068859_1007281652 | 246 |
| 587 | 3300005718 | Ga0068866_10018276 | Ga0068866_100182765 | 246 |
| 588 | 3300005719 | Ga0068861_100201088 | Ga0068861_1002010882 | 246 |
| 589 | 3300005841 | Ga0068863_100006039 | Ga0068863_1000060394 | 246 |
| 590 | 3300005842 | Ga0068858_100657725 | Ga0068858_1006577252 | 246 |
| 591 | 3300005844 | Ga0068862_100010418 | Ga0068862_1000104183 | 246 |
| 592 | 3300005844 | Ga0068862_100012785 | Ga0068862_1000127853 | 246 |
| 593 | 3300005844 | Ga0068862_100111224 | Ga0068862_1001112242 | 246 |
| 594 | 3300006058 | Ga0075432_10120310 | Ga0075432_101203101 | 246 |
| 595 | 3300006844 | Ga0075428_100005718 | Ga0075428_1000057182 | 246 |
| 596 | 3300006847 | Ga0075431_100027376 | Ga0075431_1000273764 | 246 |
| 597 | 3300006847 | Ga0075431_100244848 | Ga0075431_1002448482 | 246 |
| 598 | 3300006871 | Ga0075434_100223029 | Ga0075434_1002230292 | 246 |
| 599 | 3300006931 | Ga0097620_100728244 | Ga0097620_1007282442 | 246 |
| 600 | 3300007076 | Ga0075435_100022979 | Ga0075435_1000229792 | 246 |
| 601 | 3300007076 | Ga0075435_100324701 | Ga0075435_1003247011 | 246 |
| 602 | 3300009093 | Ga0105240_10300646 | Ga0105240_103006462 | 246 |
| 603 | 3300009094 | Ga0111539_10003211 | Ga0111539_1000321111 | 246 |
| 604 | 3300009147 | Ga0114129_10009647 | Ga0114129_100096478 | 246 |
| 605 | 3300009176 | Ga0105242_10032160 | Ga0105242_100321602 | 246 |
| 606 | 3300009177 | Ga0105248_10010331 | Ga0105248_100103315 | 246 |
| 607 | 3300013296 | Ga0157374_10355621 | Ga0157374_103556213 | 246 |
| 608 | 3300013306 | Ga0163162_10011971 | Ga0163162_100119716 | 246 |
| 609 | 3300013308 | Ga0157375_10288976 | Ga0157375_102889762 | 246 |
| 610 | 3300014325 | Ga0163163_10003686 | Ga0163163_100036869 | 246 |
| 611 | 3300025899 | Ga0207642_10023708 | Ga0207642_100237082 | 246 |
| 612 | 3300025906 | Ga0207699_10086755 | Ga0207699_100867553 | 246 |
| 613 | 3300025907 | Ga0207645_10001380 | Ga0207645_100013806 | 246 |
| 614 | 3300025918 | Ga0207662_10215621 | Ga0207662_102156212 | 246 |
| 615 | 3300025926 | Ga0207659_10005133 | Ga0207659_100051336 | 246 |
| 616 | 3300025931 | Ga0207644_10104966 | Ga0207644_101049663 | 246 |
| 617 | 3300025933 | Ga0207706_10312518 | Ga0207706_103125182 | 246 |
| 618 | 3300025936 | Ga0207670_10060496 | Ga0207670_100604963 | 246 |
| 619 | 3300025937 | Ga0207669_10008229 | Ga0207669_100082296 | 246 |
| 620 | 3300025940 | Ga0207691_10032110 | Ga0207691_100321106 | 246 |
| 621 | 3300025941 | Ga0207711_10007046 | Ga0207711_100070464 | 246 |
| 622 | 3300025960 | Ga0207651_10071150 | Ga0207651_100711503 | 246 |
| 623 | 3300025960 | Ga0207651_10238027 | Ga0207651_102380272 | 246 |
| 624 | 3300025972 | Ga0207668_10125344 | Ga0207668_101253443 | 246 |
| 625 | 3300025986 | Ga0207658_10015751 | Ga0207658_100157511 | 246 |
| 626 | 3300026041 | Ga0207639_10409940 | Ga0207639_104099402 | 246 |
| 627 | 3300026075 | Ga0207708_10006725 | Ga0207708_100067256 | 246 |
| 628 | 3300026075 | Ga0207708_10041274 | Ga0207708_100412746 | 246 |
| 629 | 3300026075 | Ga0207708_10227457 | Ga0207708_102274572 | 246 |
| 630 | 3300026088 | Ga0207641_10000874 | Ga0207641_100008746 | 246 |
| 631 | 3300026089 | Ga0207648_10005825 | Ga0207648_100058256 | 246 |
| 632 | 3300026118 | Ga0207675_100026496 | Ga0207675_1000264962 | 246 |
| 633 | 3300026118 | Ga0207675_100646857 | Ga0207675_1006468571 | 246 |
| 634 | 3300027907 | Ga0207428_10009231 | Ga0207428_100092312 | 246 |
| 635 | 3300028380 | Ga0268265_10002942 | Ga0268265_100029427 | 246 |
| 636 | 3300028380 | Ga0268265_10355242 | Ga0268265_103552422 | 246 |
| 637 | 3300028381 | Ga0268264_10037638 | Ga0268264_100376383 | 246 |
| 638 | 3300035115 | Ga0373941_0028270 | Ga0373941_0028270_734_1570 | 246 |
| 639 | 3300035121 | Ga0373960_0091831 | Ga0373960_0091831_25_861 | 246 |
| 640 | 3300048907 | Ga0496104_0001736 | Ga0496104_0001736_2757_3578 | 246 |
| 641 | 3300048908 | Ga0496105_0043932 | Ga0496105_0043932_2332_3153 | 246 |
| 642 | 3300048911 | Ga0496108_0001282 | Ga0496108_0001282_1654_2475 | 246 |
| 643 | 3300048912 | Ga0496109_0000572 | Ga0496109_0000572_13724_14545 | 246 |
| 644 | 3300048913 | Ga0496110_0004885 | Ga0496110_0004885_9463_10284 | 246 |
| 645 | 3300048914 | Ga0496111_0052625 | Ga0496111_0052625_995_1816 | 246 |
| 646 | 3300048915 | Ga0496112_0000217 | Ga0496112_0000217_15389_16210 | 246 |
| 647 | 3300050507 | nmdc:mga05p37_32697_c1 | nmdc:mga05p37_32697_c1_5148_5969 | 246 |
| 648 | 3300050510 | nmdc:mga06r32_290387_c1 | nmdc:mga06r32_290387_c1_185_1006 | 246 |
| 649 | 3300050510 | nmdc:mga06r32_61562_c1 | nmdc:mga06r32_61562_c1_1104_1952 | 246 |
| 650 | 3300050511 | nmdc:mga08y16_10005_c1 | nmdc:mga08y16_10005_c1_7904_8788 | 246 |
| 651 | 3300050511 | nmdc:mga08y16_54506_c1 | nmdc:mga08y16_54506_c1_2428_3261 | 246 |
| 652 | 3300050512 | nmdc:mga0n895_293502_c1 | nmdc:mga0n895_293502_c1_291_1127 | 246 |
| 653 | 3300050514 | nmdc:mga08x19_284359_c1 | nmdc:mga08x19_284359_c1_74_931 | 246 |
| 654 | 3300005356 | Ga0070674_100070301 | Ga0070674_1000703012 | 247 |
| 655 | 3300005468 | Ga0070707_100300062 | Ga0070707_1003000622 | 247 |
| 656 | 3300005471 | Ga0070698_100115766 | Ga0070698_1001157661 | 247 |
| 657 | 3300005471 | Ga0070698_100419282 | Ga0070698_1004192821 | 247 |
| 658 | 3300005518 | Ga0070699_100107057 | Ga0070699_1001070574 | 247 |
| 659 | 3300005536 | Ga0070697_100452978 | Ga0070697_1004529782 | 247 |
| 660 | 3300006844 | Ga0075428_100060471 | Ga0075428_1000604712 | 247 |
| 661 | 3300006852 | Ga0075433_10123407 | Ga0075433_101234073 | 247 |
| 662 | 3300006852 | Ga0075433_10313673 | Ga0075433_103136731 | 247 |
| 663 | 3300006871 | Ga0075434_100058394 | Ga0075434_1000583943 | 247 |
| 664 | 3300009147 | Ga0114129_10024941 | Ga0114129_100249416 | 247 |
| 665 | 3300009147 | Ga0114129_10031424 | Ga0114129_100314246 | 247 |
| 666 | 3300009147 | Ga0114129_10294020 | Ga0114129_102940203 | 247 |
| 667 | 3300009147 | Ga0114129_10719821 | Ga0114129_107198212 | 247 |
| 668 | 3300009177 | Ga0105248_10125684 | Ga0105248_101256845 | 247 |
| 669 | 3300025922 | Ga0207646_10247832 | Ga0207646_102478322 | 247 |
| 670 | 3300025937 | Ga0207669_10071619 | Ga0207669_100716194 | 247 |
| 671 | 3300025941 | Ga0207711_10044421 | Ga0207711_100444212 | 247 |
| 672 | 3300028381 | Ga0268264_10510400 | Ga0268264_105104002 | 247 |
| 673 | 3300046684 | Ga0495669_0062038 | Ga0495669_0062038_138_977 | 247 |
| 674 | 3300050507 | nmdc:mga05p37_19809_c1 | nmdc:mga05p37_19809_c1_2044_2883 | 247 |
| 675 | 3300050507 | nmdc:mga05p37_25178_c1 | nmdc:mga05p37_25178_c1_4835_5674 | 247 |
| 676 | 3300050507 | nmdc:mga05p37_56245_c1 | nmdc:mga05p37_56245_c1_1970_2809 | 247 |
| 677 | 3300050512 | nmdc:mga0n895_16945_c1 | nmdc:mga0n895_16945_c1_2426_3265 | 247 |
| 678 | 3300050512 | nmdc:mga0n895_389765_c1 | nmdc:mga0n895_389765_c1_191_1042 | 247 |
| 679 | 3300050515 | nmdc:mga0a205_139575_c1 | nmdc:mga0a205_139575_c1_1094_1933 | 247 |
| 680 | 3300050515 | nmdc:mga0a205_168886_c1 | nmdc:mga0a205_168886_c1_428_1267 | 247 |
| 681 | 3300006871 | Ga0075434_100004203 | Ga0075434_1000042039 | 248 |
| 682 | 3300007076 | Ga0075435_100000882 | Ga0075435_1000008826 | 248 |
| 683 | 3300025937 | Ga0207669_10091392 | Ga0207669_100913923 | 248 |
| 684 | 3300035725 | Ga0373947_0080509 | Ga0373947_0080509_261_1106 | 248 |
| 685 | 3300036401 | Ga0373937_0150704 | Ga0373937_0150704_151_996 | 248 |
| 686 | 3300037068 | Ga0373925_0156271 | Ga0373925_0156271_650_1495 | 248 |
| 687 | 3300046473 | Ga0495582_0330502 | Ga0495582_0330502_21_866 | 248 |
| 688 | 3300050510 | nmdc:mga06r32_635240_c1 | nmdc:mga06r32_635240_c1_36_872 | 248 |
| 689 | 3300050512 | nmdc:mga0n895_1546_c1 | nmdc:mga0n895_1546_c1_6580_7428 | 248 |
| 690 | 3300050513 | nmdc:mga0rr50_8_c1 | nmdc:mga0rr50_8_c1_188158_189006 | 248 |
| 691 | 3300005458 | Ga0070681_10317944 | Ga0070681_103179441 | 249 |
| 692 | 3300005615 | Ga0070702_100063997 | Ga0070702_1000639973 | 249 |
| 693 | 3300014325 | Ga0163163_10004927 | Ga0163163_100049274 | 249 |
| 694 | 3300025315 | Ga0207697_10092291 | Ga0207697_100922912 | 249 |
| 695 | 3300025925 | Ga0207650_10082910 | Ga0207650_100829103 | 249 |
| 696 | 3300026095 | Ga0207676_10016713 | Ga0207676_100167135 | 249 |
| 697 | 3300046514 | Ga0495618_0274435 | Ga0495618_0274435_19_867 | 249 |
| 698 | 3300050508 | nmdc:mga09592_55909_c1 | nmdc:mga09592_55909_c1_2500_3312 | 249 |
| 699 | 3300050509 | nmdc:mga0qj67_62513_c1 | nmdc:mga0qj67_62513_c1_1833_2672 | 249 |
| 700 | 3300005354 | Ga0070675_100004794 | Ga0070675_1000047943 | 250 |
| 701 | 3300005617 | Ga0068859_100110287 | Ga0068859_1001102875 | 250 |
| 702 | 3300006852 | Ga0075433_10130784 | Ga0075433_101307842 | 250 |
| 703 | 3300006931 | Ga0097620_100110288 | Ga0097620_1001102885 | 250 |
| 704 | 3300005331 | Ga0070670_100046518 | Ga0070670_1000465186 | 251 |
| 705 | 3300005336 | Ga0070680_100095629 | Ga0070680_1000956292 | 251 |
| 706 | 3300005354 | Ga0070675_100181715 | Ga0070675_1001817152 | 251 |
| 707 | 3300013296 | Ga0157374_10597305 | Ga0157374_105973052 | 251 |
| 708 | 3300014325 | Ga0163163_10697006 | Ga0163163_106970062 | 251 |
| 709 | 3300025925 | Ga0207650_10019729 | Ga0207650_100197297 | 251 |
| 710 | 3300049572 | Ga0501036_0010569 | Ga0501036_0010569_6774_7583 | 251 |
| 711 | 3300049575 | Ga0501039_0007645 | Ga0501039_0007645_6024_6833 | 251 |
| 712 | 3300049576 | Ga0501040_0184162 | Ga0501040_0184162_619_1428 | 251 |
| 713 | 3300049578 | Ga0501042_0009658 | Ga0501042_0009658_782_1591 | 251 |
| 714 | 3300049580 | Ga0501046_0165786 | Ga0501046_0165786_688_1497 | 251 |
| 715 | 3300049582 | Ga0501048_0128729 | Ga0501048_0128729_847_1656 | 251 |
| 716 | 3300049588 | Ga0501072_0020504 | Ga0501072_0020504_346_1155 | 251 |
| 717 | 3300049590 | Ga0501074_0078777 | Ga0501074_0078777_368_1177 | 251 |
| 718 | 3300049741 | Ga0501079_0086679 | Ga0501079_0086679_15_824 | 251 |
| 719 | 3300049822 | Ga0501035_0280331 | Ga0501035_0280331_485_1294 | 251 |
| 720 | 3300061734 | Ga0530510_0010913 | Ga0530510_0010913_4032_4841 | 251 |
| 721 | 3300009094 | Ga0111539_10001720 | Ga0111539_1000172011 | 252 |
| 722 | 3300009147 | Ga0114129_10061566 | Ga0114129_100615662 | 252 |
| 723 | 3300027907 | Ga0207428_10001587 | Ga0207428_100015879 | 252 |
| 724 | 3300050507 | nmdc:mga05p37_263070_c1 | nmdc:mga05p37_263070_c1_467_1327 | 252 |
| 725 | 3300050510 | nmdc:mga06r32_166886_c1 | nmdc:mga06r32_166886_c1_1004_1864 | 252 |
| 726 | 3300050511 | nmdc:mga08y16_6338_c1 | nmdc:mga08y16_6338_c1_5874_6734 | 252 |
| 727 | 3300006846 | Ga0075430_100048673 | Ga0075430_1000486735 | 254 |
| 728 | 3300006847 | Ga0075431_100023216 | Ga0075431_1000232162 | 254 |
| 729 | 3300050509 | nmdc:mga0qj67_41255_c1 | nmdc:mga0qj67_41255_c1_1822_2679 | 254 |
| 730 | 3300059426 | Ga0590077_008969 | Ga0590077_008969_139_996 | 254 |
| 731 | 3300005367 | Ga0070667_100550813 | Ga0070667_1005508131 | 255 |
| 732 | 3300014326 | Ga0157380_10379905 | Ga0157380_103799052 | 255 |
| 733 | 3300026118 | Ga0207675_100233121 | Ga0207675_1002331212 | 255 |
| 734 | 3300003203 | JGI25406J46586_10000102 | JGI25406J46586_1000010226 | 256 |
| 735 | 3300003203 | JGI25406J46586_10001270 | JGI25406J46586_100012705 | 256 |
| 736 | 3300005295 | Ga0065707_10234770 | Ga0065707_102347701 | 256 |
| 737 | 3300005518 | Ga0070699_100011273 | Ga0070699_1000112732 | 256 |
| 738 | 3300005985 | Ga0081539_10000056 | Ga0081539_10000056112 | 256 |
| 739 | 3300005985 | Ga0081539_10000460 | Ga0081539_1000046054 | 256 |
| 740 | 3300005985 | Ga0081539_10002890 | Ga0081539_1000289022 | 256 |
| 741 | 3300009094 | Ga0111539_10009925 | Ga0111539_100099258 | 256 |
| 742 | 3300025908 | Ga0207643_10143862 | Ga0207643_101438622 | 256 |
| 743 | 3300050511 | nmdc:mga08y16_259387_c1 | nmdc:mga08y16_259387_c1_606_1448 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.7896 | 18 | 229 |
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.7677 | 18 | 229 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.7335 | 24 | 183 |
| 4q7c-assembly1.cif.gz_B | structure of af2299, a cdp-alcohol phosphotransferase | 0.7035 | 24 | 184 |
| 6wm5-assembly1.cif.gz_C | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii | 0.6852 | 20 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZGY5_32_207_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8972 | 14 | 190 | 1.20.120.1760 |
| af_E7F188_23_199_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8801 | 9 | 190 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8651 | 23 | 163 | 1.20.120.1760 |
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8419 | 23 | 186 | 1.20.120.1760 |
| af_D3ZGY5_32_207_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8308 | 14 | 190 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832EXD2-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase | 0.9883 | 19 | 107 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A7C7K264-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase | 0.9534 | 20 | 130 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A382IQ04-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase | 0.9445 | 18 | 132 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A497CZS9-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase | 0.9393 | 20 | 130 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A545T1Z0-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9344 | 21 | 234 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar