F478722
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 744 | 252 | 741 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300003203|JGI25406J46586_10019773|JGI25406J46586_100197732 |
| Length | 225 |
| Sequence | VHDTSVASHSCTEEHNMSNNLRILVFDNYDSFTYNLVHLVEKILHYKVEVYRNDQIPLEKVKEYDKIILSPGPGIPVEAGLLLPLIKEYASSKSILGVCLGHQAIGEAFGGKLVNLSTVYHGVATPVRIVSSESLVLSGANSPLTTHHSRPKLFEGLPEIIEVGRYHSWVVSKENFPEELEITAEDDNGYIMGLQHKTYDVRGVQFHPESVLTPKGEDILRNWLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 155 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 167 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 172 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 173 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 198 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 199 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 200 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 201 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 211 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 212 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 213 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 214 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 218 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 219 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 220 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 221 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 223 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 224 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 227 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 230 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 231 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 234 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 235 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 242 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 243 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 244 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 245 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 246 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 247 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 248 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 249 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 250 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 251 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 252 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.75 |
| Nodule | 0 |
| Rhizoplane | 0.13 |
| Rhizosphere | 96.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10019773 | 3300003203 | Bacteria | 2736 |
| 2 | rootL2_10134929 | 3300003322 | Bacteria | 4501 |
| 3 | Ga0065704_10260033 | 3300005289 | Bacteria | 968 |
| 4 | Ga0065712_10015823 | 3300005290 | Bacteria | 2795 |
| 5 | Ga0065712_10076829 | 3300005290 | Bacteria | 3583 |
| 6 | Ga0065712_10190799 | 3300005290 | Unclassified | 1149 |
| 7 | Ga0065715_10018814 | 3300005293 | Bacteria | 1843 |
| 8 | Ga0065715_10453070 | 3300005293 | Bacteria | 824 |
| 9 | Ga0070658_10005995 | 3300005327 | Bacteria | 9853 |
| 10 | Ga0070658_10010748 | 3300005327 | Bacteria | 7336 |
| 11 | Ga0070658_10294859 | 3300005327 | Bacteria | 1382 |
| 12 | Ga0070676_10000336 | 3300005328 | Bacteria | 21357 |
| 13 | Ga0070676_10167649 | 3300005328 | Bacteria | 1418 |
| 14 | Ga0070676_10688637 | 3300005328 | Bacteria | 745 |
| 15 | Ga0070683_100008329 | 3300005329 | Bacteria | 8809 |
| 16 | Ga0070683_100042317 | 3300005329 | Bacteria | 4194 |
| 17 | Ga0070690_100083796 | 3300005330 | Bacteria | 2089 |
| 18 | Ga0070670_100066481 | 3300005331 | Bacteria | 3094 |
| 19 | Ga0070670_100082144 | 3300005331 | Bacteria | 2769 |
| 20 | Ga0070670_100086833 | 3300005331 | Bacteria | 2688 |
| 21 | Ga0070670_100097335 | 3300005331 | Bacteria | 2531 |
| 22 | Ga0070670_100111799 | 3300005331 | Bacteria | 2354 |
| 23 | Ga0070670_100174030 | 3300005331 | Bacteria | 1868 |
| 24 | Ga0070670_100259146 | 3300005331 | Unclassified | 1516 |
| 25 | Ga0070670_100446724 | 3300005331 | Bacteria | 1145 |
| 26 | Ga0068869_100039941 | 3300005334 | Bacteria | 3352 |
| 27 | Ga0068869_100043129 | 3300005334 | Bacteria | 3238 |
| 28 | Ga0068869_100069980 | 3300005334 | Bacteria | 2595 |
| 29 | Ga0068869_100070355 | 3300005334 | Bacteria | 2588 |
| 30 | Ga0068869_100072563 | 3300005334 | Bacteria | 2550 |
| 31 | Ga0068869_100102808 | 3300005334 | Bacteria | 2164 |
| 32 | Ga0068869_100167679 | 3300005334 | Bacteria | 1713 |
| 33 | Ga0068869_100454782 | 3300005334 | Bacteria | 1062 |
| 34 | Ga0070666_10000051 | 3300005335 | Bacteria | 99740 |
| 35 | Ga0070666_10010156 | 3300005335 | Bacteria | 5881 |
| 36 | Ga0070666_10010207 | 3300005335 | Bacteria | 5868 |
| 37 | Ga0070666_10013609 | 3300005335 | Bacteria | 5165 |
| 38 | Ga0070666_10082177 | 3300005335 | Bacteria | 2203 |
| 39 | Ga0070682_100026905 | 3300005337 | Bacteria | 3446 |
| 40 | Ga0070682_100165344 | 3300005337 | Bacteria | 1532 |
| 41 | Ga0068868_100016530 | 3300005338 | Bacteria | 5482 |
| 42 | Ga0068868_100042340 | 3300005338 | Bacteria | 3553 |
| 43 | Ga0068868_100048846 | 3300005338 | Bacteria | 3320 |
| 44 | Ga0068868_100076548 | 3300005338 | Bacteria | 2675 |
| 45 | Ga0068868_100080003 | 3300005338 | Bacteria | 2618 |
| 46 | Ga0068868_100421421 | 3300005338 | Bacteria | 1156 |
| 47 | Ga0068868_100729983 | 3300005338 | Bacteria | 888 |
| 48 | Ga0068868_100777718 | 3300005338 | Bacteria | 862 |
| 49 | Ga0070660_100119555 | 3300005339 | Bacteria | 2102 |
| 50 | Ga0070660_100190842 | 3300005339 | Bacteria | 1659 |
| 51 | Ga0070689_100001732 | 3300005340 | Bacteria | 13951 |
| 52 | Ga0070689_100014808 | 3300005340 | Bacteria | 5674 |
| 53 | Ga0070689_100137929 | 3300005340 | Bacteria | 1959 |
| 54 | Ga0070689_100173058 | 3300005340 | Bacteria | 1750 |
| 55 | Ga0070689_100570904 | 3300005340 | Bacteria | 977 |
| 56 | Ga0070689_101163802 | 3300005340 | Bacteria | 691 |
| 57 | Ga0070661_100002702 | 3300005344 | Bacteria | 12149 |
| 58 | Ga0070661_100003143 | 3300005344 | Bacteria | 11357 |
| 59 | Ga0070661_100022549 | 3300005344 | Bacteria | 4508 |
| 60 | Ga0070661_100097142 | 3300005344 | Bacteria | 2187 |
| 61 | Ga0070661_100117915 | 3300005344 | Bacteria | 1986 |
| 62 | Ga0070661_100673780 | 3300005344 | Bacteria | 841 |
| 63 | Ga0070668_100002494 | 3300005347 | Bacteria | 13548 |
| 64 | Ga0070669_100048455 | 3300005353 | Bacteria | 3101 |
| 65 | Ga0070669_100052700 | 3300005353 | Bacteria | 2977 |
| 66 | Ga0070675_100013600 | 3300005354 | Bacteria | 6399 |
| 67 | Ga0070675_100025711 | 3300005354 | Bacteria | 4720 |
| 68 | Ga0070675_100106309 | 3300005354 | Bacteria | 2369 |
| 69 | Ga0070675_100159310 | 3300005354 | Bacteria | 1940 |
| 70 | Ga0070675_100381663 | 3300005354 | Bacteria | 1254 |
| 71 | Ga0070671_100270865 | 3300005355 | Bacteria | 1443 |
| 72 | Ga0070671_100277870 | 3300005355 | Bacteria | 1424 |
| 73 | Ga0070671_100335321 | 3300005355 | Bacteria | 1289 |
| 74 | Ga0070671_100712370 | 3300005355 | Bacteria | 871 |
| 75 | Ga0070674_100171178 | 3300005356 | Bacteria | 1656 |
| 76 | Ga0070674_100816167 | 3300005356 | Bacteria | 806 |
| 77 | Ga0070673_100001990 | 3300005364 | Bacteria | 12324 |
| 78 | Ga0070673_100010151 | 3300005364 | Bacteria | 6359 |
| 79 | Ga0070673_100085256 | 3300005364 | Bacteria | 2571 |
| 80 | Ga0070673_100413714 | 3300005364 | Bacteria | 1208 |
| 81 | Ga0070673_100614313 | 3300005364 | Bacteria | 992 |
| 82 | Ga0070673_101316908 | 3300005364 | Bacteria | 679 |
| 83 | Ga0070688_100008021 | 3300005365 | Bacteria | 5714 |
| 84 | Ga0070688_100097236 | 3300005365 | Bacteria | 1935 |
| 85 | Ga0070659_100024762 | 3300005366 | Bacteria | 4603 |
| 86 | Ga0070667_100000492 | 3300005367 | Bacteria | 40164 |
| 87 | Ga0070667_100001349 | 3300005367 | Bacteria | 22023 |
| 88 | Ga0070667_100047694 | 3300005367 | Bacteria | 3604 |
| 89 | Ga0070667_100089181 | 3300005367 | Bacteria | 2649 |
| 90 | Ga0070667_100115083 | 3300005367 | Bacteria | 2335 |
| 91 | Ga0070667_100263906 | 3300005367 | Bacteria | 1543 |
| 92 | Ga0070667_100530306 | 3300005367 | Bacteria | 1081 |
| 93 | Ga0070667_100557987 | 3300005367 | Bacteria | 1053 |
| 94 | Ga0070700_100288470 | 3300005441 | Bacteria | 1193 |
| 95 | Ga0070700_100632254 | 3300005441 | Unclassified | 843 |
| 96 | Ga0070663_100474002 | 3300005455 | Bacteria | 1035 |
| 97 | Ga0070663_100550253 | 3300005455 | Bacteria | 964 |
| 98 | Ga0070678_100013945 | 3300005456 | Bacteria | 5054 |
| 99 | Ga0070678_100072331 | 3300005456 | Bacteria | 2584 |
| 100 | Ga0070662_100004086 | 3300005457 | Bacteria | 9167 |
| 101 | Ga0070662_100230387 | 3300005457 | Bacteria | 1482 |
| 102 | Ga0070662_100520692 | 3300005457 | Bacteria | 994 |
| 103 | Ga0068867_100050069 | 3300005459 | Bacteria | 3077 |
| 104 | Ga0068867_100099372 | 3300005459 | Bacteria | 2220 |
| 105 | Ga0068867_100409940 | 3300005459 | Bacteria | 1145 |
| 106 | Ga0068867_100898685 | 3300005459 | Bacteria | 797 |
| 107 | Ga0070685_10152592 | 3300005466 | Bacteria | 1465 |
| 108 | Ga0070685_10464825 | 3300005466 | Bacteria | 889 |
| 109 | Ga0070685_10617184 | 3300005466 | Bacteria | 782 |
| 110 | Ga0070679_100045741 | 3300005530 | Bacteria | 4361 |
| 111 | Ga0070679_100062675 | 3300005530 | Bacteria | 3707 |
| 112 | Ga0070679_100108122 | 3300005530 | Unclassified | 2767 |
| 113 | Ga0070684_100021275 | 3300005535 | Bacteria | 5394 |
| 114 | Ga0070684_100060191 | 3300005535 | Bacteria | 3321 |
| 115 | Ga0068853_100000221 | 3300005539 | Bacteria | 40294 |
| 116 | Ga0068853_100008065 | 3300005539 | Bacteria | 8446 |
| 117 | Ga0068853_100020583 | 3300005539 | Bacteria | 5487 |
| 118 | Ga0068853_100057721 | 3300005539 | Bacteria | 3350 |
| 119 | Ga0068853_100093927 | 3300005539 | Unclassified | 2641 |
| 120 | Ga0068853_100317821 | 3300005539 | Bacteria | 1443 |
| 121 | Ga0068853_100808265 | 3300005539 | Bacteria | 898 |
| 122 | Ga0068853_101275444 | 3300005539 | Bacteria | 710 |
| 123 | Ga0070672_100039481 | 3300005543 | Bacteria | 3616 |
| 124 | Ga0070672_100379669 | 3300005543 | Bacteria | 1209 |
| 125 | Ga0070695_100759199 | 3300005545 | Bacteria | 774 |
| 126 | Ga0070693_100045539 | 3300005547 | Bacteria | 2487 |
| 127 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 128 | Ga0070665_100005742 | 3300005548 | Bacteria | 12739 |
| 129 | Ga0070665_100060884 | 3300005548 | Bacteria | 3784 |
| 130 | Ga0070665_101061000 | 3300005548 | Bacteria | 822 |
| 131 | Ga0070704_100554975 | 3300005549 | Unclassified | 1004 |
| 132 | Ga0068855_100075213 | 3300005563 | Bacteria | 3922 |
| 133 | Ga0068855_100174590 | 3300005563 | Bacteria | 2432 |
| 134 | Ga0068855_100204441 | 3300005563 | Bacteria | 2222 |
| 135 | Ga0068855_100396115 | 3300005563 | Bacteria | 1514 |
| 136 | Ga0068855_100539238 | 3300005563 | Bacteria | 1264 |
| 137 | Ga0070664_100003241 | 3300005564 | Bacteria | 13152 |
| 138 | Ga0070664_100050688 | 3300005564 | Bacteria | 3514 |
| 139 | Ga0070664_100070355 | 3300005564 | Bacteria | 2996 |
| 140 | Ga0070664_100164472 | 3300005564 | Bacteria | 1965 |
| 141 | Ga0070664_100189218 | 3300005564 | Bacteria | 1833 |
| 142 | Ga0070664_100223776 | 3300005564 | Bacteria | 1684 |
| 143 | Ga0070664_100226291 | 3300005564 | Bacteria | 1675 |
| 144 | Ga0070664_100283673 | 3300005564 | Bacteria | 1494 |
| 145 | Ga0068857_100007157 | 3300005577 | Bacteria | 9611 |
| 146 | Ga0068857_100021607 | 3300005577 | Bacteria | 5663 |
| 147 | Ga0068857_100323828 | 3300005577 | Bacteria | 1424 |
| 148 | Ga0068857_100481509 | 3300005577 | Bacteria | 1163 |
| 149 | Ga0068857_100667183 | 3300005577 | Bacteria | 986 |
| 150 | Ga0068854_100074699 | 3300005578 | Bacteria | 2487 |
| 151 | Ga0068854_100095714 | 3300005578 | Bacteria | 2217 |
| 152 | Ga0068854_100296132 | 3300005578 | Bacteria | 1307 |
| 153 | Ga0068854_100369934 | 3300005578 | Unclassified | 1178 |
| 154 | Ga0068854_100577392 | 3300005578 | Bacteria | 957 |
| 155 | Ga0068854_100939242 | 3300005578 | Bacteria | 762 |
| 156 | Ga0068856_100021412 | 3300005614 | Bacteria | 6285 |
| 157 | Ga0068856_100073361 | 3300005614 | Bacteria | 3389 |
| 158 | Ga0068852_100002446 | 3300005616 | Bacteria | 12784 |
| 159 | Ga0068852_100018674 | 3300005616 | Bacteria | 5466 |
| 160 | Ga0068852_100023547 | 3300005616 | Bacteria | 4958 |
| 161 | Ga0068852_100041003 | 3300005616 | Bacteria | 3910 |
| 162 | Ga0068852_100069230 | 3300005616 | Bacteria | 3092 |
| 163 | Ga0068852_100158679 | 3300005616 | Bacteria | 2110 |
| 164 | Ga0068852_101761884 | 3300005616 | Bacteria | 642 |
| 165 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 166 | Ga0068859_100009853 | 3300005617 | Bacteria | 9646 |
| 167 | Ga0068859_100085184 | 3300005617 | Bacteria | 3206 |
| 168 | Ga0068859_100104665 | 3300005617 | Bacteria | 2889 |
| 169 | Ga0068859_100171254 | 3300005617 | Bacteria | 2252 |
| 170 | Ga0068859_100353882 | 3300005617 | Bacteria | 1563 |
| 171 | Ga0068859_100377129 | 3300005617 | Bacteria | 1514 |
| 172 | Ga0068859_100837033 | 3300005617 | Bacteria | 1007 |
| 173 | Ga0068859_101312257 | 3300005617 | Bacteria | 798 |
| 174 | Ga0068864_100005800 | 3300005618 | Bacteria | 10131 |
| 175 | Ga0068864_100007839 | 3300005618 | Bacteria | 8801 |
| 176 | Ga0068864_100045381 | 3300005618 | Bacteria | 3769 |
| 177 | Ga0068864_100123054 | 3300005618 | Bacteria | 2322 |
| 178 | Ga0068866_10101263 | 3300005718 | Bacteria | 1589 |
| 179 | Ga0068861_100009306 | 3300005719 | Bacteria | 6779 |
| 180 | Ga0068861_100017858 | 3300005719 | Bacteria | 5041 |
| 181 | Ga0068861_100365929 | 3300005719 | Bacteria | 1269 |
| 182 | Ga0068861_100375244 | 3300005719 | Bacteria | 1255 |
| 183 | Ga0068851_10011215 | 3300005834 | Bacteria | 4198 |
| 184 | Ga0068851_10025307 | 3300005834 | Bacteria | 2911 |
| 185 | Ga0068851_10048024 | 3300005834 | Bacteria | 2163 |
| 186 | Ga0068870_10008007 | 3300005840 | Bacteria | 4734 |
| 187 | Ga0068870_10039396 | 3300005840 | Bacteria | 2445 |
| 188 | Ga0068870_10119725 | 3300005840 | Bacteria | 1515 |
| 189 | Ga0068870_10226282 | 3300005840 | Bacteria | 1148 |
| 190 | Ga0068870_10566938 | 3300005840 | Bacteria | 767 |
| 191 | Ga0068863_100001812 | 3300005841 | Bacteria | 21216 |
| 192 | Ga0068863_100038028 | 3300005841 | Bacteria | 4579 |
| 193 | Ga0068863_100038562 | 3300005841 | Bacteria | 4545 |
| 194 | Ga0068863_100093702 | 3300005841 | Bacteria | 2850 |
| 195 | Ga0068863_100538827 | 3300005841 | Bacteria | 1152 |
| 196 | Ga0068858_100030828 | 3300005842 | Bacteria | 4981 |
| 197 | Ga0068858_100048079 | 3300005842 | Bacteria | 3954 |
| 198 | Ga0068858_100105929 | 3300005842 | Bacteria | 2624 |
| 199 | Ga0068858_100246166 | 3300005842 | Bacteria | 1697 |
| 200 | Ga0068858_100246655 | 3300005842 | Bacteria | 1696 |
| 201 | Ga0068858_100521910 | 3300005842 | Bacteria | 1148 |
| 202 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 203 | Ga0068860_100000916 | 3300005843 | Bacteria | 32698 |
| 204 | Ga0068860_100007358 | 3300005843 | Bacteria | 11008 |
| 205 | Ga0068860_100025753 | 3300005843 | Bacteria | 5674 |
| 206 | Ga0068860_100034035 | 3300005843 | Bacteria | 4887 |
| 207 | Ga0068860_100168734 | 3300005843 | Bacteria | 2113 |
| 208 | Ga0068860_100642203 | 3300005843 | Bacteria | 1069 |
| 209 | Ga0068860_101010487 | 3300005843 | Bacteria | 850 |
| 210 | Ga0068862_100085090 | 3300005844 | Bacteria | 2748 |
| 211 | Ga0068862_100848336 | 3300005844 | Bacteria | 895 |
| 212 | Ga0068862_100944806 | 3300005844 | Bacteria | 850 |
| 213 | Ga0081539_10000531 | 3300005985 | Bacteria | 79191 |
| 214 | Ga0081539_10179039 | 3300005985 | Bacteria | 996 |
| 215 | Ga0097621_100005409 | 3300006237 | Bacteria | 9000 |
| 216 | Ga0097621_100028478 | 3300006237 | Bacteria | 4402 |
| 217 | Ga0097621_100062269 | 3300006237 | Bacteria | 3063 |
| 218 | Ga0097621_100152415 | 3300006237 | Bacteria | 1983 |
| 219 | Ga0097621_100470061 | 3300006237 | Bacteria | 1135 |
| 220 | Ga0097621_100602606 | 3300006237 | Bacteria | 1004 |
| 221 | Ga0097621_100604977 | 3300006237 | Bacteria | 1002 |
| 222 | Ga0068871_100039645 | 3300006358 | Bacteria | 3770 |
| 223 | Ga0068871_100077547 | 3300006358 | Bacteria | 2746 |
| 224 | Ga0068871_100314977 | 3300006358 | Bacteria | 1376 |
| 225 | Ga0068871_100749459 | 3300006358 | Bacteria | 898 |
| 226 | Ga0075428_100024587 | 3300006844 | Bacteria | 6666 |
| 227 | Ga0075428_100074722 | 3300006844 | Bacteria | 3702 |
| 228 | Ga0075428_100401541 | 3300006844 | Bacteria | 1469 |
| 229 | Ga0075428_100484987 | 3300006844 | Bacteria | 1323 |
| 230 | Ga0075430_100010054 | 3300006846 | Bacteria | 8005 |
| 231 | Ga0075431_100182263 | 3300006847 | Bacteria | 2155 |
| 232 | Ga0075429_100005840 | 3300006880 | Bacteria | 10619 |
| 233 | Ga0075429_100022996 | 3300006880 | Bacteria | 5403 |
| 234 | Ga0075429_100032161 | 3300006880 | Bacteria | 4560 |
| 235 | Ga0075429_100235957 | 3300006880 | Bacteria | 1602 |
| 236 | Ga0068865_100020901 | 3300006881 | Bacteria | 4251 |
| 237 | Ga0068865_100023102 | 3300006881 | Bacteria | 4068 |
| 238 | Ga0068865_100042350 | 3300006881 | Bacteria | 3105 |
| 239 | Ga0068865_100058333 | 3300006881 | Bacteria | 2696 |
| 240 | Ga0068865_100300336 | 3300006881 | Bacteria | 1285 |
| 241 | Ga0068865_100483566 | 3300006881 | Bacteria | 1029 |
| 242 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 243 | Ga0097620_100009853 | 3300006931 | Bacteria | 9646 |
| 244 | Ga0097620_100085179 | 3300006931 | Bacteria | 3206 |
| 245 | Ga0097620_100104665 | 3300006931 | Bacteria | 2889 |
| 246 | Ga0097620_100171243 | 3300006931 | Bacteria | 2252 |
| 247 | Ga0097620_100353883 | 3300006931 | Bacteria | 1563 |
| 248 | Ga0097620_100377120 | 3300006931 | Bacteria | 1514 |
| 249 | Ga0097620_100837037 | 3300006931 | Bacteria | 1007 |
| 250 | Ga0097620_101312299 | 3300006931 | Bacteria | 798 |
| 251 | Ga0075435_100795357 | 3300007076 | Bacteria | 823 |
| 252 | Ga0105240_10015708 | 3300009093 | Bacteria | 10273 |
| 253 | Ga0105240_10075581 | 3300009093 | Bacteria | 4155 |
| 254 | Ga0105240_10078410 | 3300009093 | Bacteria | 4068 |
| 255 | Ga0105240_10393330 | 3300009093 | Bacteria | 1563 |
| 256 | Ga0105240_10856083 | 3300009093 | Bacteria | 981 |
| 257 | Ga0111539_10015483 | 3300009094 | Bacteria | 9481 |
| 258 | Ga0111539_10037386 | 3300009094 | Bacteria | 5863 |
| 259 | Ga0111539_10067948 | 3300009094 | Bacteria | 4207 |
| 260 | Ga0111539_10516316 | 3300009094 | Bacteria | 1392 |
| 261 | Ga0111539_10817704 | 3300009094 | Bacteria | 1084 |
| 262 | Ga0105247_10005412 | 3300009101 | Bacteria | 8044 |
| 263 | Ga0105247_10037118 | 3300009101 | Bacteria | 2972 |
| 264 | Ga0105247_10204453 | 3300009101 | Bacteria | 1329 |
| 265 | Ga0114129_10020916 | 3300009147 | Bacteria | 9296 |
| 266 | Ga0114129_10187025 | 3300009147 | Bacteria | 2814 |
| 267 | Ga0114129_10762050 | 3300009147 | Bacteria | 1238 |
| 268 | Ga0105241_10003116 | 3300009174 | Bacteria | 12343 |
| 269 | Ga0105241_10034893 | 3300009174 | Bacteria | 3782 |
| 270 | Ga0105241_10868579 | 3300009174 | Bacteria | 835 |
| 271 | Ga0105241_11012972 | 3300009174 | Bacteria | 778 |
| 272 | Ga0105242_10012454 | 3300009176 | Bacteria | 6549 |
| 273 | Ga0105242_10040286 | 3300009176 | Bacteria | 3764 |
| 274 | Ga0105242_10058423 | 3300009176 | Bacteria | 3162 |
| 275 | Ga0105242_10071155 | 3300009176 | Bacteria | 2886 |
| 276 | Ga0105242_10490816 | 3300009176 | Bacteria | 1166 |
| 277 | Ga0105242_11095849 | 3300009176 | Unclassified | 810 |
| 278 | Ga0105248_10059502 | 3300009177 | Bacteria | 4291 |
| 279 | Ga0105248_10236470 | 3300009177 | Bacteria | 2056 |
| 280 | Ga0105248_10487872 | 3300009177 | Bacteria | 1389 |
| 281 | Ga0105237_10000088 | 3300009545 | Bacteria | 124518 |
| 282 | Ga0105237_10000755 | 3300009545 | Bacteria | 44312 |
| 283 | Ga0105237_10009395 | 3300009545 | Bacteria | 10472 |
| 284 | Ga0105237_10124916 | 3300009545 | Bacteria | 2567 |
| 285 | Ga0105237_10419151 | 3300009545 | Bacteria | 1344 |
| 286 | Ga0105238_10001132 | 3300009551 | Bacteria | 26885 |
| 287 | Ga0105238_10035958 | 3300009551 | Bacteria | 5035 |
| 288 | Ga0105238_10436812 | 3300009551 | Bacteria | 1305 |
| 289 | Ga0105249_10000607 | 3300009553 | Bacteria | 32648 |
| 290 | Ga0105249_10012834 | 3300009553 | Bacteria | 7392 |
| 291 | Ga0105249_10027191 | 3300009553 | Bacteria | 5161 |
| 292 | Ga0105249_10059671 | 3300009553 | Bacteria | 3499 |
| 293 | Ga0105249_10111257 | 3300009553 | Bacteria | 2589 |
| 294 | Ga0105249_10317110 | 3300009553 | Bacteria | 1569 |
| 295 | Ga0105249_10499074 | 3300009553 | Bacteria | 1262 |
| 296 | Ga0105249_11217466 | 3300009553 | Bacteria | 824 |
| 297 | Ga0105239_10053117 | 3300010375 | Bacteria | 4445 |
| 298 | Ga0105239_10088168 | 3300010375 | Bacteria | 3421 |
| 299 | Ga0105239_10217240 | 3300010375 | Bacteria | 2143 |
| 300 | Ga0105239_10219692 | 3300010375 | Bacteria | 2131 |
| 301 | Ga0105239_10328796 | 3300010375 | Bacteria | 1724 |
| 302 | Ga0105239_10421120 | 3300010375 | Bacteria | 1513 |
| 303 | Ga0105246_10237822 | 3300011119 | Bacteria | 1438 |
| 304 | Ga0105246_10317599 | 3300011119 | Bacteria | 1264 |
| 305 | Ga0105246_10364957 | 3300011119 | Bacteria | 1188 |
| 306 | Ga0105246_11082137 | 3300011119 | Bacteria | 731 |
| 307 | Ga0157373_10004820 | 3300013100 | Bacteria | 10155 |
| 308 | Ga0157373_10016186 | 3300013100 | Bacteria | 5442 |
| 309 | Ga0157373_10105335 | 3300013100 | Bacteria | 1983 |
| 310 | Ga0157373_10469408 | 3300013100 | Bacteria | 907 |
| 311 | Ga0157371_10064516 | 3300013102 | Bacteria | 2595 |
| 312 | Ga0157371_10179271 | 3300013102 | Bacteria | 1515 |
| 313 | Ga0157370_10055354 | 3300013104 | Bacteria | 3779 |
| 314 | Ga0157369_10009235 | 3300013105 | Bacteria | 11280 |
| 315 | Ga0157369_10039285 | 3300013105 | Bacteria | 5172 |
| 316 | Ga0157369_10063536 | 3300013105 | Bacteria | 3977 |
| 317 | Ga0157374_10004285 | 3300013296 | Bacteria | 11997 |
| 318 | Ga0157374_10008464 | 3300013296 | Bacteria | 8797 |
| 319 | Ga0157374_10017511 | 3300013296 | Bacteria | 6310 |
| 320 | Ga0157374_10050525 | 3300013296 | Bacteria | 3865 |
| 321 | Ga0157374_10168221 | 3300013296 | Bacteria | 2137 |
| 322 | Ga0157374_10312841 | 3300013296 | Bacteria | 1555 |
| 323 | Ga0157374_10349682 | 3300013296 | Bacteria | 1469 |
| 324 | Ga0157378_10011078 | 3300013297 | Bacteria | 7892 |
| 325 | Ga0157378_10011450 | 3300013297 | Bacteria | 7762 |
| 326 | Ga0157378_10016222 | 3300013297 | Bacteria | 6524 |
| 327 | Ga0157378_10034378 | 3300013297 | Bacteria | 4483 |
| 328 | Ga0157378_10234420 | 3300013297 | Bacteria | 1750 |
| 329 | Ga0157378_10546870 | 3300013297 | Bacteria | 1163 |
| 330 | Ga0157378_10886177 | 3300013297 | Bacteria | 922 |
| 331 | Ga0157378_11647535 | 3300013297 | Bacteria | 688 |
| 332 | Ga0163162_10000331 | 3300013306 | Bacteria | 43319 |
| 333 | Ga0163162_10000967 | 3300013306 | Bacteria | 26666 |
| 334 | Ga0163162_10001657 | 3300013306 | Bacteria | 20874 |
| 335 | Ga0163162_10005839 | 3300013306 | Bacteria | 11903 |
| 336 | Ga0163162_10023196 | 3300013306 | Bacteria | 6122 |
| 337 | Ga0163162_10041570 | 3300013306 | Bacteria | 4601 |
| 338 | Ga0163162_10051850 | 3300013306 | Bacteria | 4118 |
| 339 | Ga0163162_10152015 | 3300013306 | Bacteria | 2433 |
| 340 | Ga0163162_10362438 | 3300013306 | Bacteria | 1582 |
| 341 | Ga0163162_10389701 | 3300013306 | Bacteria | 1526 |
| 342 | Ga0163162_10875028 | 3300013306 | Bacteria | 1013 |
| 343 | Ga0157372_10057945 | 3300013307 | Bacteria | 4330 |
| 344 | Ga0157372_10072860 | 3300013307 | Bacteria | 3871 |
| 345 | Ga0157372_10085260 | 3300013307 | Bacteria | 3582 |
| 346 | Ga0157372_10086814 | 3300013307 | Bacteria | 3550 |
| 347 | Ga0157372_10237683 | 3300013307 | Bacteria | 2113 |
| 348 | Ga0157372_10889853 | 3300013307 | Bacteria | 1033 |
| 349 | Ga0157372_11230511 | 3300013307 | Bacteria | 865 |
| 350 | Ga0157375_10108563 | 3300013308 | Bacteria | 2870 |
| 351 | Ga0157375_10200199 | 3300013308 | Bacteria | 2153 |
| 352 | Ga0157375_10260424 | 3300013308 | Bacteria | 1896 |
| 353 | Ga0157375_10286076 | 3300013308 | Bacteria | 1812 |
| 354 | Ga0157375_10367809 | 3300013308 | Bacteria | 1604 |
| 355 | Ga0157375_10608000 | 3300013308 | Bacteria | 1252 |
| 356 | Ga0157375_10686684 | 3300013308 | Bacteria | 1178 |
| 357 | Ga0157375_11931552 | 3300013308 | Bacteria | 701 |
| 358 | Ga0163163_10000538 | 3300014325 | Bacteria | 33542 |
| 359 | Ga0163163_10000653 | 3300014325 | Bacteria | 29691 |
| 360 | Ga0163163_10005525 | 3300014325 | Bacteria | 10945 |
| 361 | Ga0163163_10170202 | 3300014325 | Bacteria | 2225 |
| 362 | Ga0163163_10195451 | 3300014325 | Bacteria | 2071 |
| 363 | Ga0163163_10237616 | 3300014325 | Bacteria | 1871 |
| 364 | Ga0163163_10240688 | 3300014325 | Bacteria | 1859 |
| 365 | Ga0163163_11244039 | 3300014325 | Bacteria | 807 |
| 366 | Ga0157380_10033396 | 3300014326 | Bacteria | 3961 |
| 367 | Ga0157380_10074259 | 3300014326 | Bacteria | 2760 |
| 368 | Ga0157380_10083353 | 3300014326 | Bacteria | 2619 |
| 369 | Ga0157380_10091846 | 3300014326 | Bacteria | 2507 |
| 370 | Ga0157380_10113725 | 3300014326 | Bacteria | 2280 |
| 371 | Ga0157380_10535593 | 3300014326 | Bacteria | 1145 |
| 372 | Ga0157377_10000932 | 3300014745 | Bacteria | 12243 |
| 373 | Ga0157377_10017538 | 3300014745 | Bacteria | 3703 |
| 374 | Ga0157377_10018348 | 3300014745 | Bacteria | 3635 |
| 375 | Ga0157379_10002723 | 3300014968 | Bacteria | 14918 |
| 376 | Ga0157379_10025305 | 3300014968 | Bacteria | 5273 |
| 377 | Ga0157379_10551241 | 3300014968 | Bacteria | 1073 |
| 378 | Ga0157379_10620243 | 3300014968 | Bacteria | 1011 |
| 379 | Ga0157376_10002682 | 3300014969 | Bacteria | 12095 |
| 380 | Ga0157376_10005888 | 3300014969 | Bacteria | 8604 |
| 381 | Ga0157376_10011043 | 3300014969 | Bacteria | 6640 |
| 382 | Ga0157376_10037066 | 3300014969 | Bacteria | 3954 |
| 383 | Ga0157376_10251467 | 3300014969 | Bacteria | 1651 |
| 384 | Ga0157376_10536282 | 3300014969 | Bacteria | 1156 |
| 385 | Ga0163161_10020165 | 3300017792 | Bacteria | 4676 |
| 386 | Ga0163161_10107559 | 3300017792 | Bacteria | 2082 |
| 387 | Ga0163161_10303496 | 3300017792 | Bacteria | 1258 |
| 388 | Ga0207666_1019755 | 3300025271 | Bacteria | 985 |
| 389 | Ga0207697_10093977 | 3300025315 | Bacteria | 1273 |
| 390 | Ga0207697_10130302 | 3300025315 | Bacteria | 1086 |
| 391 | Ga0207697_10132021 | 3300025315 | Bacteria | 1080 |
| 392 | Ga0207656_10007257 | 3300025321 | Bacteria | 4026 |
| 393 | Ga0207656_10018296 | 3300025321 | Bacteria | 2756 |
| 394 | Ga0207710_10002748 | 3300025900 | Bacteria | 8047 |
| 395 | Ga0207710_10284001 | 3300025900 | Bacteria | 833 |
| 396 | Ga0207688_10383576 | 3300025901 | Bacteria | 870 |
| 397 | Ga0207680_10000162 | 3300025903 | Bacteria | 32782 |
| 398 | Ga0207680_10011575 | 3300025903 | Bacteria | 4461 |
| 399 | Ga0207680_10022369 | 3300025903 | Bacteria | 3437 |
| 400 | Ga0207647_10000288 | 3300025904 | Bacteria | 41316 |
| 401 | Ga0207647_10031048 | 3300025904 | Bacteria | 3442 |
| 402 | Ga0207647_10146594 | 3300025904 | Bacteria | 1381 |
| 403 | Ga0207645_10009564 | 3300025907 | Bacteria | 6697 |
| 404 | Ga0207645_10248999 | 3300025907 | Bacteria | 1175 |
| 405 | Ga0207645_10665467 | 3300025907 | Bacteria | 707 |
| 406 | Ga0207643_10003598 | 3300025908 | Bacteria | 8348 |
| 407 | Ga0207643_10029894 | 3300025908 | Bacteria | 3031 |
| 408 | Ga0207643_10084438 | 3300025908 | Bacteria | 1843 |
| 409 | Ga0207705_10017561 | 3300025909 | Bacteria | 5122 |
| 410 | Ga0207705_10050880 | 3300025909 | Bacteria | 2983 |
| 411 | Ga0207705_10073058 | 3300025909 | Bacteria | 2488 |
| 412 | Ga0207654_10108045 | 3300025911 | Bacteria | 1726 |
| 413 | Ga0207654_10623912 | 3300025911 | Bacteria | 771 |
| 414 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 415 | Ga0207695_10020015 | 3300025913 | Bacteria | 7681 |
| 416 | Ga0207695_10023342 | 3300025913 | Bacteria | 6992 |
| 417 | Ga0207695_10275692 | 3300025913 | Bacteria | 1576 |
| 418 | Ga0207671_10001044 | 3300025914 | Bacteria | 33679 |
| 419 | Ga0207671_10002907 | 3300025914 | Bacteria | 17690 |
| 420 | Ga0207671_10003799 | 3300025914 | Bacteria | 14813 |
| 421 | Ga0207671_10084251 | 3300025914 | Bacteria | 2387 |
| 422 | Ga0207660_10013171 | 3300025917 | Bacteria | 5416 |
| 423 | Ga0207662_10012024 | 3300025918 | Bacteria | 4813 |
| 424 | Ga0207662_10341713 | 3300025918 | Bacteria | 1003 |
| 425 | Ga0207657_10010433 | 3300025919 | Bacteria | 9272 |
| 426 | Ga0207657_10259810 | 3300025919 | Bacteria | 1382 |
| 427 | Ga0207649_10009815 | 3300025920 | Bacteria | 5245 |
| 428 | Ga0207649_10070948 | 3300025920 | Bacteria | 2223 |
| 429 | Ga0207649_10250061 | 3300025920 | Bacteria | 1276 |
| 430 | Ga0207649_10356417 | 3300025920 | Bacteria | 1084 |
| 431 | Ga0207652_10157540 | 3300025921 | Bacteria | 2034 |
| 432 | Ga0207652_10232748 | 3300025921 | Bacteria | 1661 |
| 433 | Ga0207652_10473432 | 3300025921 | Bacteria | 1128 |
| 434 | Ga0207681_10042348 | 3300025923 | Bacteria | 3041 |
| 435 | Ga0207681_10109432 | 3300025923 | Bacteria | 2007 |
| 436 | Ga0207681_10110966 | 3300025923 | Bacteria | 1995 |
| 437 | Ga0207681_10126163 | 3300025923 | Bacteria | 1885 |
| 438 | Ga0207681_10723578 | 3300025923 | Bacteria | 828 |
| 439 | Ga0207694_10007231 | 3300025924 | Bacteria | 8426 |
| 440 | Ga0207650_10157728 | 3300025925 | Bacteria | 1796 |
| 441 | Ga0207650_10231947 | 3300025925 | Bacteria | 1489 |
| 442 | Ga0207650_10421948 | 3300025925 | Bacteria | 1107 |
| 443 | Ga0207650_10506709 | 3300025925 | Bacteria | 1009 |
| 444 | Ga0207650_10556236 | 3300025925 | Bacteria | 962 |
| 445 | Ga0207659_10025862 | 3300025926 | Bacteria | 3952 |
| 446 | Ga0207659_10116002 | 3300025926 | Bacteria | 2044 |
| 447 | Ga0207659_10239684 | 3300025926 | Bacteria | 1466 |
| 448 | Ga0207659_10583690 | 3300025926 | Bacteria | 952 |
| 449 | Ga0207659_11075588 | 3300025926 | Bacteria | 692 |
| 450 | Ga0207644_10041454 | 3300025931 | Bacteria | 3257 |
| 451 | Ga0207644_10093954 | 3300025931 | Bacteria | 2240 |
| 452 | Ga0207644_10268536 | 3300025931 | Bacteria | 1366 |
| 453 | Ga0207644_10535329 | 3300025931 | Bacteria | 969 |
| 454 | Ga0207644_10785067 | 3300025931 | Bacteria | 796 |
| 455 | Ga0207690_10004421 | 3300025932 | Bacteria | 8296 |
| 456 | Ga0207690_10121523 | 3300025932 | Bacteria | 1898 |
| 457 | Ga0207706_10006768 | 3300025933 | Bacteria | 10596 |
| 458 | Ga0207706_10009505 | 3300025933 | Bacteria | 8928 |
| 459 | Ga0207706_10060615 | 3300025933 | Bacteria | 3332 |
| 460 | Ga0207706_10095175 | 3300025933 | Bacteria | 2620 |
| 461 | Ga0207706_10450269 | 3300025933 | Bacteria | 1113 |
| 462 | Ga0207686_10003538 | 3300025934 | Bacteria | 8377 |
| 463 | Ga0207686_10083379 | 3300025934 | Bacteria | 2092 |
| 464 | Ga0207686_10108703 | 3300025934 | Bacteria | 1866 |
| 465 | Ga0207686_10359897 | 3300025934 | Bacteria | 1098 |
| 466 | Ga0207670_10158600 | 3300025936 | Bacteria | 1686 |
| 467 | Ga0207670_10179608 | 3300025936 | Bacteria | 1593 |
| 468 | Ga0207670_10249622 | 3300025936 | Bacteria | 1371 |
| 469 | Ga0207670_10317551 | 3300025936 | Bacteria | 1225 |
| 470 | Ga0207669_10161037 | 3300025937 | Bacteria | 1585 |
| 471 | Ga0207669_10313165 | 3300025937 | Bacteria | 1198 |
| 472 | Ga0207669_10363358 | 3300025937 | Bacteria | 1122 |
| 473 | Ga0207704_10017923 | 3300025938 | Bacteria | 3684 |
| 474 | Ga0207704_10032550 | 3300025938 | Bacteria | 2952 |
| 475 | Ga0207704_10033238 | 3300025938 | Bacteria | 2930 |
| 476 | Ga0207704_10063914 | 3300025938 | Bacteria | 2297 |
| 477 | Ga0207704_10090396 | 3300025938 | Bacteria | 2009 |
| 478 | Ga0207704_10694134 | 3300025938 | Bacteria | 842 |
| 479 | Ga0207691_10002527 | 3300025940 | Bacteria | 17886 |
| 480 | Ga0207691_10032248 | 3300025940 | Bacteria | 4886 |
| 481 | Ga0207691_10082409 | 3300025940 | Bacteria | 2889 |
| 482 | Ga0207691_10107984 | 3300025940 | Bacteria | 2477 |
| 483 | Ga0207691_10752318 | 3300025940 | Bacteria | 821 |
| 484 | Ga0207689_10001006 | 3300025942 | Bacteria | 27060 |
| 485 | Ga0207689_10011687 | 3300025942 | Bacteria | 7524 |
| 486 | Ga0207689_10015929 | 3300025942 | Bacteria | 6365 |
| 487 | Ga0207689_10045025 | 3300025942 | Bacteria | 3649 |
| 488 | Ga0207689_10051842 | 3300025942 | Bacteria | 3382 |
| 489 | Ga0207689_10058122 | 3300025942 | Bacteria | 3181 |
| 490 | Ga0207689_10060757 | 3300025942 | Bacteria | 3108 |
| 491 | Ga0207689_10200519 | 3300025942 | Bacteria | 1647 |
| 492 | Ga0207689_10376390 | 3300025942 | Bacteria | 1182 |
| 493 | Ga0207661_10006982 | 3300025944 | Bacteria | 8009 |
| 494 | Ga0207661_10009253 | 3300025944 | Bacteria | 7058 |
| 495 | Ga0207661_10042612 | 3300025944 | Bacteria | 3579 |
| 496 | Ga0207679_10026932 | 3300025945 | Bacteria | 3969 |
| 497 | Ga0207679_10067172 | 3300025945 | Bacteria | 2689 |
| 498 | Ga0207679_10188865 | 3300025945 | Bacteria | 1711 |
| 499 | Ga0207679_10236036 | 3300025945 | Unclassified | 1547 |
| 500 | Ga0207679_10249779 | 3300025945 | Bacteria | 1507 |
| 501 | Ga0207679_10461495 | 3300025945 | Bacteria | 1128 |
| 502 | Ga0207679_10642983 | 3300025945 | Bacteria | 959 |
| 503 | Ga0207667_10083849 | 3300025949 | Bacteria | 3300 |
| 504 | Ga0207667_10197981 | 3300025949 | Bacteria | 2061 |
| 505 | Ga0207667_10427815 | 3300025949 | Bacteria | 1347 |
| 506 | Ga0207667_10831718 | 3300025949 | Bacteria | 918 |
| 507 | Ga0207651_10001099 | 3300025960 | Bacteria | 12009 |
| 508 | Ga0207651_10075842 | 3300025960 | Bacteria | 2401 |
| 509 | Ga0207651_10076768 | 3300025960 | Bacteria | 2389 |
| 510 | Ga0207651_10087618 | 3300025960 | Bacteria | 2267 |
| 511 | Ga0207651_10143507 | 3300025960 | Bacteria | 1848 |
| 512 | Ga0207651_10268235 | 3300025960 | Bacteria | 1405 |
| 513 | Ga0207651_10291655 | 3300025960 | Bacteria | 1353 |
| 514 | Ga0207651_10469765 | 3300025960 | Bacteria | 1082 |
| 515 | Ga0207712_10004495 | 3300025961 | Bacteria | 8810 |
| 516 | Ga0207712_10033754 | 3300025961 | Bacteria | 3461 |
| 517 | Ga0207712_10060416 | 3300025961 | Bacteria | 2687 |
| 518 | Ga0207712_10131927 | 3300025961 | Bacteria | 1905 |
| 519 | Ga0207712_10172872 | 3300025961 | Bacteria | 1690 |
| 520 | Ga0207712_10243039 | 3300025961 | Bacteria | 1451 |
| 521 | Ga0207712_10265368 | 3300025961 | Bacteria | 1394 |
| 522 | Ga0207712_10681437 | 3300025961 | Bacteria | 896 |
| 523 | Ga0207668_10000843 | 3300025972 | Bacteria | 18537 |
| 524 | Ga0207668_10350783 | 3300025972 | Bacteria | 1234 |
| 525 | Ga0207668_10542887 | 3300025972 | Bacteria | 1006 |
| 526 | Ga0207668_10593479 | 3300025972 | Bacteria | 964 |
| 527 | Ga0207640_10317263 | 3300025981 | Bacteria | 1239 |
| 528 | Ga0207640_10410609 | 3300025981 | Bacteria | 1105 |
| 529 | Ga0207640_10877622 | 3300025981 | Bacteria | 782 |
| 530 | Ga0207658_10007260 | 3300025986 | Bacteria | 7555 |
| 531 | Ga0207658_10014240 | 3300025986 | Bacteria | 5447 |
| 532 | Ga0207658_10015834 | 3300025986 | Bacteria | 5177 |
| 533 | Ga0207658_10094747 | 3300025986 | Bacteria | 2324 |
| 534 | Ga0207658_10266122 | 3300025986 | Bacteria | 1463 |
| 535 | Ga0207658_10385801 | 3300025986 | Bacteria | 1228 |
| 536 | Ga0207658_10428469 | 3300025986 | Bacteria | 1168 |
| 537 | Ga0207677_10008700 | 3300026023 | Bacteria | 5684 |
| 538 | Ga0207677_10190599 | 3300026023 | Bacteria | 1621 |
| 539 | Ga0207677_10275415 | 3300026023 | Bacteria | 1379 |
| 540 | Ga0207677_10404649 | 3300026023 | Bacteria | 1158 |
| 541 | Ga0207677_11029291 | 3300026023 | Bacteria | 748 |
| 542 | Ga0207703_10004370 | 3300026035 | Bacteria | 11617 |
| 543 | Ga0207703_10005016 | 3300026035 | Bacteria | 10732 |
| 544 | Ga0207703_10942432 | 3300026035 | Bacteria | 827 |
| 545 | Ga0207703_10974627 | 3300026035 | Bacteria | 813 |
| 546 | Ga0207639_10003645 | 3300026041 | Bacteria | 10352 |
| 547 | Ga0207639_10014405 | 3300026041 | Bacteria | 5561 |
| 548 | Ga0207639_10022108 | 3300026041 | Bacteria | 4578 |
| 549 | Ga0207639_10106484 | 3300026041 | Bacteria | 2276 |
| 550 | Ga0207639_10183268 | 3300026041 | Bacteria | 1783 |
| 551 | Ga0207639_10254627 | 3300026041 | Bacteria | 1532 |
| 552 | Ga0207639_10361586 | 3300026041 | Bacteria | 1299 |
| 553 | Ga0207639_10473485 | 3300026041 | Bacteria | 1140 |
| 554 | Ga0207639_10580071 | 3300026041 | Bacteria | 1032 |
| 555 | Ga0207639_10835455 | 3300026041 | Bacteria | 859 |
| 556 | Ga0207678_10056544 | 3300026067 | Bacteria | 3377 |
| 557 | Ga0207678_10227486 | 3300026067 | Bacteria | 1597 |
| 558 | Ga0207708_10361988 | 3300026075 | Bacteria | 1192 |
| 559 | Ga0207702_10083520 | 3300026078 | Bacteria | 2779 |
| 560 | Ga0207702_10147106 | 3300026078 | Bacteria | 2139 |
| 561 | Ga0207641_10000226 | 3300026088 | Bacteria | 72539 |
| 562 | Ga0207641_10001217 | 3300026088 | Bacteria | 25759 |
| 563 | Ga0207641_10004894 | 3300026088 | Bacteria | 11515 |
| 564 | Ga0207641_10039269 | 3300026088 | Bacteria | 3958 |
| 565 | Ga0207641_10093013 | 3300026088 | Bacteria | 2642 |
| 566 | Ga0207641_10177428 | 3300026088 | Bacteria | 1949 |
| 567 | Ga0207648_10003412 | 3300026089 | Bacteria | 16676 |
| 568 | Ga0207648_10003442 | 3300026089 | Bacteria | 16603 |
| 569 | Ga0207648_10064003 | 3300026089 | Bacteria | 3205 |
| 570 | Ga0207648_10598109 | 3300026089 | Bacteria | 1016 |
| 571 | Ga0207648_11440962 | 3300026089 | Bacteria | 647 |
| 572 | Ga0207676_10006014 | 3300026095 | Bacteria | 8558 |
| 573 | Ga0207676_10009837 | 3300026095 | Bacteria | 6802 |
| 574 | Ga0207676_10022211 | 3300026095 | Bacteria | 4665 |
| 575 | Ga0207676_10154929 | 3300026095 | Unclassified | 1978 |
| 576 | Ga0207676_10180863 | 3300026095 | Bacteria | 1846 |
| 577 | Ga0207676_10221680 | 3300026095 | Bacteria | 1685 |
| 578 | Ga0207676_10406462 | 3300026095 | Bacteria | 1274 |
| 579 | Ga0207676_11111609 | 3300026095 | Bacteria | 781 |
| 580 | Ga0207674_10009363 | 3300026116 | Bacteria | 11203 |
| 581 | Ga0207674_10017713 | 3300026116 | Bacteria | 7763 |
| 582 | Ga0207674_10068485 | 3300026116 | Bacteria | 3571 |
| 583 | Ga0207674_10174613 | 3300026116 | Bacteria | 2101 |
| 584 | Ga0207674_10260707 | 3300026116 | Bacteria | 1680 |
| 585 | Ga0207675_100000124 | 3300026118 | Bacteria | 63805 |
| 586 | Ga0207675_100042901 | 3300026118 | Bacteria | 4223 |
| 587 | Ga0207675_100226570 | 3300026118 | Bacteria | 1802 |
| 588 | Ga0207675_100311867 | 3300026118 | Bacteria | 1534 |
| 589 | Ga0207675_100331231 | 3300026118 | Bacteria | 1488 |
| 590 | Ga0207675_100420382 | 3300026118 | Bacteria | 1320 |
| 591 | Ga0207675_100450664 | 3300026118 | Bacteria | 1275 |
| 592 | Ga0207675_100521626 | 3300026118 | Bacteria | 1184 |
| 593 | Ga0207683_10010911 | 3300026121 | Bacteria | 7748 |
| 594 | Ga0207683_10286707 | 3300026121 | Bacteria | 1505 |
| 595 | Ga0207698_10004520 | 3300026142 | Bacteria | 8484 |
| 596 | Ga0207698_10023926 | 3300026142 | Bacteria | 4277 |
| 597 | Ga0207698_10129774 | 3300026142 | Bacteria | 2151 |
| 598 | Ga0207698_10209554 | 3300026142 | Bacteria | 1752 |
| 599 | Ga0207698_10293318 | 3300026142 | Bacteria | 1510 |
| 600 | Ga0207698_10454905 | 3300026142 | Bacteria | 1237 |
| 601 | Ga0207698_10492303 | 3300026142 | Bacteria | 1191 |
| 602 | Ga0207698_10702823 | 3300026142 | Bacteria | 1006 |
| 603 | Ga0207428_10371677 | 3300027907 | Bacteria | 1050 |
| 604 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 605 | Ga0268266_10052240 | 3300028379 | Bacteria | 3509 |
| 606 | Ga0268265_10304887 | 3300028380 | Bacteria | 1436 |
| 607 | Ga0268265_10372668 | 3300028380 | Bacteria | 1311 |
| 608 | Ga0268265_10405035 | 3300028380 | Bacteria | 1262 |
| 609 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 610 | Ga0268264_10001720 | 3300028381 | Bacteria | 20153 |
| 611 | Ga0268264_10018061 | 3300028381 | Bacteria | 5768 |
| 612 | Ga0268264_10021208 | 3300028381 | Bacteria | 5307 |
| 613 | Ga0268264_10076166 | 3300028381 | Bacteria | 2854 |
| 614 | Ga0268264_10186553 | 3300028381 | Bacteria | 1887 |
| 615 | Ga0268264_10340194 | 3300028381 | Bacteria | 1425 |
| 616 | Ga0268264_10341671 | 3300028381 | Bacteria | 1422 |
| 617 | Ga0268264_10460701 | 3300028381 | Bacteria | 1233 |
| 618 | Ga0307517_10141504 | 3300028786 | Bacteria | 1687 |
| 619 | Ga0307511_10000042 | 3300030521 | Bacteria | 102114 |
| 620 | Ga0316181_1134347 | 3300030744 | Bacteria | 1081 |
| 621 | Ga0265327_10023894 | 3300031251 | Bacteria | 3605 |
| 622 | Ga0307513_10189486 | 3300031456 | Bacteria | 1910 |
| 623 | Ga0307509_10202995 | 3300031507 | Bacteria | 1817 |
| 624 | Ga0265313_10025091 | 3300031595 | Bacteria | 3169 |
| 625 | Ga0316576_10136585 | 3300031727 | Bacteria | 1845 |
| 626 | Ga0307516_10001558 | 3300031730 | Bacteria | 31533 |
| 627 | Ga0307516_10172302 | 3300031730 | Bacteria | 1903 |
| 628 | Ga0307406_10157134 | 3300031901 | Bacteria | 1630 |
| 629 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 630 | Ga0316574_0218021 | 3300035398 | Bacteria | 1223 |
| 631 | Ga0373937_0148271 | 3300036401 | Bacteria | 2197 |
| 632 | Ga0316582_0004909 | 3300036647 | Bacteria | 6832 |
| 633 | Ga0316584_0653165 | 3300036712 | Bacteria | 725 |
| 634 | Ga0373925_0382776 | 3300037068 | Bacteria | 1146 |
| 635 | Ga0451839_0226574 | 3300041496 | Bacteria | 1118 |
| 636 | Ga0451577_0344330 | 3300042876 | Bacteria | 1352 |
| 637 | Ga0451577_0587167 | 3300042876 | Bacteria | 1011 |
| 638 | Ga0466972_0003815 | 3300044658 | Bacteria | 7496 |
| 639 | Ga0453683_0062951 | 3300044673 | Bacteria | 2319 |
| 640 | Ga0453683_0105467 | 3300044673 | Bacteria | 1770 |
| 641 | Ga0453683_0174959 | 3300044673 | Bacteria | 1360 |
| 642 | Ga0466965_0023948 | 3300044683 | Bacteria | 2951 |
| 643 | Ga0453684_0001141 | 3300044712 | Bacteria | 82874 |
| 644 | Ga0453684_0011041 | 3300044712 | Bacteria | 15260 |
| 645 | Ga0453684_0065811 | 3300044712 | Bacteria | 4620 |
| 646 | Ga0453684_0086354 | 3300044712 | Bacteria | 3894 |
| 647 | Ga0453684_0116758 | 3300044712 | Bacteria | 3231 |
| 648 | Ga0453684_0223413 | 3300044712 | Bacteria | 2180 |
| 649 | Ga0466960_0109903 | 3300044901 | Bacteria | 1431 |
| 650 | Ga0451576_0161967 | 3300045051 | Bacteria | 2335 |
| 651 | Ga0466967_0231916 | 3300045976 | Bacteria | 1758 |
| 652 | Ga0495638_0029092 | 3300046460 | Bacteria | 3564 |
| 653 | Ga0495638_0037856 | 3300046460 | Bacteria | 3068 |
| 654 | Ga0495650_0081148 | 3300046471 | Bacteria | 1250 |
| 655 | Ga0495608_0363958 | 3300046511 | Bacteria | 888 |
| 656 | Ga0495618_0191190 | 3300046514 | Bacteria | 1298 |
| 657 | Ga0495628_0277620 | 3300046516 | Bacteria | 1245 |
| 658 | Ga0495648_0003874 | 3300046524 | Bacteria | 12979 |
| 659 | Ga0495586_0089623 | 3300046535 | Bacteria | 1698 |
| 660 | Ga0495597_0160117 | 3300046542 | Bacteria | 919 |
| 661 | Ga0495634_0045371 | 3300046642 | Bacteria | 2972 |
| 662 | Ga0495611_0001116 | 3300046648 | Bacteria | 14130 |
| 663 | Ga0495625_0487995 | 3300046660 | Bacteria | 755 |
| 664 | Ga0495635_0143355 | 3300046663 | Bacteria | 1627 |
| 665 | Ga0495604_0433740 | 3300047317 | Bacteria | 861 |
| 666 | Ga0495672_0025973 | 3300047320 | Bacteria | 3743 |
| 667 | Ga0495672_0031178 | 3300047320 | Bacteria | 3331 |
| 668 | Ga0495672_0092697 | 3300047320 | Bacteria | 1656 |
| 669 | Ga0495680_0077801 | 3300047322 | Bacteria | 2512 |
| 670 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 671 | Ga0495675_0177873 | 3300047444 | Bacteria | 1304 |
| 672 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 673 | Ga0496110_0105873 | 3300048913 | Bacteria | 2524 |
| 674 | Ga0501290_006192 | 3300049513 | Bacteria | 1497 |
| 675 | Ga0501297_001092 | 3300049520 | Bacteria | 2461 |
| 676 | Ga0501298_004277 | 3300049521 | Bacteria | 2244 |
| 677 | Ga0501300_019512 | 3300049523 | Bacteria | 990 |
| 678 | Ga0501033_0029523 | 3300049570 | Bacteria | 4121 |
| 679 | Ga0501034_0004012 | 3300049571 | Bacteria | 16517 |
| 680 | Ga0501036_0121343 | 3300049572 | Bacteria | 2207 |
| 681 | Ga0501036_0930959 | 3300049572 | Bacteria | 713 |
| 682 | Ga0501037_0007826 | 3300049573 | Bacteria | 7827 |
| 683 | Ga0501037_0058879 | 3300049573 | Bacteria | 2803 |
| 684 | Ga0501038_0033809 | 3300049574 | Bacteria | 4500 |
| 685 | Ga0501043_0015257 | 3300049579 | Bacteria | 6018 |
| 686 | Ga0501043_0069140 | 3300049579 | Bacteria | 2774 |
| 687 | Ga0501046_0409747 | 3300049580 | Bacteria | 978 |
| 688 | Ga0501047_0009183 | 3300049581 | Bacteria | 9336 |
| 689 | Ga0501198_002350 | 3300049649 | Bacteria | 2543 |
| 690 | Ga0501202_000823 | 3300049652 | Bacteria | 4687 |
| 691 | Ga0501207_000761 | 3300049654 | Unclassified | 3817 |
| 692 | Ga0501217_000618 | 3300049661 | Bacteria | 5991 |
| 693 | Ga0501222_004886 | 3300049662 | Bacteria | 1820 |
| 694 | Ga0501224_002993 | 3300049664 | Bacteria | 2340 |
| 695 | Ga0501227_041075 | 3300049665 | Bacteria | 1143 |
| 696 | Ga0501235_005341 | 3300049669 | Bacteria | 2794 |
| 697 | Ga0501243_000451 | 3300049675 | Bacteria | 5469 |
| 698 | Ga0501243_076963 | 3300049675 | Bacteria | 643 |
| 699 | Ga0501251_005468 | 3300049681 | Bacteria | 1349 |
| 700 | Ga0501256_011026 | 3300049685 | Bacteria | 868 |
| 701 | Ga0501257_016382 | 3300049686 | Bacteria | 1719 |
| 702 | Ga0501259_000660 | 3300049688 | Bacteria | 5531 |
| 703 | Ga0501261_002743 | 3300049690 | Bacteria | 2165 |
| 704 | Ga0501221_000044 | 3300049704 | Bacteria | 12905 |
| 705 | Ga0501225_0004470 | 3300049705 | Bacteria | 4163 |
| 706 | Ga0501234_008484 | 3300049707 | Bacteria | 1601 |
| 707 | Ga0501268_029809 | 3300049765 | Bacteria | 982 |
| 708 | Ga0501268_031161 | 3300049765 | Bacteria | 966 |
| 709 | Ga0501270_002824 | 3300049767 | Bacteria | 1819 |
| 710 | Ga0501271_002637 | 3300049768 | Bacteria | 1614 |
| 711 | Ga0501279_004209 | 3300049775 | Bacteria | 1888 |
| 712 | Ga0501280_017470 | 3300049776 | Bacteria | 1042 |
| 713 | Ga0501035_0042854 | 3300049822 | Bacteria | 4080 |
| 714 | Ga0501044_0021863 | 3300049823 | Bacteria | 6820 |
| 715 | Ga0501212_003582 | 3300049851 | Bacteria | 1957 |
| 716 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 717 | nmdc:mga05p37_285602_c1 | 3300050507 | Bacteria | 1966 |
| 718 | nmdc:mga05p37_5498_c1 | 3300050507 | Bacteria | 14884 |
| 719 | nmdc:mga05p37_930469_c1 | 3300050507 | Bacteria | 933 |
| 720 | nmdc:mga09592_28583_c1 | 3300050508 | Bacteria | 4633 |
| 721 | nmdc:mga09592_763746_c1 | 3300050508 | Bacteria | 820 |
| 722 | nmdc:mga0qj67_96975_c1 | 3300050509 | Bacteria | 2374 |
| 723 | nmdc:mga06r32_277465_c1 | 3300050510 | Bacteria | 1663 |
| 724 | nmdc:mga08y16_1403890_c1 | 3300050511 | Bacteria | 661 |
| 725 | nmdc:mga08y16_23575_c1 | 3300050511 | Bacteria | 6500 |
| 726 | nmdc:mga08y16_466503_c1 | 3300050511 | Bacteria | 1286 |
| 727 | nmdc:mga08y16_65269_c1 | 3300050511 | Bacteria | 3800 |
| 728 | nmdc:mga0n895_347485_c1 | 3300050512 | Bacteria | 1502 |
| 729 | Ga0500578_0000694 | 3300053086 | Bacteria | 40191 |
| 730 | Ga0500578_0397420 | 3300053086 | Bacteria | 795 |
| 731 | Ga0500646_0005658 | 3300053090 | Bacteria | 3165 |
| 732 | Ga0500583_0046978 | 3300053092 | Bacteria | 1988 |
| 733 | Ga0500641_0172941 | 3300053096 | Bacteria | 929 |
| 734 | Ga0500594_0062483 | 3300053118 | Bacteria | 1077 |
| 735 | Ga0500642_0083252 | 3300053130 | Bacteria | 1472 |
| 736 | Ga0500652_076832 | 3300053131 | Bacteria | 1388 |
| 737 | Ga0500588_0166184 | 3300053146 | Bacteria | 805 |
| 738 | Ga0500622_0001463 | 3300053156 | Bacteria | 18819 |
| 739 | Ga0500639_133926 | 3300053163 | Bacteria | 1170 |
| 740 | Ga0500637_0168951 | 3300053178 | Bacteria | 1258 |
| 741 | Ga0500611_000034 | 3300053727 | Bacteria | 78957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0344330 | Ga0451577_0344330_791_1249 | 150 |
| 2 | 3300005337 | Ga0070682_100165344 | Ga0070682_1001653442 | 167 |
| 3 | 3300049574 | Ga0501038_0033809 | Ga0501038_0033809_3969_4481 | 169 |
| 4 | 3300011119 | Ga0105246_11082137 | Ga0105246_110821371 | 171 |
| 5 | 3300048913 | Ga0496110_0105873 | Ga0496110_0105873_1962_2510 | 175 |
| 6 | 3300026023 | Ga0207677_11029291 | Ga0207677_110292911 | 178 |
| 7 | 3300049765 | Ga0501268_031161 | Ga0501268_031161_287_853 | 178 |
| 8 | 3300009093 | Ga0105240_10078410 | Ga0105240_100784103 | 181 |
| 9 | 3300009174 | Ga0105241_11012972 | Ga0105241_110129721 | 181 |
| 10 | 3300005617 | Ga0068859_101312257 | Ga0068859_1013122571 | 183 |
| 11 | 3300006931 | Ga0097620_101312299 | Ga0097620_1013122991 | 183 |
| 12 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_416172_416726 | 183 |
| 13 | 3300005841 | Ga0068863_100093702 | Ga0068863_1000937024 | 184 |
| 14 | 3300026088 | Ga0207641_10001217 | Ga0207641_1000121717 | 184 |
| 15 | iso_pu_bacteria | 2738541283 | 2738755937 | 184 |
| 16 | 3300005577 | Ga0068857_100481509 | Ga0068857_1004815092 | 185 |
| 17 | 3300009147 | Ga0114129_10020916 | Ga0114129_100209169 | 185 |
| 18 | 3300009553 | Ga0105249_10499074 | Ga0105249_104990741 | 185 |
| 19 | 3300025961 | Ga0207712_10172872 | Ga0207712_101728722 | 185 |
| 20 | 3300050507 | nmdc:mga05p37_5498_c1 | nmdc:mga05p37_5498_c1_12808_13494 | 185 |
| 21 | iso_pu_bacteria | 2818991444 | 2819588779 | 185 |
| 22 | 3300005578 | Ga0068854_100577392 | Ga0068854_1005773922 | 186 |
| 23 | 3300009545 | Ga0105237_10000088 | Ga0105237_1000008877 | 186 |
| 24 | 3300003322 | rootL2_10134929 | rootL2_101349292 | 187 |
| 25 | 3300005289 | Ga0065704_10260033 | Ga0065704_102600331 | 187 |
| 26 | 3300005290 | Ga0065712_10015823 | Ga0065712_100158232 | 187 |
| 27 | 3300005328 | Ga0070676_10167649 | Ga0070676_101676491 | 187 |
| 28 | 3300005331 | Ga0070670_100066481 | Ga0070670_1000664812 | 187 |
| 29 | 3300005331 | Ga0070670_100086833 | Ga0070670_1000868332 | 187 |
| 30 | 3300005334 | Ga0068869_100102808 | Ga0068869_1001028082 | 187 |
| 31 | 3300005335 | Ga0070666_10082177 | Ga0070666_100821772 | 187 |
| 32 | 3300005340 | Ga0070689_100014808 | Ga0070689_1000148087 | 187 |
| 33 | 3300005353 | Ga0070669_100052700 | Ga0070669_1000527002 | 187 |
| 34 | 3300005354 | Ga0070675_100013600 | Ga0070675_1000136002 | 187 |
| 35 | 3300005364 | Ga0070673_100010151 | Ga0070673_1000101511 | 187 |
| 36 | 3300005365 | Ga0070688_100008021 | Ga0070688_1000080214 | 187 |
| 37 | 3300005459 | Ga0068867_100898685 | Ga0068867_1008986851 | 187 |
| 38 | 3300005466 | Ga0070685_10152592 | Ga0070685_101525922 | 187 |
| 39 | 3300005539 | Ga0068853_100000221 | Ga0068853_10000022138 | 187 |
| 40 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001712 | 187 |
| 41 | 3300005548 | Ga0070665_100060884 | Ga0070665_1000608842 | 187 |
| 42 | 3300005564 | Ga0070664_100283673 | Ga0070664_1002836732 | 187 |
| 43 | 3300005719 | Ga0068861_100009306 | Ga0068861_1000093068 | 187 |
| 44 | 3300005840 | Ga0068870_10008007 | Ga0068870_100080072 | 187 |
| 45 | 3300005840 | Ga0068870_10119725 | Ga0068870_101197252 | 187 |
| 46 | 3300005843 | Ga0068860_100000046 | Ga0068860_10000004625 | 187 |
| 47 | 3300005844 | Ga0068862_100848336 | Ga0068862_1008483362 | 187 |
| 48 | 3300006237 | Ga0097621_100604977 | Ga0097621_1006049772 | 187 |
| 49 | 3300006880 | Ga0075429_100235957 | Ga0075429_1002359572 | 187 |
| 50 | 3300006881 | Ga0068865_100483566 | Ga0068865_1004835662 | 187 |
| 51 | 3300009093 | Ga0105240_10075581 | Ga0105240_100755813 | 187 |
| 52 | 3300009094 | Ga0111539_10015483 | Ga0111539_100154838 | 187 |
| 53 | 3300009176 | Ga0105242_10012454 | Ga0105242_100124546 | 187 |
| 54 | 3300009545 | Ga0105237_10419151 | Ga0105237_104191512 | 187 |
| 55 | 3300009551 | Ga0105238_10035958 | Ga0105238_100359583 | 187 |
| 56 | 3300009553 | Ga0105249_10111257 | Ga0105249_101112572 | 187 |
| 57 | 3300010375 | Ga0105239_10219692 | Ga0105239_102196921 | 187 |
| 58 | 3300013297 | Ga0157378_10546870 | Ga0157378_105468702 | 187 |
| 59 | 3300013297 | Ga0157378_10886177 | Ga0157378_108861772 | 187 |
| 60 | 3300013306 | Ga0163162_10000331 | Ga0163162_100003317 | 187 |
| 61 | 3300013306 | Ga0163162_10051850 | Ga0163162_100518504 | 187 |
| 62 | 3300013307 | Ga0157372_10086814 | Ga0157372_100868143 | 187 |
| 63 | 3300014326 | Ga0157380_10033396 | Ga0157380_100333962 | 187 |
| 64 | 3300014326 | Ga0157380_10113725 | Ga0157380_101137252 | 187 |
| 65 | 3300014745 | Ga0157377_10000932 | Ga0157377_100009323 | 187 |
| 66 | 3300025315 | Ga0207697_10130302 | Ga0207697_101303022 | 187 |
| 67 | 3300025904 | Ga0207647_10146594 | Ga0207647_101465942 | 187 |
| 68 | 3300025907 | Ga0207645_10665467 | Ga0207645_106654671 | 187 |
| 69 | 3300025908 | Ga0207643_10029894 | Ga0207643_100298942 | 187 |
| 70 | 3300025913 | Ga0207695_10000323 | Ga0207695_1000032365 | 187 |
| 71 | 3300025913 | Ga0207695_10020015 | Ga0207695_1002001510 | 187 |
| 72 | 3300025914 | Ga0207671_10084251 | Ga0207671_100842512 | 187 |
| 73 | 3300025923 | Ga0207681_10042348 | Ga0207681_100423482 | 187 |
| 74 | 3300025925 | Ga0207650_10231947 | Ga0207650_102319472 | 187 |
| 75 | 3300025936 | Ga0207670_10179608 | Ga0207670_101796083 | 187 |
| 76 | 3300025937 | Ga0207669_10313165 | Ga0207669_103131652 | 187 |
| 77 | 3300025938 | Ga0207704_10694134 | Ga0207704_106941341 | 187 |
| 78 | 3300025942 | Ga0207689_10376390 | Ga0207689_103763901 | 187 |
| 79 | 3300025961 | Ga0207712_10131927 | Ga0207712_101319273 | 187 |
| 80 | 3300025972 | Ga0207668_10593479 | Ga0207668_105934792 | 187 |
| 81 | 3300026035 | Ga0207703_10974627 | Ga0207703_109746271 | 187 |
| 82 | 3300026041 | Ga0207639_10003645 | Ga0207639_100036454 | 187 |
| 83 | 3300026041 | Ga0207639_10580071 | Ga0207639_105800712 | 187 |
| 84 | 3300026089 | Ga0207648_11440962 | Ga0207648_114409621 | 187 |
| 85 | 3300026116 | Ga0207674_10068485 | Ga0207674_100684853 | 187 |
| 86 | 3300026118 | Ga0207675_100000124 | Ga0207675_10000012424 | 187 |
| 87 | 3300027907 | Ga0207428_10371677 | Ga0207428_103716771 | 187 |
| 88 | 3300028379 | Ga0268266_10000049 | Ga0268266_1000004973 | 187 |
| 89 | 3300028381 | Ga0268264_10000041 | Ga0268264_10000041302 | 187 |
| 90 | 3300028786 | Ga0307517_10141504 | Ga0307517_101415042 | 187 |
| 91 | 3300031727 | Ga0316576_10136585 | Ga0316576_101365853 | 187 |
| 92 | 3300033180 | Ga0307510_10000091 | Ga0307510_1000009125 | 187 |
| 93 | 3300035398 | Ga0316574_0218021 | Ga0316574_0218021_83_670 | 187 |
| 94 | 3300036647 | Ga0316582_0004909 | Ga0316582_0004909_876_1463 | 187 |
| 95 | 3300036712 | Ga0316584_0653165 | Ga0316584_0653165_32_601 | 187 |
| 96 | 3300042876 | Ga0451577_0587167 | Ga0451577_0587167_405_977 | 187 |
| 97 | 3300044658 | Ga0466972_0003815 | Ga0466972_0003815_5653_6222 | 187 |
| 98 | 3300044673 | Ga0453683_0062951 | Ga0453683_0062951_1705_2274 | 187 |
| 99 | 3300044673 | Ga0453683_0105467 | Ga0453683_0105467_661_1230 | 187 |
| 100 | 3300044683 | Ga0466965_0023948 | Ga0466965_0023948_850_1416 | 187 |
| 101 | 3300044712 | Ga0453684_0001141 | Ga0453684_0001141_5880_6452 | 187 |
| 102 | 3300044712 | Ga0453684_0011041 | Ga0453684_0011041_10450_11028 | 187 |
| 103 | 3300044712 | Ga0453684_0065811 | Ga0453684_0065811_1485_2057 | 187 |
| 104 | 3300044712 | Ga0453684_0086354 | Ga0453684_0086354_2825_3403 | 187 |
| 105 | 3300044712 | Ga0453684_0116758 | Ga0453684_0116758_1291_1863 | 187 |
| 106 | 3300044712 | Ga0453684_0223413 | Ga0453684_0223413_1549_2118 | 187 |
| 107 | 3300044901 | Ga0466960_0109903 | Ga0466960_0109903_106_675 | 187 |
| 108 | 3300045051 | Ga0451576_0161967 | Ga0451576_0161967_977_1555 | 187 |
| 109 | 3300045976 | Ga0466967_0231916 | Ga0466967_0231916_794_1387 | 187 |
| 110 | 3300046460 | Ga0495638_0037856 | Ga0495638_0037856_2327_2896 | 187 |
| 111 | 3300046524 | Ga0495648_0003874 | Ga0495648_0003874_10750_11319 | 187 |
| 112 | 3300046542 | Ga0495597_0160117 | Ga0495597_0160117_43_612 | 187 |
| 113 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_347703_348272 | 187 |
| 114 | 3300049513 | Ga0501290_006192 | Ga0501290_006192_251_817 | 187 |
| 115 | 3300049520 | Ga0501297_001092 | Ga0501297_001092_396_962 | 187 |
| 116 | 3300049521 | Ga0501298_004277 | Ga0501298_004277_980_1546 | 187 |
| 117 | 3300049523 | Ga0501300_019512 | Ga0501300_019512_348_914 | 187 |
| 118 | 3300049649 | Ga0501198_002350 | Ga0501198_002350_1265_1831 | 187 |
| 119 | 3300049652 | Ga0501202_000823 | Ga0501202_000823_3742_4308 | 187 |
| 120 | 3300049654 | Ga0501207_000761 | Ga0501207_000761_2787_3353 | 187 |
| 121 | 3300049661 | Ga0501217_000618 | Ga0501217_000618_3854_4420 | 187 |
| 122 | 3300049662 | Ga0501222_004886 | Ga0501222_004886_221_787 | 187 |
| 123 | 3300049664 | Ga0501224_002993 | Ga0501224_002993_925_1491 | 187 |
| 124 | 3300049665 | Ga0501227_041075 | Ga0501227_041075_160_726 | 187 |
| 125 | 3300049669 | Ga0501235_005341 | Ga0501235_005341_1150_1716 | 187 |
| 126 | 3300049675 | Ga0501243_000451 | Ga0501243_000451_2334_2900 | 187 |
| 127 | 3300049681 | Ga0501251_005468 | Ga0501251_005468_84_650 | 187 |
| 128 | 3300049685 | Ga0501256_011026 | Ga0501256_011026_66_632 | 187 |
| 129 | 3300049686 | Ga0501257_016382 | Ga0501257_016382_930_1496 | 187 |
| 130 | 3300049688 | Ga0501259_000660 | Ga0501259_000660_3562_4128 | 187 |
| 131 | 3300049690 | Ga0501261_002743 | Ga0501261_002743_1512_2078 | 187 |
| 132 | 3300049704 | Ga0501221_000044 | Ga0501221_000044_11414_11980 | 187 |
| 133 | 3300049705 | Ga0501225_0004470 | Ga0501225_0004470_1154_1720 | 187 |
| 134 | 3300049707 | Ga0501234_008484 | Ga0501234_008484_127_693 | 187 |
| 135 | 3300049765 | Ga0501268_029809 | Ga0501268_029809_23_589 | 187 |
| 136 | 3300049767 | Ga0501270_002824 | Ga0501270_002824_381_947 | 187 |
| 137 | 3300049768 | Ga0501271_002637 | Ga0501271_002637_705_1271 | 187 |
| 138 | 3300049775 | Ga0501279_004209 | Ga0501279_004209_1284_1850 | 187 |
| 139 | 3300049776 | Ga0501280_017470 | Ga0501280_017470_391_957 | 187 |
| 140 | 3300049851 | Ga0501212_003582 | Ga0501212_003582_720_1286 | 187 |
| 141 | 3300050508 | nmdc:mga09592_763746_c1 | nmdc:mga09592_763746_c1_101_667 | 187 |
| 142 | 3300050511 | nmdc:mga08y16_23575_c1 | nmdc:mga08y16_23575_c1_204_770 | 187 |
| 143 | 3300053092 | Ga0500583_0046978 | Ga0500583_0046978_1202_1771 | 187 |
| 144 | 3300053130 | Ga0500642_0083252 | Ga0500642_0083252_718_1287 | 187 |
| 145 | 3300053156 | Ga0500622_0001463 | Ga0500622_0001463_16436_17005 | 187 |
| 146 | 3300005331 | Ga0070670_100174030 | Ga0070670_1001740302 | 188 |
| 147 | 3300005353 | Ga0070669_100048455 | Ga0070669_1000484553 | 188 |
| 148 | 3300005441 | Ga0070700_100632254 | Ga0070700_1006322541 | 188 |
| 149 | 3300005549 | Ga0070704_100554975 | Ga0070704_1005549751 | 188 |
| 150 | 3300005617 | Ga0068859_100104665 | Ga0068859_1001046653 | 188 |
| 151 | 3300005844 | Ga0068862_100085090 | Ga0068862_1000850901 | 188 |
| 152 | 3300006844 | Ga0075428_100024587 | Ga0075428_1000245872 | 188 |
| 153 | 3300006844 | Ga0075428_100401541 | Ga0075428_1004015412 | 188 |
| 154 | 3300006846 | Ga0075430_100010054 | Ga0075430_1000100545 | 188 |
| 155 | 3300006847 | Ga0075431_100182263 | Ga0075431_1001822632 | 188 |
| 156 | 3300006880 | Ga0075429_100005840 | Ga0075429_1000058409 | 188 |
| 157 | 3300006880 | Ga0075429_100022996 | Ga0075429_1000229963 | 188 |
| 158 | 3300006880 | Ga0075429_100032161 | Ga0075429_1000321612 | 188 |
| 159 | 3300006931 | Ga0097620_100104665 | Ga0097620_1001046653 | 188 |
| 160 | 3300007076 | Ga0075435_100795357 | Ga0075435_1007953571 | 188 |
| 161 | 3300009094 | Ga0111539_10067948 | Ga0111539_100679484 | 188 |
| 162 | 3300009147 | Ga0114129_10187025 | Ga0114129_101870254 | 188 |
| 163 | 3300009147 | Ga0114129_10762050 | Ga0114129_107620502 | 188 |
| 164 | 3300009553 | Ga0105249_10000607 | Ga0105249_100006072 | 188 |
| 165 | 3300013100 | Ga0157373_10469408 | Ga0157373_104694082 | 188 |
| 166 | 3300014325 | Ga0163163_10237616 | Ga0163163_102376162 | 188 |
| 167 | 3300025923 | Ga0207681_10110966 | Ga0207681_101109662 | 188 |
| 168 | 3300025925 | Ga0207650_10421948 | Ga0207650_104219482 | 188 |
| 169 | 3300025926 | Ga0207659_10116002 | Ga0207659_101160022 | 188 |
| 170 | 3300026041 | Ga0207639_10014405 | Ga0207639_100144052 | 188 |
| 171 | 3300026095 | Ga0207676_10006014 | Ga0207676_100060143 | 188 |
| 172 | 3300026142 | Ga0207698_10454905 | Ga0207698_104549052 | 188 |
| 173 | 3300047320 | Ga0495672_0031178 | Ga0495672_0031178_38_607 | 188 |
| 174 | 3300047320 | Ga0495672_0092697 | Ga0495672_0092697_277_846 | 188 |
| 175 | 3300049570 | Ga0501033_0029523 | Ga0501033_0029523_2167_2736 | 188 |
| 176 | 3300049571 | Ga0501034_0004012 | Ga0501034_0004012_6399_6968 | 188 |
| 177 | 3300049572 | Ga0501036_0121343 | Ga0501036_0121343_556_1125 | 188 |
| 178 | 3300049573 | Ga0501037_0007826 | Ga0501037_0007826_185_754 | 188 |
| 179 | 3300049579 | Ga0501043_0015257 | Ga0501043_0015257_5371_5940 | 188 |
| 180 | 3300049579 | Ga0501043_0069140 | Ga0501043_0069140_482_1048 | 188 |
| 181 | 3300049580 | Ga0501046_0409747 | Ga0501046_0409747_310_879 | 188 |
| 182 | 3300049581 | Ga0501047_0009183 | Ga0501047_0009183_1788_2357 | 188 |
| 183 | 3300049675 | Ga0501243_076963 | Ga0501243_076963_47_616 | 188 |
| 184 | 3300049822 | Ga0501035_0042854 | Ga0501035_0042854_1963_2532 | 188 |
| 185 | 3300049823 | Ga0501044_0021863 | Ga0501044_0021863_2385_2954 | 188 |
| 186 | 3300050507 | nmdc:mga05p37_285602_c1 | nmdc:mga05p37_285602_c1_254_823 | 188 |
| 187 | 3300050508 | nmdc:mga09592_28583_c1 | nmdc:mga09592_28583_c1_3190_3759 | 188 |
| 188 | 3300050511 | nmdc:mga08y16_1403890_c1 | nmdc:mga08y16_1403890_c1_66_635 | 188 |
| 189 | 3300050511 | nmdc:mga08y16_65269_c1 | nmdc:mga08y16_65269_c1_2587_3156 | 188 |
| 190 | 3300053090 | Ga0500646_0005658 | Ga0500646_0005658_2004_2573 | 188 |
| 191 | 3300053096 | Ga0500641_0172941 | Ga0500641_0172941_211_783 | 188 |
| 192 | 3300053163 | Ga0500639_133926 | Ga0500639_133926_175_852 | 188 |
| 193 | iso_pu_bacteria | 2929154850 | 2929157421 | 188 |
| 194 | 3300005985 | Ga0081539_10000531 | Ga0081539_1000053136 | 189 |
| 195 | 3300009094 | Ga0111539_10817704 | Ga0111539_108177042 | 189 |
| 196 | 3300025986 | Ga0207658_10385801 | Ga0207658_103858012 | 189 |
| 197 | 3300031456 | Ga0307513_10189486 | Ga0307513_101894862 | 189 |
| 198 | 3300050005 | Ga0501284_00029 | Ga0501284_00029_15410_15982 | 189 |
| 199 | 3300005344 | Ga0070661_100117915 | Ga0070661_1001179152 | 190 |
| 200 | 3300005564 | Ga0070664_100164472 | Ga0070664_1001644722 | 190 |
| 201 | 3300005577 | Ga0068857_100667183 | Ga0068857_1006671831 | 190 |
| 202 | 3300005616 | Ga0068852_100002446 | Ga0068852_1000024469 | 190 |
| 203 | 3300009545 | Ga0105237_10009395 | Ga0105237_100093953 | 190 |
| 204 | 3300009551 | Ga0105238_10001132 | Ga0105238_1000113219 | 190 |
| 205 | 3300010375 | Ga0105239_10217240 | Ga0105239_102172401 | 190 |
| 206 | 3300013105 | Ga0157369_10063536 | Ga0157369_100635364 | 190 |
| 207 | 3300013307 | Ga0157372_10072860 | Ga0157372_100728602 | 190 |
| 208 | 3300013307 | Ga0157372_10085260 | Ga0157372_100852605 | 190 |
| 209 | 3300025904 | Ga0207647_10000288 | Ga0207647_1000028844 | 190 |
| 210 | 3300025914 | Ga0207671_10002907 | Ga0207671_1000290710 | 190 |
| 211 | 3300025920 | Ga0207649_10356417 | Ga0207649_103564172 | 190 |
| 212 | 3300025924 | Ga0207694_10007231 | Ga0207694_100072315 | 190 |
| 213 | 3300025932 | Ga0207690_10004421 | Ga0207690_100044216 | 190 |
| 214 | 3300025945 | Ga0207679_10642983 | Ga0207679_106429832 | 190 |
| 215 | 3300026041 | Ga0207639_10361586 | Ga0207639_103615862 | 190 |
| 216 | 3300026142 | Ga0207698_10023926 | Ga0207698_100239262 | 190 |
| 217 | 3300030521 | Ga0307511_10000042 | Ga0307511_1000004277 | 190 |
| 218 | 3300030744 | Ga0316181_1134347 | Ga0316181_11343472 | 190 |
| 219 | 3300031730 | Ga0307516_10172302 | Ga0307516_101723022 | 190 |
| 220 | 3300031901 | Ga0307406_10157134 | Ga0307406_101571341 | 190 |
| 221 | 3300041496 | Ga0451839_0226574 | Ga0451839_0226574_302_895 | 190 |
| 222 | 3300044673 | Ga0453683_0174959 | Ga0453683_0174959_581_1156 | 190 |
| 223 | 3300046460 | Ga0495638_0029092 | Ga0495638_0029092_1731_2306 | 190 |
| 224 | 3300046660 | Ga0495625_0487995 | Ga0495625_0487995_151_726 | 190 |
| 225 | 3300053178 | Ga0500637_0168951 | Ga0500637_0168951_212_787 | 190 |
| 226 | 3300005329 | Ga0070683_100042317 | Ga0070683_1000423172 | 191 |
| 227 | 3300005344 | Ga0070661_100003143 | Ga0070661_10000314314 | 191 |
| 228 | 3300005539 | Ga0068853_100020583 | Ga0068853_1000205835 | 191 |
| 229 | 3300005577 | Ga0068857_100007157 | Ga0068857_1000071579 | 191 |
| 230 | 3300013100 | Ga0157373_10105335 | Ga0157373_101053352 | 191 |
| 231 | 3300025920 | Ga0207649_10009815 | Ga0207649_100098155 | 191 |
| 232 | 3300025933 | Ga0207706_10450269 | Ga0207706_104502692 | 191 |
| 233 | 3300025944 | Ga0207661_10009253 | Ga0207661_100092537 | 191 |
| 234 | 3300026041 | Ga0207639_10183268 | Ga0207639_101832682 | 191 |
| 235 | 3300026116 | Ga0207674_10009363 | Ga0207674_100093635 | 191 |
| 236 | 3300046511 | Ga0495608_0363958 | Ga0495608_0363958_78_716 | 191 |
| 237 | 3300046535 | Ga0495586_0089623 | Ga0495586_0089623_965_1603 | 191 |
| 238 | 3300046663 | Ga0495635_0143355 | Ga0495635_0143355_572_1210 | 191 |
| 239 | 3300047320 | Ga0495672_0025973 | Ga0495672_0025973_2957_3544 | 191 |
| 240 | 3300047444 | Ga0495675_0177873 | Ga0495675_0177873_222_860 | 191 |
| 241 | 3300049572 | Ga0501036_0930959 | Ga0501036_0930959_102_686 | 191 |
| 242 | 3300049573 | Ga0501037_0058879 | Ga0501037_0058879_841_1425 | 191 |
| 243 | 3300005290 | Ga0065712_10076829 | Ga0065712_100768292 | 192 |
| 244 | 3300005293 | Ga0065715_10018814 | Ga0065715_100188142 | 192 |
| 245 | 3300005293 | Ga0065715_10453070 | Ga0065715_104530702 | 192 |
| 246 | 3300005327 | Ga0070658_10005995 | Ga0070658_100059952 | 192 |
| 247 | 3300005327 | Ga0070658_10010748 | Ga0070658_100107485 | 192 |
| 248 | 3300005327 | Ga0070658_10294859 | Ga0070658_102948592 | 192 |
| 249 | 3300005328 | Ga0070676_10000336 | Ga0070676_100003365 | 192 |
| 250 | 3300005328 | Ga0070676_10688637 | Ga0070676_106886371 | 192 |
| 251 | 3300005331 | Ga0070670_100446724 | Ga0070670_1004467242 | 192 |
| 252 | 3300005334 | Ga0068869_100069980 | Ga0068869_1000699801 | 192 |
| 253 | 3300005334 | Ga0068869_100070355 | Ga0068869_1000703552 | 192 |
| 254 | 3300005334 | Ga0068869_100167679 | Ga0068869_1001676792 | 192 |
| 255 | 3300005334 | Ga0068869_100454782 | Ga0068869_1004547822 | 192 |
| 256 | 3300005335 | Ga0070666_10000051 | Ga0070666_1000005121 | 192 |
| 257 | 3300005335 | Ga0070666_10010156 | Ga0070666_100101564 | 192 |
| 258 | 3300005335 | Ga0070666_10013609 | Ga0070666_100136092 | 192 |
| 259 | 3300005337 | Ga0070682_100026905 | Ga0070682_1000269054 | 192 |
| 260 | 3300005338 | Ga0068868_100016530 | Ga0068868_1000165304 | 192 |
| 261 | 3300005338 | Ga0068868_100048846 | Ga0068868_1000488462 | 192 |
| 262 | 3300005338 | Ga0068868_100080003 | Ga0068868_1000800032 | 192 |
| 263 | 3300005338 | Ga0068868_100421421 | Ga0068868_1004214211 | 192 |
| 264 | 3300005338 | Ga0068868_100777718 | Ga0068868_1007777181 | 192 |
| 265 | 3300005339 | Ga0070660_100119555 | Ga0070660_1001195552 | 192 |
| 266 | 3300005340 | Ga0070689_100137929 | Ga0070689_1001379292 | 192 |
| 267 | 3300005340 | Ga0070689_100570904 | Ga0070689_1005709041 | 192 |
| 268 | 3300005344 | Ga0070661_100673780 | Ga0070661_1006737802 | 192 |
| 269 | 3300005347 | Ga0070668_100002494 | Ga0070668_1000024943 | 192 |
| 270 | 3300005354 | Ga0070675_100025711 | Ga0070675_1000257115 | 192 |
| 271 | 3300005354 | Ga0070675_100159310 | Ga0070675_1001593102 | 192 |
| 272 | 3300005355 | Ga0070671_100270865 | Ga0070671_1002708652 | 192 |
| 273 | 3300005355 | Ga0070671_100712370 | Ga0070671_1007123702 | 192 |
| 274 | 3300005356 | Ga0070674_100816167 | Ga0070674_1008161671 | 192 |
| 275 | 3300005364 | Ga0070673_100001990 | Ga0070673_1000019904 | 192 |
| 276 | 3300005364 | Ga0070673_100413714 | Ga0070673_1004137141 | 192 |
| 277 | 3300005364 | Ga0070673_100614313 | Ga0070673_1006143132 | 192 |
| 278 | 3300005365 | Ga0070688_100097236 | Ga0070688_1000972362 | 192 |
| 279 | 3300005367 | Ga0070667_100000492 | Ga0070667_10000049227 | 192 |
| 280 | 3300005367 | Ga0070667_100001349 | Ga0070667_10000134923 | 192 |
| 281 | 3300005367 | Ga0070667_100047694 | Ga0070667_1000476942 | 192 |
| 282 | 3300005367 | Ga0070667_100115083 | Ga0070667_1001150832 | 192 |
| 283 | 3300005367 | Ga0070667_100530306 | Ga0070667_1005303062 | 192 |
| 284 | 3300005367 | Ga0070667_100557987 | Ga0070667_1005579872 | 192 |
| 285 | 3300005455 | Ga0070663_100474002 | Ga0070663_1004740021 | 192 |
| 286 | 3300005456 | Ga0070678_100072331 | Ga0070678_1000723313 | 192 |
| 287 | 3300005457 | Ga0070662_100004086 | Ga0070662_1000040864 | 192 |
| 288 | 3300005457 | Ga0070662_100520692 | Ga0070662_1005206922 | 192 |
| 289 | 3300005459 | Ga0068867_100099372 | Ga0068867_1000993722 | 192 |
| 290 | 3300005459 | Ga0068867_100409940 | Ga0068867_1004099402 | 192 |
| 291 | 3300005466 | Ga0070685_10617184 | Ga0070685_106171841 | 192 |
| 292 | 3300005530 | Ga0070679_100062675 | Ga0070679_1000626754 | 192 |
| 293 | 3300005530 | Ga0070679_100108122 | Ga0070679_1001081222 | 192 |
| 294 | 3300005539 | Ga0068853_100008065 | Ga0068853_1000080657 | 192 |
| 295 | 3300005539 | Ga0068853_100093927 | Ga0068853_1000939272 | 192 |
| 296 | 3300005539 | Ga0068853_100317821 | Ga0068853_1003178212 | 192 |
| 297 | 3300005539 | Ga0068853_100808265 | Ga0068853_1008082652 | 192 |
| 298 | 3300005539 | Ga0068853_101275444 | Ga0068853_1012754441 | 192 |
| 299 | 3300005543 | Ga0070672_100039481 | Ga0070672_1000394813 | 192 |
| 300 | 3300005543 | Ga0070672_100379669 | Ga0070672_1003796692 | 192 |
| 301 | 3300005545 | Ga0070695_100759199 | Ga0070695_1007591991 | 192 |
| 302 | 3300005548 | Ga0070665_100005742 | Ga0070665_1000057423 | 192 |
| 303 | 3300005563 | Ga0068855_100075213 | Ga0068855_1000752133 | 192 |
| 304 | 3300005563 | Ga0068855_100204441 | Ga0068855_1002044412 | 192 |
| 305 | 3300005563 | Ga0068855_100396115 | Ga0068855_1003961152 | 192 |
| 306 | 3300005564 | Ga0070664_100223776 | Ga0070664_1002237762 | 192 |
| 307 | 3300005577 | Ga0068857_100323828 | Ga0068857_1003238282 | 192 |
| 308 | 3300005578 | Ga0068854_100074699 | Ga0068854_1000746993 | 192 |
| 309 | 3300005578 | Ga0068854_100296132 | Ga0068854_1002961322 | 192 |
| 310 | 3300005578 | Ga0068854_100939242 | Ga0068854_1009392421 | 192 |
| 311 | 3300005614 | Ga0068856_100021412 | Ga0068856_1000214126 | 192 |
| 312 | 3300005616 | Ga0068852_100023547 | Ga0068852_1000235475 | 192 |
| 313 | 3300005616 | Ga0068852_100041003 | Ga0068852_1000410032 | 192 |
| 314 | 3300005616 | Ga0068852_100069230 | Ga0068852_1000692302 | 192 |
| 315 | 3300005616 | Ga0068852_101761884 | Ga0068852_1017618841 | 192 |
| 316 | 3300005617 | Ga0068859_100000023 | Ga0068859_100000023229 | 192 |
| 317 | 3300005617 | Ga0068859_100009853 | Ga0068859_10000985310 | 192 |
| 318 | 3300005617 | Ga0068859_100085184 | Ga0068859_1000851842 | 192 |
| 319 | 3300005617 | Ga0068859_100171254 | Ga0068859_1001712543 | 192 |
| 320 | 3300005617 | Ga0068859_100837033 | Ga0068859_1008370332 | 192 |
| 321 | 3300005618 | Ga0068864_100005800 | Ga0068864_1000058006 | 192 |
| 322 | 3300005618 | Ga0068864_100007839 | Ga0068864_1000078392 | 192 |
| 323 | 3300005718 | Ga0068866_10101263 | Ga0068866_101012631 | 192 |
| 324 | 3300005719 | Ga0068861_100375244 | Ga0068861_1003752442 | 192 |
| 325 | 3300005834 | Ga0068851_10011215 | Ga0068851_100112154 | 192 |
| 326 | 3300005834 | Ga0068851_10025307 | Ga0068851_100253072 | 192 |
| 327 | 3300005834 | Ga0068851_10048024 | Ga0068851_100480242 | 192 |
| 328 | 3300005840 | Ga0068870_10039396 | Ga0068870_100393962 | 192 |
| 329 | 3300005840 | Ga0068870_10226282 | Ga0068870_102262822 | 192 |
| 330 | 3300005840 | Ga0068870_10566938 | Ga0068870_105669382 | 192 |
| 331 | 3300005841 | Ga0068863_100001812 | Ga0068863_10000181222 | 192 |
| 332 | 3300005841 | Ga0068863_100038028 | Ga0068863_1000380282 | 192 |
| 333 | 3300005842 | Ga0068858_100048079 | Ga0068858_1000480794 | 192 |
| 334 | 3300005842 | Ga0068858_100246166 | Ga0068858_1002461662 | 192 |
| 335 | 3300005842 | Ga0068858_100246655 | Ga0068858_1002466552 | 192 |
| 336 | 3300005843 | Ga0068860_100000916 | Ga0068860_10000091631 | 192 |
| 337 | 3300005843 | Ga0068860_100007358 | Ga0068860_10000735815 | 192 |
| 338 | 3300005843 | Ga0068860_100025753 | Ga0068860_1000257536 | 192 |
| 339 | 3300005843 | Ga0068860_100034035 | Ga0068860_1000340352 | 192 |
| 340 | 3300005843 | Ga0068860_101010487 | Ga0068860_1010104872 | 192 |
| 341 | 3300005844 | Ga0068862_100944806 | Ga0068862_1009448062 | 192 |
| 342 | 3300006237 | Ga0097621_100028478 | Ga0097621_1000284784 | 192 |
| 343 | 3300006237 | Ga0097621_100062269 | Ga0097621_1000622692 | 192 |
| 344 | 3300006237 | Ga0097621_100152415 | Ga0097621_1001524152 | 192 |
| 345 | 3300006237 | Ga0097621_100470061 | Ga0097621_1004700612 | 192 |
| 346 | 3300006358 | Ga0068871_100039645 | Ga0068871_1000396452 | 192 |
| 347 | 3300006358 | Ga0068871_100077547 | Ga0068871_1000775473 | 192 |
| 348 | 3300006358 | Ga0068871_100314977 | Ga0068871_1003149772 | 192 |
| 349 | 3300006358 | Ga0068871_100749459 | Ga0068871_1007494592 | 192 |
| 350 | 3300006844 | Ga0075428_100074722 | Ga0075428_1000747222 | 192 |
| 351 | 3300006844 | Ga0075428_100484987 | Ga0075428_1004849872 | 192 |
| 352 | 3300006881 | Ga0068865_100020901 | Ga0068865_1000209014 | 192 |
| 353 | 3300006881 | Ga0068865_100023102 | Ga0068865_1000231022 | 192 |
| 354 | 3300006881 | Ga0068865_100300336 | Ga0068865_1003003362 | 192 |
| 355 | 3300006931 | Ga0097620_100000023 | Ga0097620_100000023229 | 192 |
| 356 | 3300006931 | Ga0097620_100009853 | Ga0097620_10000985310 | 192 |
| 357 | 3300006931 | Ga0097620_100085179 | Ga0097620_1000851794 | 192 |
| 358 | 3300006931 | Ga0097620_100171243 | Ga0097620_1001712433 | 192 |
| 359 | 3300006931 | Ga0097620_100837037 | Ga0097620_1008370372 | 192 |
| 360 | 3300009093 | Ga0105240_10015708 | Ga0105240_100157087 | 192 |
| 361 | 3300009093 | Ga0105240_10393330 | Ga0105240_103933302 | 192 |
| 362 | 3300009094 | Ga0111539_10516316 | Ga0111539_105163163 | 192 |
| 363 | 3300009101 | Ga0105247_10005412 | Ga0105247_100054129 | 192 |
| 364 | 3300009101 | Ga0105247_10037118 | Ga0105247_100371183 | 192 |
| 365 | 3300009174 | Ga0105241_10003116 | Ga0105241_1000311616 | 192 |
| 366 | 3300009174 | Ga0105241_10034893 | Ga0105241_100348935 | 192 |
| 367 | 3300009176 | Ga0105242_10040286 | Ga0105242_100402863 | 192 |
| 368 | 3300009176 | Ga0105242_10071155 | Ga0105242_100711553 | 192 |
| 369 | 3300009176 | Ga0105242_10490816 | Ga0105242_104908162 | 192 |
| 370 | 3300009177 | Ga0105248_10059502 | Ga0105248_100595024 | 192 |
| 371 | 3300009177 | Ga0105248_10236470 | Ga0105248_102364702 | 192 |
| 372 | 3300009545 | Ga0105237_10000755 | Ga0105237_1000075550 | 192 |
| 373 | 3300009545 | Ga0105237_10124916 | Ga0105237_101249162 | 192 |
| 374 | 3300009551 | Ga0105238_10436812 | Ga0105238_104368122 | 192 |
| 375 | 3300009553 | Ga0105249_10012834 | Ga0105249_100128344 | 192 |
| 376 | 3300009553 | Ga0105249_10027191 | Ga0105249_100271915 | 192 |
| 377 | 3300009553 | Ga0105249_10059671 | Ga0105249_100596713 | 192 |
| 378 | 3300009553 | Ga0105249_11217466 | Ga0105249_112174662 | 192 |
| 379 | 3300010375 | Ga0105239_10053117 | Ga0105239_100531172 | 192 |
| 380 | 3300010375 | Ga0105239_10088168 | Ga0105239_100881683 | 192 |
| 381 | 3300010375 | Ga0105239_10328796 | Ga0105239_103287962 | 192 |
| 382 | 3300011119 | Ga0105246_10237822 | Ga0105246_102378223 | 192 |
| 383 | 3300011119 | Ga0105246_10364957 | Ga0105246_103649572 | 192 |
| 384 | 3300013100 | Ga0157373_10004820 | Ga0157373_100048202 | 192 |
| 385 | 3300013102 | Ga0157371_10179271 | Ga0157371_101792712 | 192 |
| 386 | 3300013105 | Ga0157369_10009235 | Ga0157369_100092352 | 192 |
| 387 | 3300013296 | Ga0157374_10008464 | Ga0157374_100084649 | 192 |
| 388 | 3300013296 | Ga0157374_10050525 | Ga0157374_100505252 | 192 |
| 389 | 3300013296 | Ga0157374_10312841 | Ga0157374_103128412 | 192 |
| 390 | 3300013296 | Ga0157374_10349682 | Ga0157374_103496821 | 192 |
| 391 | 3300013297 | Ga0157378_10011078 | Ga0157378_100110782 | 192 |
| 392 | 3300013297 | Ga0157378_10011450 | Ga0157378_100114503 | 192 |
| 393 | 3300013297 | Ga0157378_10016222 | Ga0157378_100162225 | 192 |
| 394 | 3300013297 | Ga0157378_11647535 | Ga0157378_116475351 | 192 |
| 395 | 3300013306 | Ga0163162_10000967 | Ga0163162_1000096727 | 192 |
| 396 | 3300013306 | Ga0163162_10001657 | Ga0163162_1000165720 | 192 |
| 397 | 3300013306 | Ga0163162_10005839 | Ga0163162_100058392 | 192 |
| 398 | 3300013306 | Ga0163162_10362438 | Ga0163162_103624382 | 192 |
| 399 | 3300013306 | Ga0163162_10875028 | Ga0163162_108750282 | 192 |
| 400 | 3300013307 | Ga0157372_10057945 | Ga0157372_100579452 | 192 |
| 401 | 3300013307 | Ga0157372_10237683 | Ga0157372_102376832 | 192 |
| 402 | 3300013308 | Ga0157375_10108563 | Ga0157375_101085634 | 192 |
| 403 | 3300013308 | Ga0157375_10260424 | Ga0157375_102604242 | 192 |
| 404 | 3300013308 | Ga0157375_10286076 | Ga0157375_102860762 | 192 |
| 405 | 3300013308 | Ga0157375_10367809 | Ga0157375_103678092 | 192 |
| 406 | 3300013308 | Ga0157375_10686684 | Ga0157375_106866841 | 192 |
| 407 | 3300013308 | Ga0157375_11931552 | Ga0157375_119315521 | 192 |
| 408 | 3300014325 | Ga0163163_10000653 | Ga0163163_100006539 | 192 |
| 409 | 3300014325 | Ga0163163_10170202 | Ga0163163_101702022 | 192 |
| 410 | 3300014325 | Ga0163163_11244039 | Ga0163163_112440391 | 192 |
| 411 | 3300014326 | Ga0157380_10083353 | Ga0157380_100833532 | 192 |
| 412 | 3300014745 | Ga0157377_10018348 | Ga0157377_100183482 | 192 |
| 413 | 3300014968 | Ga0157379_10002723 | Ga0157379_1000272315 | 192 |
| 414 | 3300014968 | Ga0157379_10551241 | Ga0157379_105512412 | 192 |
| 415 | 3300014969 | Ga0157376_10002682 | Ga0157376_1000268215 | 192 |
| 416 | 3300014969 | Ga0157376_10005888 | Ga0157376_100058882 | 192 |
| 417 | 3300014969 | Ga0157376_10251467 | Ga0157376_102514673 | 192 |
| 418 | 3300017792 | Ga0163161_10107559 | Ga0163161_101075592 | 192 |
| 419 | 3300025271 | Ga0207666_1019755 | Ga0207666_10197552 | 192 |
| 420 | 3300025315 | Ga0207697_10132021 | Ga0207697_101320212 | 192 |
| 421 | 3300025321 | Ga0207656_10007257 | Ga0207656_100072572 | 192 |
| 422 | 3300025321 | Ga0207656_10018296 | Ga0207656_100182963 | 192 |
| 423 | 3300025900 | Ga0207710_10002748 | Ga0207710_100027483 | 192 |
| 424 | 3300025903 | Ga0207680_10000162 | Ga0207680_1000016223 | 192 |
| 425 | 3300025903 | Ga0207680_10011575 | Ga0207680_100115755 | 192 |
| 426 | 3300025903 | Ga0207680_10022369 | Ga0207680_100223691 | 192 |
| 427 | 3300025907 | Ga0207645_10248999 | Ga0207645_102489992 | 192 |
| 428 | 3300025908 | Ga0207643_10003598 | Ga0207643_100035983 | 192 |
| 429 | 3300025908 | Ga0207643_10084438 | Ga0207643_100844381 | 192 |
| 430 | 3300025909 | Ga0207705_10017561 | Ga0207705_100175613 | 192 |
| 431 | 3300025909 | Ga0207705_10050880 | Ga0207705_100508802 | 192 |
| 432 | 3300025909 | Ga0207705_10073058 | Ga0207705_100730583 | 192 |
| 433 | 3300025911 | Ga0207654_10108045 | Ga0207654_101080452 | 192 |
| 434 | 3300025911 | Ga0207654_10623912 | Ga0207654_106239122 | 192 |
| 435 | 3300025913 | Ga0207695_10023342 | Ga0207695_100233426 | 192 |
| 436 | 3300025913 | Ga0207695_10275692 | Ga0207695_102756922 | 192 |
| 437 | 3300025914 | Ga0207671_10003799 | Ga0207671_100037994 | 192 |
| 438 | 3300025917 | Ga0207660_10013171 | Ga0207660_100131713 | 192 |
| 439 | 3300025918 | Ga0207662_10012024 | Ga0207662_100120242 | 192 |
| 440 | 3300025918 | Ga0207662_10341713 | Ga0207662_103417132 | 192 |
| 441 | 3300025919 | Ga0207657_10010433 | Ga0207657_100104332 | 192 |
| 442 | 3300025921 | Ga0207652_10157540 | Ga0207652_101575402 | 192 |
| 443 | 3300025921 | Ga0207652_10473432 | Ga0207652_104734322 | 192 |
| 444 | 3300025923 | Ga0207681_10109432 | Ga0207681_101094323 | 192 |
| 445 | 3300025923 | Ga0207681_10723578 | Ga0207681_107235781 | 192 |
| 446 | 3300025925 | Ga0207650_10157728 | Ga0207650_101577282 | 192 |
| 447 | 3300025925 | Ga0207650_10556236 | Ga0207650_105562361 | 192 |
| 448 | 3300025926 | Ga0207659_10025862 | Ga0207659_100258621 | 192 |
| 449 | 3300025926 | Ga0207659_10239684 | Ga0207659_102396842 | 192 |
| 450 | 3300025926 | Ga0207659_10583690 | Ga0207659_105836902 | 192 |
| 451 | 3300025931 | Ga0207644_10041454 | Ga0207644_100414542 | 192 |
| 452 | 3300025931 | Ga0207644_10785067 | Ga0207644_107850671 | 192 |
| 453 | 3300025933 | Ga0207706_10006768 | Ga0207706_1000676811 | 192 |
| 454 | 3300025933 | Ga0207706_10095175 | Ga0207706_100951753 | 192 |
| 455 | 3300025934 | Ga0207686_10003538 | Ga0207686_100035386 | 192 |
| 456 | 3300025934 | Ga0207686_10083379 | Ga0207686_100833792 | 192 |
| 457 | 3300025934 | Ga0207686_10108703 | Ga0207686_101087032 | 192 |
| 458 | 3300025934 | Ga0207686_10359897 | Ga0207686_103598972 | 192 |
| 459 | 3300025936 | Ga0207670_10249622 | Ga0207670_102496222 | 192 |
| 460 | 3300025937 | Ga0207669_10363358 | Ga0207669_103633582 | 192 |
| 461 | 3300025938 | Ga0207704_10033238 | Ga0207704_100332382 | 192 |
| 462 | 3300025938 | Ga0207704_10063914 | Ga0207704_100639142 | 192 |
| 463 | 3300025938 | Ga0207704_10090396 | Ga0207704_100903962 | 192 |
| 464 | 3300025940 | Ga0207691_10002527 | Ga0207691_100025273 | 192 |
| 465 | 3300025940 | Ga0207691_10082409 | Ga0207691_100824092 | 192 |
| 466 | 3300025940 | Ga0207691_10107984 | Ga0207691_101079842 | 192 |
| 467 | 3300025940 | Ga0207691_10752318 | Ga0207691_107523181 | 192 |
| 468 | 3300025942 | Ga0207689_10001006 | Ga0207689_100010062 | 192 |
| 469 | 3300025942 | Ga0207689_10060757 | Ga0207689_100607572 | 192 |
| 470 | 3300025942 | Ga0207689_10200519 | Ga0207689_102005192 | 192 |
| 471 | 3300025949 | Ga0207667_10427815 | Ga0207667_104278152 | 192 |
| 472 | 3300025949 | Ga0207667_10831718 | Ga0207667_108317182 | 192 |
| 473 | 3300025960 | Ga0207651_10001099 | Ga0207651_100010994 | 192 |
| 474 | 3300025960 | Ga0207651_10075842 | Ga0207651_100758422 | 192 |
| 475 | 3300025960 | Ga0207651_10076768 | Ga0207651_100767682 | 192 |
| 476 | 3300025960 | Ga0207651_10268235 | Ga0207651_102682352 | 192 |
| 477 | 3300025960 | Ga0207651_10469765 | Ga0207651_104697651 | 192 |
| 478 | 3300025961 | Ga0207712_10004495 | Ga0207712_1000449512 | 192 |
| 479 | 3300025961 | Ga0207712_10033754 | Ga0207712_100337543 | 192 |
| 480 | 3300025961 | Ga0207712_10060416 | Ga0207712_100604162 | 192 |
| 481 | 3300025961 | Ga0207712_10243039 | Ga0207712_102430391 | 192 |
| 482 | 3300025961 | Ga0207712_10265368 | Ga0207712_102653682 | 192 |
| 483 | 3300025972 | Ga0207668_10000843 | Ga0207668_100008433 | 192 |
| 484 | 3300025972 | Ga0207668_10542887 | Ga0207668_105428873 | 192 |
| 485 | 3300025981 | Ga0207640_10317263 | Ga0207640_103172631 | 192 |
| 486 | 3300025981 | Ga0207640_10877622 | Ga0207640_108776221 | 192 |
| 487 | 3300025986 | Ga0207658_10007260 | Ga0207658_1000726010 | 192 |
| 488 | 3300025986 | Ga0207658_10015834 | Ga0207658_100158343 | 192 |
| 489 | 3300025986 | Ga0207658_10266122 | Ga0207658_102661222 | 192 |
| 490 | 3300026023 | Ga0207677_10190599 | Ga0207677_101905992 | 192 |
| 491 | 3300026023 | Ga0207677_10275415 | Ga0207677_102754151 | 192 |
| 492 | 3300026035 | Ga0207703_10004370 | Ga0207703_1000437013 | 192 |
| 493 | 3300026035 | Ga0207703_10005016 | Ga0207703_100050162 | 192 |
| 494 | 3300026041 | Ga0207639_10022108 | Ga0207639_100221082 | 192 |
| 495 | 3300026041 | Ga0207639_10106484 | Ga0207639_101064842 | 192 |
| 496 | 3300026041 | Ga0207639_10254627 | Ga0207639_102546272 | 192 |
| 497 | 3300026041 | Ga0207639_10473485 | Ga0207639_104734851 | 192 |
| 498 | 3300026041 | Ga0207639_10835455 | Ga0207639_108354552 | 192 |
| 499 | 3300026078 | Ga0207702_10083520 | Ga0207702_100835202 | 192 |
| 500 | 3300026078 | Ga0207702_10147106 | Ga0207702_101471062 | 192 |
| 501 | 3300026088 | Ga0207641_10000226 | Ga0207641_1000022652 | 192 |
| 502 | 3300026088 | Ga0207641_10004894 | Ga0207641_1000489413 | 192 |
| 503 | 3300026088 | Ga0207641_10039269 | Ga0207641_100392694 | 192 |
| 504 | 3300026089 | Ga0207648_10003442 | Ga0207648_1000344214 | 192 |
| 505 | 3300026089 | Ga0207648_10064003 | Ga0207648_100640033 | 192 |
| 506 | 3300026095 | Ga0207676_10009837 | Ga0207676_100098375 | 192 |
| 507 | 3300026095 | Ga0207676_10022211 | Ga0207676_100222116 | 192 |
| 508 | 3300026095 | Ga0207676_10180863 | Ga0207676_101808632 | 192 |
| 509 | 3300026116 | Ga0207674_10260707 | Ga0207674_102607072 | 192 |
| 510 | 3300026118 | Ga0207675_100311867 | Ga0207675_1003118672 | 192 |
| 511 | 3300026118 | Ga0207675_100331231 | Ga0207675_1003312312 | 192 |
| 512 | 3300026118 | Ga0207675_100521626 | Ga0207675_1005216262 | 192 |
| 513 | 3300026121 | Ga0207683_10010911 | Ga0207683_100109114 | 192 |
| 514 | 3300026121 | Ga0207683_10286707 | Ga0207683_102867072 | 192 |
| 515 | 3300026142 | Ga0207698_10004520 | Ga0207698_100045209 | 192 |
| 516 | 3300026142 | Ga0207698_10129774 | Ga0207698_101297742 | 192 |
| 517 | 3300026142 | Ga0207698_10209554 | Ga0207698_102095542 | 192 |
| 518 | 3300026142 | Ga0207698_10702823 | Ga0207698_107028232 | 192 |
| 519 | 3300028379 | Ga0268266_10052240 | Ga0268266_100522404 | 192 |
| 520 | 3300028380 | Ga0268265_10304887 | Ga0268265_103048872 | 192 |
| 521 | 3300028381 | Ga0268264_10001720 | Ga0268264_100017204 | 192 |
| 522 | 3300028381 | Ga0268264_10018061 | Ga0268264_100180613 | 192 |
| 523 | 3300028381 | Ga0268264_10021208 | Ga0268264_100212086 | 192 |
| 524 | 3300028381 | Ga0268264_10076166 | Ga0268264_100761661 | 192 |
| 525 | 3300028381 | Ga0268264_10186553 | Ga0268264_101865532 | 192 |
| 526 | 3300028381 | Ga0268264_10340194 | Ga0268264_103401942 | 192 |
| 527 | 3300031507 | Ga0307509_10202995 | Ga0307509_102029952 | 192 |
| 528 | 3300046648 | Ga0495611_0001116 | Ga0495611_0001116_4099_4680 | 192 |
| 529 | 3300050509 | nmdc:mga0qj67_96975_c1 | nmdc:mga0qj67_96975_c1_997_1596 | 192 |
| 530 | 3300050510 | nmdc:mga06r32_277465_c1 | nmdc:mga06r32_277465_c1_468_1067 | 192 |
| 531 | 3300050511 | nmdc:mga08y16_466503_c1 | nmdc:mga08y16_466503_c1_23_619 | 192 |
| 532 | 3300053146 | Ga0500588_0166184 | Ga0500588_0166184_63_644 | 192 |
| 533 | 3300005459 | Ga0068867_100050069 | Ga0068867_1000500692 | 193 |
| 534 | 3300006881 | Ga0068865_100058333 | Ga0068865_1000583332 | 193 |
| 535 | 3300009176 | Ga0105242_10058423 | Ga0105242_100584233 | 193 |
| 536 | 3300014325 | Ga0163163_10195451 | Ga0163163_101954512 | 193 |
| 537 | 3300014326 | Ga0157380_10091846 | Ga0157380_100918462 | 193 |
| 538 | 3300025938 | Ga0207704_10017923 | Ga0207704_100179232 | 193 |
| 539 | 3300026089 | Ga0207648_10003412 | Ga0207648_100034123 | 193 |
| 540 | 3300026095 | Ga0207676_10406462 | Ga0207676_104064622 | 193 |
| 541 | 3300026118 | Ga0207675_100226570 | Ga0207675_1002265702 | 193 |
| 542 | 3300005843 | Ga0068860_100642203 | Ga0068860_1006422032 | 195 |
| 543 | 3300009101 | Ga0105247_10204453 | Ga0105247_102044532 | 195 |
| 544 | 3300025900 | Ga0207710_10284001 | Ga0207710_102840012 | 195 |
| 545 | 3300025914 | Ga0207671_10001044 | Ga0207671_100010442 | 195 |
| 546 | 3300036401 | Ga0373937_0148271 | Ga0373937_0148271_125_784 | 195 |
| 547 | 3300046516 | Ga0495628_0277620 | Ga0495628_0277620_223_882 | 195 |
| 548 | 3300046642 | Ga0495634_0045371 | Ga0495634_0045371_2278_2937 | 195 |
| 549 | 3300047317 | Ga0495604_0433740 | Ga0495604_0433740_28_687 | 195 |
| 550 | 3300047322 | Ga0495680_0077801 | Ga0495680_0077801_103_762 | 195 |
| 551 | 3300053086 | Ga0500578_0000694 | Ga0500578_0000694_2253_2921 | 195 |
| 552 | 3300014326 | Ga0157380_10074259 | Ga0157380_100742593 | 196 |
| 553 | 3300025942 | Ga0207689_10051842 | Ga0207689_100518425 | 196 |
| 554 | 3300050507 | nmdc:mga05p37_930469_c1 | nmdc:mga05p37_930469_c1_26_619 | 196 |
| 555 | 3300005331 | Ga0070670_100097335 | Ga0070670_1000973353 | 197 |
| 556 | 3300009553 | Ga0105249_10317110 | Ga0105249_103171102 | 197 |
| 557 | 3300011119 | Ga0105246_10317599 | Ga0105246_103175992 | 197 |
| 558 | 3300013296 | Ga0157374_10004285 | Ga0157374_100042859 | 197 |
| 559 | 3300013306 | Ga0163162_10152015 | Ga0163162_101520153 | 197 |
| 560 | 3300013307 | Ga0157372_10889853 | Ga0157372_108898532 | 197 |
| 561 | 3300014325 | Ga0163163_10000538 | Ga0163163_1000053824 | 197 |
| 562 | 3300031730 | Ga0307516_10001558 | Ga0307516_100015584 | 197 |
| 563 | 3300053727 | Ga0500611_000034 | Ga0500611_000034_11424_12023 | 197 |
| 564 | 3300005331 | Ga0070670_100082144 | Ga0070670_1000821444 | 199 |
| 565 | 3300005334 | Ga0068869_100043129 | Ga0068869_1000431291 | 200 |
| 566 | 3300005338 | Ga0068868_100042340 | Ga0068868_1000423404 | 200 |
| 567 | 3300005344 | Ga0070661_100002702 | Ga0070661_1000027028 | 200 |
| 568 | 3300005354 | Ga0070675_100381663 | Ga0070675_1003816632 | 200 |
| 569 | 3300005455 | Ga0070663_100550253 | Ga0070663_1005502531 | 200 |
| 570 | 3300005535 | Ga0070684_100060191 | Ga0070684_1000601914 | 200 |
| 571 | 3300005548 | Ga0070665_101061000 | Ga0070665_1010610001 | 200 |
| 572 | 3300005564 | Ga0070664_100189218 | Ga0070664_1001892182 | 200 |
| 573 | 3300005617 | Ga0068859_100353882 | Ga0068859_1003538822 | 200 |
| 574 | 3300005618 | Ga0068864_100045381 | Ga0068864_1000453813 | 200 |
| 575 | 3300005842 | Ga0068858_100105929 | Ga0068858_1001059292 | 200 |
| 576 | 3300005843 | Ga0068860_100168734 | Ga0068860_1001687341 | 200 |
| 577 | 3300005985 | Ga0081539_10179039 | Ga0081539_101790391 | 200 |
| 578 | 3300006881 | Ga0068865_100042350 | Ga0068865_1000423502 | 200 |
| 579 | 3300006931 | Ga0097620_100353883 | Ga0097620_1003538832 | 200 |
| 580 | 3300014326 | Ga0157380_10535593 | Ga0157380_105355931 | 200 |
| 581 | 3300025315 | Ga0207697_10093977 | Ga0207697_100939772 | 200 |
| 582 | 3300025919 | Ga0207657_10259810 | Ga0207657_102598102 | 200 |
| 583 | 3300025920 | Ga0207649_10070948 | Ga0207649_100709482 | 200 |
| 584 | 3300025926 | Ga0207659_11075588 | Ga0207659_110755881 | 200 |
| 585 | 3300025931 | Ga0207644_10535329 | Ga0207644_105353292 | 200 |
| 586 | 3300025936 | Ga0207670_10158600 | Ga0207670_101586002 | 200 |
| 587 | 3300025938 | Ga0207704_10032550 | Ga0207704_100325503 | 200 |
| 588 | 3300025940 | Ga0207691_10032248 | Ga0207691_100322482 | 200 |
| 589 | 3300025942 | Ga0207689_10015929 | Ga0207689_100159294 | 200 |
| 590 | 3300025944 | Ga0207661_10006982 | Ga0207661_100069826 | 200 |
| 591 | 3300025945 | Ga0207679_10249779 | Ga0207679_102497791 | 200 |
| 592 | 3300025961 | Ga0207712_10681437 | Ga0207712_106814371 | 200 |
| 593 | 3300025986 | Ga0207658_10428469 | Ga0207658_104284692 | 200 |
| 594 | 3300026067 | Ga0207678_10056544 | Ga0207678_100565443 | 200 |
| 595 | 3300026075 | Ga0207708_10361988 | Ga0207708_103619882 | 200 |
| 596 | 3300026088 | Ga0207641_10177428 | Ga0207641_101774282 | 200 |
| 597 | 3300026089 | Ga0207648_10598109 | Ga0207648_105981092 | 200 |
| 598 | 3300026095 | Ga0207676_11111609 | Ga0207676_111116091 | 200 |
| 599 | 3300026116 | Ga0207674_10017713 | Ga0207674_100177137 | 200 |
| 600 | 3300026142 | Ga0207698_10293318 | Ga0207698_102933182 | 200 |
| 601 | 3300028381 | Ga0268264_10341671 | Ga0268264_103416712 | 200 |
| 602 | 3300053086 | Ga0500578_0397420 | Ga0500578_0397420_85_762 | 200 |
| 603 | 3300031251 | Ga0265327_10023894 | Ga0265327_100238942 | 201 |
| 604 | 3300005616 | Ga0068852_100018674 | Ga0068852_1000186746 | 202 |
| 605 | 3300005842 | Ga0068858_100521910 | Ga0068858_1005219101 | 202 |
| 606 | 3300010375 | Ga0105239_10421120 | Ga0105239_104211202 | 202 |
| 607 | 3300014968 | Ga0157379_10620243 | Ga0157379_106202432 | 202 |
| 608 | 3300017792 | Ga0163161_10303496 | Ga0163161_103034962 | 202 |
| 609 | 3300025942 | Ga0207689_10045025 | Ga0207689_100450253 | 202 |
| 610 | 3300026035 | Ga0207703_10942432 | Ga0207703_109424321 | 202 |
| 611 | 3300026095 | Ga0207676_10154929 | Ga0207676_101549292 | 202 |
| 612 | 3300005331 | Ga0070670_100111799 | Ga0070670_1001117992 | 203 |
| 613 | 3300005334 | Ga0068869_100039941 | Ga0068869_1000399412 | 203 |
| 614 | 3300005340 | Ga0070689_101163802 | Ga0070689_1011638021 | 203 |
| 615 | 3300005344 | Ga0070661_100097142 | Ga0070661_1000971422 | 203 |
| 616 | 3300005355 | Ga0070671_100335321 | Ga0070671_1003353212 | 203 |
| 617 | 3300005364 | Ga0070673_100085256 | Ga0070673_1000852562 | 203 |
| 618 | 3300005364 | Ga0070673_101316908 | Ga0070673_1013169081 | 203 |
| 619 | 3300005564 | Ga0070664_100070355 | Ga0070664_1000703552 | 203 |
| 620 | 3300005564 | Ga0070664_100226291 | Ga0070664_1002262912 | 203 |
| 621 | 3300005617 | Ga0068859_100377129 | Ga0068859_1003771292 | 203 |
| 622 | 3300005618 | Ga0068864_100123054 | Ga0068864_1001230542 | 203 |
| 623 | 3300005719 | Ga0068861_100365929 | Ga0068861_1003659292 | 203 |
| 624 | 3300005841 | Ga0068863_100538827 | Ga0068863_1005388271 | 203 |
| 625 | 3300006931 | Ga0097620_100377120 | Ga0097620_1003771202 | 203 |
| 626 | 3300009177 | Ga0105248_10487872 | Ga0105248_104878722 | 203 |
| 627 | 3300013296 | Ga0157374_10017511 | Ga0157374_100175116 | 203 |
| 628 | 3300013296 | Ga0157374_10168221 | Ga0157374_101682213 | 203 |
| 629 | 3300013306 | Ga0163162_10023196 | Ga0163162_100231965 | 203 |
| 630 | 3300013307 | Ga0157372_11230511 | Ga0157372_112305112 | 203 |
| 631 | 3300013308 | Ga0157375_10200199 | Ga0157375_102001992 | 203 |
| 632 | 3300014325 | Ga0163163_10005525 | Ga0163163_100055255 | 203 |
| 633 | 3300014968 | Ga0157379_10025305 | Ga0157379_100253055 | 203 |
| 634 | 3300017792 | Ga0163161_10020165 | Ga0163161_100201652 | 203 |
| 635 | 3300025901 | Ga0207688_10383576 | Ga0207688_103835762 | 203 |
| 636 | 3300025907 | Ga0207645_10009564 | Ga0207645_100095646 | 203 |
| 637 | 3300025920 | Ga0207649_10250061 | Ga0207649_102500612 | 203 |
| 638 | 3300025923 | Ga0207681_10126163 | Ga0207681_101261632 | 203 |
| 639 | 3300025925 | Ga0207650_10506709 | Ga0207650_105067092 | 203 |
| 640 | 3300025931 | Ga0207644_10093954 | Ga0207644_100939541 | 203 |
| 641 | 3300025933 | Ga0207706_10060615 | Ga0207706_100606152 | 203 |
| 642 | 3300025942 | Ga0207689_10058122 | Ga0207689_100581221 | 203 |
| 643 | 3300025944 | Ga0207661_10042612 | Ga0207661_100426124 | 203 |
| 644 | 3300025945 | Ga0207679_10067172 | Ga0207679_100671722 | 203 |
| 645 | 3300025945 | Ga0207679_10188865 | Ga0207679_101888652 | 203 |
| 646 | 3300025960 | Ga0207651_10087618 | Ga0207651_100876182 | 203 |
| 647 | 3300025960 | Ga0207651_10143507 | Ga0207651_101435072 | 203 |
| 648 | 3300026023 | Ga0207677_10008700 | Ga0207677_100087005 | 203 |
| 649 | 3300026023 | Ga0207677_10404649 | Ga0207677_104046492 | 203 |
| 650 | 3300026095 | Ga0207676_10221680 | Ga0207676_102216803 | 203 |
| 651 | 3300026118 | Ga0207675_100450664 | Ga0207675_1004506642 | 203 |
| 652 | 3300031595 | Ga0265313_10025091 | Ga0265313_100250912 | 203 |
| 653 | 3300046471 | Ga0495650_0081148 | Ga0495650_0081148_114_728 | 203 |
| 654 | 3300005290 | Ga0065712_10190799 | Ga0065712_101907992 | 204 |
| 655 | 3300005331 | Ga0070670_100259146 | Ga0070670_1002591462 | 204 |
| 656 | 3300005334 | Ga0068869_100072563 | Ga0068869_1000725632 | 204 |
| 657 | 3300005335 | Ga0070666_10010207 | Ga0070666_100102072 | 204 |
| 658 | 3300005338 | Ga0068868_100729983 | Ga0068868_1007299832 | 204 |
| 659 | 3300005340 | Ga0070689_100001732 | Ga0070689_10000173215 | 204 |
| 660 | 3300005355 | Ga0070671_100277870 | Ga0070671_1002778702 | 204 |
| 661 | 3300005367 | Ga0070667_100089181 | Ga0070667_1000891812 | 204 |
| 662 | 3300005367 | Ga0070667_100263906 | Ga0070667_1002639062 | 204 |
| 663 | 3300005441 | Ga0070700_100288470 | Ga0070700_1002884702 | 204 |
| 664 | 3300005456 | Ga0070678_100013945 | Ga0070678_1000139458 | 204 |
| 665 | 3300005466 | Ga0070685_10464825 | Ga0070685_104648251 | 204 |
| 666 | 3300005563 | Ga0068855_100539238 | Ga0068855_1005392382 | 204 |
| 667 | 3300005564 | Ga0070664_100050688 | Ga0070664_1000506883 | 204 |
| 668 | 3300005578 | Ga0068854_100369934 | Ga0068854_1003699342 | 204 |
| 669 | 3300005842 | Ga0068858_100030828 | Ga0068858_1000308284 | 204 |
| 670 | 3300006237 | Ga0097621_100602606 | Ga0097621_1006026061 | 204 |
| 671 | 3300009093 | Ga0105240_10856083 | Ga0105240_108560832 | 204 |
| 672 | 3300009174 | Ga0105241_10868579 | Ga0105241_108685792 | 204 |
| 673 | 3300009176 | Ga0105242_11095849 | Ga0105242_110958491 | 204 |
| 674 | 3300013297 | Ga0157378_10234420 | Ga0157378_102344203 | 204 |
| 675 | 3300013306 | Ga0163162_10389701 | Ga0163162_103897011 | 204 |
| 676 | 3300014969 | Ga0157376_10011043 | Ga0157376_100110434 | 204 |
| 677 | 3300025904 | Ga0207647_10031048 | Ga0207647_100310484 | 204 |
| 678 | 3300025932 | Ga0207690_10121523 | Ga0207690_101215232 | 204 |
| 679 | 3300025945 | Ga0207679_10236036 | Ga0207679_102360362 | 204 |
| 680 | 3300025945 | Ga0207679_10461495 | Ga0207679_104614952 | 204 |
| 681 | 3300025986 | Ga0207658_10014240 | Ga0207658_100142406 | 204 |
| 682 | 3300025986 | Ga0207658_10094747 | Ga0207658_100947472 | 204 |
| 683 | 3300026067 | Ga0207678_10227486 | Ga0207678_102274861 | 204 |
| 684 | 3300028380 | Ga0268265_10372668 | Ga0268265_103726682 | 204 |
| 685 | 3300050512 | nmdc:mga0n895_347485_c1 | nmdc:mga0n895_347485_c1_34_654 | 204 |
| 686 | 3300005329 | Ga0070683_100008329 | Ga0070683_1000083298 | 205 |
| 687 | 3300005330 | Ga0070690_100083796 | Ga0070690_1000837962 | 205 |
| 688 | 3300005339 | Ga0070660_100190842 | Ga0070660_1001908421 | 205 |
| 689 | 3300005340 | Ga0070689_100173058 | Ga0070689_1001730581 | 205 |
| 690 | 3300005344 | Ga0070661_100022549 | Ga0070661_1000225492 | 205 |
| 691 | 3300005354 | Ga0070675_100106309 | Ga0070675_1001063092 | 205 |
| 692 | 3300005356 | Ga0070674_100171178 | Ga0070674_1001711783 | 205 |
| 693 | 3300005366 | Ga0070659_100024762 | Ga0070659_1000247622 | 205 |
| 694 | 3300005457 | Ga0070662_100230387 | Ga0070662_1002303872 | 205 |
| 695 | 3300005530 | Ga0070679_100045741 | Ga0070679_1000457413 | 205 |
| 696 | 3300005535 | Ga0070684_100021275 | Ga0070684_1000212753 | 205 |
| 697 | 3300005539 | Ga0068853_100057721 | Ga0068853_1000577213 | 205 |
| 698 | 3300005547 | Ga0070693_100045539 | Ga0070693_1000455392 | 205 |
| 699 | 3300005563 | Ga0068855_100174590 | Ga0068855_1001745902 | 205 |
| 700 | 3300005564 | Ga0070664_100003241 | Ga0070664_1000032415 | 205 |
| 701 | 3300005577 | Ga0068857_100021607 | Ga0068857_1000216076 | 205 |
| 702 | 3300005578 | Ga0068854_100095714 | Ga0068854_1000957142 | 205 |
| 703 | 3300005614 | Ga0068856_100073361 | Ga0068856_1000733613 | 205 |
| 704 | 3300005616 | Ga0068852_100158679 | Ga0068852_1001586792 | 205 |
| 705 | 3300005719 | Ga0068861_100017858 | Ga0068861_1000178584 | 205 |
| 706 | 3300005841 | Ga0068863_100038562 | Ga0068863_1000385623 | 205 |
| 707 | 3300006237 | Ga0097621_100005409 | Ga0097621_1000054092 | 205 |
| 708 | 3300009094 | Ga0111539_10037386 | Ga0111539_100373865 | 205 |
| 709 | 3300013100 | Ga0157373_10016186 | Ga0157373_100161862 | 205 |
| 710 | 3300013102 | Ga0157371_10064516 | Ga0157371_100645162 | 205 |
| 711 | 3300013104 | Ga0157370_10055354 | Ga0157370_100553542 | 205 |
| 712 | 3300013105 | Ga0157369_10039285 | Ga0157369_100392852 | 205 |
| 713 | 3300013297 | Ga0157378_10034378 | Ga0157378_100343784 | 205 |
| 714 | 3300013306 | Ga0163162_10041570 | Ga0163162_100415703 | 205 |
| 715 | 3300013308 | Ga0157375_10608000 | Ga0157375_106080002 | 205 |
| 716 | 3300014325 | Ga0163163_10240688 | Ga0163163_102406882 | 205 |
| 717 | 3300014745 | Ga0157377_10017538 | Ga0157377_100175382 | 205 |
| 718 | 3300014969 | Ga0157376_10536282 | Ga0157376_105362821 | 205 |
| 719 | 3300025921 | Ga0207652_10232748 | Ga0207652_102327481 | 205 |
| 720 | 3300025931 | Ga0207644_10268536 | Ga0207644_102685361 | 205 |
| 721 | 3300025933 | Ga0207706_10009505 | Ga0207706_100095057 | 205 |
| 722 | 3300025936 | Ga0207670_10317551 | Ga0207670_103175512 | 205 |
| 723 | 3300025937 | Ga0207669_10161037 | Ga0207669_101610373 | 205 |
| 724 | 3300025942 | Ga0207689_10011687 | Ga0207689_100116877 | 205 |
| 725 | 3300025945 | Ga0207679_10026932 | Ga0207679_100269321 | 205 |
| 726 | 3300025949 | Ga0207667_10083849 | Ga0207667_100838493 | 205 |
| 727 | 3300025949 | Ga0207667_10197981 | Ga0207667_101979811 | 205 |
| 728 | 3300025960 | Ga0207651_10291655 | Ga0207651_102916552 | 205 |
| 729 | 3300025972 | Ga0207668_10350783 | Ga0207668_103507831 | 205 |
| 730 | 3300025981 | Ga0207640_10410609 | Ga0207640_104106092 | 205 |
| 731 | 3300026088 | Ga0207641_10093013 | Ga0207641_100930133 | 205 |
| 732 | 3300026116 | Ga0207674_10174613 | Ga0207674_101746132 | 205 |
| 733 | 3300026118 | Ga0207675_100042901 | Ga0207675_1000429011 | 205 |
| 734 | 3300026118 | Ga0207675_100420382 | Ga0207675_1004203822 | 205 |
| 735 | 3300026142 | Ga0207698_10492303 | Ga0207698_104923032 | 205 |
| 736 | 3300028380 | Ga0268265_10405035 | Ga0268265_104050352 | 205 |
| 737 | 3300028381 | Ga0268264_10460701 | Ga0268264_104607012 | 205 |
| 738 | 3300037068 | Ga0373925_0382776 | Ga0373925_0382776_75_734 | 205 |
| 739 | 3300005338 | Ga0068868_100076548 | Ga0068868_1000765481 | 207 |
| 740 | 3300053118 | Ga0500594_0062483 | Ga0500594_0062483_43_729 | 207 |
| 741 | 3300053131 | Ga0500652_076832 | Ga0500652_076832_465_1151 | 207 |
| 742 | 3300014969 | Ga0157376_10037066 | Ga0157376_100370664 | 208 |
| 743 | 3300046514 | Ga0495618_0191190 | Ga0495618_0191190_320_958 | 208 |
| 744 | 3300003203 | JGI25406J46586_10019773 | JGI25406J46586_100197732 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hx7-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9081 | 21 | 223 |
| 6qur-assembly1.cif.gz_A | mapping the allosteric communication network of aminodeoxychorismate synthase | 0.9022 | 23 | 224 |
| 8hx8-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate | 0.9021 | 21 | 224 |
| 8hx7-assembly1.cif.gz_A | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.8942 | 21 | 224 |
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.8928 | 23 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.934 | 23 | 224 | 3.40.50.880 |
| af_Q2FYR8_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9337 | 23 | 224 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9302 | 23 | 224 | 3.40.50.880 |
| af_P9WN35_1_200_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.917 | 22 | 224 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.911 | 23 | 224 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3ZA09-F1-model_v4 | deleted | 0.9768 | 22 | 224 |
|
| AF-A0A7X8JLR0-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9749 | 22 | 124 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A7Y2YPC8-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9744 | 21 | 110 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A4Q3SID1-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9742 | 22 | 125 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A368MXV3-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9733 | 22 | 225 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar