F478698

General Info

Members Datasets Scaffolds Average Seq Length
743 328 1486 90

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0120346|Ga0439460_0120346_294_596
Length 100
Sequence LRERWFGATGRRVPEIAIEGELDAADALVLDGVSDEAALREAHEQGRPVVVRADSAEAVKAALARPEVASVLVPDSKRELLELDLTELTYGEAQGIRGEP

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
110 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
111 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
112 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
228 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
231 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
235 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 1.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 10.23
Rhizosphere 88.02
Stem 0
Stem Tuber 0
Unclassified 17.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0120346 3300042461 Bacteria 858
2 JGI24743J22301_10073630 3300001991 Bacteria 715
3 JGI24738J21930_10054436 3300002075 Bacteria 817
4 JGI24744J21845_10002216 3300002077 Bacteria 3953
5 JGI25405J52794_10085705 3300003911 Bacteria 695
6 Ga0070658_11069837 3300005327 Bacteria 702
7 Ga0070683_101448747 3300005329 Bacteria 660
8 Ga0070677_10933061 3300005333 Bacteria 503
9 Ga0068869_100212491 3300005334 Bacteria 1530
10 Ga0068869_100728198 3300005334 Bacteria 848
11 Ga0070680_100031377 3300005336 Bacteria 4272
12 Ga0070680_100095638 3300005336 Bacteria 2463
13 Ga0070680_100504841 3300005336 Unclassified 1035
14 Ga0070682_100003760 3300005337 Bacteria 8436
15 Ga0070682_100236754 3300005337 Bacteria 1308
16 Ga0070682_100378309 3300005337 Unclassified 1064
17 Ga0068868_100010668 3300005338 Bacteria 6658
18 Ga0068868_100062642 3300005338 Bacteria 2949
19 Ga0068868_101476540 3300005338 Bacteria 636
20 Ga0070660_100011996 3300005339 Bacteria 6182
21 Ga0070660_100036877 3300005339 Archaea 3705
22 Ga0070660_100114922 3300005339 Bacteria 2145
23 Ga0070689_100012496 3300005340 Bacteria 6118
24 Ga0070691_10076186 3300005341 Bacteria 1635
25 Ga0070691_10294887 3300005341 Bacteria 884
26 Ga0070687_100138783 3300005343 Bacteria 1413
27 Ga0070661_100214320 3300005344 Bacteria 1475
28 Ga0070661_100827899 3300005344 Archaea 761
29 Ga0070692_10008190 3300005345 Bacteria 4650
30 Ga0070692_11275941 3300005345 Bacteria 526
31 Ga0070668_100184927 3300005347 Bacteria 1704
32 Ga0070668_100486712 3300005347 Bacteria 1066
33 Ga0070669_100341821 3300005353 Bacteria 1213
34 Ga0070669_101239610 3300005353 Unclassified 645
35 Ga0070675_100694823 3300005354 Unclassified 926
36 Ga0070671_100448578 3300005355 Bacteria 1107
37 Ga0070674_100004532 3300005356 Bacteria 7933
38 Ga0070674_100148682 3300005356 Bacteria 1765
39 Ga0070673_100675299 3300005364 Bacteria 947
40 Ga0070673_100723451 3300005364 Unclassified 915
41 Ga0070688_100002151 3300005365 Bacteria 9925
42 Ga0070659_100067114 3300005366 Bacteria 2844
43 Ga0070659_100462005 3300005366 Unclassified 1078
44 Ga0070709_10017422 3300005434 Bacteria 4121
45 Ga0070709_10125804 3300005434 Bacteria 1744
46 Ga0070709_10321689 3300005434 Bacteria 1135
47 Ga0070709_10768902 3300005434 Bacteria 754
48 Ga0070714_100010948 3300005435 Bacteria 7184
49 Ga0070714_100078622 3300005435 Bacteria 2867
50 Ga0070714_100228405 3300005435 Bacteria 1713
51 Ga0070714_101149455 3300005435 Bacteria 757
52 Ga0070714_101274109 3300005435 Bacteria 717
53 Ga0070714_101439253 3300005435 Bacteria 673
54 Ga0070713_100035241 3300005436 Bacteria 4027
55 Ga0070713_100102854 3300005436 Bacteria 2478
56 Ga0070713_100240663 3300005436 Bacteria 1648
57 Ga0070710_10006515 3300005437 Bacteria 5613
58 Ga0070710_10010022 3300005437 Bacteria 4646
59 Ga0070701_10028361 3300005438 Bacteria 2751
60 Ga0070701_10225499 3300005438 Bacteria 1120
61 Ga0070711_100022911 3300005439 Bacteria 4054
62 Ga0070711_100159962 3300005439 Bacteria 1706
63 Ga0070711_100203275 3300005439 Bacteria 1530
64 Ga0070711_100246599 3300005439 Bacteria 1399
65 Ga0070711_100331453 3300005439 Bacteria 1218
66 Ga0070705_100017913 3300005440 Bacteria 3703
67 Ga0070705_101424186 3300005440 Bacteria 578
68 Ga0070705_101485273 3300005440 Unclassified 567
69 Ga0070700_100012870 3300005441 Bacteria 4686
70 Ga0070700_100822334 3300005441 Unclassified 750
71 Ga0070700_101522103 3300005441 Unclassified 569
72 Ga0070708_100135842 3300005445 Unclassified 2278
73 Ga0070708_100137136 3300005445 Bacteria 2267
74 Ga0070708_100152853 3300005445 Bacteria 2147
75 Ga0070708_100212958 3300005445 Unclassified 1811
76 Ga0070708_101588730 3300005445 Bacteria 609
77 Ga0070663_100453768 3300005455 Bacteria 1057
78 Ga0070678_100015082 3300005456 Bacteria 4899
79 Ga0070678_100021656 3300005456 Bacteria 4244
80 Ga0070678_100240532 3300005456 Bacteria 1513
81 Ga0070678_100330595 3300005456 Bacteria 1304
82 Ga0070678_101571588 3300005456 Archaea 617
83 Ga0070662_100092970 3300005457 Unclassified 2268
84 Ga0070662_100547042 3300005457 Bacteria 970
85 Ga0070681_10168677 3300005458 Bacteria 2111
86 Ga0070681_10235092 3300005458 Unclassified 1747
87 Ga0068867_100003914 3300005459 Bacteria 10475
88 Ga0068867_100079649 3300005459 Unclassified 2465
89 Ga0070685_10033983 3300005466 Bacteria 2870
90 Ga0070706_100003217 3300005467 Bacteria 16130
91 Ga0070706_100058084 3300005467 Bacteria 3571
92 Ga0070706_100071800 3300005467 Bacteria 3203
93 Ga0070706_100369167 3300005467 Unclassified 1337
94 Ga0070706_102107862 3300005467 Bacteria 510
95 Ga0070707_100001362 3300005468 Bacteria 23998
96 Ga0070707_100009422 3300005468 Bacteria 9063
97 Ga0070707_100252073 3300005468 Unclassified 1718
98 Ga0070698_100005957 3300005471 Bacteria 13293
99 Ga0070698_100156395 3300005471 Bacteria 2225
100 Ga0070699_100037948 3300005518 Bacteria 4171
101 Ga0070699_100042055 3300005518 Bacteria 3954
102 Ga0070699_100645785 3300005518 Unclassified 966
103 Ga0070699_100674667 3300005518 Bacteria 944
104 Ga0070699_100865122 3300005518 Bacteria 828
105 Ga0070679_100050625 3300005530 Archaea 4138
106 Ga0070679_100139555 3300005530 Unclassified 2404
107 Ga0070679_100235932 3300005530 Bacteria 1788
108 Ga0070679_100240390 3300005530 Bacteria 1768
109 Ga0070679_100992523 3300005530 Bacteria 784
110 Ga0070684_100639315 3300005535 Unclassified 990
111 Ga0070697_100044068 3300005536 Bacteria 3613
112 Ga0070697_100298372 3300005536 Bacteria 1385
113 Ga0068853_100005042 3300005539 Bacteria 10300
114 Ga0068853_100613132 3300005539 Unclassified 1034
115 Ga0070672_100158549 3300005543 Bacteria 1876
116 Ga0070686_100146896 3300005544 Unclassified 1647
117 Ga0070686_101103974 3300005544 Unclassified 655
118 Ga0070695_100135985 3300005545 Bacteria 1699
119 Ga0070695_100273562 3300005545 Bacteria 1238
120 Ga0070695_100301422 3300005545 Bacteria 1184
121 Ga0070696_100060042 3300005546 Bacteria 2658
122 Ga0070696_100152127 3300005546 Unclassified 1699
123 Ga0070696_100717813 3300005546 Unclassified 816
124 Ga0070696_101307751 3300005546 Bacteria 616
125 Ga0070693_100016468 3300005547 Bacteria 3828
126 Ga0070665_100024429 3300005548 Bacteria 6086
127 Ga0070704_101168986 3300005549 Bacteria 701
128 Ga0070704_101620203 3300005549 Unclassified 597
129 Ga0070704_101936670 3300005549 Bacteria 547
130 Ga0068855_100054310 3300005563 Bacteria 4708
131 Ga0068855_100121082 3300005563 Unclassified 2995
132 Ga0068855_100150559 3300005563 Bacteria 2646
133 Ga0068855_100525888 3300005563 Bacteria 1283
134 Ga0070664_101571319 3300005564 Bacteria 623
135 Ga0070664_101910228 3300005564 Unclassified 563
136 Ga0068854_101145683 3300005578 Unclassified 695
137 Ga0068854_101626434 3300005578 Bacteria 589
138 Ga0068856_100002162 3300005614 Bacteria 20361
139 Ga0068856_100061341 3300005614 Bacteria 3714
140 Ga0068856_101105380 3300005614 Bacteria 810
141 Ga0070702_100105698 3300005615 Bacteria 1735
142 Ga0070702_100448148 3300005615 Bacteria 936
143 Ga0070702_100958613 3300005615 Unclassified 674
144 Ga0068852_100014271 3300005616 Bacteria 6108
145 Ga0068852_100252170 3300005616 Unclassified 1691
146 Ga0068859_100069036 3300005617 Bacteria 3568
147 Ga0068859_100094205 3300005617 Bacteria 3047
148 Ga0068864_100229868 3300005618 Unclassified 1715
149 Ga0068864_100730418 3300005618 Bacteria 969
150 Ga0068866_10008433 3300005718 Bacteria 4345
151 Ga0068866_10104473 3300005718 Bacteria 1569
152 Ga0068866_10157838 3300005718 Unclassified 1320
153 Ga0068866_11043435 3300005718 Unclassified 583
154 Ga0068861_100005704 3300005719 Bacteria 8439
155 Ga0068861_100433276 3300005719 Bacteria 1174
156 Ga0068861_101246204 3300005719 Unclassified 721
157 Ga0068851_10528994 3300005834 Bacteria 710
158 Ga0068870_10059327 3300005840 Bacteria 2051
159 Ga0068863_100671835 3300005841 Bacteria 1028
160 Ga0068858_100230765 3300005842 Unclassified 1755
161 Ga0068858_101887950 3300005842 Bacteria 590
162 Ga0068860_100117102 3300005843 Bacteria 2549
163 Ga0068860_101094164 3300005843 Bacteria 816
164 Ga0068862_100616738 3300005844 Bacteria 1043
165 Ga0081455_10039020 3300005937 Bacteria 4201
166 Ga0081455_10278259 3300005937 Unclassified 1210
167 Ga0081538_10235903 3300005981 Bacteria 710
168 Ga0081540_1010777 3300005983 Bacteria 6146
169 Ga0081540_1070182 3300005983 Bacteria 1624
170 Ga0081539_10095198 3300005985 Bacteria 1530
171 Ga0070717_10059025 3300006028 Bacteria 3173
172 Ga0070717_10243557 3300006028 Bacteria 1586
173 Ga0070717_11466842 3300006028 Bacteria 619
174 Ga0075365_10177238 3300006038 Bacteria 1489
175 Ga0075364_10196099 3300006051 Unclassified 1368
176 Ga0075432_10035055 3300006058 Bacteria 1744
177 Ga0070715_10090578 3300006163 Bacteria 1406
178 Ga0070715_10096996 3300006163 Bacteria 1368
179 Ga0070715_10551764 3300006163 Bacteria 668
180 Ga0070716_100148530 3300006173 Bacteria 1504
181 Ga0070716_100545116 3300006173 Bacteria 864
182 Ga0070712_100010588 3300006175 Bacteria 5823
183 Ga0070712_100022492 3300006175 Bacteria 4154
184 Ga0097621_100023655 3300006237 Bacteria 4786
185 Ga0068871_100005450 3300006358 Bacteria 8921
186 Ga0068871_100010855 3300006358 Bacteria 6668
187 Ga0075428_100476410 3300006844 Bacteria 1336
188 Ga0075428_100540879 3300006844 Bacteria 1245
189 Ga0075430_100408165 3300006846 Bacteria 1121
190 Ga0075431_100334635 3300006847 Bacteria 1524
191 Ga0075433_10034290 3300006852 Bacteria 4358
192 Ga0075433_10127931 3300006852 Bacteria 2256
193 Ga0075433_10235581 3300006852 Bacteria 1625
194 Ga0075434_100320802 3300006871 Bacteria 1570
195 Ga0075434_100880584 3300006871 Bacteria 910
196 Ga0075434_101005269 3300006871 Bacteria 848
197 Ga0068865_100003055 3300006881 Bacteria 10010
198 Ga0068865_100054353 3300006881 Bacteria 2782
199 Ga0075436_100049813 3300006914 Unclassified 2891
200 Ga0075436_100266670 3300006914 Bacteria 1222
201 Ga0075436_100449504 3300006914 Bacteria 938
202 Ga0075436_100485482 3300006914 Bacteria 902
203 Ga0097620_100069035 3300006931 Bacteria 3568
204 Ga0097620_100094200 3300006931 Bacteria 3047
205 Ga0075435_100016185 3300007076 Bacteria 5620
206 Ga0075435_100032815 3300007076 Bacteria 4102
207 Ga0075435_100039398 3300007076 Bacteria 3771
208 Ga0075435_100356089 3300007076 Unclassified 1255
209 Ga0105240_10057696 3300009093 Bacteria 4848
210 Ga0105240_10490825 3300009093 Bacteria 1367
211 Ga0105240_11011098 3300009093 Unclassified 889
212 Ga0111539_10289046 3300009094 Bacteria 1908
213 Ga0111539_10473578 3300009094 Bacteria 1458
214 Ga0111539_10503089 3300009094 Bacteria 1411
215 Ga0111539_12788003 3300009094 Bacteria 566
216 Ga0105245_10016126 3300009098 Bacteria 6510
217 Ga0105245_10024904 3300009098 Bacteria 5259
218 Ga0105245_10046418 3300009098 Bacteria 3882
219 Ga0105245_10270721 3300009098 Bacteria 1657
220 Ga0105245_11287375 3300009098 Unclassified 780
221 Ga0105245_11526987 3300009098 Unclassified 719
222 Ga0105247_10069466 3300009101 Bacteria 2198
223 Ga0114129_10111342 3300009147 Bacteria 3777
224 Ga0114129_10499344 3300009147 Unclassified 1589
225 Ga0114129_10947694 3300009147 Unclassified 1087
226 Ga0114129_11072284 3300009147 Bacteria 1010
227 Ga0114129_11391760 3300009147 Bacteria 866
228 Ga0114129_11679191 3300009147 Bacteria 776
229 Ga0114129_12763341 3300009147 Bacteria 584
230 Ga0105243_10011291 3300009148 Bacteria 6757
231 Ga0105243_10066817 3300009148 Bacteria 2893
232 Ga0105243_10419206 3300009148 Bacteria 1248
233 Ga0105243_11094775 3300009148 Bacteria 805
234 Ga0105241_10071910 3300009174 Bacteria 2686
235 Ga0105241_10226482 3300009174 Bacteria 1574
236 Ga0105242_10883277 3300009176 Bacteria 892
237 Ga0105248_10024950 3300009177 Bacteria 6645
238 Ga0105248_10068321 3300009177 Bacteria 3990
239 Ga0105248_11842792 3300009177 Bacteria 686
240 Ga0105237_10043577 3300009545 Bacteria 4520
241 Ga0105238_10252584 3300009551 Unclassified 1742
242 Ga0105238_10340356 3300009551 Bacteria 1488
243 Ga0105238_11734277 3300009551 Bacteria 656
244 Ga0105249_10005612 3300009553 Bacteria 10852
245 Ga0105249_10106607 3300009553 Bacteria 2644
246 Ga0105249_11045266 3300009553 Bacteria 886
247 Ga0105239_10047166 3300010375 Bacteria 4721
248 Ga0105239_10131471 3300010375 Bacteria 2784
249 Ga0105239_10181594 3300010375 Bacteria 2354
250 Ga0105246_10008656 3300011119 Bacteria 6257
251 Ga0105246_11312758 3300011119 Bacteria 671
252 Ga0105246_11973555 3300011119 Unclassified 562
253 Ga0157344_1023061 3300012476 Bacteria 550
254 Ga0157325_1032803 3300012485 Bacteria 529
255 Ga0157342_1006866 3300012507 Bacteria 1090
256 Ga0157338_1020414 3300012515 Unclassified 767
257 Ga0157338_1087892 3300012515 Unclassified 514
258 Ga0157373_10726647 3300013100 Unclassified 729
259 Ga0157373_10738523 3300013100 Bacteria 723
260 Ga0157371_10357226 3300013102 Bacteria 1064
261 Ga0157369_10010509 3300013105 Bacteria 10536
262 Ga0157369_10174690 3300013105 Bacteria 2262
263 Ga0157374_10012128 3300013296 Bacteria 7486
264 Ga0157378_10076762 3300013297 Bacteria 3011
265 Ga0157378_11563062 3300013297 Unclassified 705
266 Ga0163162_10004391 3300013306 Bacteria 13571
267 Ga0163162_10054564 3300013306 Bacteria 4020
268 Ga0163162_10449095 3300013306 Bacteria 1421
269 Ga0157372_10156272 3300013307 Unclassified 2635
270 Ga0157372_10231776 3300013307 Bacteria 2141
271 Ga0157375_10062566 3300013308 Bacteria 3699
272 Ga0157375_10072916 3300013308 Bacteria 3451
273 Ga0157380_10000820 3300014326 Bacteria 19481
274 Ga0182008_10010586 3300014497 Bacteria 4932
275 Ga0182008_10107770 3300014497 Bacteria 1379
276 Ga0182008_10124584 3300014497 Bacteria 1282
277 Ga0182008_10187803 3300014497 Bacteria 1048
278 Ga0157377_10001363 3300014745 Bacteria 10498
279 Ga0157379_10094192 3300014968 Bacteria 2687
280 Ga0157379_10118556 3300014968 Bacteria 2381
281 Ga0157376_10003432 3300014969 Bacteria 10906
282 Ga0157376_10036180 3300014969 Bacteria 3998
283 Ga0157376_10059553 3300014969 Bacteria 3202
284 Ga0182006_1006796 3300015261 Bacteria 5278
285 Ga0182007_10023172 3300015262 Bacteria 2185
286 Ga0163161_11072952 3300017792 Unclassified 691
287 Ga0163161_11577652 3300017792 Unclassified 578
288 Ga0197907_11200153 3300020069 Bacteria 1319
289 Ga0206356_10432734 3300020070 Bacteria 2160
290 Ga0206356_11656821 3300020070 Bacteria 4724
291 Ga0206354_10130814 3300020081 Bacteria 677
292 Ga0206354_10221712 3300020081 Bacteria 2487
293 Ga0206354_11711433 3300020081 Bacteria 746
294 Ga0206353_10137641 3300020082 Bacteria 4725
295 Ga0206353_10425681 3300020082 Bacteria 970
296 Ga0206353_10849129 3300020082 Bacteria 1830
297 Ga0224712_10055536 3300022467 Bacteria 1558
298 Ga0224712_10076729 3300022467 Bacteria 1370
299 Ga0207692_10073204 3300025898 Bacteria 1812
300 Ga0207692_10630635 3300025898 Bacteria 691
301 Ga0207642_10004158 3300025899 Bacteria 4648
302 Ga0207642_10241648 3300025899 Bacteria 1020
303 Ga0207642_10409617 3300025899 Archaea 813
304 Ga0207710_10408175 3300025900 Bacteria 698
305 Ga0207688_10500396 3300025901 Unclassified 761
306 Ga0207647_10069697 3300025904 Bacteria 2125
307 Ga0207685_10052216 3300025905 Bacteria 1583
308 Ga0207699_10009894 3300025906 Bacteria 4765
309 Ga0207699_10016185 3300025906 Bacteria 3894
310 Ga0207699_10237186 3300025906 Bacteria 1252
311 Ga0207699_10265088 3300025906 Bacteria 1189
312 Ga0207643_10033044 3300025908 Bacteria 2894
313 Ga0207705_10192106 3300025909 Bacteria 1544
314 Ga0207705_10503386 3300025909 Bacteria 941
315 Ga0207684_10015175 3300025910 Bacteria 6635
316 Ga0207684_10182169 3300025910 Bacteria 1811
317 Ga0207684_10338017 3300025910 Unclassified 1297
318 Ga0207684_10461663 3300025910 Bacteria 1090
319 Ga0207684_10985211 3300025910 Bacteria 706
320 Ga0207654_10279978 3300025911 Bacteria 1128
321 Ga0207707_10100715 3300025912 Bacteria 2525
322 Ga0207707_11225877 3300025912 Bacteria 606
323 Ga0207695_10091670 3300025913 Bacteria 3052
324 Ga0207695_10435985 3300025913 Bacteria 1194
325 Ga0207695_10524778 3300025913 Bacteria 1066
326 Ga0207671_10231612 3300025914 Bacteria 1449
327 Ga0207693_10000499 3300025915 Bacteria 35458
328 Ga0207693_10008162 3300025915 Bacteria 8579
329 Ga0207693_10069056 3300025915 Bacteria 2766
330 Ga0207693_10236641 3300025915 Bacteria 1434
331 Ga0207663_10001885 3300025916 Bacteria 9921
332 Ga0207663_10153653 3300025916 Bacteria 1617
333 Ga0207663_10367050 3300025916 Bacteria 1093
334 Ga0207663_10386999 3300025916 Bacteria 1067
335 Ga0207663_10641119 3300025916 Bacteria 838
336 Ga0207663_10712691 3300025916 Bacteria 795
337 Ga0207660_10056505 3300025917 Bacteria 2808
338 Ga0207660_10082828 3300025917 Bacteria 2361
339 Ga0207660_10105498 3300025917 Bacteria 2112
340 Ga0207662_10150039 3300025918 Bacteria 1482
341 Ga0207657_10003301 3300025919 Bacteria 17246
342 Ga0207657_10047289 3300025919 Bacteria 3763
343 Ga0207649_10175075 3300025920 Bacteria 1498
344 Ga0207649_11113840 3300025920 Archaea 623
345 Ga0207652_10062108 3300025921 Bacteria 3228
346 Ga0207652_10072700 3300025921 Bacteria 2991
347 Ga0207652_10231601 3300025921 Unclassified 1665
348 Ga0207652_11153590 3300025921 Bacteria 676
349 Ga0207652_11185742 3300025921 Unclassified 665
350 Ga0207646_10001072 3300025922 Bacteria 34848
351 Ga0207646_10004270 3300025922 Bacteria 15605
352 Ga0207646_11612339 3300025922 Unclassified 559
353 Ga0207681_10078480 3300025923 Bacteria 2324
354 Ga0207681_11404531 3300025923 Unclassified 586
355 Ga0207694_10176059 3300025924 Bacteria 1733
356 Ga0207659_10229048 3300025926 Bacteria 1498
357 Ga0207659_10417414 3300025926 Unclassified 1125
358 Ga0207687_10054205 3300025927 Unclassified 2804
359 Ga0207687_10301073 3300025927 Bacteria 1292
360 Ga0207687_10897073 3300025927 Unclassified 758
361 Ga0207700_10160779 3300025928 Bacteria 1865
362 Ga0207700_10359065 3300025928 Bacteria 1270
363 Ga0207664_10031428 3300025929 Bacteria 4062
364 Ga0207664_10375524 3300025929 Bacteria 1261
365 Ga0207664_10511379 3300025929 Bacteria 1076
366 Ga0207690_10514306 3300025932 Unclassified 970
367 Ga0207706_10033209 3300025933 Bacteria 4594
368 Ga0207706_11066800 3300025933 Unclassified 676
369 Ga0207709_10002593 3300025935 Bacteria 11265
370 Ga0207709_10023219 3300025935 Bacteria 3528
371 Ga0207709_10103697 3300025935 Bacteria 1886
372 Ga0207709_10420966 3300025935 Bacteria 1026
373 Ga0207670_10034007 3300025936 Bacteria 3290
374 Ga0207669_10045477 3300025937 Bacteria 2587
375 Ga0207669_10096813 3300025937 Bacteria 1938
376 Ga0207669_10389223 3300025937 Bacteria 1089
377 Ga0207704_10006544 3300025938 Bacteria 5443
378 Ga0207704_10961809 3300025938 Unclassified 721
379 Ga0207665_10040744 3300025939 Bacteria 3100
380 Ga0207665_10233833 3300025939 Bacteria 1352
381 Ga0207691_10007967 3300025940 Bacteria 10194
382 Ga0207691_10096134 3300025940 Bacteria 2649
383 Ga0207689_10562115 3300025942 Bacteria 958
384 Ga0207679_11084413 3300025945 Unclassified 735
385 Ga0207679_11167956 3300025945 Bacteria 706
386 Ga0207667_10080896 3300025949 Unclassified 3365
387 Ga0207667_10109854 3300025949 Bacteria 2844
388 Ga0207667_10307418 3300025949 Bacteria 1620
389 Ga0207651_10283769 3300025960 Bacteria 1370
390 Ga0207651_11253569 3300025960 Bacteria 666
391 Ga0207712_10110643 3300025961 Bacteria 2060
392 Ga0207712_10721913 3300025961 Bacteria 871
393 Ga0207668_10116718 3300025972 Bacteria 2013
394 Ga0207668_11644587 3300025972 Bacteria 580
395 Ga0207640_11265341 3300025981 Bacteria 658
396 Ga0207677_10198040 3300026023 Unclassified 1594
397 Ga0207677_10487687 3300026023 Bacteria 1063
398 Ga0207639_10298468 3300026041 Bacteria 1423
399 Ga0207678_10018137 3300026067 Bacteria 6181
400 Ga0207678_10073845 3300026067 Bacteria 2923
401 Ga0207708_10000434 3300026075 Bacteria 32516
402 Ga0207702_10007931 3300026078 Bacteria 8996
403 Ga0207702_10116681 3300026078 Bacteria 2382
404 Ga0207702_10709834 3300026078 Bacteria 991
405 Ga0207648_10002641 3300026089 Bacteria 19147
406 Ga0207648_10082064 3300026089 Bacteria 2811
407 Ga0207648_10206738 3300026089 Bacteria 1742
408 Ga0207648_10255120 3300026089 Bacteria 1564
409 Ga0207676_10216997 3300026095 Bacteria 1701
410 Ga0207675_101374838 3300026118 Bacteria 727
411 Ga0207675_101820027 3300026118 Unclassified 628
412 Ga0207675_101828854 3300026118 Unclassified 626
413 Ga0207683_10002738 3300026121 Bacteria 15398
414 Ga0207683_10003610 3300026121 Bacteria 13485
415 Ga0207683_10005388 3300026121 Bacteria 10966
416 Ga0207683_11092481 3300026121 Unclassified 740
417 Ga0207698_10056585 3300026142 Bacteria 3029
418 Ga0207698_10190040 3300026142 Bacteria 1828
419 Ga0207698_12253953 3300026142 Bacteria 557
420 Ga0207428_10003839 3300027907 Bacteria 14417
421 Ga0207428_10436789 3300027907 Bacteria 955
422 Ga0207428_11242619 3300027907 Bacteria 517
423 Ga0268266_10037554 3300028379 Bacteria 4125
424 Ga0268265_10228619 3300028380 Bacteria 1633
425 Ga0268265_10457731 3300028380 Bacteria 1193
426 Ga0268264_10077799 3300028381 Bacteria 2826
427 Ga0265313_10034611 3300031595 Bacteria 2552
428 Ga0265342_10094881 3300031712 Bacteria 1706
429 Ga0307406_10290864 3300031901 Unclassified 1251
430 Ga0307409_100737023 3300031995 Unclassified 988
431 Ga0307409_101012961 3300031995 Unclassified 849
432 Ga0307415_100298328 3300032126 Bacteria 1334
433 Ga0373948_0124031 3300034817 Unclassified 626
434 Ga0373959_0131536 3300034820 Bacteria 619
435 Ga0373926_0115523 3300035083 Unclassified 1010
436 Ga0373944_0117218 3300035089 Bacteria 914
437 Ga0373944_0242051 3300035089 Bacteria 664
438 Ga0373949_0008021 3300035090 Bacteria 2313
439 Ga0373932_0053851 3300035112 Bacteria 1202
440 Ga0373939_0162266 3300035114 Unclassified 821
441 Ga0373960_0014971 3300035121 Bacteria 1973
442 Ga0373943_0048687 3300035170 Bacteria 2077
443 Ga0373946_0079717 3300035171 Bacteria 1431
444 Ga0373942_0022524 3300035207 Bacteria 1599
445 Ga0373942_0160472 3300035207 Archaea 727
446 Ga0373961_0059612 3300035241 Bacteria 1154
447 Ga0373961_0256391 3300035241 Unclassified 634
448 Ga0373962_0030057 3300035242 Bacteria 1484
449 Ga0373931_0047315 3300035691 Bacteria 2276
450 Ga0373935_0167033 3300035692 Unclassified 1503
451 Ga0373927_1177153 3300035695 Unclassified 506
452 Ga0373947_0519721 3300035725 Bacteria 809
453 Ga0373925_0003083 3300037068 Bacteria 13079
454 Ga0395899_0001963 3300037312 Bacteria 16910
455 Ga0395899_0003970 3300037312 Bacteria 11655
456 Ga0395899_0006551 3300037312 Bacteria 9025
457 Ga0395899_0016730 3300037312 Bacteria 5591
458 Ga0395899_0017465 3300037312 Bacteria 5466
459 Ga0395899_0067673 3300037312 Bacteria 2620
460 Ga0395899_0075689 3300037312 Bacteria 2458
461 Ga0395899_0186219 3300037312 Bacteria 1455
462 Ga0395899_0186336 3300037312 Unclassified 1454
463 Ga0395899_0745005 3300037312 Bacteria 610
464 Ga0395899_0769762 3300037312 Bacteria 597
465 Ga0395900_0000528 3300037418 Bacteria 53945
466 Ga0395900_0009930 3300037418 Bacteria 9744
467 Ga0395900_0026000 3300037418 Bacteria 5994
468 Ga0395900_0032772 3300037418 Bacteria 5344
469 Ga0395900_0048050 3300037418 Bacteria 4395
470 Ga0395900_0082055 3300037418 Bacteria 3312
471 Ga0395900_0132720 3300037418 Bacteria 2551
472 Ga0395900_0139567 3300037418 Bacteria 2482
473 Ga0395900_0184555 3300037418 Unclassified 2118
474 Ga0395900_0435003 3300037418 Unclassified 1270
475 Ga0395900_0697931 3300037418 Unclassified 948
476 Ga0395898_0002345 3300037466 Bacteria 22578
477 Ga0395898_0002958 3300037466 Bacteria 19307
478 Ga0395898_0005922 3300037466 Bacteria 13132
479 Ga0395898_0008588 3300037466 Bacteria 10780
480 Ga0395898_0009089 3300037466 Bacteria 10465
481 Ga0395898_0046330 3300037466 Bacteria 4271
482 Ga0395898_0062737 3300037466 Unclassified 3608
483 Ga0395898_0066039 3300037466 Bacteria 3506
484 Ga0395898_0087474 3300037466 Unclassified 3001
485 Ga0395898_0096184 3300037466 Bacteria 2845
486 Ga0395898_0151178 3300037466 Bacteria 2221
487 Ga0395898_0285647 3300037466 Unclassified 1574
488 Ga0395898_0537164 3300037466 Bacteria 1111
489 Ga0395898_0636986 3300037466 Unclassified 1008
490 Ga0395898_0784242 3300037466 Bacteria 894
491 Ga0395898_1193220 3300037466 Unclassified 692
492 Ga0395898_1533621 3300037466 Bacteria 592
493 Ga0395905_0000661 3300037471 Bacteria 45819
494 Ga0395905_0001694 3300037471 Bacteria 25990
495 Ga0395905_0011923 3300037471 Bacteria 8382
496 Ga0395905_0031156 3300037471 Bacteria 5022
497 Ga0395905_0033831 3300037471 Bacteria 4800
498 Ga0395905_0040274 3300037471 Bacteria 4382
499 Ga0395905_0080512 3300037471 Bacteria 3052
500 Ga0395905_0155303 3300037471 Bacteria 2152
501 Ga0395905_0199219 3300037471 Bacteria 1877
502 Ga0395905_0256858 3300037471 Bacteria 1632
503 Ga0395905_0393837 3300037471 Bacteria 1280
504 Ga0395905_0476123 3300037471 Unclassified 1148
505 Ga0395905_0838173 3300037471 Bacteria 822
506 Ga0395901_0001602 3300038443 Bacteria 23437
507 Ga0395901_0001739 3300038443 Bacteria 22507
508 Ga0395901_0001749 3300038443 Bacteria 22444
509 Ga0395901_0003765 3300038443 Bacteria 15289
510 Ga0395901_0005893 3300038443 Bacteria 12398
511 Ga0395901_0043406 3300038443 Bacteria 4663
512 Ga0395901_0147972 3300038443 Bacteria 2468
513 Ga0395901_0257563 3300038443 Bacteria 1816
514 Ga0395901_0267510 3300038443 Bacteria 1778
515 Ga0395901_0297177 3300038443 Unclassified 1674
516 Ga0395901_0340763 3300038443 Bacteria 1549
517 Ga0395901_0341299 3300038443 Bacteria 1547
518 Ga0395901_0350581 3300038443 Bacteria 1523
519 Ga0395901_0385383 3300038443 Bacteria 1442
520 Ga0395901_0701157 3300038443 Bacteria 1010
521 Ga0395901_0863085 3300038443 Bacteria 889
522 Ga0395901_0910806 3300038443 Bacteria 861
523 Ga0395901_0980220 3300038443 Bacteria 822
524 Ga0395901_0983229 3300038443 Bacteria 821
525 Ga0395901_1076501 3300038443 Bacteria 776
526 Ga0395901_1091707 3300038443 Unclassified 769
527 Ga0395901_1318085 3300038443 Bacteria 683
528 Ga0242420_145673 3300038996 Bacteria 529
529 Ga0439466_0218409 3300041411 Unclassified 579
530 Ga0451789_1142008 3300041443 Bacteria 722
531 Ga0451793_1812798 3300041452 Bacteria 959
532 Ga0451795_0146402 3300041456 Bacteria 681
533 Ga0451800_1404220 3300041459 Unclassified 1519
534 Ga0451802_1467075 3300041460 Bacteria 519
535 Ga0451802_1873421 3300041460 Bacteria 551
536 Ga0451807_1176568 3300041486 Bacteria 1491
537 Ga0451835_0714903 3300041492 Bacteria 1381
538 Ga0451837_1311960 3300041494 Bacteria 628
539 Ga0451839_0058348 3300041496 Unclassified 583
540 Ga0451841_0862240 3300041498 Bacteria 664
541 Ga0451849_1344522 3300041505 Unclassified 1729
542 Ga0451843_0649213 3300041509 Unclassified 579
543 Ga0451853_0466113 3300041512 Bacteria 1009
544 Ga0451853_3853896 3300041512 Unclassified 696
545 Ga0439431_0047274 3300041997 Bacteria 1109
546 Ga0439433_0024070 3300041999 Bacteria 1371
547 Ga0439442_005208 3300042002 Bacteria 2607
548 Ga0439448_0006888 3300042005 Bacteria 3278
549 Ga0439432_135701 3300042006 Unclassified 725
550 Ga0439455_0021734 3300042012 Bacteria 1532
551 Ga0439462_0007795 3300042015 Bacteria 2687
552 Ga0450919_018115 3300042121 Bacteria 794
553 Ga0450923_059554 3300042125 Bacteria 831
554 Ga0439446_0001483 3300042156 Bacteria 5361
555 Ga0439458_0003351 3300042157 Bacteria 3765
556 Ga0466966_0069494 3300044684 Bacteria 2209
557 Ga0466961_0237400 3300044693 Bacteria 1121
558 Ga0466963_0065421 3300044694 Bacteria 2438
559 Ga0466963_0208313 3300044694 Archaea 1368
560 Ga0466963_0641576 3300044694 Bacteria 750
561 Ga0466964_0302396 3300044706 Archaea 807
562 Ga0466964_0761964 3300044706 Unclassified 544
563 Ga0466968_0185526 3300044735 Bacteria 969
564 Ga0466968_0322721 3300044735 Unclassified 746
565 Ga0466968_0455555 3300044735 Bacteria 633
566 Ga0466957_0079564 3300044842 Bacteria 2040
567 Ga0466957_0690571 3300044842 Bacteria 720
568 Ga0466960_0037169 3300044901 Bacteria 2283
569 Ga0466960_0313629 3300044901 Bacteria 887
570 Ga0466959_0040893 3300045049 Bacteria 3424
571 Ga0466959_0407043 3300045049 Archaea 924
572 Ga0451576_1416926 3300045051 Bacteria 723
573 Ga0451576_1876869 3300045051 Bacteria 618
574 Ga0466958_0060435 3300045836 Bacteria 2307
575 Ga0466967_0160773 3300045976 Bacteria 2108
576 Ga0466967_0797624 3300045976 Archaea 937
577 Ga0466967_1063518 3300045976 Unclassified 806
578 Ga0466967_1457400 3300045976 Bacteria 682
579 Ga0495603_0002063 3300046455 Bacteria 11810
580 Ga0495603_0006748 3300046455 Bacteria 6889
581 Ga0495603_0741007 3300046455 Bacteria 561
582 Ga0495641_0005728 3300046461 Bacteria 8262
583 Ga0495651_0283286 3300046462 Unclassified 1119
584 Ga0495582_0042033 3300046473 Bacteria 2518
585 Ga0495605_0466520 3300046474 Bacteria 519
586 Ga0495639_0145371 3300046475 Bacteria 1142
587 Ga0495639_0199321 3300046475 Bacteria 979
588 Ga0495664_0506061 3300046477 Bacteria 721
589 Ga0495584_0073685 3300046491 Bacteria 1716
590 Ga0495594_0000307 3300046499 Bacteria 24065
591 Ga0495596_0043734 3300046500 Unclassified 1765
592 Ga0495616_0207329 3300046513 Unclassified 859
593 Ga0495620_0227564 3300046515 Bacteria 713
594 Ga0495620_0397735 3300046515 Bacteria 522
595 Ga0495630_0505241 3300046517 Bacteria 927
596 Ga0495631_0220249 3300046518 Unclassified 810
597 Ga0495631_0382375 3300046518 Unclassified 599
598 Ga0495637_0222781 3300046520 Bacteria 686
599 Ga0495644_0091114 3300046523 Unclassified 1151
600 Ga0495666_0046733 3300046526 Bacteria 2086
601 Ga0495598_0261414 3300046537 Bacteria 644
602 Ga0495609_0233690 3300046538 Unclassified 761
603 Ga0495645_0399159 3300046543 Bacteria 877
604 Ga0495656_0013806 3300046615 Bacteria 3014
605 Ga0495656_0090661 3300046615 Unclassified 1397
606 Ga0495656_0508762 3300046615 Bacteria 639
607 Ga0495668_0132220 3300046616 Unclassified 1366
608 Ga0495588_0153116 3300046674 Unclassified 1218
609 Ga0495588_0255063 3300046674 Unclassified 924
610 Ga0495599_0660676 3300046678 Bacteria 605
611 Ga0495647_0020951 3300046681 Bacteria 2351
612 Ga0495658_0098005 3300046683 Bacteria 1746
613 Ga0495669_0197656 3300046684 Bacteria 961
614 Ga0495613_0653258 3300046689 Bacteria 696
615 Ga0495589_0376586 3300046794 Unclassified 653
616 Ga0495589_0533666 3300046794 Bacteria 535
617 Ga0495589_0554617 3300046794 Bacteria 524
618 Ga0495581_0308177 3300047315 Bacteria 925
619 Ga0495581_0781474 3300047315 Unclassified 548
620 Ga0495676_0212496 3300047321 Bacteria 1337
621 Ga0495677_0188095 3300047445 Bacteria 801
622 Ga0496100_0003975 3300048903 Bacteria 7770
623 Ga0496100_0286265 3300048903 Bacteria 1230
624 Ga0496100_0474471 3300048903 Bacteria 961
625 Ga0496100_1559468 3300048903 Bacteria 522
626 Ga0496101_0009755 3300048904 Bacteria 6320
627 Ga0496101_0031633 3300048904 Bacteria 3721
628 Ga0496101_0141817 3300048904 Bacteria 1832
629 Ga0496101_0183539 3300048904 Bacteria 1612
630 Ga0496101_0317308 3300048904 Bacteria 1222
631 Ga0496102_0039982 3300048905 Bacteria 4240
632 Ga0496102_0043801 3300048905 Bacteria 4059
633 Ga0496102_0087472 3300048905 Bacteria 2879
634 Ga0496103_0005357 3300048906 Bacteria 7685
635 Ga0496103_0234069 3300048906 Bacteria 1182
636 Ga0496104_0032151 3300048907 Bacteria 4883
637 Ga0496104_0075582 3300048907 Bacteria 3208
638 Ga0496104_0187599 3300048907 Bacteria 1978
639 Ga0496104_0571938 3300048907 Bacteria 1040
640 Ga0496105_0003888 3300048908 Bacteria 11164
641 Ga0496105_0019259 3300048908 Bacteria 5504
642 Ga0496105_0264107 3300048908 Bacteria 1391
643 Ga0496105_0403699 3300048908 Unclassified 1084
644 Ga0496106_0006113 3300048909 Bacteria 8906
645 Ga0496106_0244304 3300048909 Bacteria 1434
646 Ga0496106_0492933 3300048909 Bacteria 984
647 Ga0496106_1150327 3300048909 Bacteria 607
648 Ga0496107_0025630 3300048910 Bacteria 4175
649 Ga0496107_0134362 3300048910 Bacteria 1827
650 Ga0496107_0250884 3300048910 Bacteria 1317
651 Ga0496107_0354344 3300048910 Bacteria 1092
652 Ga0496108_0007670 3300048911 Bacteria 8738
653 Ga0496108_0110537 3300048911 Bacteria 2350
654 Ga0496108_0139246 3300048911 Bacteria 2090
655 Ga0496108_0443937 3300048911 Bacteria 1133
656 Ga0496108_1141060 3300048911 Bacteria 661
657 Ga0496109_0003761 3300048912 Bacteria 12677
658 Ga0496109_0094744 3300048912 Bacteria 2763
659 Ga0496109_0128506 3300048912 Bacteria 2364
660 Ga0496109_0190719 3300048912 Bacteria 1926
661 Ga0496109_0542244 3300048912 Bacteria 1097
662 Ga0496110_0007559 3300048913 Bacteria 8681
663 Ga0496110_0039756 3300048913 Bacteria 4096
664 Ga0496110_1394373 3300048913 Unclassified 610
665 Ga0496110_1532193 3300048913 Bacteria 576
666 Ga0496111_0004179 3300048914 Bacteria 9084
667 Ga0496111_0038639 3300048914 Bacteria 3420
668 Ga0496111_0088187 3300048914 Bacteria 2272
669 Ga0496111_0405598 3300048914 Bacteria 1007
670 Ga0496111_0820669 3300048914 Bacteria 672
671 Ga0496111_1112597 3300048914 Bacteria 563
672 Ga0496112_0006315 3300048915 Bacteria 10405
673 Ga0496112_0011387 3300048915 Bacteria 8121
674 Ga0496112_0123741 3300048915 Bacteria 2557
675 Ga0496112_0270913 3300048915 Bacteria 1646
676 Ga0496113_0031583 3300048916 Bacteria 3844
677 Ga0496113_0173656 3300048916 Bacteria 1707
678 Ga0496113_0236597 3300048916 Bacteria 1457
679 Ga0496113_0495139 3300048916 Bacteria 981
680 Ga0496114_0011921 3300048917 Bacteria 6956
681 Ga0496114_0033169 3300048917 Bacteria 4252
682 Ga0496114_0088471 3300048917 Unclassified 2627
683 Ga0496114_0138237 3300048917 Bacteria 2107
684 Ga0496114_0160090 3300048917 Bacteria 1957
685 Ga0496114_0663298 3300048917 Unclassified 917
686 Ga0496115_0001849 3300048918 Bacteria 15140
687 Ga0496115_0023452 3300048918 Bacteria 4790
688 Ga0496115_0063525 3300048918 Bacteria 2979
689 Ga0496115_0180947 3300048918 Bacteria 1742
690 Ga0496115_0442924 3300048918 Bacteria 1050
691 Ga0501033_0998906 3300049570 Bacteria 559
692 Ga0501039_0165130 3300049575 Bacteria 1741
693 Ga0501040_0092920 3300049576 Bacteria 2098
694 Ga0501048_0270911 3300049582 Bacteria 1207
695 Ga0501067_0150780 3300049583 Bacteria 1295
696 Ga0501067_0772379 3300049583 Unclassified 541
697 Ga0501069_0077058 3300049585 Bacteria 1875
698 Ga0501069_0538052 3300049585 Bacteria 698
699 Ga0501070_0412743 3300049586 Bacteria 1091
700 Ga0501072_0124595 3300049588 Bacteria 2053
701 Ga0501072_0421762 3300049588 Bacteria 1058
702 Ga0501075_0132864 3300049591 Bacteria 1896
703 Ga0501077_0036044 3300049593 Bacteria 3150
704 Ga0501077_0485320 3300049593 Bacteria 792
705 Ga0501079_0132643 3300049741 Bacteria 1939
706 Ga0501079_0693511 3300049741 Bacteria 801
707 Ga0501081_0324741 3300049743 Bacteria 1132
708 nmdc:mga00v17_90467_c1 3300050491 Unclassified 1921
709 nmdc:mga0yw44_221912_c1 3300050492 Unclassified 1253
710 nmdc:mga0yw44_959786_c1 3300050492 Bacteria 579
711 nmdc:mga05p37_287920_c1 3300050507 Bacteria 1956
712 nmdc:mga05p37_48992_c1 3300050507 Bacteria 5195
713 nmdc:mga05p37_91336_c1 3300050507 Bacteria 3752
714 nmdc:mga09592_183438_c1 3300050508 Unclassified 1810
715 nmdc:mga06r32_675599_c1 3300050510 Bacteria 1000
716 nmdc:mga08y16_2034958_c1 3300050511 Bacteria 523
717 nmdc:mga08y16_33901_c1 3300050511 Bacteria 5364
718 nmdc:mga08y16_401249_c1 3300050511 Bacteria 1403
719 nmdc:mga0n895_1031793_c1 3300050512 Bacteria 802
720 nmdc:mga0n895_1460392_c1 3300050512 Bacteria 651
721 nmdc:mga0n895_1974475_c1 3300050512 Bacteria 542
722 nmdc:mga0n895_223049_c1 3300050512 Bacteria 1913
723 nmdc:mga0n895_294890_c1 3300050512 Bacteria 1644
724 nmdc:mga0n895_692189_c1 3300050512 Bacteria 1016
725 nmdc:mga0rr50_1052705_c1 3300050513 Bacteria 693
726 nmdc:mga0rr50_106557_c1 3300050513 Bacteria 2212
727 nmdc:mga0rr50_495817_c1 3300050513 Bacteria 1038
728 nmdc:mga0rr50_8368_c1 3300050513 Bacteria 6437
729 nmdc:mga0rr50_978560_c1 3300050513 Bacteria 721
730 nmdc:mga08x19_16822_c1 3300050514 Bacteria 4466
731 nmdc:mga08x19_377941_c1 3300050514 Unclassified 992
732 nmdc:mga08x19_497399_c1 3300050514 Bacteria 860
733 nmdc:mga08x19_562839_c1 3300050514 Bacteria 807
734 nmdc:mga08x19_862256_c1 3300050514 Bacteria 643
735 nmdc:mga0a205_1288579_c1 3300050515 Bacteria 578
736 nmdc:mga0a205_211416_c1 3300050515 Unclassified 1828
737 nmdc:mga0a205_252129_c1 3300050515 Bacteria 1644
738 nmdc:mga0a205_44721_c1 3300050515 Unclassified 4270
739 nmdc:mga0a205_64776_c1 3300050515 Bacteria 3531
740 nmdc:mga0a205_750810_c1 3300050515 Bacteria 824
741 Ga0501084_0014206 3300054114 Bacteria 6594
742 Ga0501082_0530210 3300060353 Bacteria 1030
743 Ga0530510_0117357 3300061734 Unclassified 1952
744 Ga0439460_0120346
745 JGI24743J22301_10073630
746 JGI24738J21930_10054436
747 JGI24744J21845_10002216
748 JGI25405J52794_10085705
749 Ga0070658_11069837
750 Ga0070683_101448747
751 Ga0070677_10933061
752 Ga0068869_100212491
753 Ga0068869_100728198
754 Ga0070680_100031377
755 Ga0070680_100095638
756 Ga0070680_100504841
757 Ga0070682_100003760
758 Ga0070682_100236754
759 Ga0070682_100378309
760 Ga0068868_100010668
761 Ga0068868_100062642
762 Ga0068868_101476540
763 Ga0070660_100011996
764 Ga0070660_100036877
765 Ga0070660_100114922
766 Ga0070689_100012496
767 Ga0070691_10076186
768 Ga0070691_10294887
769 Ga0070687_100138783
770 Ga0070661_100214320
771 Ga0070661_100827899
772 Ga0070692_10008190
773 Ga0070692_11275941
774 Ga0070668_100184927
775 Ga0070668_100486712
776 Ga0070669_100341821
777 Ga0070669_101239610
778 Ga0070675_100694823
779 Ga0070671_100448578
780 Ga0070674_100004532
781 Ga0070674_100148682
782 Ga0070673_100675299
783 Ga0070673_100723451
784 Ga0070688_100002151
785 Ga0070659_100067114
786 Ga0070659_100462005
787 Ga0070709_10017422
788 Ga0070709_10125804
789 Ga0070709_10321689
790 Ga0070709_10768902
791 Ga0070714_100010948
792 Ga0070714_100078622
793 Ga0070714_100228405
794 Ga0070714_101149455
795 Ga0070714_101274109
796 Ga0070714_101439253
797 Ga0070713_100035241
798 Ga0070713_100102854
799 Ga0070713_100240663
800 Ga0070710_10006515
801 Ga0070710_10010022
802 Ga0070701_10028361
803 Ga0070701_10225499
804 Ga0070711_100022911
805 Ga0070711_100159962
806 Ga0070711_100203275
807 Ga0070711_100246599
808 Ga0070711_100331453
809 Ga0070705_100017913
810 Ga0070705_101424186
811 Ga0070705_101485273
812 Ga0070700_100012870
813 Ga0070700_100822334
814 Ga0070700_101522103
815 Ga0070708_100135842
816 Ga0070708_100137136
817 Ga0070708_100152853
818 Ga0070708_100212958
819 Ga0070708_101588730
820 Ga0070663_100453768
821 Ga0070678_100015082
822 Ga0070678_100021656
823 Ga0070678_100240532
824 Ga0070678_100330595
825 Ga0070678_101571588
826 Ga0070662_100092970
827 Ga0070662_100547042
828 Ga0070681_10168677
829 Ga0070681_10235092
830 Ga0068867_100003914
831 Ga0068867_100079649
832 Ga0070685_10033983
833 Ga0070706_100003217
834 Ga0070706_100058084
835 Ga0070706_100071800
836 Ga0070706_100369167
837 Ga0070706_102107862
838 Ga0070707_100001362
839 Ga0070707_100009422
840 Ga0070707_100252073
841 Ga0070698_100005957
842 Ga0070698_100156395
843 Ga0070699_100037948
844 Ga0070699_100042055
845 Ga0070699_100645785
846 Ga0070699_100674667
847 Ga0070699_100865122
848 Ga0070679_100050625
849 Ga0070679_100139555
850 Ga0070679_100235932
851 Ga0070679_100240390
852 Ga0070679_100992523
853 Ga0070684_100639315
854 Ga0070697_100044068
855 Ga0070697_100298372
856 Ga0068853_100005042
857 Ga0068853_100613132
858 Ga0070672_100158549
859 Ga0070686_100146896
860 Ga0070686_101103974
861 Ga0070695_100135985
862 Ga0070695_100273562
863 Ga0070695_100301422
864 Ga0070696_100060042
865 Ga0070696_100152127
866 Ga0070696_100717813
867 Ga0070696_101307751
868 Ga0070693_100016468
869 Ga0070665_100024429
870 Ga0070704_101168986
871 Ga0070704_101620203
872 Ga0070704_101936670
873 Ga0068855_100054310
874 Ga0068855_100121082
875 Ga0068855_100150559
876 Ga0068855_100525888
877 Ga0070664_101571319
878 Ga0070664_101910228
879 Ga0068854_101145683
880 Ga0068854_101626434
881 Ga0068856_100002162
882 Ga0068856_100061341
883 Ga0068856_101105380
884 Ga0070702_100105698
885 Ga0070702_100448148
886 Ga0070702_100958613
887 Ga0068852_100014271
888 Ga0068852_100252170
889 Ga0068859_100069036
890 Ga0068859_100094205
891 Ga0068864_100229868
892 Ga0068864_100730418
893 Ga0068866_10008433
894 Ga0068866_10104473
895 Ga0068866_10157838
896 Ga0068866_11043435
897 Ga0068861_100005704
898 Ga0068861_100433276
899 Ga0068861_101246204
900 Ga0068851_10528994
901 Ga0068870_10059327
902 Ga0068863_100671835
903 Ga0068858_100230765
904 Ga0068858_101887950
905 Ga0068860_100117102
906 Ga0068860_101094164
907 Ga0068862_100616738
908 Ga0081455_10039020
909 Ga0081455_10278259
910 Ga0081538_10235903
911 Ga0081540_1010777
912 Ga0081540_1070182
913 Ga0081539_10095198
914 Ga0070717_10059025
915 Ga0070717_10243557
916 Ga0070717_11466842
917 Ga0075365_10177238
918 Ga0075364_10196099
919 Ga0075432_10035055
920 Ga0070715_10090578
921 Ga0070715_10096996
922 Ga0070715_10551764
923 Ga0070716_100148530
924 Ga0070716_100545116
925 Ga0070712_100010588
926 Ga0070712_100022492
927 Ga0097621_100023655
928 Ga0068871_100005450
929 Ga0068871_100010855
930 Ga0075428_100476410
931 Ga0075428_100540879
932 Ga0075430_100408165
933 Ga0075431_100334635
934 Ga0075433_10034290
935 Ga0075433_10127931
936 Ga0075433_10235581
937 Ga0075434_100320802
938 Ga0075434_100880584
939 Ga0075434_101005269
940 Ga0068865_100003055
941 Ga0068865_100054353
942 Ga0075436_100049813
943 Ga0075436_100266670
944 Ga0075436_100449504
945 Ga0075436_100485482
946 Ga0097620_100069035
947 Ga0097620_100094200
948 Ga0075435_100016185
949 Ga0075435_100032815
950 Ga0075435_100039398
951 Ga0075435_100356089
952 Ga0105240_10057696
953 Ga0105240_10490825
954 Ga0105240_11011098
955 Ga0111539_10289046
956 Ga0111539_10473578
957 Ga0111539_10503089
958 Ga0111539_12788003
959 Ga0105245_10016126
960 Ga0105245_10024904
961 Ga0105245_10046418
962 Ga0105245_10270721
963 Ga0105245_11287375
964 Ga0105245_11526987
965 Ga0105247_10069466
966 Ga0114129_10111342
967 Ga0114129_10499344
968 Ga0114129_10947694
969 Ga0114129_11072284
970 Ga0114129_11391760
971 Ga0114129_11679191
972 Ga0114129_12763341
973 Ga0105243_10011291
974 Ga0105243_10066817
975 Ga0105243_10419206
976 Ga0105243_11094775
977 Ga0105241_10071910
978 Ga0105241_10226482
979 Ga0105242_10883277
980 Ga0105248_10024950
981 Ga0105248_10068321
982 Ga0105248_11842792
983 Ga0105237_10043577
984 Ga0105238_10252584
985 Ga0105238_10340356
986 Ga0105238_11734277
987 Ga0105249_10005612
988 Ga0105249_10106607
989 Ga0105249_11045266
990 Ga0105239_10047166
991 Ga0105239_10131471
992 Ga0105239_10181594
993 Ga0105246_10008656
994 Ga0105246_11312758
995 Ga0105246_11973555
996 Ga0157344_1023061
997 Ga0157325_1032803
998 Ga0157342_1006866
999 Ga0157338_1020414
1000 Ga0157338_1087892
1001 Ga0157373_10726647
1002 Ga0157373_10738523
1003 Ga0157371_10357226
1004 Ga0157369_10010509
1005 Ga0157369_10174690
1006 Ga0157374_10012128
1007 Ga0157378_10076762
1008 Ga0157378_11563062
1009 Ga0163162_10004391
1010 Ga0163162_10054564
1011 Ga0163162_10449095
1012 Ga0157372_10156272
1013 Ga0157372_10231776
1014 Ga0157375_10062566
1015 Ga0157375_10072916
1016 Ga0157380_10000820
1017 Ga0182008_10010586
1018 Ga0182008_10107770
1019 Ga0182008_10124584
1020 Ga0182008_10187803
1021 Ga0157377_10001363
1022 Ga0157379_10094192
1023 Ga0157379_10118556
1024 Ga0157376_10003432
1025 Ga0157376_10036180
1026 Ga0157376_10059553
1027 Ga0182006_1006796
1028 Ga0182007_10023172
1029 Ga0163161_11072952
1030 Ga0163161_11577652
1031 Ga0197907_11200153
1032 Ga0206356_10432734
1033 Ga0206356_11656821
1034 Ga0206354_10130814
1035 Ga0206354_10221712
1036 Ga0206354_11711433
1037 Ga0206353_10137641
1038 Ga0206353_10425681
1039 Ga0206353_10849129
1040 Ga0224712_10055536
1041 Ga0224712_10076729
1042 Ga0207692_10073204
1043 Ga0207692_10630635
1044 Ga0207642_10004158
1045 Ga0207642_10241648
1046 Ga0207642_10409617
1047 Ga0207710_10408175
1048 Ga0207688_10500396
1049 Ga0207647_10069697
1050 Ga0207685_10052216
1051 Ga0207699_10009894
1052 Ga0207699_10016185
1053 Ga0207699_10237186
1054 Ga0207699_10265088
1055 Ga0207643_10033044
1056 Ga0207705_10192106
1057 Ga0207705_10503386
1058 Ga0207684_10015175
1059 Ga0207684_10182169
1060 Ga0207684_10338017
1061 Ga0207684_10461663
1062 Ga0207684_10985211
1063 Ga0207654_10279978
1064 Ga0207707_10100715
1065 Ga0207707_11225877
1066 Ga0207695_10091670
1067 Ga0207695_10435985
1068 Ga0207695_10524778
1069 Ga0207671_10231612
1070 Ga0207693_10000499
1071 Ga0207693_10008162
1072 Ga0207693_10069056
1073 Ga0207693_10236641
1074 Ga0207663_10001885
1075 Ga0207663_10153653
1076 Ga0207663_10367050
1077 Ga0207663_10386999
1078 Ga0207663_10641119
1079 Ga0207663_10712691
1080 Ga0207660_10056505
1081 Ga0207660_10082828
1082 Ga0207660_10105498
1083 Ga0207662_10150039
1084 Ga0207657_10003301
1085 Ga0207657_10047289
1086 Ga0207649_10175075
1087 Ga0207649_11113840
1088 Ga0207652_10062108
1089 Ga0207652_10072700
1090 Ga0207652_10231601
1091 Ga0207652_11153590
1092 Ga0207652_11185742
1093 Ga0207646_10001072
1094 Ga0207646_10004270
1095 Ga0207646_11612339
1096 Ga0207681_10078480
1097 Ga0207681_11404531
1098 Ga0207694_10176059
1099 Ga0207659_10229048
1100 Ga0207659_10417414
1101 Ga0207687_10054205
1102 Ga0207687_10301073
1103 Ga0207687_10897073
1104 Ga0207700_10160779
1105 Ga0207700_10359065
1106 Ga0207664_10031428
1107 Ga0207664_10375524
1108 Ga0207664_10511379
1109 Ga0207690_10514306
1110 Ga0207706_10033209
1111 Ga0207706_11066800
1112 Ga0207709_10002593
1113 Ga0207709_10023219
1114 Ga0207709_10103697
1115 Ga0207709_10420966
1116 Ga0207670_10034007
1117 Ga0207669_10045477
1118 Ga0207669_10096813
1119 Ga0207669_10389223
1120 Ga0207704_10006544
1121 Ga0207704_10961809
1122 Ga0207665_10040744
1123 Ga0207665_10233833
1124 Ga0207691_10007967
1125 Ga0207691_10096134
1126 Ga0207689_10562115
1127 Ga0207679_11084413
1128 Ga0207679_11167956
1129 Ga0207667_10080896
1130 Ga0207667_10109854
1131 Ga0207667_10307418
1132 Ga0207651_10283769
1133 Ga0207651_11253569
1134 Ga0207712_10110643
1135 Ga0207712_10721913
1136 Ga0207668_10116718
1137 Ga0207668_11644587
1138 Ga0207640_11265341
1139 Ga0207677_10198040
1140 Ga0207677_10487687
1141 Ga0207639_10298468
1142 Ga0207678_10018137
1143 Ga0207678_10073845
1144 Ga0207708_10000434
1145 Ga0207702_10007931
1146 Ga0207702_10116681
1147 Ga0207702_10709834
1148 Ga0207648_10002641
1149 Ga0207648_10082064
1150 Ga0207648_10206738
1151 Ga0207648_10255120
1152 Ga0207676_10216997
1153 Ga0207675_101374838
1154 Ga0207675_101820027
1155 Ga0207675_101828854
1156 Ga0207683_10002738
1157 Ga0207683_10003610
1158 Ga0207683_10005388
1159 Ga0207683_11092481
1160 Ga0207698_10056585
1161 Ga0207698_10190040
1162 Ga0207698_12253953
1163 Ga0207428_10003839
1164 Ga0207428_10436789
1165 Ga0207428_11242619
1166 Ga0268266_10037554
1167 Ga0268265_10228619
1168 Ga0268265_10457731
1169 Ga0268264_10077799
1170 Ga0265313_10034611
1171 Ga0265342_10094881
1172 Ga0307406_10290864
1173 Ga0307409_100737023
1174 Ga0307409_101012961
1175 Ga0307415_100298328
1176 Ga0373948_0124031
1177 Ga0373959_0131536
1178 Ga0373926_0115523
1179 Ga0373944_0117218
1180 Ga0373944_0242051
1181 Ga0373949_0008021
1182 Ga0373932_0053851
1183 Ga0373939_0162266
1184 Ga0373960_0014971
1185 Ga0373943_0048687
1186 Ga0373946_0079717
1187 Ga0373942_0022524
1188 Ga0373942_0160472
1189 Ga0373961_0059612
1190 Ga0373961_0256391
1191 Ga0373962_0030057
1192 Ga0373931_0047315
1193 Ga0373935_0167033
1194 Ga0373927_1177153
1195 Ga0373947_0519721
1196 Ga0373925_0003083
1197 Ga0395899_0001963
1198 Ga0395899_0003970
1199 Ga0395899_0006551
1200 Ga0395899_0016730
1201 Ga0395899_0017465
1202 Ga0395899_0067673
1203 Ga0395899_0075689
1204 Ga0395899_0186219
1205 Ga0395899_0186336
1206 Ga0395899_0745005
1207 Ga0395899_0769762
1208 Ga0395900_0000528
1209 Ga0395900_0009930
1210 Ga0395900_0026000
1211 Ga0395900_0032772
1212 Ga0395900_0048050
1213 Ga0395900_0082055
1214 Ga0395900_0132720
1215 Ga0395900_0139567
1216 Ga0395900_0184555
1217 Ga0395900_0435003
1218 Ga0395900_0697931
1219 Ga0395898_0002345
1220 Ga0395898_0002958
1221 Ga0395898_0005922
1222 Ga0395898_0008588
1223 Ga0395898_0009089
1224 Ga0395898_0046330
1225 Ga0395898_0062737
1226 Ga0395898_0066039
1227 Ga0395898_0087474
1228 Ga0395898_0096184
1229 Ga0395898_0151178
1230 Ga0395898_0285647
1231 Ga0395898_0537164
1232 Ga0395898_0636986
1233 Ga0395898_0784242
1234 Ga0395898_1193220
1235 Ga0395898_1533621
1236 Ga0395905_0000661
1237 Ga0395905_0001694
1238 Ga0395905_0011923
1239 Ga0395905_0031156
1240 Ga0395905_0033831
1241 Ga0395905_0040274
1242 Ga0395905_0080512
1243 Ga0395905_0155303
1244 Ga0395905_0199219
1245 Ga0395905_0256858
1246 Ga0395905_0393837
1247 Ga0395905_0476123
1248 Ga0395905_0838173
1249 Ga0395901_0001602
1250 Ga0395901_0001739
1251 Ga0395901_0001749
1252 Ga0395901_0003765
1253 Ga0395901_0005893
1254 Ga0395901_0043406
1255 Ga0395901_0147972
1256 Ga0395901_0257563
1257 Ga0395901_0267510
1258 Ga0395901_0297177
1259 Ga0395901_0340763
1260 Ga0395901_0341299
1261 Ga0395901_0350581
1262 Ga0395901_0385383
1263 Ga0395901_0701157
1264 Ga0395901_0863085
1265 Ga0395901_0910806
1266 Ga0395901_0980220
1267 Ga0395901_0983229
1268 Ga0395901_1076501
1269 Ga0395901_1091707
1270 Ga0395901_1318085
1271 Ga0242420_145673
1272 Ga0439466_0218409
1273 Ga0451789_1142008
1274 Ga0451793_1812798
1275 Ga0451795_0146402
1276 Ga0451800_1404220
1277 Ga0451802_1467075
1278 Ga0451802_1873421
1279 Ga0451807_1176568
1280 Ga0451835_0714903
1281 Ga0451837_1311960
1282 Ga0451839_0058348
1283 Ga0451841_0862240
1284 Ga0451849_1344522
1285 Ga0451843_0649213
1286 Ga0451853_0466113
1287 Ga0451853_3853896
1288 Ga0439431_0047274
1289 Ga0439433_0024070
1290 Ga0439442_005208
1291 Ga0439448_0006888
1292 Ga0439432_135701
1293 Ga0439455_0021734
1294 Ga0439462_0007795
1295 Ga0450919_018115
1296 Ga0450923_059554
1297 Ga0439446_0001483
1298 Ga0439458_0003351
1299 Ga0466966_0069494
1300 Ga0466961_0237400
1301 Ga0466963_0065421
1302 Ga0466963_0208313
1303 Ga0466963_0641576
1304 Ga0466964_0302396
1305 Ga0466964_0761964
1306 Ga0466968_0185526
1307 Ga0466968_0322721
1308 Ga0466968_0455555
1309 Ga0466957_0079564
1310 Ga0466957_0690571
1311 Ga0466960_0037169
1312 Ga0466960_0313629
1313 Ga0466959_0040893
1314 Ga0466959_0407043
1315 Ga0451576_1416926
1316 Ga0451576_1876869
1317 Ga0466958_0060435
1318 Ga0466967_0160773
1319 Ga0466967_0797624
1320 Ga0466967_1063518
1321 Ga0466967_1457400
1322 Ga0495603_0002063
1323 Ga0495603_0006748
1324 Ga0495603_0741007
1325 Ga0495641_0005728
1326 Ga0495651_0283286
1327 Ga0495582_0042033
1328 Ga0495605_0466520
1329 Ga0495639_0145371
1330 Ga0495639_0199321
1331 Ga0495664_0506061
1332 Ga0495584_0073685
1333 Ga0495594_0000307
1334 Ga0495596_0043734
1335 Ga0495616_0207329
1336 Ga0495620_0227564
1337 Ga0495620_0397735
1338 Ga0495630_0505241
1339 Ga0495631_0220249
1340 Ga0495631_0382375
1341 Ga0495637_0222781
1342 Ga0495644_0091114
1343 Ga0495666_0046733
1344 Ga0495598_0261414
1345 Ga0495609_0233690
1346 Ga0495645_0399159
1347 Ga0495656_0013806
1348 Ga0495656_0090661
1349 Ga0495656_0508762
1350 Ga0495668_0132220
1351 Ga0495588_0153116
1352 Ga0495588_0255063
1353 Ga0495599_0660676
1354 Ga0495647_0020951
1355 Ga0495658_0098005
1356 Ga0495669_0197656
1357 Ga0495613_0653258
1358 Ga0495589_0376586
1359 Ga0495589_0533666
1360 Ga0495589_0554617
1361 Ga0495581_0308177
1362 Ga0495581_0781474
1363 Ga0495676_0212496
1364 Ga0495677_0188095
1365 Ga0496100_0003975
1366 Ga0496100_0286265
1367 Ga0496100_0474471
1368 Ga0496100_1559468
1369 Ga0496101_0009755
1370 Ga0496101_0031633
1371 Ga0496101_0141817
1372 Ga0496101_0183539
1373 Ga0496101_0317308
1374 Ga0496102_0039982
1375 Ga0496102_0043801
1376 Ga0496102_0087472
1377 Ga0496103_0005357
1378 Ga0496103_0234069
1379 Ga0496104_0032151
1380 Ga0496104_0075582
1381 Ga0496104_0187599
1382 Ga0496104_0571938
1383 Ga0496105_0003888
1384 Ga0496105_0019259
1385 Ga0496105_0264107
1386 Ga0496105_0403699
1387 Ga0496106_0006113
1388 Ga0496106_0244304
1389 Ga0496106_0492933
1390 Ga0496106_1150327
1391 Ga0496107_0025630
1392 Ga0496107_0134362
1393 Ga0496107_0250884
1394 Ga0496107_0354344
1395 Ga0496108_0007670
1396 Ga0496108_0110537
1397 Ga0496108_0139246
1398 Ga0496108_0443937
1399 Ga0496108_1141060
1400 Ga0496109_0003761
1401 Ga0496109_0094744
1402 Ga0496109_0128506
1403 Ga0496109_0190719
1404 Ga0496109_0542244
1405 Ga0496110_0007559
1406 Ga0496110_0039756
1407 Ga0496110_1394373
1408 Ga0496110_1532193
1409 Ga0496111_0004179
1410 Ga0496111_0038639
1411 Ga0496111_0088187
1412 Ga0496111_0405598
1413 Ga0496111_0820669
1414 Ga0496111_1112597
1415 Ga0496112_0006315
1416 Ga0496112_0011387
1417 Ga0496112_0123741
1418 Ga0496112_0270913
1419 Ga0496113_0031583
1420 Ga0496113_0173656
1421 Ga0496113_0236597
1422 Ga0496113_0495139
1423 Ga0496114_0011921
1424 Ga0496114_0033169
1425 Ga0496114_0088471
1426 Ga0496114_0138237
1427 Ga0496114_0160090
1428 Ga0496114_0663298
1429 Ga0496115_0001849
1430 Ga0496115_0023452
1431 Ga0496115_0063525
1432 Ga0496115_0180947
1433 Ga0496115_0442924
1434 Ga0501033_0998906
1435 Ga0501039_0165130
1436 Ga0501040_0092920
1437 Ga0501048_0270911
1438 Ga0501067_0150780
1439 Ga0501067_0772379
1440 Ga0501069_0077058
1441 Ga0501069_0538052
1442 Ga0501070_0412743
1443 Ga0501072_0124595
1444 Ga0501072_0421762
1445 Ga0501075_0132864
1446 Ga0501077_0036044
1447 Ga0501077_0485320
1448 Ga0501079_0132643
1449 Ga0501079_0693511
1450 Ga0501081_0324741
1451 nmdc:mga00v17_90467_c1
1452 nmdc:mga0yw44_221912_c1
1453 nmdc:mga0yw44_959786_c1
1454 nmdc:mga05p37_287920_c1
1455 nmdc:mga05p37_48992_c1
1456 nmdc:mga05p37_91336_c1
1457 nmdc:mga09592_183438_c1
1458 nmdc:mga06r32_675599_c1
1459 nmdc:mga08y16_2034958_c1
1460 nmdc:mga08y16_33901_c1
1461 nmdc:mga08y16_401249_c1
1462 nmdc:mga0n895_1031793_c1
1463 nmdc:mga0n895_1460392_c1
1464 nmdc:mga0n895_1974475_c1
1465 nmdc:mga0n895_223049_c1
1466 nmdc:mga0n895_294890_c1
1467 nmdc:mga0n895_692189_c1
1468 nmdc:mga0rr50_1052705_c1
1469 nmdc:mga0rr50_106557_c1
1470 nmdc:mga0rr50_495817_c1
1471 nmdc:mga0rr50_8368_c1
1472 nmdc:mga0rr50_978560_c1
1473 nmdc:mga08x19_16822_c1
1474 nmdc:mga08x19_377941_c1
1475 nmdc:mga08x19_497399_c1
1476 nmdc:mga08x19_562839_c1
1477 nmdc:mga08x19_862256_c1
1478 nmdc:mga0a205_1288579_c1
1479 nmdc:mga0a205_211416_c1
1480 nmdc:mga0a205_252129_c1
1481 nmdc:mga0a205_44721_c1
1482 nmdc:mga0a205_64776_c1
1483 nmdc:mga0a205_750810_c1
1484 Ga0501084_0014206
1485 Ga0501082_0530210
1486 Ga0530510_0117357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o5w-assembly1.cif.gz_BBB crystal structure of holo-f210w mutant of hydroxy ketone aldolase (swhka)from sphingomonas wittichii rw1 0.7756 40 76
8h5s-assembly1.cif.gz_A crystal structure of rv3400 from mycobacterium tuberculosis 0.7671 36 73
7nr1-assembly1.cif.gz_A crystal structure of holo-s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 0.7283 36 76
4hgr-assembly1.cif.gz_D crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.7076 32 73
6rg0-assembly4.cif.gz_D structure of pdxj 0.6877 37 91
ID Description Score Start End Superfamily
af_O06179_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8719 26 60 3.20.20.70
af_O07738_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8161 27 60 3.20.20.70
af_Q21407_331_657_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7788 35 74 3.20.20.190
4q6jA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.7472 36 69 3.20.20.450
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7383 26 71 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7V9T9T0-F1-model_v4 Uncharacterized protein 0.981 1 91
AF-A0A538DEU2-F1-model_v4 Uncharacterized protein 0.9772 13 92
AF-A0A7V9T9T0-F1-model_v4 Uncharacterized protein 0.9702 1 91
AF-A0A538DEU2-F1-model_v4 Uncharacterized protein 0.9654 13 92
AF-A0A7W1JGU1-F1-model_v4 DUF1028 domain-containing protein 0.9648 1 88

Map