F478692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 339 | 1486 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300025940|Ga0207691_10074203|Ga0207691_100742032 |
| Length | 371 |
| Sequence | MINWFTSASLRFPCVSAFLSASLRSSLRLCFTFFATLSYPLRLWVTTTINYLLANLHIVMSITSLFKIEYPIVQAGMVWTSGWRLASAVSNAGGLGLIGSGSMYPDVLREHIRKCRAATDKPFGVNIPILYSDINKHMEIVMEEGVKIIFTSAGNPKTWTSVLKEKGITVVHVVSSSKFAKKAEESGCDAVVAEGFEAGGHNGREETTTFVLVPMVKEAVSIPVMAAGGIATGRQMLAAMVLGADGVQVGSRFAASEEASIHNNFKKAIIDATEGDTLLSLKQVVPVRLMKNKFYQLVEEAEKRGADAAELAALLGRGRAKKGMFEGDIENGELEIGQVSAMLYDILPAGKIVSQLWQEYLEALKDPIHQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 89 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 90 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 176 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 215 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 216 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 217 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 218 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 262 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 263 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 275 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 276 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 278 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 279 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 280 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 282 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 283 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 284 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 285 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 286 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 287 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 288 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 289 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 290 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 291 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 292 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 293 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 294 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 295 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 296 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 297 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 298 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 299 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 300 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 301 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 302 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 303 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 304 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 305 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 306 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 307 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 308 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 309 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 310 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 311 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 312 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 313 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 314 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 315 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 316 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 317 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 318 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 319 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 320 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 321 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 322 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 323 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 324 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 325 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 326 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 327 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 328 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 329 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 330 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 331 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 332 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 333 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 334 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 335 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 336 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 337 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 338 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 339 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.19 |
| Metatranscriptomes | 0 |
| Isolates | 7.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 3.5 |
| Nodule | 0.81 |
| Rhizoplane | 0.54 |
| Rhizosphere | 87.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207691_10074203 | 3300025940 | Bacteria | 3068 |
| 2 | SwRhRL2b_contig_222865 | 2162886007 | Bacteria | 1282 |
| 3 | JGI24751J29686_10000969 | 3300002459 | Bacteria | 6311 |
| 4 | JGI25154J39366_1000002 | 3300002738 | Bacteria | 466942 |
| 5 | JGI25159J45721_1022740 | 3300002987 | Bacteria | 1152 |
| 6 | JGI25406J46586_10000469 | 3300003203 | Bacteria | 18825 |
| 7 | JGI25153J46596_10000442 | 3300003215 | Bacteria | 26683 |
| 8 | rootH1_10123138 | 3300003316 | Bacteria | 5152 |
| 9 | rootH2_10072046 | 3300003320 | Bacteria | 6824 |
| 10 | rootH2_10092365 | 3300003320 | Bacteria | 2057 |
| 11 | rootH2_10094093 | 3300003320 | Bacteria | 1593 |
| 12 | rootH2_10177331 | 3300003320 | Bacteria | 3480 |
| 13 | rootL2_10060945 | 3300003322 | Bacteria | 2560 |
| 14 | rootL2_10070185 | 3300003322 | Bacteria | 7356 |
| 15 | rootL2_10077208 | 3300003322 | Bacteria | 1962 |
| 16 | rootL2_10128079 | 3300003322 | Bacteria | 2630 |
| 17 | rootL2_10198780 | 3300003322 | Bacteria | 2606 |
| 18 | rootH1_10004531 | 3300003323 | Bacteria | 21017 |
| 19 | rootH1_10047386 | 3300003323 | Bacteria | 13847 |
| 20 | rootH1_10118920 | 3300003323 | Bacteria | 5683 |
| 21 | JGI25160J50197_1003902 | 3300003354 | Bacteria | 6535 |
| 22 | Ga0055542_1002479 | 3300003762 | Bacteria | 6031 |
| 23 | Ga0055526_1038586 | 3300003771 | Bacteria | 1229 |
| 24 | Ga0055528_1000403 | 3300003790 | Bacteria | 35028 |
| 25 | Ga0055530_10000192 | 3300003791 | Bacteria | 54681 |
| 26 | Ga0065165_1000471 | 3300005262 | Bacteria | 62792 |
| 27 | Ga0065714_10006385 | 3300005288 | Bacteria | 4307 |
| 28 | Ga0065704_10088122 | 3300005289 | Bacteria | 2966 |
| 29 | Ga0065715_10007518 | 3300005293 | Bacteria | 3101 |
| 30 | Ga0070658_10055020 | 3300005327 | Bacteria | 3232 |
| 31 | Ga0070676_10052308 | 3300005328 | Bacteria | 2401 |
| 32 | Ga0070683_100013297 | 3300005329 | Bacteria | 7176 |
| 33 | Ga0070683_100013478 | 3300005329 | Bacteria | 7131 |
| 34 | Ga0070683_100269621 | 3300005329 | Bacteria | 1619 |
| 35 | Ga0070690_100076768 | 3300005330 | Bacteria | 2180 |
| 36 | Ga0070670_100020475 | 3300005331 | Bacteria | 5687 |
| 37 | Ga0070670_100059498 | 3300005331 | Bacteria | 3279 |
| 38 | Ga0070670_100071414 | 3300005331 | Bacteria | 2981 |
| 39 | Ga0070670_100113482 | 3300005331 | Unclassified | 2336 |
| 40 | Ga0070670_100256490 | 3300005331 | Bacteria | 1524 |
| 41 | Ga0070670_100275100 | 3300005331 | Bacteria | 1470 |
| 42 | Ga0070677_10003773 | 3300005333 | Bacteria | 4900 |
| 43 | Ga0068869_100006120 | 3300005334 | Bacteria | 7613 |
| 44 | Ga0068869_100009276 | 3300005334 | Bacteria | 6380 |
| 45 | Ga0068869_100011552 | 3300005334 | Bacteria | 5796 |
| 46 | Ga0068869_100049809 | 3300005334 | Unclassified | 3034 |
| 47 | Ga0068869_100112028 | 3300005334 | Unclassified | 2077 |
| 48 | Ga0068869_100149228 | 3300005334 | Bacteria | 1812 |
| 49 | Ga0070666_10000197 | 3300005335 | Bacteria | 41178 |
| 50 | Ga0070666_10010755 | 3300005335 | Bacteria | 5725 |
| 51 | Ga0070680_100001463 | 3300005336 | Bacteria | 17124 |
| 52 | Ga0070680_100139213 | 3300005336 | Bacteria | 2034 |
| 53 | Ga0070682_100000746 | 3300005337 | Bacteria | 19419 |
| 54 | Ga0070682_100004192 | 3300005337 | Bacteria | 7996 |
| 55 | Ga0070682_100013593 | 3300005337 | Bacteria | 4688 |
| 56 | Ga0068868_100001462 | 3300005338 | Bacteria | 16301 |
| 57 | Ga0068868_100015057 | 3300005338 | Bacteria | 5712 |
| 58 | Ga0068868_100024322 | 3300005338 | Bacteria | 4595 |
| 59 | Ga0068868_100034198 | 3300005338 | Bacteria | 3923 |
| 60 | Ga0068868_100085227 | 3300005338 | Bacteria | 2538 |
| 61 | Ga0068868_100098293 | 3300005338 | Bacteria | 2367 |
| 62 | Ga0068868_100108663 | 3300005338 | Bacteria | 2252 |
| 63 | Ga0070689_100033464 | 3300005340 | Bacteria | 3917 |
| 64 | Ga0070689_100043322 | 3300005340 | Bacteria | 3458 |
| 65 | Ga0070689_100101410 | 3300005340 | Bacteria | 2278 |
| 66 | Ga0070691_10006228 | 3300005341 | Bacteria | 5445 |
| 67 | Ga0070687_100023187 | 3300005343 | Bacteria | 2947 |
| 68 | Ga0070687_100024252 | 3300005343 | Bacteria | 2893 |
| 69 | Ga0070661_100048542 | 3300005344 | Bacteria | 3107 |
| 70 | Ga0070668_100000150 | 3300005347 | Bacteria | 44112 |
| 71 | Ga0070668_100115603 | 3300005347 | Bacteria | 2139 |
| 72 | Ga0070668_100240828 | 3300005347 | Bacteria | 1498 |
| 73 | Ga0070668_100303312 | 3300005347 | Bacteria | 1340 |
| 74 | Ga0070669_100000684 | 3300005353 | Bacteria | 24819 |
| 75 | Ga0070669_100069874 | 3300005353 | Bacteria | 2594 |
| 76 | Ga0070669_100085461 | 3300005353 | Bacteria | 2356 |
| 77 | Ga0070669_100151206 | 3300005353 | Bacteria | 1797 |
| 78 | Ga0070669_100340567 | 3300005353 | Bacteria | 1215 |
| 79 | Ga0070669_100354542 | 3300005353 | Bacteria | 1192 |
| 80 | Ga0070675_100107298 | 3300005354 | Bacteria | 2358 |
| 81 | Ga0070675_100126933 | 3300005354 | Bacteria | 2171 |
| 82 | Ga0070675_100226505 | 3300005354 | Bacteria | 1630 |
| 83 | Ga0070675_100261920 | 3300005354 | Bacteria | 1515 |
| 84 | Ga0070671_100000785 | 3300005355 | Bacteria | 22867 |
| 85 | Ga0070671_100015192 | 3300005355 | Bacteria | 6219 |
| 86 | Ga0070671_100027026 | 3300005355 | Bacteria | 4722 |
| 87 | Ga0070671_100040659 | 3300005355 | Bacteria | 3863 |
| 88 | Ga0070674_100058996 | 3300005356 | Bacteria | 2670 |
| 89 | Ga0070674_100128892 | 3300005356 | Bacteria | 1883 |
| 90 | Ga0070673_100002484 | 3300005364 | Bacteria | 11257 |
| 91 | Ga0070673_100006938 | 3300005364 | Bacteria | 7412 |
| 92 | Ga0070673_100044198 | 3300005364 | Bacteria | 3448 |
| 93 | Ga0070673_100053086 | 3300005364 | Bacteria | 3182 |
| 94 | Ga0070673_100065753 | 3300005364 | Unclassified | 2894 |
| 95 | Ga0070673_100083385 | 3300005364 | Bacteria | 2597 |
| 96 | Ga0070688_100037591 | 3300005365 | Bacteria | 2950 |
| 97 | Ga0070688_100078843 | 3300005365 | Bacteria | 2126 |
| 98 | Ga0070688_100099885 | 3300005365 | Unclassified | 1911 |
| 99 | Ga0070667_100004914 | 3300005367 | Bacteria | 11203 |
| 100 | Ga0070667_100039271 | 3300005367 | Bacteria | 3967 |
| 101 | Ga0070667_100051810 | 3300005367 | Bacteria | 3461 |
| 102 | Ga0070667_100070666 | 3300005367 | Bacteria | 2972 |
| 103 | Ga0070667_100076000 | 3300005367 | Bacteria | 2867 |
| 104 | Ga0070701_10236176 | 3300005438 | Bacteria | 1097 |
| 105 | Ga0070678_100019430 | 3300005456 | Unclassified | 4429 |
| 106 | Ga0070662_100008456 | 3300005457 | Bacteria | 6712 |
| 107 | Ga0070662_100027946 | 3300005457 | Bacteria | 3922 |
| 108 | Ga0070662_100050949 | 3300005457 | Bacteria | 2988 |
| 109 | Ga0070662_100069735 | 3300005457 | Bacteria | 2588 |
| 110 | Ga0070662_100277653 | 3300005457 | Bacteria | 1355 |
| 111 | Ga0070662_100403945 | 3300005457 | Bacteria | 1128 |
| 112 | Ga0070681_10011641 | 3300005458 | Bacteria | 8710 |
| 113 | Ga0068867_100003811 | 3300005459 | Bacteria | 10607 |
| 114 | Ga0068867_100038807 | 3300005459 | Bacteria | 3469 |
| 115 | Ga0068867_100134851 | 3300005459 | Bacteria | 1923 |
| 116 | Ga0068867_100172879 | 3300005459 | Bacteria | 1712 |
| 117 | Ga0070685_10013579 | 3300005466 | Bacteria | 4298 |
| 118 | Ga0070685_10138355 | 3300005466 | Bacteria | 1530 |
| 119 | Ga0070685_10253404 | 3300005466 | Bacteria | 1167 |
| 120 | Ga0070706_100457222 | 3300005467 | Bacteria | 1188 |
| 121 | Ga0070698_100001014 | 3300005471 | Bacteria | 30868 |
| 122 | Ga0070698_100013818 | 3300005471 | Bacteria | 8541 |
| 123 | Ga0070699_100043816 | 3300005518 | Bacteria | 3873 |
| 124 | Ga0070679_100004632 | 3300005530 | Bacteria | 12694 |
| 125 | Ga0070679_100020771 | 3300005530 | Bacteria | 6405 |
| 126 | Ga0070679_100032240 | 3300005530 | Bacteria | 5181 |
| 127 | Ga0070679_100049032 | 3300005530 | Bacteria | 4206 |
| 128 | Ga0070679_100057004 | 3300005530 | Bacteria | 3893 |
| 129 | Ga0070679_100089190 | 3300005530 | Bacteria | 3071 |
| 130 | Ga0070684_100012410 | 3300005535 | Bacteria | 6828 |
| 131 | Ga0070684_100061961 | 3300005535 | Bacteria | 3275 |
| 132 | Ga0070684_100341933 | 3300005535 | Bacteria | 1376 |
| 133 | Ga0068853_100006195 | 3300005539 | Bacteria | 9472 |
| 134 | Ga0068853_100038073 | 3300005539 | Bacteria | 4095 |
| 135 | Ga0068853_100049243 | 3300005539 | Bacteria | 3621 |
| 136 | Ga0068853_100124603 | 3300005539 | Bacteria | 2301 |
| 137 | Ga0070672_100026671 | 3300005543 | Bacteria | 4303 |
| 138 | Ga0070672_100089337 | 3300005543 | Unclassified | 2482 |
| 139 | Ga0070672_100199240 | 3300005543 | Bacteria | 1674 |
| 140 | Ga0070686_100023936 | 3300005544 | Unclassified | 3656 |
| 141 | Ga0070686_100079835 | 3300005544 | Bacteria | 2163 |
| 142 | Ga0070693_100002444 | 3300005547 | Bacteria | 8558 |
| 143 | Ga0070693_100009879 | 3300005547 | Bacteria | 4761 |
| 144 | Ga0070665_100004781 | 3300005548 | Bacteria | 14098 |
| 145 | Ga0070665_100152673 | 3300005548 | Bacteria | 2312 |
| 146 | Ga0070704_100039067 | 3300005549 | Bacteria | 3256 |
| 147 | Ga0068855_100031076 | 3300005563 | Bacteria | 6380 |
| 148 | Ga0068855_100165265 | 3300005563 | Bacteria | 2509 |
| 149 | Ga0070664_100007054 | 3300005564 | Bacteria | 9067 |
| 150 | Ga0070664_100016373 | 3300005564 | Bacteria | 6077 |
| 151 | Ga0070664_100051981 | 3300005564 | Bacteria | 3470 |
| 152 | Ga0068857_100154255 | 3300005577 | Bacteria | 2082 |
| 153 | Ga0068857_100442631 | 3300005577 | Bacteria | 1214 |
| 154 | Ga0068857_100538287 | 3300005577 | Bacteria | 1099 |
| 155 | Ga0068854_100227998 | 3300005578 | Bacteria | 1477 |
| 156 | Ga0068856_100007483 | 3300005614 | Bacteria | 10660 |
| 157 | Ga0070702_100006790 | 3300005615 | Bacteria | 5441 |
| 158 | Ga0068852_100008988 | 3300005616 | Bacteria | 7396 |
| 159 | Ga0068852_100084002 | 3300005616 | Bacteria | 2832 |
| 160 | Ga0068852_100208149 | 3300005616 | Bacteria | 1854 |
| 161 | Ga0068852_100599348 | 3300005616 | Bacteria | 1106 |
| 162 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 163 | Ga0068859_100001558 | 3300005617 | Bacteria | 23386 |
| 164 | Ga0068859_100028833 | 3300005617 | Bacteria | 5567 |
| 165 | Ga0068859_100046339 | 3300005617 | Bacteria | 4366 |
| 166 | Ga0068859_100087483 | 3300005617 | Bacteria | 3164 |
| 167 | Ga0068859_100091904 | 3300005617 | Bacteria | 3086 |
| 168 | Ga0068859_100122650 | 3300005617 | Bacteria | 2665 |
| 169 | Ga0068859_100197792 | 3300005617 | Bacteria | 2094 |
| 170 | Ga0068859_100205340 | 3300005617 | Unclassified | 2055 |
| 171 | Ga0068859_100565995 | 3300005617 | Bacteria | 1230 |
| 172 | Ga0068864_100000588 | 3300005618 | Bacteria | 30940 |
| 173 | Ga0068864_100015735 | 3300005618 | Bacteria | 6291 |
| 174 | Ga0068864_100101111 | 3300005618 | Unclassified | 2557 |
| 175 | Ga0068864_100104636 | 3300005618 | Bacteria | 2514 |
| 176 | Ga0068864_100276508 | 3300005618 | Bacteria | 1566 |
| 177 | Ga0068861_100008331 | 3300005719 | Bacteria | 7129 |
| 178 | Ga0068861_100106090 | 3300005719 | Bacteria | 2244 |
| 179 | Ga0068861_100450809 | 3300005719 | Bacteria | 1153 |
| 180 | Ga0068851_10009667 | 3300005834 | Bacteria | 4490 |
| 181 | Ga0068851_10055112 | 3300005834 | Bacteria | 2025 |
| 182 | Ga0068851_10065936 | 3300005834 | Bacteria | 1865 |
| 183 | Ga0068870_10005271 | 3300005840 | Bacteria | 5631 |
| 184 | Ga0068870_10044741 | 3300005840 | Unclassified | 2314 |
| 185 | Ga0068863_100000444 | 3300005841 | Bacteria | 41977 |
| 186 | Ga0068863_100007240 | 3300005841 | Bacteria | 10873 |
| 187 | Ga0068863_100021443 | 3300005841 | Bacteria | 6165 |
| 188 | Ga0068863_100067546 | 3300005841 | Bacteria | 3382 |
| 189 | Ga0068858_100003038 | 3300005842 | Bacteria | 16817 |
| 190 | Ga0068858_100125108 | 3300005842 | Bacteria | 2406 |
| 191 | Ga0068858_100220572 | 3300005842 | Bacteria | 1796 |
| 192 | Ga0068858_100429408 | 3300005842 | Bacteria | 1271 |
| 193 | Ga0068860_100000661 | 3300005843 | Bacteria | 40073 |
| 194 | Ga0068860_100002053 | 3300005843 | Bacteria | 21203 |
| 195 | Ga0068860_100010583 | 3300005843 | Bacteria | 9112 |
| 196 | Ga0068860_100075954 | 3300005843 | Bacteria | 3195 |
| 197 | Ga0068860_100385533 | 3300005843 | Bacteria | 1384 |
| 198 | Ga0068862_100002714 | 3300005844 | Bacteria | 15540 |
| 199 | Ga0068862_100003587 | 3300005844 | Bacteria | 13289 |
| 200 | Ga0068862_100184986 | 3300005844 | Unclassified | 1872 |
| 201 | Ga0081539_10000345 | 3300005985 | Bacteria | 102083 |
| 202 | Ga0081539_10039312 | 3300005985 | Bacteria | 2793 |
| 203 | Ga0075366_10018368 | 3300006195 | Bacteria | 4036 |
| 204 | Ga0097621_100000250 | 3300006237 | Bacteria | 36249 |
| 205 | Ga0097621_100006407 | 3300006237 | Bacteria | 8353 |
| 206 | Ga0097621_100017391 | 3300006237 | Bacteria | 5459 |
| 207 | Ga0097621_100022094 | 3300006237 | Bacteria | 4935 |
| 208 | Ga0097621_100040304 | 3300006237 | Bacteria | 3755 |
| 209 | Ga0097621_100136371 | 3300006237 | Bacteria | 2093 |
| 210 | Ga0097621_100178995 | 3300006237 | Bacteria | 1831 |
| 211 | Ga0075370_10050635 | 3300006353 | Bacteria | 2356 |
| 212 | Ga0068871_100001641 | 3300006358 | Bacteria | 15081 |
| 213 | Ga0068871_100002754 | 3300006358 | Bacteria | 12010 |
| 214 | Ga0068871_100007063 | 3300006358 | Bacteria | 8004 |
| 215 | Ga0068871_100020767 | 3300006358 | Bacteria | 5036 |
| 216 | Ga0068871_100025073 | 3300006358 | Bacteria | 4634 |
| 217 | Ga0068871_100318460 | 3300006358 | Bacteria | 1369 |
| 218 | Ga0075428_100000697 | 3300006844 | Bacteria | 34709 |
| 219 | Ga0075430_100219420 | 3300006846 | Bacteria | 1578 |
| 220 | Ga0075434_100062765 | 3300006871 | Bacteria | 3699 |
| 221 | Ga0075429_100006131 | 3300006880 | Bacteria | 10392 |
| 222 | Ga0068865_100000270 | 3300006881 | Bacteria | 28438 |
| 223 | Ga0068865_100090604 | 3300006881 | Unclassified | 2218 |
| 224 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 225 | Ga0097620_100001558 | 3300006931 | Bacteria | 23386 |
| 226 | Ga0097620_100028833 | 3300006931 | Bacteria | 5567 |
| 227 | Ga0097620_100046340 | 3300006931 | Bacteria | 4366 |
| 228 | Ga0097620_100087484 | 3300006931 | Bacteria | 3164 |
| 229 | Ga0097620_100091906 | 3300006931 | Bacteria | 3086 |
| 230 | Ga0097620_100122653 | 3300006931 | Bacteria | 2665 |
| 231 | Ga0097620_100197791 | 3300006931 | Bacteria | 2094 |
| 232 | Ga0097620_100205341 | 3300006931 | Unclassified | 2055 |
| 233 | Ga0097620_100566013 | 3300006931 | Bacteria | 1230 |
| 234 | Ga0099824_1018449 | 3300006942 | Bacteria | 5728 |
| 235 | Ga0079104_1000271 | 3300006946 | Bacteria | 67895 |
| 236 | Ga0099826_10001648 | 3300006948 | Bacteria | 13672 |
| 237 | Ga0105240_10007181 | 3300009093 | Bacteria | 16222 |
| 238 | Ga0105240_10009267 | 3300009093 | Bacteria | 13961 |
| 239 | Ga0105240_10169854 | 3300009093 | Bacteria | 2584 |
| 240 | Ga0105240_10205016 | 3300009093 | Unclassified | 2309 |
| 241 | Ga0111539_10006077 | 3300009094 | Bacteria | 15590 |
| 242 | Ga0111539_10236413 | 3300009094 | Bacteria | 2127 |
| 243 | Ga0105247_10012726 | 3300009101 | Bacteria | 5049 |
| 244 | Ga0105247_10072386 | 3300009101 | Bacteria | 2157 |
| 245 | Ga0114129_10110174 | 3300009147 | Bacteria | 3800 |
| 246 | Ga0105241_10000147 | 3300009174 | Bacteria | 50428 |
| 247 | Ga0105241_10001335 | 3300009174 | Bacteria | 18732 |
| 248 | Ga0105241_10016066 | 3300009174 | Bacteria | 5488 |
| 249 | Ga0105241_10094160 | 3300009174 | Bacteria | 2368 |
| 250 | Ga0105242_10025659 | 3300009176 | Bacteria | 4666 |
| 251 | Ga0105242_10066533 | 3300009176 | Bacteria | 2976 |
| 252 | Ga0105242_10071844 | 3300009176 | Bacteria | 2873 |
| 253 | Ga0105242_10356068 | 3300009176 | Bacteria | 1353 |
| 254 | Ga0105237_10001853 | 3300009545 | Bacteria | 27135 |
| 255 | Ga0105237_10146102 | 3300009545 | Bacteria | 2360 |
| 256 | Ga0105237_10270216 | 3300009545 | Bacteria | 1703 |
| 257 | Ga0105249_10002091 | 3300009553 | Bacteria | 17312 |
| 258 | Ga0105249_10029947 | 3300009553 | Bacteria | 4917 |
| 259 | Ga0105249_10046883 | 3300009553 | Bacteria | 3935 |
| 260 | Ga0105249_10255016 | 3300009553 | Bacteria | 1740 |
| 261 | Ga0105249_10286814 | 3300009553 | Bacteria | 1646 |
| 262 | Ga0105239_10000240 | 3300010375 | Bacteria | 81097 |
| 263 | Ga0105239_10008674 | 3300010375 | Bacteria | 11515 |
| 264 | Ga0105239_10694479 | 3300010375 | Bacteria | 1163 |
| 265 | Ga0105239_10696851 | 3300010375 | Bacteria | 1161 |
| 266 | Ga0105239_10868367 | 3300010375 | Bacteria | 1035 |
| 267 | Ga0105246_10015172 | 3300011119 | Bacteria | 4860 |
| 268 | Ga0105246_10033751 | 3300011119 | Bacteria | 3404 |
| 269 | Ga0105246_10054852 | 3300011119 | Unclassified | 2748 |
| 270 | Ga0105246_10114034 | 3300011119 | Bacteria | 1991 |
| 271 | Ga0105246_10220100 | 3300011119 | Bacteria | 1488 |
| 272 | Ga0157373_10000012 | 3300013100 | Bacteria | 188666 |
| 273 | Ga0157373_10003271 | 3300013100 | Bacteria | 12236 |
| 274 | Ga0157373_10083610 | 3300013100 | Bacteria | 2250 |
| 275 | Ga0157371_10013452 | 3300013102 | Bacteria | 6213 |
| 276 | Ga0157371_10029577 | 3300013102 | Bacteria | 3959 |
| 277 | Ga0157371_10054414 | 3300013102 | Bacteria | 2842 |
| 278 | Ga0157370_10000319 | 3300013104 | Bacteria | 60498 |
| 279 | Ga0157370_10000549 | 3300013104 | Bacteria | 46792 |
| 280 | Ga0157370_10006906 | 3300013104 | Bacteria | 12414 |
| 281 | Ga0157370_10008707 | 3300013104 | Bacteria | 10919 |
| 282 | Ga0157370_10012265 | 3300013104 | Bacteria | 8897 |
| 283 | Ga0157370_10022264 | 3300013104 | Bacteria | 6306 |
| 284 | Ga0157370_10131662 | 3300013104 | Bacteria | 2333 |
| 285 | Ga0157370_10188098 | 3300013104 | Bacteria | 1917 |
| 286 | Ga0157369_10009277 | 3300013105 | Bacteria | 11257 |
| 287 | Ga0157369_10019067 | 3300013105 | Bacteria | 7680 |
| 288 | Ga0157369_10114631 | 3300013105 | Bacteria | 2862 |
| 289 | Ga0157369_10253642 | 3300013105 | Bacteria | 1836 |
| 290 | Ga0157374_10003011 | 3300013296 | Bacteria | 14108 |
| 291 | Ga0157374_10003032 | 3300013296 | Bacteria | 14074 |
| 292 | Ga0157374_10005065 | 3300013296 | Bacteria | 11052 |
| 293 | Ga0157374_10019854 | 3300013296 | Bacteria | 5956 |
| 294 | Ga0157374_10021072 | 3300013296 | Bacteria | 5793 |
| 295 | Ga0157374_10142237 | 3300013296 | Bacteria | 2329 |
| 296 | Ga0157374_10326315 | 3300013296 | Bacteria | 1522 |
| 297 | Ga0157378_10006187 | 3300013297 | Bacteria | 10471 |
| 298 | Ga0157378_10012950 | 3300013297 | Bacteria | 7296 |
| 299 | Ga0157378_10039467 | 3300013297 | Bacteria | 4187 |
| 300 | Ga0157378_10100844 | 3300013297 | Unclassified | 2636 |
| 301 | Ga0157378_10139763 | 3300013297 | Bacteria | 2248 |
| 302 | Ga0157378_10271618 | 3300013297 | Bacteria | 1631 |
| 303 | Ga0163162_10000406 | 3300013306 | Bacteria | 39456 |
| 304 | Ga0163162_10004042 | 3300013306 | Bacteria | 14074 |
| 305 | Ga0163162_10009348 | 3300013306 | Bacteria | 9533 |
| 306 | Ga0163162_10012674 | 3300013306 | Bacteria | 8230 |
| 307 | Ga0163162_10014865 | 3300013306 | Bacteria | 7601 |
| 308 | Ga0163162_10040326 | 3300013306 | Bacteria | 4669 |
| 309 | Ga0163162_10070766 | 3300013306 | Bacteria | 3540 |
| 310 | Ga0163162_10119474 | 3300013306 | Unclassified | 2739 |
| 311 | Ga0163162_10180192 | 3300013306 | Bacteria | 2239 |
| 312 | Ga0163162_10275796 | 3300013306 | Unclassified | 1813 |
| 313 | Ga0163162_10842777 | 3300013306 | Bacteria | 1032 |
| 314 | Ga0157372_10002904 | 3300013307 | Bacteria | 18532 |
| 315 | Ga0157372_10040228 | 3300013307 | Bacteria | 5162 |
| 316 | Ga0157372_10047057 | 3300013307 | Bacteria | 4791 |
| 317 | Ga0157372_10103231 | 3300013307 | Bacteria | 3257 |
| 318 | Ga0157372_10126112 | 3300013307 | Bacteria | 2943 |
| 319 | Ga0157372_10167412 | 3300013307 | Bacteria | 2542 |
| 320 | Ga0157372_10248314 | 3300013307 | Bacteria | 2065 |
| 321 | Ga0157372_10287337 | 3300013307 | Bacteria | 1913 |
| 322 | Ga0157375_10000483 | 3300013308 | Bacteria | 36292 |
| 323 | Ga0157375_10003520 | 3300013308 | Bacteria | 13581 |
| 324 | Ga0157375_10009439 | 3300013308 | Bacteria | 8566 |
| 325 | Ga0157375_10014733 | 3300013308 | Bacteria | 6987 |
| 326 | Ga0157375_10038886 | 3300013308 | Bacteria | 4572 |
| 327 | Ga0157375_10038922 | 3300013308 | Bacteria | 4570 |
| 328 | Ga0157375_10065040 | 3300013308 | Bacteria | 3634 |
| 329 | Ga0157375_10191858 | 3300013308 | Bacteria | 2198 |
| 330 | Ga0157375_10350073 | 3300013308 | Bacteria | 1643 |
| 331 | Ga0157375_10425604 | 3300013308 | Bacteria | 1494 |
| 332 | Ga0163163_10000668 | 3300014325 | Bacteria | 29354 |
| 333 | Ga0163163_10000814 | 3300014325 | Bacteria | 26541 |
| 334 | Ga0163163_10003526 | 3300014325 | Bacteria | 13287 |
| 335 | Ga0163163_10051366 | 3300014325 | Bacteria | 4065 |
| 336 | Ga0163163_10112707 | 3300014325 | Bacteria | 2749 |
| 337 | Ga0163163_10175721 | 3300014325 | Bacteria | 2188 |
| 338 | Ga0163163_10189303 | 3300014325 | Bacteria | 2106 |
| 339 | Ga0163163_10204283 | 3300014325 | Bacteria | 2024 |
| 340 | Ga0157380_10023116 | 3300014326 | Bacteria | 4687 |
| 341 | Ga0157380_10091802 | 3300014326 | Unclassified | 2508 |
| 342 | Ga0157377_10010837 | 3300014745 | Bacteria | 4526 |
| 343 | Ga0157377_10019341 | 3300014745 | Bacteria | 3557 |
| 344 | Ga0157377_10028121 | 3300014745 | Bacteria | 3024 |
| 345 | Ga0157379_10000784 | 3300014968 | Bacteria | 25788 |
| 346 | Ga0157379_10022752 | 3300014968 | Bacteria | 5554 |
| 347 | Ga0157379_10150942 | 3300014968 | Bacteria | 2096 |
| 348 | Ga0157379_10261826 | 3300014968 | Bacteria | 1571 |
| 349 | Ga0157376_10000353 | 3300014969 | Bacteria | 30588 |
| 350 | Ga0157376_10003428 | 3300014969 | Bacteria | 10916 |
| 351 | Ga0157376_10026021 | 3300014969 | Bacteria | 4617 |
| 352 | Ga0157376_10027908 | 3300014969 | Bacteria | 4481 |
| 353 | Ga0157376_10071914 | 3300014969 | Bacteria | 2941 |
| 354 | Ga0157376_10090933 | 3300014969 | Bacteria | 2643 |
| 355 | Ga0157376_10145283 | 3300014969 | Bacteria | 2133 |
| 356 | Ga0157376_10322893 | 3300014969 | Bacteria | 1468 |
| 357 | Ga0182006_1012778 | 3300015261 | Bacteria | 3666 |
| 358 | Ga0182006_1038940 | 3300015261 | Bacteria | 1878 |
| 359 | Ga0163161_10001881 | 3300017792 | Bacteria | 15314 |
| 360 | Ga0163161_10004936 | 3300017792 | Bacteria | 9279 |
| 361 | Ga0163161_10024983 | 3300017792 | Bacteria | 4224 |
| 362 | Ga0163161_10150044 | 3300017792 | Bacteria | 1771 |
| 363 | Ga0163161_10318761 | 3300017792 | Bacteria | 1228 |
| 364 | Ga0213876_10003069 | 3300021384 | Bacteria | 9661 |
| 365 | Ga0209258_100288 | 3300025242 | Bacteria | 82681 |
| 366 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 367 | Ga0209026_1000322 | 3300025250 | Bacteria | 50696 |
| 368 | Ga0209148_1000269 | 3300025254 | Bacteria | 81695 |
| 369 | Ga0209130_1008683 | 3300025284 | Bacteria | 2974 |
| 370 | Ga0209758_1002054 | 3300025297 | Bacteria | 21540 |
| 371 | Ga0209758_1006416 | 3300025297 | Bacteria | 8469 |
| 372 | Ga0207426_1000189 | 3300025302 | Bacteria | 153457 |
| 373 | Ga0207426_1000233 | 3300025302 | Bacteria | 127848 |
| 374 | Ga0207426_1002647 | 3300025302 | Bacteria | 11036 |
| 375 | Ga0207697_10018880 | 3300025315 | Bacteria | 2825 |
| 376 | Ga0207656_10005441 | 3300025321 | Bacteria | 4501 |
| 377 | Ga0207682_10011973 | 3300025893 | Unclassified | 3387 |
| 378 | Ga0207682_10013516 | 3300025893 | Bacteria | 3181 |
| 379 | Ga0207642_10065789 | 3300025899 | Bacteria | 1704 |
| 380 | Ga0207710_10007460 | 3300025900 | Bacteria | 4631 |
| 381 | Ga0207688_10037205 | 3300025901 | Bacteria | 2699 |
| 382 | Ga0207688_10089788 | 3300025901 | Bacteria | 1763 |
| 383 | Ga0207680_10000172 | 3300025903 | Bacteria | 31500 |
| 384 | Ga0207680_10003430 | 3300025903 | Bacteria | 7474 |
| 385 | Ga0207680_10258382 | 3300025903 | Bacteria | 1205 |
| 386 | Ga0207647_10000530 | 3300025904 | Bacteria | 30443 |
| 387 | Ga0207645_10000093 | 3300025907 | Bacteria | 64854 |
| 388 | Ga0207645_10008578 | 3300025907 | Bacteria | 7120 |
| 389 | Ga0207645_10010212 | 3300025907 | Bacteria | 6454 |
| 390 | Ga0207645_10022768 | 3300025907 | Bacteria | 4073 |
| 391 | Ga0207643_10012278 | 3300025908 | Bacteria | 4632 |
| 392 | Ga0207643_10054452 | 3300025908 | Unclassified | 2274 |
| 393 | Ga0207705_10135990 | 3300025909 | Bacteria | 1832 |
| 394 | Ga0207654_10001168 | 3300025911 | Bacteria | 14087 |
| 395 | Ga0207654_10002138 | 3300025911 | Bacteria | 10117 |
| 396 | Ga0207654_10015092 | 3300025911 | Bacteria | 4000 |
| 397 | Ga0207707_10000293 | 3300025912 | Bacteria | 53373 |
| 398 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 399 | Ga0207695_10028248 | 3300025913 | Bacteria | 6226 |
| 400 | Ga0207695_10028466 | 3300025913 | Bacteria | 6196 |
| 401 | Ga0207695_10125120 | 3300025913 | Bacteria | 2534 |
| 402 | Ga0207695_10140001 | 3300025913 | Bacteria | 2369 |
| 403 | Ga0207695_10324911 | 3300025913 | Unclassified | 1428 |
| 404 | Ga0207671_10000126 | 3300025914 | Bacteria | 118967 |
| 405 | Ga0207671_10002103 | 3300025914 | Bacteria | 21762 |
| 406 | Ga0207671_10025114 | 3300025914 | Bacteria | 4476 |
| 407 | Ga0207671_10236586 | 3300025914 | Unclassified | 1434 |
| 408 | Ga0207660_10001044 | 3300025917 | Bacteria | 18326 |
| 409 | Ga0207660_10144584 | 3300025917 | Bacteria | 1821 |
| 410 | Ga0207662_10040491 | 3300025918 | Bacteria | 2739 |
| 411 | Ga0207662_10274437 | 3300025918 | Unclassified | 1114 |
| 412 | Ga0207657_10019421 | 3300025919 | Bacteria | 6454 |
| 413 | Ga0207649_10050499 | 3300025920 | Bacteria | 2573 |
| 414 | Ga0207652_10002374 | 3300025921 | Bacteria | 15916 |
| 415 | Ga0207652_10020483 | 3300025921 | Bacteria | 5446 |
| 416 | Ga0207681_10004037 | 3300025923 | Bacteria | 9105 |
| 417 | Ga0207681_10010995 | 3300025923 | Bacteria | 5560 |
| 418 | Ga0207681_10118875 | 3300025923 | Bacteria | 1935 |
| 419 | Ga0207681_10148091 | 3300025923 | Bacteria | 1756 |
| 420 | Ga0207681_10224965 | 3300025923 | Unclassified | 1453 |
| 421 | Ga0207650_10002421 | 3300025925 | Bacteria | 12992 |
| 422 | Ga0207650_10013718 | 3300025925 | Bacteria | 5617 |
| 423 | Ga0207650_10076987 | 3300025925 | Bacteria | 2521 |
| 424 | Ga0207659_10031409 | 3300025926 | Bacteria | 3635 |
| 425 | Ga0207659_10051279 | 3300025926 | Bacteria | 2934 |
| 426 | Ga0207659_10064248 | 3300025926 | Bacteria | 2655 |
| 427 | Ga0207659_10161176 | 3300025926 | Bacteria | 1761 |
| 428 | Ga0207687_10162063 | 3300025927 | Bacteria | 1717 |
| 429 | Ga0207644_10025842 | 3300025931 | Bacteria | 4040 |
| 430 | Ga0207644_10038744 | 3300025931 | Bacteria | 3360 |
| 431 | Ga0207644_10144728 | 3300025931 | Bacteria | 1834 |
| 432 | Ga0207706_10008178 | 3300025933 | Bacteria | 9650 |
| 433 | Ga0207706_10009135 | 3300025933 | Bacteria | 9112 |
| 434 | Ga0207706_10207399 | 3300025933 | Bacteria | 1718 |
| 435 | Ga0207706_10223175 | 3300025933 | Bacteria | 1650 |
| 436 | Ga0207706_10306801 | 3300025933 | Bacteria | 1382 |
| 437 | Ga0207686_10001124 | 3300025934 | Bacteria | 15459 |
| 438 | Ga0207686_10012741 | 3300025934 | Bacteria | 4631 |
| 439 | Ga0207686_10130834 | 3300025934 | Bacteria | 1721 |
| 440 | Ga0207670_10027994 | 3300025936 | Bacteria | 3571 |
| 441 | Ga0207670_10033175 | 3300025936 | Bacteria | 3325 |
| 442 | Ga0207670_10034096 | 3300025936 | Unclassified | 3286 |
| 443 | Ga0207670_10172348 | 3300025936 | Bacteria | 1623 |
| 444 | Ga0207670_10224949 | 3300025936 | Bacteria | 1438 |
| 445 | Ga0207669_10048989 | 3300025937 | Bacteria | 2515 |
| 446 | Ga0207669_10065229 | 3300025937 | Bacteria | 2258 |
| 447 | Ga0207704_10005332 | 3300025938 | Bacteria | 5926 |
| 448 | Ga0207704_10020901 | 3300025938 | Bacteria | 3474 |
| 449 | Ga0207704_10383847 | 3300025938 | Bacteria | 1103 |
| 450 | Ga0207691_10000012 | 3300025940 | Bacteria | 147942 |
| 451 | Ga0207691_10003790 | 3300025940 | Bacteria | 14676 |
| 452 | Ga0207691_10012726 | 3300025940 | Bacteria | 8060 |
| 453 | Ga0207691_10064705 | 3300025940 | Bacteria | 3312 |
| 454 | Ga0207691_10075791 | 3300025940 | Unclassified | 3032 |
| 455 | Ga0207691_10239591 | 3300025940 | Bacteria | 1568 |
| 456 | Ga0207689_10001304 | 3300025942 | Bacteria | 24024 |
| 457 | Ga0207689_10002620 | 3300025942 | Bacteria | 16648 |
| 458 | Ga0207689_10003101 | 3300025942 | Bacteria | 15285 |
| 459 | Ga0207689_10007834 | 3300025942 | Bacteria | 9337 |
| 460 | Ga0207689_10011955 | 3300025942 | Bacteria | 7439 |
| 461 | Ga0207689_10013056 | 3300025942 | Bacteria | 7093 |
| 462 | Ga0207689_10071824 | 3300025942 | Bacteria | 2843 |
| 463 | Ga0207661_10009997 | 3300025944 | Bacteria | 6818 |
| 464 | Ga0207661_10137906 | 3300025944 | Bacteria | 2097 |
| 465 | Ga0207679_10007257 | 3300025945 | Bacteria | 7023 |
| 466 | Ga0207679_10418864 | 3300025945 | Bacteria | 1181 |
| 467 | Ga0207667_10125681 | 3300025949 | Bacteria | 2642 |
| 468 | Ga0207667_10301871 | 3300025949 | Bacteria | 1636 |
| 469 | Ga0207667_10364332 | 3300025949 | Bacteria | 1474 |
| 470 | Ga0207651_10001926 | 3300025960 | Bacteria | 9740 |
| 471 | Ga0207651_10026736 | 3300025960 | Bacteria | 3611 |
| 472 | Ga0207651_10028310 | 3300025960 | Bacteria | 3533 |
| 473 | Ga0207651_10084514 | 3300025960 | Unclassified | 2299 |
| 474 | Ga0207651_10145679 | 3300025960 | Bacteria | 1836 |
| 475 | Ga0207651_10191634 | 3300025960 | Unclassified | 1631 |
| 476 | Ga0207651_10370413 | 3300025960 | Bacteria | 1211 |
| 477 | Ga0207712_10021930 | 3300025961 | Bacteria | 4198 |
| 478 | Ga0207712_10036448 | 3300025961 | Bacteria | 3350 |
| 479 | Ga0207712_10042977 | 3300025961 | Bacteria | 3115 |
| 480 | Ga0207712_10119146 | 3300025961 | Bacteria | 1994 |
| 481 | Ga0207668_10039622 | 3300025972 | Bacteria | 3173 |
| 482 | Ga0207668_10085338 | 3300025972 | Bacteria | 2303 |
| 483 | Ga0207668_10103528 | 3300025972 | Bacteria | 2120 |
| 484 | Ga0207640_10206476 | 3300025981 | Bacteria | 1493 |
| 485 | Ga0207658_10002697 | 3300025986 | Bacteria | 12818 |
| 486 | Ga0207658_10014460 | 3300025986 | Bacteria | 5405 |
| 487 | Ga0207658_10045476 | 3300025986 | Bacteria | 3200 |
| 488 | Ga0207658_10066095 | 3300025986 | Bacteria | 2719 |
| 489 | Ga0207658_10083654 | 3300025986 | Bacteria | 2453 |
| 490 | Ga0207658_10094611 | 3300025986 | Bacteria | 2326 |
| 491 | Ga0207658_10136906 | 3300025986 | Bacteria | 1976 |
| 492 | Ga0207658_10237409 | 3300025986 | Bacteria | 1542 |
| 493 | Ga0207677_10005962 | 3300026023 | Bacteria | 6636 |
| 494 | Ga0207677_10008400 | 3300026023 | Bacteria | 5762 |
| 495 | Ga0207677_10041915 | 3300026023 | Bacteria | 3030 |
| 496 | Ga0207677_10137476 | 3300026023 | Bacteria | 1865 |
| 497 | Ga0207703_10244506 | 3300026035 | Bacteria | 1614 |
| 498 | Ga0207639_10009544 | 3300026041 | Bacteria | 6698 |
| 499 | Ga0207639_10038404 | 3300026041 | Bacteria | 3561 |
| 500 | Ga0207639_10106292 | 3300026041 | Bacteria | 2278 |
| 501 | Ga0207708_10150620 | 3300026075 | Unclassified | 1831 |
| 502 | Ga0207641_10000090 | 3300026088 | Bacteria | 127735 |
| 503 | Ga0207641_10006270 | 3300026088 | Bacteria | 10057 |
| 504 | Ga0207641_10018885 | 3300026088 | Bacteria | 5655 |
| 505 | Ga0207641_10022878 | 3300026088 | Bacteria | 5148 |
| 506 | Ga0207641_10046968 | 3300026088 | Bacteria | 3640 |
| 507 | Ga0207641_10076769 | 3300026088 | Bacteria | 2889 |
| 508 | Ga0207648_10002423 | 3300026089 | Bacteria | 20073 |
| 509 | Ga0207648_10007046 | 3300026089 | Bacteria | 11110 |
| 510 | Ga0207648_10010083 | 3300026089 | Bacteria | 8982 |
| 511 | Ga0207648_10014891 | 3300026089 | Bacteria | 7169 |
| 512 | Ga0207648_10037382 | 3300026089 | Bacteria | 4276 |
| 513 | Ga0207648_10039420 | 3300026089 | Bacteria | 4155 |
| 514 | Ga0207648_10045069 | 3300026089 | Bacteria | 3869 |
| 515 | Ga0207648_10261809 | 3300026089 | Unclassified | 1543 |
| 516 | Ga0207676_10002953 | 3300026095 | Bacteria | 12129 |
| 517 | Ga0207676_10004398 | 3300026095 | Bacteria | 9968 |
| 518 | Ga0207676_10106918 | 3300026095 | Bacteria | 2332 |
| 519 | Ga0207676_10154686 | 3300026095 | Bacteria | 1979 |
| 520 | Ga0207674_10008150 | 3300026116 | Bacteria | 12147 |
| 521 | Ga0207674_10016068 | 3300026116 | Bacteria | 8199 |
| 522 | Ga0207674_10061678 | 3300026116 | Bacteria | 3788 |
| 523 | Ga0207674_10149606 | 3300026116 | Bacteria | 2292 |
| 524 | Ga0207674_10211292 | 3300026116 | Unclassified | 1889 |
| 525 | Ga0207674_10320438 | 3300026116 | Bacteria | 1499 |
| 526 | Ga0207675_100000599 | 3300026118 | Bacteria | 35195 |
| 527 | Ga0207675_100014459 | 3300026118 | Bacteria | 7358 |
| 528 | Ga0207675_100040594 | 3300026118 | Bacteria | 4346 |
| 529 | Ga0207675_100250545 | 3300026118 | Unclassified | 1714 |
| 530 | Ga0207683_10011150 | 3300026121 | Bacteria | 7662 |
| 531 | Ga0207683_10019343 | 3300026121 | Bacteria | 5815 |
| 532 | Ga0207698_10082811 | 3300026142 | Bacteria | 2595 |
| 533 | Ga0207698_10083806 | 3300026142 | Bacteria | 2581 |
| 534 | Ga0207698_10101749 | 3300026142 | Bacteria | 2384 |
| 535 | Ga0207698_10178782 | 3300026142 | Bacteria | 1877 |
| 536 | Ga0209281_1000396 | 3300027111 | Bacteria | 67930 |
| 537 | Ga0209489_115670 | 3300027361 | Bacteria | 4487 |
| 538 | Ga0209282_1014230 | 3300027666 | Bacteria | 5065 |
| 539 | Ga0268266_10156944 | 3300028379 | Bacteria | 2056 |
| 540 | Ga0268265_10031497 | 3300028380 | Bacteria | 3830 |
| 541 | Ga0268264_10001333 | 3300028381 | Bacteria | 23222 |
| 542 | Ga0268264_10013877 | 3300028381 | Bacteria | 6625 |
| 543 | Ga0268264_10024998 | 3300028381 | Bacteria | 4881 |
| 544 | Ga0268264_10361866 | 3300028381 | Bacteria | 1384 |
| 545 | Ga0265318_10006751 | 3300028577 | Bacteria | 5253 |
| 546 | Ga0307517_10005589 | 3300028786 | Bacteria | 18886 |
| 547 | Ga0307515_10000010 | 3300028794 | Bacteria | 651586 |
| 548 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 549 | Ga0265330_10000202 | 3300031235 | Bacteria | 46065 |
| 550 | Ga0265332_10000426 | 3300031238 | Bacteria | 29736 |
| 551 | Ga0265320_10045545 | 3300031240 | Bacteria | 2155 |
| 552 | Ga0265329_10008872 | 3300031242 | Bacteria | 3788 |
| 553 | Ga0265339_10029916 | 3300031249 | Bacteria | 3087 |
| 554 | Ga0265339_10079097 | 3300031249 | Bacteria | 1740 |
| 555 | Ga0265331_10003139 | 3300031250 | Bacteria | 10788 |
| 556 | Ga0265331_10034036 | 3300031250 | Bacteria | 2516 |
| 557 | Ga0265327_10000089 | 3300031251 | Bacteria | 197227 |
| 558 | Ga0265327_10000099 | 3300031251 | Bacteria | 190474 |
| 559 | Ga0265327_10000404 | 3300031251 | Bacteria | 80704 |
| 560 | Ga0265327_10027616 | 3300031251 | Bacteria | 3262 |
| 561 | Ga0265327_10069821 | 3300031251 | Bacteria | 1762 |
| 562 | Ga0265316_10000084 | 3300031344 | Bacteria | 99744 |
| 563 | Ga0307509_10059815 | 3300031507 | Bacteria | 4030 |
| 564 | Ga0307509_10112909 | 3300031507 | Bacteria | 2716 |
| 565 | Ga0307508_10142565 | 3300031616 | Bacteria | 2000 |
| 566 | Ga0265314_10000076 | 3300031711 | Bacteria | 146266 |
| 567 | Ga0265342_10000147 | 3300031712 | Bacteria | 79849 |
| 568 | Ga0316576_10141436 | 3300031727 | Bacteria | 1812 |
| 569 | Ga0307516_10002555 | 3300031730 | Bacteria | 24195 |
| 570 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 571 | Ga0307413_10000054 | 3300031824 | Bacteria | 30198 |
| 572 | Ga0307410_10030652 | 3300031852 | Bacteria | 3440 |
| 573 | Ga0307410_10156448 | 3300031852 | Unclassified | 1703 |
| 574 | Ga0307406_10000106 | 3300031901 | Bacteria | 48892 |
| 575 | Ga0307412_10166082 | 3300031911 | Bacteria | 1646 |
| 576 | Ga0307416_100005748 | 3300032002 | Bacteria | 7680 |
| 577 | Ga0307414_10002930 | 3300032004 | Bacteria | 9021 |
| 578 | Ga0307414_10106217 | 3300032004 | Bacteria | 2125 |
| 579 | Ga0307414_10207491 | 3300032004 | Bacteria | 1599 |
| 580 | Ga0307414_10221375 | 3300032004 | Bacteria | 1554 |
| 581 | Ga0307411_10000005 | 3300032005 | Bacteria | 391311 |
| 582 | Ga0373955_0055185 | 3300035172 | Bacteria | 2175 |
| 583 | Ga0316574_0168967 | 3300035398 | Bacteria | 1408 |
| 584 | Ga0373933_0014955 | 3300035724 | Bacteria | 4322 |
| 585 | Ga0373937_0038820 | 3300036401 | Bacteria | 4339 |
| 586 | Ga0395900_0018785 | 3300037418 | Bacteria | 7049 |
| 587 | Ga0395900_0027165 | 3300037418 | Bacteria | 5861 |
| 588 | Ga0395905_0001907 | 3300037471 | Bacteria | 24001 |
| 589 | Ga0395905_0357381 | 3300037471 | Bacteria | 1353 |
| 590 | Ga0395901_0140923 | 3300038443 | Bacteria | 2534 |
| 591 | Ga0395901_0368452 | 3300038443 | Bacteria | 1480 |
| 592 | Ga0436365_0741238 | 3300039437 | Bacteria | 21789 |
| 593 | Ga0436365_0751285 | 3300039437 | Bacteria | 9848 |
| 594 | Ga0436365_1685836 | 3300039437 | Unclassified | 1278 |
| 595 | Ga0439447_001386 | 3300041407 | Bacteria | 8869 |
| 596 | Ga0451837_0561395 | 3300041494 | Bacteria | 3969 |
| 597 | Ga0439449_0045602 | 3300042007 | Bacteria | 1625 |
| 598 | Ga0439457_001352 | 3300042014 | Bacteria | 7369 |
| 599 | Ga0439457_007426 | 3300042014 | Bacteria | 2631 |
| 600 | Ga0450898_012608 | 3300042134 | Unclassified | 1399 |
| 601 | Ga0453683_0013816 | 3300044673 | Bacteria | 5253 |
| 602 | Ga0453684_0213135 | 3300044712 | Bacteria | 2243 |
| 603 | Ga0453684_0259456 | 3300044712 | Bacteria | 1991 |
| 604 | Ga0453684_0267700 | 3300044712 | Unclassified | 1954 |
| 605 | Ga0453684_0282375 | 3300044712 | Bacteria | 1893 |
| 606 | Ga0451576_0023699 | 3300045051 | Bacteria | 6641 |
| 607 | Ga0495627_000178 | 3300046453 | Bacteria | 72186 |
| 608 | Ga0495650_0087018 | 3300046471 | Bacteria | 1195 |
| 609 | Ga0495580_0083987 | 3300046472 | Bacteria | 2219 |
| 610 | Ga0495606_0132101 | 3300046507 | Bacteria | 1483 |
| 611 | Ga0495630_0006491 | 3300046517 | Bacteria | 8327 |
| 612 | Ga0495643_0002422 | 3300046522 | Bacteria | 14827 |
| 613 | Ga0495654_0000099 | 3300046530 | Bacteria | 98758 |
| 614 | Ga0495654_0017069 | 3300046530 | Bacteria | 3822 |
| 615 | Ga0495633_0000108 | 3300046558 | Bacteria | 111235 |
| 616 | Ga0495633_0000575 | 3300046558 | Bacteria | 35732 |
| 617 | Ga0495634_0090043 | 3300046642 | Bacteria | 1994 |
| 618 | Ga0495625_0041275 | 3300046660 | Bacteria | 3359 |
| 619 | Ga0495635_0071895 | 3300046663 | Bacteria | 2371 |
| 620 | Ga0495657_0047599 | 3300046675 | Bacteria | 2898 |
| 621 | Ga0495613_0303943 | 3300046689 | Bacteria | 1104 |
| 622 | Ga0495670_0124777 | 3300046691 | Bacteria | 1339 |
| 623 | Ga0495672_0021476 | 3300047320 | Bacteria | 4211 |
| 624 | Ga0495672_0061382 | 3300047320 | Bacteria | 2167 |
| 625 | Ga0495680_0147702 | 3300047322 | Bacteria | 1716 |
| 626 | Ga0495684_0174299 | 3300047471 | Bacteria | 1597 |
| 627 | Ga0495686_0000234 | 3300047472 | Bacteria | 101539 |
| 628 | Ga0495686_0000982 | 3300047472 | Bacteria | 34919 |
| 629 | Ga0495686_0035962 | 3300047472 | Bacteria | 3180 |
| 630 | Ga0495686_0059901 | 3300047472 | Bacteria | 2368 |
| 631 | Ga0495602_0161958 | 3300048088 | Unclassified | 1746 |
| 632 | Ga0496101_0192286 | 3300048904 | Bacteria | 1575 |
| 633 | Ga0496108_0146220 | 3300048911 | Bacteria | 2038 |
| 634 | Ga0496109_0380319 | 3300048912 | Unclassified | 1334 |
| 635 | Ga0496115_0219420 | 3300048918 | Bacteria | 1569 |
| 636 | Ga0496125_0000443 | 3300048928 | Bacteria | 75675 |
| 637 | Ga0496126_0020255 | 3300048929 | Bacteria | 6529 |
| 638 | Ga0501031_0010511 | 3300049568 | Bacteria | 6027 |
| 639 | Ga0501034_0000111 | 3300049571 | Bacteria | 150159 |
| 640 | Ga0501034_0038786 | 3300049571 | Bacteria | 4825 |
| 641 | Ga0501034_0059795 | 3300049571 | Bacteria | 3828 |
| 642 | Ga0501036_0015334 | 3300049572 | Bacteria | 6400 |
| 643 | Ga0501036_0023469 | 3300049572 | Bacteria | 5196 |
| 644 | Ga0501037_0075137 | 3300049573 | Bacteria | 2455 |
| 645 | Ga0501038_0010541 | 3300049574 | Bacteria | 8453 |
| 646 | Ga0501038_0092826 | 3300049574 | Bacteria | 2527 |
| 647 | Ga0501039_0012373 | 3300049575 | Bacteria | 6511 |
| 648 | Ga0501043_0022411 | 3300049579 | Bacteria | 4954 |
| 649 | Ga0501043_0031567 | 3300049579 | Bacteria | 4164 |
| 650 | Ga0501046_0008958 | 3300049580 | Bacteria | 8689 |
| 651 | Ga0501046_0085739 | 3300049580 | Unclassified | 2428 |
| 652 | Ga0501047_0232674 | 3300049581 | Bacteria | 1696 |
| 653 | Ga0501047_0266220 | 3300049581 | Bacteria | 1561 |
| 654 | Ga0501047_0330409 | 3300049581 | Unclassified | 1363 |
| 655 | Ga0501048_0281393 | 3300049582 | Bacteria | 1183 |
| 656 | Ga0501070_0090647 | 3300049586 | Bacteria | 2530 |
| 657 | Ga0501073_0013600 | 3300049589 | Bacteria | 5918 |
| 658 | Ga0501074_0130420 | 3300049590 | Bacteria | 1798 |
| 659 | Ga0501249_001601 | 3300049679 | Bacteria | 4630 |
| 660 | Ga0501253_002620 | 3300049683 | Bacteria | 2049 |
| 661 | Ga0501257_003920 | 3300049686 | Bacteria | 3226 |
| 662 | Ga0501259_004807 | 3300049688 | Bacteria | 2142 |
| 663 | Ga0501241_000212 | 3300049758 | Bacteria | 13175 |
| 664 | Ga0501266_000015 | 3300049763 | Bacteria | 177219 |
| 665 | Ga0501035_0020068 | 3300049822 | Bacteria | 6137 |
| 666 | Ga0501035_0147749 | 3300049822 | Bacteria | 2041 |
| 667 | Ga0501044_0031497 | 3300049823 | Bacteria | 5582 |
| 668 | Ga0501044_0041619 | 3300049823 | Bacteria | 4783 |
| 669 | Ga0501044_0112564 | 3300049823 | Bacteria | 2728 |
| 670 | nmdc:mga05p37_115948_c1 | 3300050507 | Bacteria | 3292 |
| 671 | nmdc:mga09592_11770_c1 | 3300050508 | Bacteria | 3723 |
| 672 | nmdc:mga0qj67_151648_c1 | 3300050509 | Bacteria | 1880 |
| 673 | nmdc:mga06r32_304937_c1 | 3300050510 | Bacteria | 1578 |
| 674 | nmdc:mga08y16_23269_c1 | 3300050511 | Bacteria | 6542 |
| 675 | nmdc:mga08y16_275626_c1 | 3300050511 | Bacteria | 1736 |
| 676 | nmdc:mga08y16_6461_c1 | 3300050511 | Bacteria | 12298 |
| 677 | Ga0495619_0097895 | 3300053085 | Bacteria | 1994 |
| 678 | Ga0500641_0000594 | 3300053096 | Bacteria | 13048 |
| 679 | Ga0500652_004401 | 3300053131 | Bacteria | 4362 |
| 680 | Ga0500658_0000008 | 3300053134 | Bacteria | 273324 |
| 681 | Ga0500559_0055747 | 3300053136 | Bacteria | 1753 |
| 682 | Ga0500568_0011168 | 3300053139 | Bacteria | 4182 |
| 683 | Ga0500622_0002110 | 3300053156 | Bacteria | 14814 |
| 684 | Ga0500636_0044270 | 3300053177 | Bacteria | 2625 |
| 685 | Ga0500611_000029 | 3300053727 | Bacteria | 89288 |
| 686 | 2511232194 | 2511231000 | Bacteria | 4488346 |
| 687 | 2513235504 | 2513020052 | Bacteria | 5120511 |
| 688 | 2520878424 | 2519899754 | Bacteria | 5336938 |
| 689 | 2524004828 | 2523533629 | Bacteria | 2982326 |
| 690 | 2585155864 | 2582581281 | Bacteria | 4487904 |
| 691 | 2585160212 | 2582581282 | Bacteria | 4495830 |
| 692 | 2585425632 | 2582581873 | Bacteria | 3032664 |
| 693 | 2587678253 | 2585428045 | Bacteria | 5203023 |
| 694 | 2587942093 | 2585428115 | Bacteria | 4420269 |
| 695 | 2588216080 | 2585428183 | Bacteria | 5166119 |
| 696 | 2590602581 | 2588254255 | Bacteria | 5014294 |
| 697 | 2590611006 | 2588254257 | Bacteria | 5436094 |
| 698 | 2644011828 | 2643221600 | Bacteria | 5530138 |
| 699 | 2644370210 | 2643221667 | Bacteria | 5627472 |
| 700 | 2644641949 | 2643221716 | Bacteria | 4986332 |
| 701 | 2644685610 | 2643221725 | Bacteria | 5087956 |
| 702 | 2729202850 | 2728369107 | Bacteria | 5082720 |
| 703 | 2740003350 | 2739367857 | Bacteria | 5433684 |
| 704 | 2740008167 | 2739367858 | Bacteria | 5432813 |
| 705 | 2740061152 | 2739367874 | Bacteria | 4872888 |
| 706 | 2753671691 | 2751185877 | Bacteria | 4921427 |
| 707 | 2772606382 | 2772190705 | Bacteria | 4666226 |
| 708 | 2775673685 | 2775506739 | Bacteria | 3855222 |
| 709 | 2817415449 | 2816332280 | Bacteria | 5109718 |
| 710 | 2819571688 | 2818991442 | Bacteria | 8318214 |
| 711 | 2819589920 | 2818991444 | Bacteria | 6968812 |
| 712 | 2819677472 | 2818991460 | Bacteria | 7595395 |
| 713 | 2840678178 | 2840677318 | Bacteria | 2664183 |
| 714 | 2857614217 | 2857613821 | Bacteria | 4917088 |
| 715 | 2857619451 | 2857618242 | Bacteria | 5635925 |
| 716 | 2881362274 | 2881359912 | Bacteria | 4935907 |
| 717 | 2881956706 | 2881955468 | Bacteria | 3545609 |
| 718 | 2883070619 | 2883068021 | Bacteria | 6192739 |
| 719 | 2884797400 | 2884791551 | Bacteria | 8511252 |
| 720 | 2896085996 | 2896085136 | Bacteria | 6129793 |
| 721 | 2896115461 | 2896109856 | Bacteria | 7140722 |
| 722 | 2903898225 | 2903895155 | Bacteria | 5258610 |
| 723 | 2904424117 | 2904419702 | Bacteria | 5166287 |
| 724 | 2904469532 | 2904467357 | Bacteria | 8057758 |
| 725 | 2919193331 | 2919191525 | Bacteria | 5765973 |
| 726 | 2919511000 | 2919509842 | Bacteria | 4104664 |
| 727 | 2919686152 | 2919683626 | Bacteria | 5534354 |
| 728 | 2929152683 | 2929150217 | Bacteria | 5462483 |
| 729 | 2929183544 | 2929177148 | Bacteria | 7883697 |
| 730 | 2929927944 | 2929921140 | Bacteria | 8649150 |
| 731 | 2945979508 | 2945977869 | Bacteria | 7777518 |
| 732 | 2946014623 | 2946013367 | Bacteria | 7766675 |
| 733 | 2958462543 | 2958458903 | Bacteria | 5301041 |
| 734 | 2958512794 | 2958512119 | Bacteria | 4528530 |
| 735 | 2965323592 | 2965320100 | Bacteria | 3975600 |
| 736 | 2984575111 | 2984572630 | Bacteria | 4186940 |
| 737 | 2984608562 | 2984606641 | Bacteria | 4186971 |
| 738 | 2993374370 | 2993372514 | Bacteria | 4214139 |
| 739 | 2993481260 | 2993480792 | Bacteria | 4022225 |
| 740 | 8003152433 | 8003151029 | Bacteria | 8187759 |
| 741 | 8054312022 | 8054307821 | Bacteria | 5212224 |
| 742 | 8055421080 | 8055419101 | Bacteria | 5289643 |
| 743 | 8055594506 | 8055592153 | Bacteria | 5961247 |
| 744 | Ga0207691_10074203 | |||
| 745 | SwRhRL2b_contig_222865 | |||
| 746 | JGI24751J29686_10000969 | |||
| 747 | JGI25154J39366_1000002 | |||
| 748 | JGI25159J45721_1022740 | |||
| 749 | JGI25406J46586_10000469 | |||
| 750 | JGI25153J46596_10000442 | |||
| 751 | rootH1_10123138 | |||
| 752 | rootH2_10072046 | |||
| 753 | rootH2_10092365 | |||
| 754 | rootH2_10094093 | |||
| 755 | rootH2_10177331 | |||
| 756 | rootL2_10060945 | |||
| 757 | rootL2_10070185 | |||
| 758 | rootL2_10077208 | |||
| 759 | rootL2_10128079 | |||
| 760 | rootL2_10198780 | |||
| 761 | rootH1_10004531 | |||
| 762 | rootH1_10047386 | |||
| 763 | rootH1_10118920 | |||
| 764 | JGI25160J50197_1003902 | |||
| 765 | Ga0055542_1002479 | |||
| 766 | Ga0055526_1038586 | |||
| 767 | Ga0055528_1000403 | |||
| 768 | Ga0055530_10000192 | |||
| 769 | Ga0065165_1000471 | |||
| 770 | Ga0065714_10006385 | |||
| 771 | Ga0065704_10088122 | |||
| 772 | Ga0065715_10007518 | |||
| 773 | Ga0070658_10055020 | |||
| 774 | Ga0070676_10052308 | |||
| 775 | Ga0070683_100013297 | |||
| 776 | Ga0070683_100013478 | |||
| 777 | Ga0070683_100269621 | |||
| 778 | Ga0070690_100076768 | |||
| 779 | Ga0070670_100020475 | |||
| 780 | Ga0070670_100059498 | |||
| 781 | Ga0070670_100071414 | |||
| 782 | Ga0070670_100113482 | |||
| 783 | Ga0070670_100256490 | |||
| 784 | Ga0070670_100275100 | |||
| 785 | Ga0070677_10003773 | |||
| 786 | Ga0068869_100006120 | |||
| 787 | Ga0068869_100009276 | |||
| 788 | Ga0068869_100011552 | |||
| 789 | Ga0068869_100049809 | |||
| 790 | Ga0068869_100112028 | |||
| 791 | Ga0068869_100149228 | |||
| 792 | Ga0070666_10000197 | |||
| 793 | Ga0070666_10010755 | |||
| 794 | Ga0070680_100001463 | |||
| 795 | Ga0070680_100139213 | |||
| 796 | Ga0070682_100000746 | |||
| 797 | Ga0070682_100004192 | |||
| 798 | Ga0070682_100013593 | |||
| 799 | Ga0068868_100001462 | |||
| 800 | Ga0068868_100015057 | |||
| 801 | Ga0068868_100024322 | |||
| 802 | Ga0068868_100034198 | |||
| 803 | Ga0068868_100085227 | |||
| 804 | Ga0068868_100098293 | |||
| 805 | Ga0068868_100108663 | |||
| 806 | Ga0070689_100033464 | |||
| 807 | Ga0070689_100043322 | |||
| 808 | Ga0070689_100101410 | |||
| 809 | Ga0070691_10006228 | |||
| 810 | Ga0070687_100023187 | |||
| 811 | Ga0070687_100024252 | |||
| 812 | Ga0070661_100048542 | |||
| 813 | Ga0070668_100000150 | |||
| 814 | Ga0070668_100115603 | |||
| 815 | Ga0070668_100240828 | |||
| 816 | Ga0070668_100303312 | |||
| 817 | Ga0070669_100000684 | |||
| 818 | Ga0070669_100069874 | |||
| 819 | Ga0070669_100085461 | |||
| 820 | Ga0070669_100151206 | |||
| 821 | Ga0070669_100340567 | |||
| 822 | Ga0070669_100354542 | |||
| 823 | Ga0070675_100107298 | |||
| 824 | Ga0070675_100126933 | |||
| 825 | Ga0070675_100226505 | |||
| 826 | Ga0070675_100261920 | |||
| 827 | Ga0070671_100000785 | |||
| 828 | Ga0070671_100015192 | |||
| 829 | Ga0070671_100027026 | |||
| 830 | Ga0070671_100040659 | |||
| 831 | Ga0070674_100058996 | |||
| 832 | Ga0070674_100128892 | |||
| 833 | Ga0070673_100002484 | |||
| 834 | Ga0070673_100006938 | |||
| 835 | Ga0070673_100044198 | |||
| 836 | Ga0070673_100053086 | |||
| 837 | Ga0070673_100065753 | |||
| 838 | Ga0070673_100083385 | |||
| 839 | Ga0070688_100037591 | |||
| 840 | Ga0070688_100078843 | |||
| 841 | Ga0070688_100099885 | |||
| 842 | Ga0070667_100004914 | |||
| 843 | Ga0070667_100039271 | |||
| 844 | Ga0070667_100051810 | |||
| 845 | Ga0070667_100070666 | |||
| 846 | Ga0070667_100076000 | |||
| 847 | Ga0070701_10236176 | |||
| 848 | Ga0070678_100019430 | |||
| 849 | Ga0070662_100008456 | |||
| 850 | Ga0070662_100027946 | |||
| 851 | Ga0070662_100050949 | |||
| 852 | Ga0070662_100069735 | |||
| 853 | Ga0070662_100277653 | |||
| 854 | Ga0070662_100403945 | |||
| 855 | Ga0070681_10011641 | |||
| 856 | Ga0068867_100003811 | |||
| 857 | Ga0068867_100038807 | |||
| 858 | Ga0068867_100134851 | |||
| 859 | Ga0068867_100172879 | |||
| 860 | Ga0070685_10013579 | |||
| 861 | Ga0070685_10138355 | |||
| 862 | Ga0070685_10253404 | |||
| 863 | Ga0070706_100457222 | |||
| 864 | Ga0070698_100001014 | |||
| 865 | Ga0070698_100013818 | |||
| 866 | Ga0070699_100043816 | |||
| 867 | Ga0070679_100004632 | |||
| 868 | Ga0070679_100020771 | |||
| 869 | Ga0070679_100032240 | |||
| 870 | Ga0070679_100049032 | |||
| 871 | Ga0070679_100057004 | |||
| 872 | Ga0070679_100089190 | |||
| 873 | Ga0070684_100012410 | |||
| 874 | Ga0070684_100061961 | |||
| 875 | Ga0070684_100341933 | |||
| 876 | Ga0068853_100006195 | |||
| 877 | Ga0068853_100038073 | |||
| 878 | Ga0068853_100049243 | |||
| 879 | Ga0068853_100124603 | |||
| 880 | Ga0070672_100026671 | |||
| 881 | Ga0070672_100089337 | |||
| 882 | Ga0070672_100199240 | |||
| 883 | Ga0070686_100023936 | |||
| 884 | Ga0070686_100079835 | |||
| 885 | Ga0070693_100002444 | |||
| 886 | Ga0070693_100009879 | |||
| 887 | Ga0070665_100004781 | |||
| 888 | Ga0070665_100152673 | |||
| 889 | Ga0070704_100039067 | |||
| 890 | Ga0068855_100031076 | |||
| 891 | Ga0068855_100165265 | |||
| 892 | Ga0070664_100007054 | |||
| 893 | Ga0070664_100016373 | |||
| 894 | Ga0070664_100051981 | |||
| 895 | Ga0068857_100154255 | |||
| 896 | Ga0068857_100442631 | |||
| 897 | Ga0068857_100538287 | |||
| 898 | Ga0068854_100227998 | |||
| 899 | Ga0068856_100007483 | |||
| 900 | Ga0070702_100006790 | |||
| 901 | Ga0068852_100008988 | |||
| 902 | Ga0068852_100084002 | |||
| 903 | Ga0068852_100208149 | |||
| 904 | Ga0068852_100599348 | |||
| 905 | Ga0068859_100000007 | |||
| 906 | Ga0068859_100001558 | |||
| 907 | Ga0068859_100028833 | |||
| 908 | Ga0068859_100046339 | |||
| 909 | Ga0068859_100087483 | |||
| 910 | Ga0068859_100091904 | |||
| 911 | Ga0068859_100122650 | |||
| 912 | Ga0068859_100197792 | |||
| 913 | Ga0068859_100205340 | |||
| 914 | Ga0068859_100565995 | |||
| 915 | Ga0068864_100000588 | |||
| 916 | Ga0068864_100015735 | |||
| 917 | Ga0068864_100101111 | |||
| 918 | Ga0068864_100104636 | |||
| 919 | Ga0068864_100276508 | |||
| 920 | Ga0068861_100008331 | |||
| 921 | Ga0068861_100106090 | |||
| 922 | Ga0068861_100450809 | |||
| 923 | Ga0068851_10009667 | |||
| 924 | Ga0068851_10055112 | |||
| 925 | Ga0068851_10065936 | |||
| 926 | Ga0068870_10005271 | |||
| 927 | Ga0068870_10044741 | |||
| 928 | Ga0068863_100000444 | |||
| 929 | Ga0068863_100007240 | |||
| 930 | Ga0068863_100021443 | |||
| 931 | Ga0068863_100067546 | |||
| 932 | Ga0068858_100003038 | |||
| 933 | Ga0068858_100125108 | |||
| 934 | Ga0068858_100220572 | |||
| 935 | Ga0068858_100429408 | |||
| 936 | Ga0068860_100000661 | |||
| 937 | Ga0068860_100002053 | |||
| 938 | Ga0068860_100010583 | |||
| 939 | Ga0068860_100075954 | |||
| 940 | Ga0068860_100385533 | |||
| 941 | Ga0068862_100002714 | |||
| 942 | Ga0068862_100003587 | |||
| 943 | Ga0068862_100184986 | |||
| 944 | Ga0081539_10000345 | |||
| 945 | Ga0081539_10039312 | |||
| 946 | Ga0075366_10018368 | |||
| 947 | Ga0097621_100000250 | |||
| 948 | Ga0097621_100006407 | |||
| 949 | Ga0097621_100017391 | |||
| 950 | Ga0097621_100022094 | |||
| 951 | Ga0097621_100040304 | |||
| 952 | Ga0097621_100136371 | |||
| 953 | Ga0097621_100178995 | |||
| 954 | Ga0075370_10050635 | |||
| 955 | Ga0068871_100001641 | |||
| 956 | Ga0068871_100002754 | |||
| 957 | Ga0068871_100007063 | |||
| 958 | Ga0068871_100020767 | |||
| 959 | Ga0068871_100025073 | |||
| 960 | Ga0068871_100318460 | |||
| 961 | Ga0075428_100000697 | |||
| 962 | Ga0075430_100219420 | |||
| 963 | Ga0075434_100062765 | |||
| 964 | Ga0075429_100006131 | |||
| 965 | Ga0068865_100000270 | |||
| 966 | Ga0068865_100090604 | |||
| 967 | Ga0097620_100000007 | |||
| 968 | Ga0097620_100001558 | |||
| 969 | Ga0097620_100028833 | |||
| 970 | Ga0097620_100046340 | |||
| 971 | Ga0097620_100087484 | |||
| 972 | Ga0097620_100091906 | |||
| 973 | Ga0097620_100122653 | |||
| 974 | Ga0097620_100197791 | |||
| 975 | Ga0097620_100205341 | |||
| 976 | Ga0097620_100566013 | |||
| 977 | Ga0099824_1018449 | |||
| 978 | Ga0079104_1000271 | |||
| 979 | Ga0099826_10001648 | |||
| 980 | Ga0105240_10007181 | |||
| 981 | Ga0105240_10009267 | |||
| 982 | Ga0105240_10169854 | |||
| 983 | Ga0105240_10205016 | |||
| 984 | Ga0111539_10006077 | |||
| 985 | Ga0111539_10236413 | |||
| 986 | Ga0105247_10012726 | |||
| 987 | Ga0105247_10072386 | |||
| 988 | Ga0114129_10110174 | |||
| 989 | Ga0105241_10000147 | |||
| 990 | Ga0105241_10001335 | |||
| 991 | Ga0105241_10016066 | |||
| 992 | Ga0105241_10094160 | |||
| 993 | Ga0105242_10025659 | |||
| 994 | Ga0105242_10066533 | |||
| 995 | Ga0105242_10071844 | |||
| 996 | Ga0105242_10356068 | |||
| 997 | Ga0105237_10001853 | |||
| 998 | Ga0105237_10146102 | |||
| 999 | Ga0105237_10270216 | |||
| 1000 | Ga0105249_10002091 | |||
| 1001 | Ga0105249_10029947 | |||
| 1002 | Ga0105249_10046883 | |||
| 1003 | Ga0105249_10255016 | |||
| 1004 | Ga0105249_10286814 | |||
| 1005 | Ga0105239_10000240 | |||
| 1006 | Ga0105239_10008674 | |||
| 1007 | Ga0105239_10694479 | |||
| 1008 | Ga0105239_10696851 | |||
| 1009 | Ga0105239_10868367 | |||
| 1010 | Ga0105246_10015172 | |||
| 1011 | Ga0105246_10033751 | |||
| 1012 | Ga0105246_10054852 | |||
| 1013 | Ga0105246_10114034 | |||
| 1014 | Ga0105246_10220100 | |||
| 1015 | Ga0157373_10000012 | |||
| 1016 | Ga0157373_10003271 | |||
| 1017 | Ga0157373_10083610 | |||
| 1018 | Ga0157371_10013452 | |||
| 1019 | Ga0157371_10029577 | |||
| 1020 | Ga0157371_10054414 | |||
| 1021 | Ga0157370_10000319 | |||
| 1022 | Ga0157370_10000549 | |||
| 1023 | Ga0157370_10006906 | |||
| 1024 | Ga0157370_10008707 | |||
| 1025 | Ga0157370_10012265 | |||
| 1026 | Ga0157370_10022264 | |||
| 1027 | Ga0157370_10131662 | |||
| 1028 | Ga0157370_10188098 | |||
| 1029 | Ga0157369_10009277 | |||
| 1030 | Ga0157369_10019067 | |||
| 1031 | Ga0157369_10114631 | |||
| 1032 | Ga0157369_10253642 | |||
| 1033 | Ga0157374_10003011 | |||
| 1034 | Ga0157374_10003032 | |||
| 1035 | Ga0157374_10005065 | |||
| 1036 | Ga0157374_10019854 | |||
| 1037 | Ga0157374_10021072 | |||
| 1038 | Ga0157374_10142237 | |||
| 1039 | Ga0157374_10326315 | |||
| 1040 | Ga0157378_10006187 | |||
| 1041 | Ga0157378_10012950 | |||
| 1042 | Ga0157378_10039467 | |||
| 1043 | Ga0157378_10100844 | |||
| 1044 | Ga0157378_10139763 | |||
| 1045 | Ga0157378_10271618 | |||
| 1046 | Ga0163162_10000406 | |||
| 1047 | Ga0163162_10004042 | |||
| 1048 | Ga0163162_10009348 | |||
| 1049 | Ga0163162_10012674 | |||
| 1050 | Ga0163162_10014865 | |||
| 1051 | Ga0163162_10040326 | |||
| 1052 | Ga0163162_10070766 | |||
| 1053 | Ga0163162_10119474 | |||
| 1054 | Ga0163162_10180192 | |||
| 1055 | Ga0163162_10275796 | |||
| 1056 | Ga0163162_10842777 | |||
| 1057 | Ga0157372_10002904 | |||
| 1058 | Ga0157372_10040228 | |||
| 1059 | Ga0157372_10047057 | |||
| 1060 | Ga0157372_10103231 | |||
| 1061 | Ga0157372_10126112 | |||
| 1062 | Ga0157372_10167412 | |||
| 1063 | Ga0157372_10248314 | |||
| 1064 | Ga0157372_10287337 | |||
| 1065 | Ga0157375_10000483 | |||
| 1066 | Ga0157375_10003520 | |||
| 1067 | Ga0157375_10009439 | |||
| 1068 | Ga0157375_10014733 | |||
| 1069 | Ga0157375_10038886 | |||
| 1070 | Ga0157375_10038922 | |||
| 1071 | Ga0157375_10065040 | |||
| 1072 | Ga0157375_10191858 | |||
| 1073 | Ga0157375_10350073 | |||
| 1074 | Ga0157375_10425604 | |||
| 1075 | Ga0163163_10000668 | |||
| 1076 | Ga0163163_10000814 | |||
| 1077 | Ga0163163_10003526 | |||
| 1078 | Ga0163163_10051366 | |||
| 1079 | Ga0163163_10112707 | |||
| 1080 | Ga0163163_10175721 | |||
| 1081 | Ga0163163_10189303 | |||
| 1082 | Ga0163163_10204283 | |||
| 1083 | Ga0157380_10023116 | |||
| 1084 | Ga0157380_10091802 | |||
| 1085 | Ga0157377_10010837 | |||
| 1086 | Ga0157377_10019341 | |||
| 1087 | Ga0157377_10028121 | |||
| 1088 | Ga0157379_10000784 | |||
| 1089 | Ga0157379_10022752 | |||
| 1090 | Ga0157379_10150942 | |||
| 1091 | Ga0157379_10261826 | |||
| 1092 | Ga0157376_10000353 | |||
| 1093 | Ga0157376_10003428 | |||
| 1094 | Ga0157376_10026021 | |||
| 1095 | Ga0157376_10027908 | |||
| 1096 | Ga0157376_10071914 | |||
| 1097 | Ga0157376_10090933 | |||
| 1098 | Ga0157376_10145283 | |||
| 1099 | Ga0157376_10322893 | |||
| 1100 | Ga0182006_1012778 | |||
| 1101 | Ga0182006_1038940 | |||
| 1102 | Ga0163161_10001881 | |||
| 1103 | Ga0163161_10004936 | |||
| 1104 | Ga0163161_10024983 | |||
| 1105 | Ga0163161_10150044 | |||
| 1106 | Ga0163161_10318761 | |||
| 1107 | Ga0213876_10003069 | |||
| 1108 | Ga0209258_100288 | |||
| 1109 | Ga0209646_1000005 | |||
| 1110 | Ga0209026_1000322 | |||
| 1111 | Ga0209148_1000269 | |||
| 1112 | Ga0209130_1008683 | |||
| 1113 | Ga0209758_1002054 | |||
| 1114 | Ga0209758_1006416 | |||
| 1115 | Ga0207426_1000189 | |||
| 1116 | Ga0207426_1000233 | |||
| 1117 | Ga0207426_1002647 | |||
| 1118 | Ga0207697_10018880 | |||
| 1119 | Ga0207656_10005441 | |||
| 1120 | Ga0207682_10011973 | |||
| 1121 | Ga0207682_10013516 | |||
| 1122 | Ga0207642_10065789 | |||
| 1123 | Ga0207710_10007460 | |||
| 1124 | Ga0207688_10037205 | |||
| 1125 | Ga0207688_10089788 | |||
| 1126 | Ga0207680_10000172 | |||
| 1127 | Ga0207680_10003430 | |||
| 1128 | Ga0207680_10258382 | |||
| 1129 | Ga0207647_10000530 | |||
| 1130 | Ga0207645_10000093 | |||
| 1131 | Ga0207645_10008578 | |||
| 1132 | Ga0207645_10010212 | |||
| 1133 | Ga0207645_10022768 | |||
| 1134 | Ga0207643_10012278 | |||
| 1135 | Ga0207643_10054452 | |||
| 1136 | Ga0207705_10135990 | |||
| 1137 | Ga0207654_10001168 | |||
| 1138 | Ga0207654_10002138 | |||
| 1139 | Ga0207654_10015092 | |||
| 1140 | Ga0207707_10000293 | |||
| 1141 | Ga0207695_10000010 | |||
| 1142 | Ga0207695_10028248 | |||
| 1143 | Ga0207695_10028466 | |||
| 1144 | Ga0207695_10125120 | |||
| 1145 | Ga0207695_10140001 | |||
| 1146 | Ga0207695_10324911 | |||
| 1147 | Ga0207671_10000126 | |||
| 1148 | Ga0207671_10002103 | |||
| 1149 | Ga0207671_10025114 | |||
| 1150 | Ga0207671_10236586 | |||
| 1151 | Ga0207660_10001044 | |||
| 1152 | Ga0207660_10144584 | |||
| 1153 | Ga0207662_10040491 | |||
| 1154 | Ga0207662_10274437 | |||
| 1155 | Ga0207657_10019421 | |||
| 1156 | Ga0207649_10050499 | |||
| 1157 | Ga0207652_10002374 | |||
| 1158 | Ga0207652_10020483 | |||
| 1159 | Ga0207681_10004037 | |||
| 1160 | Ga0207681_10010995 | |||
| 1161 | Ga0207681_10118875 | |||
| 1162 | Ga0207681_10148091 | |||
| 1163 | Ga0207681_10224965 | |||
| 1164 | Ga0207650_10002421 | |||
| 1165 | Ga0207650_10013718 | |||
| 1166 | Ga0207650_10076987 | |||
| 1167 | Ga0207659_10031409 | |||
| 1168 | Ga0207659_10051279 | |||
| 1169 | Ga0207659_10064248 | |||
| 1170 | Ga0207659_10161176 | |||
| 1171 | Ga0207687_10162063 | |||
| 1172 | Ga0207644_10025842 | |||
| 1173 | Ga0207644_10038744 | |||
| 1174 | Ga0207644_10144728 | |||
| 1175 | Ga0207706_10008178 | |||
| 1176 | Ga0207706_10009135 | |||
| 1177 | Ga0207706_10207399 | |||
| 1178 | Ga0207706_10223175 | |||
| 1179 | Ga0207706_10306801 | |||
| 1180 | Ga0207686_10001124 | |||
| 1181 | Ga0207686_10012741 | |||
| 1182 | Ga0207686_10130834 | |||
| 1183 | Ga0207670_10027994 | |||
| 1184 | Ga0207670_10033175 | |||
| 1185 | Ga0207670_10034096 | |||
| 1186 | Ga0207670_10172348 | |||
| 1187 | Ga0207670_10224949 | |||
| 1188 | Ga0207669_10048989 | |||
| 1189 | Ga0207669_10065229 | |||
| 1190 | Ga0207704_10005332 | |||
| 1191 | Ga0207704_10020901 | |||
| 1192 | Ga0207704_10383847 | |||
| 1193 | Ga0207691_10000012 | |||
| 1194 | Ga0207691_10003790 | |||
| 1195 | Ga0207691_10012726 | |||
| 1196 | Ga0207691_10064705 | |||
| 1197 | Ga0207691_10075791 | |||
| 1198 | Ga0207691_10239591 | |||
| 1199 | Ga0207689_10001304 | |||
| 1200 | Ga0207689_10002620 | |||
| 1201 | Ga0207689_10003101 | |||
| 1202 | Ga0207689_10007834 | |||
| 1203 | Ga0207689_10011955 | |||
| 1204 | Ga0207689_10013056 | |||
| 1205 | Ga0207689_10071824 | |||
| 1206 | Ga0207661_10009997 | |||
| 1207 | Ga0207661_10137906 | |||
| 1208 | Ga0207679_10007257 | |||
| 1209 | Ga0207679_10418864 | |||
| 1210 | Ga0207667_10125681 | |||
| 1211 | Ga0207667_10301871 | |||
| 1212 | Ga0207667_10364332 | |||
| 1213 | Ga0207651_10001926 | |||
| 1214 | Ga0207651_10026736 | |||
| 1215 | Ga0207651_10028310 | |||
| 1216 | Ga0207651_10084514 | |||
| 1217 | Ga0207651_10145679 | |||
| 1218 | Ga0207651_10191634 | |||
| 1219 | Ga0207651_10370413 | |||
| 1220 | Ga0207712_10021930 | |||
| 1221 | Ga0207712_10036448 | |||
| 1222 | Ga0207712_10042977 | |||
| 1223 | Ga0207712_10119146 | |||
| 1224 | Ga0207668_10039622 | |||
| 1225 | Ga0207668_10085338 | |||
| 1226 | Ga0207668_10103528 | |||
| 1227 | Ga0207640_10206476 | |||
| 1228 | Ga0207658_10002697 | |||
| 1229 | Ga0207658_10014460 | |||
| 1230 | Ga0207658_10045476 | |||
| 1231 | Ga0207658_10066095 | |||
| 1232 | Ga0207658_10083654 | |||
| 1233 | Ga0207658_10094611 | |||
| 1234 | Ga0207658_10136906 | |||
| 1235 | Ga0207658_10237409 | |||
| 1236 | Ga0207677_10005962 | |||
| 1237 | Ga0207677_10008400 | |||
| 1238 | Ga0207677_10041915 | |||
| 1239 | Ga0207677_10137476 | |||
| 1240 | Ga0207703_10244506 | |||
| 1241 | Ga0207639_10009544 | |||
| 1242 | Ga0207639_10038404 | |||
| 1243 | Ga0207639_10106292 | |||
| 1244 | Ga0207708_10150620 | |||
| 1245 | Ga0207641_10000090 | |||
| 1246 | Ga0207641_10006270 | |||
| 1247 | Ga0207641_10018885 | |||
| 1248 | Ga0207641_10022878 | |||
| 1249 | Ga0207641_10046968 | |||
| 1250 | Ga0207641_10076769 | |||
| 1251 | Ga0207648_10002423 | |||
| 1252 | Ga0207648_10007046 | |||
| 1253 | Ga0207648_10010083 | |||
| 1254 | Ga0207648_10014891 | |||
| 1255 | Ga0207648_10037382 | |||
| 1256 | Ga0207648_10039420 | |||
| 1257 | Ga0207648_10045069 | |||
| 1258 | Ga0207648_10261809 | |||
| 1259 | Ga0207676_10002953 | |||
| 1260 | Ga0207676_10004398 | |||
| 1261 | Ga0207676_10106918 | |||
| 1262 | Ga0207676_10154686 | |||
| 1263 | Ga0207674_10008150 | |||
| 1264 | Ga0207674_10016068 | |||
| 1265 | Ga0207674_10061678 | |||
| 1266 | Ga0207674_10149606 | |||
| 1267 | Ga0207674_10211292 | |||
| 1268 | Ga0207674_10320438 | |||
| 1269 | Ga0207675_100000599 | |||
| 1270 | Ga0207675_100014459 | |||
| 1271 | Ga0207675_100040594 | |||
| 1272 | Ga0207675_100250545 | |||
| 1273 | Ga0207683_10011150 | |||
| 1274 | Ga0207683_10019343 | |||
| 1275 | Ga0207698_10082811 | |||
| 1276 | Ga0207698_10083806 | |||
| 1277 | Ga0207698_10101749 | |||
| 1278 | Ga0207698_10178782 | |||
| 1279 | Ga0209281_1000396 | |||
| 1280 | Ga0209489_115670 | |||
| 1281 | Ga0209282_1014230 | |||
| 1282 | Ga0268266_10156944 | |||
| 1283 | Ga0268265_10031497 | |||
| 1284 | Ga0268264_10001333 | |||
| 1285 | Ga0268264_10013877 | |||
| 1286 | Ga0268264_10024998 | |||
| 1287 | Ga0268264_10361866 | |||
| 1288 | Ga0265318_10006751 | |||
| 1289 | Ga0307517_10005589 | |||
| 1290 | Ga0307515_10000010 | |||
| 1291 | Ga0307515_10000078 | |||
| 1292 | Ga0265330_10000202 | |||
| 1293 | Ga0265332_10000426 | |||
| 1294 | Ga0265320_10045545 | |||
| 1295 | Ga0265329_10008872 | |||
| 1296 | Ga0265339_10029916 | |||
| 1297 | Ga0265339_10079097 | |||
| 1298 | Ga0265331_10003139 | |||
| 1299 | Ga0265331_10034036 | |||
| 1300 | Ga0265327_10000089 | |||
| 1301 | Ga0265327_10000099 | |||
| 1302 | Ga0265327_10000404 | |||
| 1303 | Ga0265327_10027616 | |||
| 1304 | Ga0265327_10069821 | |||
| 1305 | Ga0265316_10000084 | |||
| 1306 | Ga0307509_10059815 | |||
| 1307 | Ga0307509_10112909 | |||
| 1308 | Ga0307508_10142565 | |||
| 1309 | Ga0265314_10000076 | |||
| 1310 | Ga0265342_10000147 | |||
| 1311 | Ga0316576_10141436 | |||
| 1312 | Ga0307516_10002555 | |||
| 1313 | Ga0307405_10000001 | |||
| 1314 | Ga0307413_10000054 | |||
| 1315 | Ga0307410_10030652 | |||
| 1316 | Ga0307410_10156448 | |||
| 1317 | Ga0307406_10000106 | |||
| 1318 | Ga0307412_10166082 | |||
| 1319 | Ga0307416_100005748 | |||
| 1320 | Ga0307414_10002930 | |||
| 1321 | Ga0307414_10106217 | |||
| 1322 | Ga0307414_10207491 | |||
| 1323 | Ga0307414_10221375 | |||
| 1324 | Ga0307411_10000005 | |||
| 1325 | Ga0373955_0055185 | |||
| 1326 | Ga0316574_0168967 | |||
| 1327 | Ga0373933_0014955 | |||
| 1328 | Ga0373937_0038820 | |||
| 1329 | Ga0395900_0018785 | |||
| 1330 | Ga0395900_0027165 | |||
| 1331 | Ga0395905_0001907 | |||
| 1332 | Ga0395905_0357381 | |||
| 1333 | Ga0395901_0140923 | |||
| 1334 | Ga0395901_0368452 | |||
| 1335 | Ga0436365_0741238 | |||
| 1336 | Ga0436365_0751285 | |||
| 1337 | Ga0436365_1685836 | |||
| 1338 | Ga0439447_001386 | |||
| 1339 | Ga0451837_0561395 | |||
| 1340 | Ga0439449_0045602 | |||
| 1341 | Ga0439457_001352 | |||
| 1342 | Ga0439457_007426 | |||
| 1343 | Ga0450898_012608 | |||
| 1344 | Ga0453683_0013816 | |||
| 1345 | Ga0453684_0213135 | |||
| 1346 | Ga0453684_0259456 | |||
| 1347 | Ga0453684_0267700 | |||
| 1348 | Ga0453684_0282375 | |||
| 1349 | Ga0451576_0023699 | |||
| 1350 | Ga0495627_000178 | |||
| 1351 | Ga0495650_0087018 | |||
| 1352 | Ga0495580_0083987 | |||
| 1353 | Ga0495606_0132101 | |||
| 1354 | Ga0495630_0006491 | |||
| 1355 | Ga0495643_0002422 | |||
| 1356 | Ga0495654_0000099 | |||
| 1357 | Ga0495654_0017069 | |||
| 1358 | Ga0495633_0000108 | |||
| 1359 | Ga0495633_0000575 | |||
| 1360 | Ga0495634_0090043 | |||
| 1361 | Ga0495625_0041275 | |||
| 1362 | Ga0495635_0071895 | |||
| 1363 | Ga0495657_0047599 | |||
| 1364 | Ga0495613_0303943 | |||
| 1365 | Ga0495670_0124777 | |||
| 1366 | Ga0495672_0021476 | |||
| 1367 | Ga0495672_0061382 | |||
| 1368 | Ga0495680_0147702 | |||
| 1369 | Ga0495684_0174299 | |||
| 1370 | Ga0495686_0000234 | |||
| 1371 | Ga0495686_0000982 | |||
| 1372 | Ga0495686_0035962 | |||
| 1373 | Ga0495686_0059901 | |||
| 1374 | Ga0495602_0161958 | |||
| 1375 | Ga0496101_0192286 | |||
| 1376 | Ga0496108_0146220 | |||
| 1377 | Ga0496109_0380319 | |||
| 1378 | Ga0496115_0219420 | |||
| 1379 | Ga0496125_0000443 | |||
| 1380 | Ga0496126_0020255 | |||
| 1381 | Ga0501031_0010511 | |||
| 1382 | Ga0501034_0000111 | |||
| 1383 | Ga0501034_0038786 | |||
| 1384 | Ga0501034_0059795 | |||
| 1385 | Ga0501036_0015334 | |||
| 1386 | Ga0501036_0023469 | |||
| 1387 | Ga0501037_0075137 | |||
| 1388 | Ga0501038_0010541 | |||
| 1389 | Ga0501038_0092826 | |||
| 1390 | Ga0501039_0012373 | |||
| 1391 | Ga0501043_0022411 | |||
| 1392 | Ga0501043_0031567 | |||
| 1393 | Ga0501046_0008958 | |||
| 1394 | Ga0501046_0085739 | |||
| 1395 | Ga0501047_0232674 | |||
| 1396 | Ga0501047_0266220 | |||
| 1397 | Ga0501047_0330409 | |||
| 1398 | Ga0501048_0281393 | |||
| 1399 | Ga0501070_0090647 | |||
| 1400 | Ga0501073_0013600 | |||
| 1401 | Ga0501074_0130420 | |||
| 1402 | Ga0501249_001601 | |||
| 1403 | Ga0501253_002620 | |||
| 1404 | Ga0501257_003920 | |||
| 1405 | Ga0501259_004807 | |||
| 1406 | Ga0501241_000212 | |||
| 1407 | Ga0501266_000015 | |||
| 1408 | Ga0501035_0020068 | |||
| 1409 | Ga0501035_0147749 | |||
| 1410 | Ga0501044_0031497 | |||
| 1411 | Ga0501044_0041619 | |||
| 1412 | Ga0501044_0112564 | |||
| 1413 | nmdc:mga05p37_115948_c1 | |||
| 1414 | nmdc:mga09592_11770_c1 | |||
| 1415 | nmdc:mga0qj67_151648_c1 | |||
| 1416 | nmdc:mga06r32_304937_c1 | |||
| 1417 | nmdc:mga08y16_23269_c1 | |||
| 1418 | nmdc:mga08y16_275626_c1 | |||
| 1419 | nmdc:mga08y16_6461_c1 | |||
| 1420 | Ga0495619_0097895 | |||
| 1421 | Ga0500641_0000594 | |||
| 1422 | Ga0500652_004401 | |||
| 1423 | Ga0500658_0000008 | |||
| 1424 | Ga0500559_0055747 | |||
| 1425 | Ga0500568_0011168 | |||
| 1426 | Ga0500622_0002110 | |||
| 1427 | Ga0500636_0044270 | |||
| 1428 | Ga0500611_000029 | |||
| 1429 | 2511232194 | |||
| 1430 | 2513235504 | |||
| 1431 | 2520878424 | |||
| 1432 | 2524004828 | |||
| 1433 | 2585155864 | |||
| 1434 | 2585160212 | |||
| 1435 | 2585425632 | |||
| 1436 | 2587678253 | |||
| 1437 | 2587942093 | |||
| 1438 | 2588216080 | |||
| 1439 | 2590602581 | |||
| 1440 | 2590611006 | |||
| 1441 | 2644011828 | |||
| 1442 | 2644370210 | |||
| 1443 | 2644641949 | |||
| 1444 | 2644685610 | |||
| 1445 | 2729202850 | |||
| 1446 | 2740003350 | |||
| 1447 | 2740008167 | |||
| 1448 | 2740061152 | |||
| 1449 | 2753671691 | |||
| 1450 | 2772606382 | |||
| 1451 | 2775673685 | |||
| 1452 | 2817415449 | |||
| 1453 | 2819571688 | |||
| 1454 | 2819589920 | |||
| 1455 | 2819677472 | |||
| 1456 | 2840678178 | |||
| 1457 | 2857614217 | |||
| 1458 | 2857619451 | |||
| 1459 | 2881362274 | |||
| 1460 | 2881956706 | |||
| 1461 | 2883070619 | |||
| 1462 | 2884797400 | |||
| 1463 | 2896085996 | |||
| 1464 | 2896115461 | |||
| 1465 | 2903898225 | |||
| 1466 | 2904424117 | |||
| 1467 | 2904469532 | |||
| 1468 | 2919193331 | |||
| 1469 | 2919511000 | |||
| 1470 | 2919686152 | |||
| 1471 | 2929152683 | |||
| 1472 | 2929183544 | |||
| 1473 | 2929927944 | |||
| 1474 | 2945979508 | |||
| 1475 | 2946014623 | |||
| 1476 | 2958462543 | |||
| 1477 | 2958512794 | |||
| 1478 | 2965323592 | |||
| 1479 | 2984575111 | |||
| 1480 | 2984608562 | |||
| 1481 | 2993374370 | |||
| 1482 | 2993481260 | |||
| 1483 | 8003152433 | |||
| 1484 | 8054312022 | |||
| 1485 | 8055421080 | |||
| 1486 | 8055594506 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iql-assembly1.cif.gz_B | crystal structure of porphyromonas gingivalis enoyl-acp reductase ii (fabk) with cofactors nadph and fmn | 0.9789 | 4 | 314 |
| 5gvj-assembly1.cif.gz_A-2 | structure of fabk (m276a) mutant from thermotoga maritima | 0.9759 | 3 | 312 |
| 2z6j-assembly1.cif.gz_A | crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor | 0.9736 | 3 | 312 |
| 7l00-assembly1.cif.gz_A | crystal structure of c. difficile enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor | 0.9714 | 5 | 308 |
| 2z6j-assembly1.cif.gz_B | crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor | 0.9689 | 3 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I9N1_3_315_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9816 | 4 | 313 | 3.20.20.70 |
| 5gvjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9759 | 3 | 312 | 3.20.20.70 |
| af_A4I9N1_3_315_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9692 | 4 | 313 | 3.20.20.70 |
| 5gvjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9564 | 3 | 312 | 3.20.20.70 |
| 2gjnA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9534 | 3 | 313 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5Y4I8-F1-model_v4 | deleted | 1.002 | 3 | 121 |
|
| AF-A0A258JPQ4-F1-model_v4 | Nitronate monooxygenase | 1.001 | 4 | 143 |
GO:0018580
|
| AF-A0A359MMT9-F1-model_v4 | deleted | 0.9989 | 22 | 112 |
|
| AF-A0A4Q5W4L1-F1-model_v4 | deleted | 0.9982 | 153 | 310 |
|
| AF-A0A3D3PJU3-F1-model_v4 | Nitronate monooxygenase | 0.9955 | 4 | 101 |
GO:0018580
|