F478722

General Info

Members Datasets Scaffolds Average Seq Length
744 252 741 195

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10019773|JGI25406J46586_100197732
Length 225
Sequence VHDTSVASHSCTEEHNMSNNLRILVFDNYDSFTYNLVHLVEKILHYKVEVYRNDQIPLEKVKEYDKIILSPGPGIPVEAGLLLPLIKEYASSKSILGVCLGHQAIGEAFGGKLVNLSTVYHGVATPVRIVSSESLVLSGANSPLTTHHSRPKLFEGLPEIIEVGRYHSWVVSKENFPEELEITAEDDNGYIMGLQHKTYDVRGVQFHPESVLTPKGEDILRNWLK

Samples

Sample ID Description Type Environment
1 2738541283 Pedobacter sp. OK701 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
155 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
198 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
199 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
200 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
210 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
211 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
212 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
213 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
214 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
215 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
218 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
219 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
222 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
223 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
226 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
227 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
228 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
229 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
230 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
234 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 0.13
Rhizosphere 96.51
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10019773 3300003203 Bacteria 2736
2 rootL2_10134929 3300003322 Bacteria 4501
3 Ga0065704_10260033 3300005289 Bacteria 968
4 Ga0065712_10015823 3300005290 Bacteria 2795
5 Ga0065712_10076829 3300005290 Bacteria 3583
6 Ga0065712_10190799 3300005290 Unclassified 1149
7 Ga0065715_10018814 3300005293 Bacteria 1843
8 Ga0065715_10453070 3300005293 Bacteria 824
9 Ga0070658_10005995 3300005327 Bacteria 9853
10 Ga0070658_10010748 3300005327 Bacteria 7336
11 Ga0070658_10294859 3300005327 Bacteria 1382
12 Ga0070676_10000336 3300005328 Bacteria 21357
13 Ga0070676_10167649 3300005328 Bacteria 1418
14 Ga0070676_10688637 3300005328 Bacteria 745
15 Ga0070683_100008329 3300005329 Bacteria 8809
16 Ga0070683_100042317 3300005329 Bacteria 4194
17 Ga0070690_100083796 3300005330 Bacteria 2089
18 Ga0070670_100066481 3300005331 Bacteria 3094
19 Ga0070670_100082144 3300005331 Bacteria 2769
20 Ga0070670_100086833 3300005331 Bacteria 2688
21 Ga0070670_100097335 3300005331 Bacteria 2531
22 Ga0070670_100111799 3300005331 Bacteria 2354
23 Ga0070670_100174030 3300005331 Bacteria 1868
24 Ga0070670_100259146 3300005331 Unclassified 1516
25 Ga0070670_100446724 3300005331 Bacteria 1145
26 Ga0068869_100039941 3300005334 Bacteria 3352
27 Ga0068869_100043129 3300005334 Bacteria 3238
28 Ga0068869_100069980 3300005334 Bacteria 2595
29 Ga0068869_100070355 3300005334 Bacteria 2588
30 Ga0068869_100072563 3300005334 Bacteria 2550
31 Ga0068869_100102808 3300005334 Bacteria 2164
32 Ga0068869_100167679 3300005334 Bacteria 1713
33 Ga0068869_100454782 3300005334 Bacteria 1062
34 Ga0070666_10000051 3300005335 Bacteria 99740
35 Ga0070666_10010156 3300005335 Bacteria 5881
36 Ga0070666_10010207 3300005335 Bacteria 5868
37 Ga0070666_10013609 3300005335 Bacteria 5165
38 Ga0070666_10082177 3300005335 Bacteria 2203
39 Ga0070682_100026905 3300005337 Bacteria 3446
40 Ga0070682_100165344 3300005337 Bacteria 1532
41 Ga0068868_100016530 3300005338 Bacteria 5482
42 Ga0068868_100042340 3300005338 Bacteria 3553
43 Ga0068868_100048846 3300005338 Bacteria 3320
44 Ga0068868_100076548 3300005338 Bacteria 2675
45 Ga0068868_100080003 3300005338 Bacteria 2618
46 Ga0068868_100421421 3300005338 Bacteria 1156
47 Ga0068868_100729983 3300005338 Bacteria 888
48 Ga0068868_100777718 3300005338 Bacteria 862
49 Ga0070660_100119555 3300005339 Bacteria 2102
50 Ga0070660_100190842 3300005339 Bacteria 1659
51 Ga0070689_100001732 3300005340 Bacteria 13951
52 Ga0070689_100014808 3300005340 Bacteria 5674
53 Ga0070689_100137929 3300005340 Bacteria 1959
54 Ga0070689_100173058 3300005340 Bacteria 1750
55 Ga0070689_100570904 3300005340 Bacteria 977
56 Ga0070689_101163802 3300005340 Bacteria 691
57 Ga0070661_100002702 3300005344 Bacteria 12149
58 Ga0070661_100003143 3300005344 Bacteria 11357
59 Ga0070661_100022549 3300005344 Bacteria 4508
60 Ga0070661_100097142 3300005344 Bacteria 2187
61 Ga0070661_100117915 3300005344 Bacteria 1986
62 Ga0070661_100673780 3300005344 Bacteria 841
63 Ga0070668_100002494 3300005347 Bacteria 13548
64 Ga0070669_100048455 3300005353 Bacteria 3101
65 Ga0070669_100052700 3300005353 Bacteria 2977
66 Ga0070675_100013600 3300005354 Bacteria 6399
67 Ga0070675_100025711 3300005354 Bacteria 4720
68 Ga0070675_100106309 3300005354 Bacteria 2369
69 Ga0070675_100159310 3300005354 Bacteria 1940
70 Ga0070675_100381663 3300005354 Bacteria 1254
71 Ga0070671_100270865 3300005355 Bacteria 1443
72 Ga0070671_100277870 3300005355 Bacteria 1424
73 Ga0070671_100335321 3300005355 Bacteria 1289
74 Ga0070671_100712370 3300005355 Bacteria 871
75 Ga0070674_100171178 3300005356 Bacteria 1656
76 Ga0070674_100816167 3300005356 Bacteria 806
77 Ga0070673_100001990 3300005364 Bacteria 12324
78 Ga0070673_100010151 3300005364 Bacteria 6359
79 Ga0070673_100085256 3300005364 Bacteria 2571
80 Ga0070673_100413714 3300005364 Bacteria 1208
81 Ga0070673_100614313 3300005364 Bacteria 992
82 Ga0070673_101316908 3300005364 Bacteria 679
83 Ga0070688_100008021 3300005365 Bacteria 5714
84 Ga0070688_100097236 3300005365 Bacteria 1935
85 Ga0070659_100024762 3300005366 Bacteria 4603
86 Ga0070667_100000492 3300005367 Bacteria 40164
87 Ga0070667_100001349 3300005367 Bacteria 22023
88 Ga0070667_100047694 3300005367 Bacteria 3604
89 Ga0070667_100089181 3300005367 Bacteria 2649
90 Ga0070667_100115083 3300005367 Bacteria 2335
91 Ga0070667_100263906 3300005367 Bacteria 1543
92 Ga0070667_100530306 3300005367 Bacteria 1081
93 Ga0070667_100557987 3300005367 Bacteria 1053
94 Ga0070700_100288470 3300005441 Bacteria 1193
95 Ga0070700_100632254 3300005441 Unclassified 843
96 Ga0070663_100474002 3300005455 Bacteria 1035
97 Ga0070663_100550253 3300005455 Bacteria 964
98 Ga0070678_100013945 3300005456 Bacteria 5054
99 Ga0070678_100072331 3300005456 Bacteria 2584
100 Ga0070662_100004086 3300005457 Bacteria 9167
101 Ga0070662_100230387 3300005457 Bacteria 1482
102 Ga0070662_100520692 3300005457 Bacteria 994
103 Ga0068867_100050069 3300005459 Bacteria 3077
104 Ga0068867_100099372 3300005459 Bacteria 2220
105 Ga0068867_100409940 3300005459 Bacteria 1145
106 Ga0068867_100898685 3300005459 Bacteria 797
107 Ga0070685_10152592 3300005466 Bacteria 1465
108 Ga0070685_10464825 3300005466 Bacteria 889
109 Ga0070685_10617184 3300005466 Bacteria 782
110 Ga0070679_100045741 3300005530 Bacteria 4361
111 Ga0070679_100062675 3300005530 Bacteria 3707
112 Ga0070679_100108122 3300005530 Unclassified 2767
113 Ga0070684_100021275 3300005535 Bacteria 5394
114 Ga0070684_100060191 3300005535 Bacteria 3321
115 Ga0068853_100000221 3300005539 Bacteria 40294
116 Ga0068853_100008065 3300005539 Bacteria 8446
117 Ga0068853_100020583 3300005539 Bacteria 5487
118 Ga0068853_100057721 3300005539 Bacteria 3350
119 Ga0068853_100093927 3300005539 Unclassified 2641
120 Ga0068853_100317821 3300005539 Bacteria 1443
121 Ga0068853_100808265 3300005539 Bacteria 898
122 Ga0068853_101275444 3300005539 Bacteria 710
123 Ga0070672_100039481 3300005543 Bacteria 3616
124 Ga0070672_100379669 3300005543 Bacteria 1209
125 Ga0070695_100759199 3300005545 Bacteria 774
126 Ga0070693_100045539 3300005547 Bacteria 2487
127 Ga0070665_100000001 3300005548 Bacteria 1083363
128 Ga0070665_100005742 3300005548 Bacteria 12739
129 Ga0070665_100060884 3300005548 Bacteria 3784
130 Ga0070665_101061000 3300005548 Bacteria 822
131 Ga0070704_100554975 3300005549 Unclassified 1004
132 Ga0068855_100075213 3300005563 Bacteria 3922
133 Ga0068855_100174590 3300005563 Bacteria 2432
134 Ga0068855_100204441 3300005563 Bacteria 2222
135 Ga0068855_100396115 3300005563 Bacteria 1514
136 Ga0068855_100539238 3300005563 Bacteria 1264
137 Ga0070664_100003241 3300005564 Bacteria 13152
138 Ga0070664_100050688 3300005564 Bacteria 3514
139 Ga0070664_100070355 3300005564 Bacteria 2996
140 Ga0070664_100164472 3300005564 Bacteria 1965
141 Ga0070664_100189218 3300005564 Bacteria 1833
142 Ga0070664_100223776 3300005564 Bacteria 1684
143 Ga0070664_100226291 3300005564 Bacteria 1675
144 Ga0070664_100283673 3300005564 Bacteria 1494
145 Ga0068857_100007157 3300005577 Bacteria 9611
146 Ga0068857_100021607 3300005577 Bacteria 5663
147 Ga0068857_100323828 3300005577 Bacteria 1424
148 Ga0068857_100481509 3300005577 Bacteria 1163
149 Ga0068857_100667183 3300005577 Bacteria 986
150 Ga0068854_100074699 3300005578 Bacteria 2487
151 Ga0068854_100095714 3300005578 Bacteria 2217
152 Ga0068854_100296132 3300005578 Bacteria 1307
153 Ga0068854_100369934 3300005578 Unclassified 1178
154 Ga0068854_100577392 3300005578 Bacteria 957
155 Ga0068854_100939242 3300005578 Bacteria 762
156 Ga0068856_100021412 3300005614 Bacteria 6285
157 Ga0068856_100073361 3300005614 Bacteria 3389
158 Ga0068852_100002446 3300005616 Bacteria 12784
159 Ga0068852_100018674 3300005616 Bacteria 5466
160 Ga0068852_100023547 3300005616 Bacteria 4958
161 Ga0068852_100041003 3300005616 Bacteria 3910
162 Ga0068852_100069230 3300005616 Bacteria 3092
163 Ga0068852_100158679 3300005616 Bacteria 2110
164 Ga0068852_101761884 3300005616 Bacteria 642
165 Ga0068859_100000023 3300005617 Bacteria 221914
166 Ga0068859_100009853 3300005617 Bacteria 9646
167 Ga0068859_100085184 3300005617 Bacteria 3206
168 Ga0068859_100104665 3300005617 Bacteria 2889
169 Ga0068859_100171254 3300005617 Bacteria 2252
170 Ga0068859_100353882 3300005617 Bacteria 1563
171 Ga0068859_100377129 3300005617 Bacteria 1514
172 Ga0068859_100837033 3300005617 Bacteria 1007
173 Ga0068859_101312257 3300005617 Bacteria 798
174 Ga0068864_100005800 3300005618 Bacteria 10131
175 Ga0068864_100007839 3300005618 Bacteria 8801
176 Ga0068864_100045381 3300005618 Bacteria 3769
177 Ga0068864_100123054 3300005618 Bacteria 2322
178 Ga0068866_10101263 3300005718 Bacteria 1589
179 Ga0068861_100009306 3300005719 Bacteria 6779
180 Ga0068861_100017858 3300005719 Bacteria 5041
181 Ga0068861_100365929 3300005719 Bacteria 1269
182 Ga0068861_100375244 3300005719 Bacteria 1255
183 Ga0068851_10011215 3300005834 Bacteria 4198
184 Ga0068851_10025307 3300005834 Bacteria 2911
185 Ga0068851_10048024 3300005834 Bacteria 2163
186 Ga0068870_10008007 3300005840 Bacteria 4734
187 Ga0068870_10039396 3300005840 Bacteria 2445
188 Ga0068870_10119725 3300005840 Bacteria 1515
189 Ga0068870_10226282 3300005840 Bacteria 1148
190 Ga0068870_10566938 3300005840 Bacteria 767
191 Ga0068863_100001812 3300005841 Bacteria 21216
192 Ga0068863_100038028 3300005841 Bacteria 4579
193 Ga0068863_100038562 3300005841 Bacteria 4545
194 Ga0068863_100093702 3300005841 Bacteria 2850
195 Ga0068863_100538827 3300005841 Bacteria 1152
196 Ga0068858_100030828 3300005842 Bacteria 4981
197 Ga0068858_100048079 3300005842 Bacteria 3954
198 Ga0068858_100105929 3300005842 Bacteria 2624
199 Ga0068858_100246166 3300005842 Bacteria 1697
200 Ga0068858_100246655 3300005842 Bacteria 1696
201 Ga0068858_100521910 3300005842 Bacteria 1148
202 Ga0068860_100000046 3300005843 Bacteria 214800
203 Ga0068860_100000916 3300005843 Bacteria 32698
204 Ga0068860_100007358 3300005843 Bacteria 11008
205 Ga0068860_100025753 3300005843 Bacteria 5674
206 Ga0068860_100034035 3300005843 Bacteria 4887
207 Ga0068860_100168734 3300005843 Bacteria 2113
208 Ga0068860_100642203 3300005843 Bacteria 1069
209 Ga0068860_101010487 3300005843 Bacteria 850
210 Ga0068862_100085090 3300005844 Bacteria 2748
211 Ga0068862_100848336 3300005844 Bacteria 895
212 Ga0068862_100944806 3300005844 Bacteria 850
213 Ga0081539_10000531 3300005985 Bacteria 79191
214 Ga0081539_10179039 3300005985 Bacteria 996
215 Ga0097621_100005409 3300006237 Bacteria 9000
216 Ga0097621_100028478 3300006237 Bacteria 4402
217 Ga0097621_100062269 3300006237 Bacteria 3063
218 Ga0097621_100152415 3300006237 Bacteria 1983
219 Ga0097621_100470061 3300006237 Bacteria 1135
220 Ga0097621_100602606 3300006237 Bacteria 1004
221 Ga0097621_100604977 3300006237 Bacteria 1002
222 Ga0068871_100039645 3300006358 Bacteria 3770
223 Ga0068871_100077547 3300006358 Bacteria 2746
224 Ga0068871_100314977 3300006358 Bacteria 1376
225 Ga0068871_100749459 3300006358 Bacteria 898
226 Ga0075428_100024587 3300006844 Bacteria 6666
227 Ga0075428_100074722 3300006844 Bacteria 3702
228 Ga0075428_100401541 3300006844 Bacteria 1469
229 Ga0075428_100484987 3300006844 Bacteria 1323
230 Ga0075430_100010054 3300006846 Bacteria 8005
231 Ga0075431_100182263 3300006847 Bacteria 2155
232 Ga0075429_100005840 3300006880 Bacteria 10619
233 Ga0075429_100022996 3300006880 Bacteria 5403
234 Ga0075429_100032161 3300006880 Bacteria 4560
235 Ga0075429_100235957 3300006880 Bacteria 1602
236 Ga0068865_100020901 3300006881 Bacteria 4251
237 Ga0068865_100023102 3300006881 Bacteria 4068
238 Ga0068865_100042350 3300006881 Bacteria 3105
239 Ga0068865_100058333 3300006881 Bacteria 2696
240 Ga0068865_100300336 3300006881 Bacteria 1285
241 Ga0068865_100483566 3300006881 Bacteria 1029
242 Ga0097620_100000023 3300006931 Bacteria 221914
243 Ga0097620_100009853 3300006931 Bacteria 9646
244 Ga0097620_100085179 3300006931 Bacteria 3206
245 Ga0097620_100104665 3300006931 Bacteria 2889
246 Ga0097620_100171243 3300006931 Bacteria 2252
247 Ga0097620_100353883 3300006931 Bacteria 1563
248 Ga0097620_100377120 3300006931 Bacteria 1514
249 Ga0097620_100837037 3300006931 Bacteria 1007
250 Ga0097620_101312299 3300006931 Bacteria 798
251 Ga0075435_100795357 3300007076 Bacteria 823
252 Ga0105240_10015708 3300009093 Bacteria 10273
253 Ga0105240_10075581 3300009093 Bacteria 4155
254 Ga0105240_10078410 3300009093 Bacteria 4068
255 Ga0105240_10393330 3300009093 Bacteria 1563
256 Ga0105240_10856083 3300009093 Bacteria 981
257 Ga0111539_10015483 3300009094 Bacteria 9481
258 Ga0111539_10037386 3300009094 Bacteria 5863
259 Ga0111539_10067948 3300009094 Bacteria 4207
260 Ga0111539_10516316 3300009094 Bacteria 1392
261 Ga0111539_10817704 3300009094 Bacteria 1084
262 Ga0105247_10005412 3300009101 Bacteria 8044
263 Ga0105247_10037118 3300009101 Bacteria 2972
264 Ga0105247_10204453 3300009101 Bacteria 1329
265 Ga0114129_10020916 3300009147 Bacteria 9296
266 Ga0114129_10187025 3300009147 Bacteria 2814
267 Ga0114129_10762050 3300009147 Bacteria 1238
268 Ga0105241_10003116 3300009174 Bacteria 12343
269 Ga0105241_10034893 3300009174 Bacteria 3782
270 Ga0105241_10868579 3300009174 Bacteria 835
271 Ga0105241_11012972 3300009174 Bacteria 778
272 Ga0105242_10012454 3300009176 Bacteria 6549
273 Ga0105242_10040286 3300009176 Bacteria 3764
274 Ga0105242_10058423 3300009176 Bacteria 3162
275 Ga0105242_10071155 3300009176 Bacteria 2886
276 Ga0105242_10490816 3300009176 Bacteria 1166
277 Ga0105242_11095849 3300009176 Unclassified 810
278 Ga0105248_10059502 3300009177 Bacteria 4291
279 Ga0105248_10236470 3300009177 Bacteria 2056
280 Ga0105248_10487872 3300009177 Bacteria 1389
281 Ga0105237_10000088 3300009545 Bacteria 124518
282 Ga0105237_10000755 3300009545 Bacteria 44312
283 Ga0105237_10009395 3300009545 Bacteria 10472
284 Ga0105237_10124916 3300009545 Bacteria 2567
285 Ga0105237_10419151 3300009545 Bacteria 1344
286 Ga0105238_10001132 3300009551 Bacteria 26885
287 Ga0105238_10035958 3300009551 Bacteria 5035
288 Ga0105238_10436812 3300009551 Bacteria 1305
289 Ga0105249_10000607 3300009553 Bacteria 32648
290 Ga0105249_10012834 3300009553 Bacteria 7392
291 Ga0105249_10027191 3300009553 Bacteria 5161
292 Ga0105249_10059671 3300009553 Bacteria 3499
293 Ga0105249_10111257 3300009553 Bacteria 2589
294 Ga0105249_10317110 3300009553 Bacteria 1569
295 Ga0105249_10499074 3300009553 Bacteria 1262
296 Ga0105249_11217466 3300009553 Bacteria 824
297 Ga0105239_10053117 3300010375 Bacteria 4445
298 Ga0105239_10088168 3300010375 Bacteria 3421
299 Ga0105239_10217240 3300010375 Bacteria 2143
300 Ga0105239_10219692 3300010375 Bacteria 2131
301 Ga0105239_10328796 3300010375 Bacteria 1724
302 Ga0105239_10421120 3300010375 Bacteria 1513
303 Ga0105246_10237822 3300011119 Bacteria 1438
304 Ga0105246_10317599 3300011119 Bacteria 1264
305 Ga0105246_10364957 3300011119 Bacteria 1188
306 Ga0105246_11082137 3300011119 Bacteria 731
307 Ga0157373_10004820 3300013100 Bacteria 10155
308 Ga0157373_10016186 3300013100 Bacteria 5442
309 Ga0157373_10105335 3300013100 Bacteria 1983
310 Ga0157373_10469408 3300013100 Bacteria 907
311 Ga0157371_10064516 3300013102 Bacteria 2595
312 Ga0157371_10179271 3300013102 Bacteria 1515
313 Ga0157370_10055354 3300013104 Bacteria 3779
314 Ga0157369_10009235 3300013105 Bacteria 11280
315 Ga0157369_10039285 3300013105 Bacteria 5172
316 Ga0157369_10063536 3300013105 Bacteria 3977
317 Ga0157374_10004285 3300013296 Bacteria 11997
318 Ga0157374_10008464 3300013296 Bacteria 8797
319 Ga0157374_10017511 3300013296 Bacteria 6310
320 Ga0157374_10050525 3300013296 Bacteria 3865
321 Ga0157374_10168221 3300013296 Bacteria 2137
322 Ga0157374_10312841 3300013296 Bacteria 1555
323 Ga0157374_10349682 3300013296 Bacteria 1469
324 Ga0157378_10011078 3300013297 Bacteria 7892
325 Ga0157378_10011450 3300013297 Bacteria 7762
326 Ga0157378_10016222 3300013297 Bacteria 6524
327 Ga0157378_10034378 3300013297 Bacteria 4483
328 Ga0157378_10234420 3300013297 Bacteria 1750
329 Ga0157378_10546870 3300013297 Bacteria 1163
330 Ga0157378_10886177 3300013297 Bacteria 922
331 Ga0157378_11647535 3300013297 Bacteria 688
332 Ga0163162_10000331 3300013306 Bacteria 43319
333 Ga0163162_10000967 3300013306 Bacteria 26666
334 Ga0163162_10001657 3300013306 Bacteria 20874
335 Ga0163162_10005839 3300013306 Bacteria 11903
336 Ga0163162_10023196 3300013306 Bacteria 6122
337 Ga0163162_10041570 3300013306 Bacteria 4601
338 Ga0163162_10051850 3300013306 Bacteria 4118
339 Ga0163162_10152015 3300013306 Bacteria 2433
340 Ga0163162_10362438 3300013306 Bacteria 1582
341 Ga0163162_10389701 3300013306 Bacteria 1526
342 Ga0163162_10875028 3300013306 Bacteria 1013
343 Ga0157372_10057945 3300013307 Bacteria 4330
344 Ga0157372_10072860 3300013307 Bacteria 3871
345 Ga0157372_10085260 3300013307 Bacteria 3582
346 Ga0157372_10086814 3300013307 Bacteria 3550
347 Ga0157372_10237683 3300013307 Bacteria 2113
348 Ga0157372_10889853 3300013307 Bacteria 1033
349 Ga0157372_11230511 3300013307 Bacteria 865
350 Ga0157375_10108563 3300013308 Bacteria 2870
351 Ga0157375_10200199 3300013308 Bacteria 2153
352 Ga0157375_10260424 3300013308 Bacteria 1896
353 Ga0157375_10286076 3300013308 Bacteria 1812
354 Ga0157375_10367809 3300013308 Bacteria 1604
355 Ga0157375_10608000 3300013308 Bacteria 1252
356 Ga0157375_10686684 3300013308 Bacteria 1178
357 Ga0157375_11931552 3300013308 Bacteria 701
358 Ga0163163_10000538 3300014325 Bacteria 33542
359 Ga0163163_10000653 3300014325 Bacteria 29691
360 Ga0163163_10005525 3300014325 Bacteria 10945
361 Ga0163163_10170202 3300014325 Bacteria 2225
362 Ga0163163_10195451 3300014325 Bacteria 2071
363 Ga0163163_10237616 3300014325 Bacteria 1871
364 Ga0163163_10240688 3300014325 Bacteria 1859
365 Ga0163163_11244039 3300014325 Bacteria 807
366 Ga0157380_10033396 3300014326 Bacteria 3961
367 Ga0157380_10074259 3300014326 Bacteria 2760
368 Ga0157380_10083353 3300014326 Bacteria 2619
369 Ga0157380_10091846 3300014326 Bacteria 2507
370 Ga0157380_10113725 3300014326 Bacteria 2280
371 Ga0157380_10535593 3300014326 Bacteria 1145
372 Ga0157377_10000932 3300014745 Bacteria 12243
373 Ga0157377_10017538 3300014745 Bacteria 3703
374 Ga0157377_10018348 3300014745 Bacteria 3635
375 Ga0157379_10002723 3300014968 Bacteria 14918
376 Ga0157379_10025305 3300014968 Bacteria 5273
377 Ga0157379_10551241 3300014968 Bacteria 1073
378 Ga0157379_10620243 3300014968 Bacteria 1011
379 Ga0157376_10002682 3300014969 Bacteria 12095
380 Ga0157376_10005888 3300014969 Bacteria 8604
381 Ga0157376_10011043 3300014969 Bacteria 6640
382 Ga0157376_10037066 3300014969 Bacteria 3954
383 Ga0157376_10251467 3300014969 Bacteria 1651
384 Ga0157376_10536282 3300014969 Bacteria 1156
385 Ga0163161_10020165 3300017792 Bacteria 4676
386 Ga0163161_10107559 3300017792 Bacteria 2082
387 Ga0163161_10303496 3300017792 Bacteria 1258
388 Ga0207666_1019755 3300025271 Bacteria 985
389 Ga0207697_10093977 3300025315 Bacteria 1273
390 Ga0207697_10130302 3300025315 Bacteria 1086
391 Ga0207697_10132021 3300025315 Bacteria 1080
392 Ga0207656_10007257 3300025321 Bacteria 4026
393 Ga0207656_10018296 3300025321 Bacteria 2756
394 Ga0207710_10002748 3300025900 Bacteria 8047
395 Ga0207710_10284001 3300025900 Bacteria 833
396 Ga0207688_10383576 3300025901 Bacteria 870
397 Ga0207680_10000162 3300025903 Bacteria 32782
398 Ga0207680_10011575 3300025903 Bacteria 4461
399 Ga0207680_10022369 3300025903 Bacteria 3437
400 Ga0207647_10000288 3300025904 Bacteria 41316
401 Ga0207647_10031048 3300025904 Bacteria 3442
402 Ga0207647_10146594 3300025904 Bacteria 1381
403 Ga0207645_10009564 3300025907 Bacteria 6697
404 Ga0207645_10248999 3300025907 Bacteria 1175
405 Ga0207645_10665467 3300025907 Bacteria 707
406 Ga0207643_10003598 3300025908 Bacteria 8348
407 Ga0207643_10029894 3300025908 Bacteria 3031
408 Ga0207643_10084438 3300025908 Bacteria 1843
409 Ga0207705_10017561 3300025909 Bacteria 5122
410 Ga0207705_10050880 3300025909 Bacteria 2983
411 Ga0207705_10073058 3300025909 Bacteria 2488
412 Ga0207654_10108045 3300025911 Bacteria 1726
413 Ga0207654_10623912 3300025911 Bacteria 771
414 Ga0207695_10000323 3300025913 Bacteria 114265
415 Ga0207695_10020015 3300025913 Bacteria 7681
416 Ga0207695_10023342 3300025913 Bacteria 6992
417 Ga0207695_10275692 3300025913 Bacteria 1576
418 Ga0207671_10001044 3300025914 Bacteria 33679
419 Ga0207671_10002907 3300025914 Bacteria 17690
420 Ga0207671_10003799 3300025914 Bacteria 14813
421 Ga0207671_10084251 3300025914 Bacteria 2387
422 Ga0207660_10013171 3300025917 Bacteria 5416
423 Ga0207662_10012024 3300025918 Bacteria 4813
424 Ga0207662_10341713 3300025918 Bacteria 1003
425 Ga0207657_10010433 3300025919 Bacteria 9272
426 Ga0207657_10259810 3300025919 Bacteria 1382
427 Ga0207649_10009815 3300025920 Bacteria 5245
428 Ga0207649_10070948 3300025920 Bacteria 2223
429 Ga0207649_10250061 3300025920 Bacteria 1276
430 Ga0207649_10356417 3300025920 Bacteria 1084
431 Ga0207652_10157540 3300025921 Bacteria 2034
432 Ga0207652_10232748 3300025921 Bacteria 1661
433 Ga0207652_10473432 3300025921 Bacteria 1128
434 Ga0207681_10042348 3300025923 Bacteria 3041
435 Ga0207681_10109432 3300025923 Bacteria 2007
436 Ga0207681_10110966 3300025923 Bacteria 1995
437 Ga0207681_10126163 3300025923 Bacteria 1885
438 Ga0207681_10723578 3300025923 Bacteria 828
439 Ga0207694_10007231 3300025924 Bacteria 8426
440 Ga0207650_10157728 3300025925 Bacteria 1796
441 Ga0207650_10231947 3300025925 Bacteria 1489
442 Ga0207650_10421948 3300025925 Bacteria 1107
443 Ga0207650_10506709 3300025925 Bacteria 1009
444 Ga0207650_10556236 3300025925 Bacteria 962
445 Ga0207659_10025862 3300025926 Bacteria 3952
446 Ga0207659_10116002 3300025926 Bacteria 2044
447 Ga0207659_10239684 3300025926 Bacteria 1466
448 Ga0207659_10583690 3300025926 Bacteria 952
449 Ga0207659_11075588 3300025926 Bacteria 692
450 Ga0207644_10041454 3300025931 Bacteria 3257
451 Ga0207644_10093954 3300025931 Bacteria 2240
452 Ga0207644_10268536 3300025931 Bacteria 1366
453 Ga0207644_10535329 3300025931 Bacteria 969
454 Ga0207644_10785067 3300025931 Bacteria 796
455 Ga0207690_10004421 3300025932 Bacteria 8296
456 Ga0207690_10121523 3300025932 Bacteria 1898
457 Ga0207706_10006768 3300025933 Bacteria 10596
458 Ga0207706_10009505 3300025933 Bacteria 8928
459 Ga0207706_10060615 3300025933 Bacteria 3332
460 Ga0207706_10095175 3300025933 Bacteria 2620
461 Ga0207706_10450269 3300025933 Bacteria 1113
462 Ga0207686_10003538 3300025934 Bacteria 8377
463 Ga0207686_10083379 3300025934 Bacteria 2092
464 Ga0207686_10108703 3300025934 Bacteria 1866
465 Ga0207686_10359897 3300025934 Bacteria 1098
466 Ga0207670_10158600 3300025936 Bacteria 1686
467 Ga0207670_10179608 3300025936 Bacteria 1593
468 Ga0207670_10249622 3300025936 Bacteria 1371
469 Ga0207670_10317551 3300025936 Bacteria 1225
470 Ga0207669_10161037 3300025937 Bacteria 1585
471 Ga0207669_10313165 3300025937 Bacteria 1198
472 Ga0207669_10363358 3300025937 Bacteria 1122
473 Ga0207704_10017923 3300025938 Bacteria 3684
474 Ga0207704_10032550 3300025938 Bacteria 2952
475 Ga0207704_10033238 3300025938 Bacteria 2930
476 Ga0207704_10063914 3300025938 Bacteria 2297
477 Ga0207704_10090396 3300025938 Bacteria 2009
478 Ga0207704_10694134 3300025938 Bacteria 842
479 Ga0207691_10002527 3300025940 Bacteria 17886
480 Ga0207691_10032248 3300025940 Bacteria 4886
481 Ga0207691_10082409 3300025940 Bacteria 2889
482 Ga0207691_10107984 3300025940 Bacteria 2477
483 Ga0207691_10752318 3300025940 Bacteria 821
484 Ga0207689_10001006 3300025942 Bacteria 27060
485 Ga0207689_10011687 3300025942 Bacteria 7524
486 Ga0207689_10015929 3300025942 Bacteria 6365
487 Ga0207689_10045025 3300025942 Bacteria 3649
488 Ga0207689_10051842 3300025942 Bacteria 3382
489 Ga0207689_10058122 3300025942 Bacteria 3181
490 Ga0207689_10060757 3300025942 Bacteria 3108
491 Ga0207689_10200519 3300025942 Bacteria 1647
492 Ga0207689_10376390 3300025942 Bacteria 1182
493 Ga0207661_10006982 3300025944 Bacteria 8009
494 Ga0207661_10009253 3300025944 Bacteria 7058
495 Ga0207661_10042612 3300025944 Bacteria 3579
496 Ga0207679_10026932 3300025945 Bacteria 3969
497 Ga0207679_10067172 3300025945 Bacteria 2689
498 Ga0207679_10188865 3300025945 Bacteria 1711
499 Ga0207679_10236036 3300025945 Unclassified 1547
500 Ga0207679_10249779 3300025945 Bacteria 1507
501 Ga0207679_10461495 3300025945 Bacteria 1128
502 Ga0207679_10642983 3300025945 Bacteria 959
503 Ga0207667_10083849 3300025949 Bacteria 3300
504 Ga0207667_10197981 3300025949 Bacteria 2061
505 Ga0207667_10427815 3300025949 Bacteria 1347
506 Ga0207667_10831718 3300025949 Bacteria 918
507 Ga0207651_10001099 3300025960 Bacteria 12009
508 Ga0207651_10075842 3300025960 Bacteria 2401
509 Ga0207651_10076768 3300025960 Bacteria 2389
510 Ga0207651_10087618 3300025960 Bacteria 2267
511 Ga0207651_10143507 3300025960 Bacteria 1848
512 Ga0207651_10268235 3300025960 Bacteria 1405
513 Ga0207651_10291655 3300025960 Bacteria 1353
514 Ga0207651_10469765 3300025960 Bacteria 1082
515 Ga0207712_10004495 3300025961 Bacteria 8810
516 Ga0207712_10033754 3300025961 Bacteria 3461
517 Ga0207712_10060416 3300025961 Bacteria 2687
518 Ga0207712_10131927 3300025961 Bacteria 1905
519 Ga0207712_10172872 3300025961 Bacteria 1690
520 Ga0207712_10243039 3300025961 Bacteria 1451
521 Ga0207712_10265368 3300025961 Bacteria 1394
522 Ga0207712_10681437 3300025961 Bacteria 896
523 Ga0207668_10000843 3300025972 Bacteria 18537
524 Ga0207668_10350783 3300025972 Bacteria 1234
525 Ga0207668_10542887 3300025972 Bacteria 1006
526 Ga0207668_10593479 3300025972 Bacteria 964
527 Ga0207640_10317263 3300025981 Bacteria 1239
528 Ga0207640_10410609 3300025981 Bacteria 1105
529 Ga0207640_10877622 3300025981 Bacteria 782
530 Ga0207658_10007260 3300025986 Bacteria 7555
531 Ga0207658_10014240 3300025986 Bacteria 5447
532 Ga0207658_10015834 3300025986 Bacteria 5177
533 Ga0207658_10094747 3300025986 Bacteria 2324
534 Ga0207658_10266122 3300025986 Bacteria 1463
535 Ga0207658_10385801 3300025986 Bacteria 1228
536 Ga0207658_10428469 3300025986 Bacteria 1168
537 Ga0207677_10008700 3300026023 Bacteria 5684
538 Ga0207677_10190599 3300026023 Bacteria 1621
539 Ga0207677_10275415 3300026023 Bacteria 1379
540 Ga0207677_10404649 3300026023 Bacteria 1158
541 Ga0207677_11029291 3300026023 Bacteria 748
542 Ga0207703_10004370 3300026035 Bacteria 11617
543 Ga0207703_10005016 3300026035 Bacteria 10732
544 Ga0207703_10942432 3300026035 Bacteria 827
545 Ga0207703_10974627 3300026035 Bacteria 813
546 Ga0207639_10003645 3300026041 Bacteria 10352
547 Ga0207639_10014405 3300026041 Bacteria 5561
548 Ga0207639_10022108 3300026041 Bacteria 4578
549 Ga0207639_10106484 3300026041 Bacteria 2276
550 Ga0207639_10183268 3300026041 Bacteria 1783
551 Ga0207639_10254627 3300026041 Bacteria 1532
552 Ga0207639_10361586 3300026041 Bacteria 1299
553 Ga0207639_10473485 3300026041 Bacteria 1140
554 Ga0207639_10580071 3300026041 Bacteria 1032
555 Ga0207639_10835455 3300026041 Bacteria 859
556 Ga0207678_10056544 3300026067 Bacteria 3377
557 Ga0207678_10227486 3300026067 Bacteria 1597
558 Ga0207708_10361988 3300026075 Bacteria 1192
559 Ga0207702_10083520 3300026078 Bacteria 2779
560 Ga0207702_10147106 3300026078 Bacteria 2139
561 Ga0207641_10000226 3300026088 Bacteria 72539
562 Ga0207641_10001217 3300026088 Bacteria 25759
563 Ga0207641_10004894 3300026088 Bacteria 11515
564 Ga0207641_10039269 3300026088 Bacteria 3958
565 Ga0207641_10093013 3300026088 Bacteria 2642
566 Ga0207641_10177428 3300026088 Bacteria 1949
567 Ga0207648_10003412 3300026089 Bacteria 16676
568 Ga0207648_10003442 3300026089 Bacteria 16603
569 Ga0207648_10064003 3300026089 Bacteria 3205
570 Ga0207648_10598109 3300026089 Bacteria 1016
571 Ga0207648_11440962 3300026089 Bacteria 647
572 Ga0207676_10006014 3300026095 Bacteria 8558
573 Ga0207676_10009837 3300026095 Bacteria 6802
574 Ga0207676_10022211 3300026095 Bacteria 4665
575 Ga0207676_10154929 3300026095 Unclassified 1978
576 Ga0207676_10180863 3300026095 Bacteria 1846
577 Ga0207676_10221680 3300026095 Bacteria 1685
578 Ga0207676_10406462 3300026095 Bacteria 1274
579 Ga0207676_11111609 3300026095 Bacteria 781
580 Ga0207674_10009363 3300026116 Bacteria 11203
581 Ga0207674_10017713 3300026116 Bacteria 7763
582 Ga0207674_10068485 3300026116 Bacteria 3571
583 Ga0207674_10174613 3300026116 Bacteria 2101
584 Ga0207674_10260707 3300026116 Bacteria 1680
585 Ga0207675_100000124 3300026118 Bacteria 63805
586 Ga0207675_100042901 3300026118 Bacteria 4223
587 Ga0207675_100226570 3300026118 Bacteria 1802
588 Ga0207675_100311867 3300026118 Bacteria 1534
589 Ga0207675_100331231 3300026118 Bacteria 1488
590 Ga0207675_100420382 3300026118 Bacteria 1320
591 Ga0207675_100450664 3300026118 Bacteria 1275
592 Ga0207675_100521626 3300026118 Bacteria 1184
593 Ga0207683_10010911 3300026121 Bacteria 7748
594 Ga0207683_10286707 3300026121 Bacteria 1505
595 Ga0207698_10004520 3300026142 Bacteria 8484
596 Ga0207698_10023926 3300026142 Bacteria 4277
597 Ga0207698_10129774 3300026142 Bacteria 2151
598 Ga0207698_10209554 3300026142 Bacteria 1752
599 Ga0207698_10293318 3300026142 Bacteria 1510
600 Ga0207698_10454905 3300026142 Bacteria 1237
601 Ga0207698_10492303 3300026142 Bacteria 1191
602 Ga0207698_10702823 3300026142 Bacteria 1006
603 Ga0207428_10371677 3300027907 Bacteria 1050
604 Ga0268266_10000049 3300028379 Bacteria 307763
605 Ga0268266_10052240 3300028379 Bacteria 3509
606 Ga0268265_10304887 3300028380 Bacteria 1436
607 Ga0268265_10372668 3300028380 Bacteria 1311
608 Ga0268265_10405035 3300028380 Bacteria 1262
609 Ga0268264_10000041 3300028381 Bacteria 372501
610 Ga0268264_10001720 3300028381 Bacteria 20153
611 Ga0268264_10018061 3300028381 Bacteria 5768
612 Ga0268264_10021208 3300028381 Bacteria 5307
613 Ga0268264_10076166 3300028381 Bacteria 2854
614 Ga0268264_10186553 3300028381 Bacteria 1887
615 Ga0268264_10340194 3300028381 Bacteria 1425
616 Ga0268264_10341671 3300028381 Bacteria 1422
617 Ga0268264_10460701 3300028381 Bacteria 1233
618 Ga0307517_10141504 3300028786 Bacteria 1687
619 Ga0307511_10000042 3300030521 Bacteria 102114
620 Ga0316181_1134347 3300030744 Bacteria 1081
621 Ga0265327_10023894 3300031251 Bacteria 3605
622 Ga0307513_10189486 3300031456 Bacteria 1910
623 Ga0307509_10202995 3300031507 Bacteria 1817
624 Ga0265313_10025091 3300031595 Bacteria 3169
625 Ga0316576_10136585 3300031727 Bacteria 1845
626 Ga0307516_10001558 3300031730 Bacteria 31533
627 Ga0307516_10172302 3300031730 Bacteria 1903
628 Ga0307406_10157134 3300031901 Bacteria 1630
629 Ga0307510_10000091 3300033180 Bacteria 68694
630 Ga0316574_0218021 3300035398 Bacteria 1223
631 Ga0373937_0148271 3300036401 Bacteria 2197
632 Ga0316582_0004909 3300036647 Bacteria 6832
633 Ga0316584_0653165 3300036712 Bacteria 725
634 Ga0373925_0382776 3300037068 Bacteria 1146
635 Ga0451839_0226574 3300041496 Bacteria 1118
636 Ga0451577_0344330 3300042876 Bacteria 1352
637 Ga0451577_0587167 3300042876 Bacteria 1011
638 Ga0466972_0003815 3300044658 Bacteria 7496
639 Ga0453683_0062951 3300044673 Bacteria 2319
640 Ga0453683_0105467 3300044673 Bacteria 1770
641 Ga0453683_0174959 3300044673 Bacteria 1360
642 Ga0466965_0023948 3300044683 Bacteria 2951
643 Ga0453684_0001141 3300044712 Bacteria 82874
644 Ga0453684_0011041 3300044712 Bacteria 15260
645 Ga0453684_0065811 3300044712 Bacteria 4620
646 Ga0453684_0086354 3300044712 Bacteria 3894
647 Ga0453684_0116758 3300044712 Bacteria 3231
648 Ga0453684_0223413 3300044712 Bacteria 2180
649 Ga0466960_0109903 3300044901 Bacteria 1431
650 Ga0451576_0161967 3300045051 Bacteria 2335
651 Ga0466967_0231916 3300045976 Bacteria 1758
652 Ga0495638_0029092 3300046460 Bacteria 3564
653 Ga0495638_0037856 3300046460 Bacteria 3068
654 Ga0495650_0081148 3300046471 Bacteria 1250
655 Ga0495608_0363958 3300046511 Bacteria 888
656 Ga0495618_0191190 3300046514 Bacteria 1298
657 Ga0495628_0277620 3300046516 Bacteria 1245
658 Ga0495648_0003874 3300046524 Bacteria 12979
659 Ga0495586_0089623 3300046535 Bacteria 1698
660 Ga0495597_0160117 3300046542 Bacteria 919
661 Ga0495634_0045371 3300046642 Bacteria 2972
662 Ga0495611_0001116 3300046648 Bacteria 14130
663 Ga0495625_0487995 3300046660 Bacteria 755
664 Ga0495635_0143355 3300046663 Bacteria 1627
665 Ga0495604_0433740 3300047317 Bacteria 861
666 Ga0495672_0025973 3300047320 Bacteria 3743
667 Ga0495672_0031178 3300047320 Bacteria 3331
668 Ga0495672_0092697 3300047320 Bacteria 1656
669 Ga0495680_0077801 3300047322 Bacteria 2512
670 Ga0495687_000001 3300047443 Bacteria 1215582
671 Ga0495675_0177873 3300047444 Bacteria 1304
672 Ga0495686_0000004 3300047472 Bacteria 869019
673 Ga0496110_0105873 3300048913 Bacteria 2524
674 Ga0501290_006192 3300049513 Bacteria 1497
675 Ga0501297_001092 3300049520 Bacteria 2461
676 Ga0501298_004277 3300049521 Bacteria 2244
677 Ga0501300_019512 3300049523 Bacteria 990
678 Ga0501033_0029523 3300049570 Bacteria 4121
679 Ga0501034_0004012 3300049571 Bacteria 16517
680 Ga0501036_0121343 3300049572 Bacteria 2207
681 Ga0501036_0930959 3300049572 Bacteria 713
682 Ga0501037_0007826 3300049573 Bacteria 7827
683 Ga0501037_0058879 3300049573 Bacteria 2803
684 Ga0501038_0033809 3300049574 Bacteria 4500
685 Ga0501043_0015257 3300049579 Bacteria 6018
686 Ga0501043_0069140 3300049579 Bacteria 2774
687 Ga0501046_0409747 3300049580 Bacteria 978
688 Ga0501047_0009183 3300049581 Bacteria 9336
689 Ga0501198_002350 3300049649 Bacteria 2543
690 Ga0501202_000823 3300049652 Bacteria 4687
691 Ga0501207_000761 3300049654 Unclassified 3817
692 Ga0501217_000618 3300049661 Bacteria 5991
693 Ga0501222_004886 3300049662 Bacteria 1820
694 Ga0501224_002993 3300049664 Bacteria 2340
695 Ga0501227_041075 3300049665 Bacteria 1143
696 Ga0501235_005341 3300049669 Bacteria 2794
697 Ga0501243_000451 3300049675 Bacteria 5469
698 Ga0501243_076963 3300049675 Bacteria 643
699 Ga0501251_005468 3300049681 Bacteria 1349
700 Ga0501256_011026 3300049685 Bacteria 868
701 Ga0501257_016382 3300049686 Bacteria 1719
702 Ga0501259_000660 3300049688 Bacteria 5531
703 Ga0501261_002743 3300049690 Bacteria 2165
704 Ga0501221_000044 3300049704 Bacteria 12905
705 Ga0501225_0004470 3300049705 Bacteria 4163
706 Ga0501234_008484 3300049707 Bacteria 1601
707 Ga0501268_029809 3300049765 Bacteria 982
708 Ga0501268_031161 3300049765 Bacteria 966
709 Ga0501270_002824 3300049767 Bacteria 1819
710 Ga0501271_002637 3300049768 Bacteria 1614
711 Ga0501279_004209 3300049775 Bacteria 1888
712 Ga0501280_017470 3300049776 Bacteria 1042
713 Ga0501035_0042854 3300049822 Bacteria 4080
714 Ga0501044_0021863 3300049823 Bacteria 6820
715 Ga0501212_003582 3300049851 Bacteria 1957
716 Ga0501284_00029 3300050005 Bacteria 74818
717 nmdc:mga05p37_285602_c1 3300050507 Bacteria 1966
718 nmdc:mga05p37_5498_c1 3300050507 Bacteria 14884
719 nmdc:mga05p37_930469_c1 3300050507 Bacteria 933
720 nmdc:mga09592_28583_c1 3300050508 Bacteria 4633
721 nmdc:mga09592_763746_c1 3300050508 Bacteria 820
722 nmdc:mga0qj67_96975_c1 3300050509 Bacteria 2374
723 nmdc:mga06r32_277465_c1 3300050510 Bacteria 1663
724 nmdc:mga08y16_1403890_c1 3300050511 Bacteria 661
725 nmdc:mga08y16_23575_c1 3300050511 Bacteria 6500
726 nmdc:mga08y16_466503_c1 3300050511 Bacteria 1286
727 nmdc:mga08y16_65269_c1 3300050511 Bacteria 3800
728 nmdc:mga0n895_347485_c1 3300050512 Bacteria 1502
729 Ga0500578_0000694 3300053086 Bacteria 40191
730 Ga0500578_0397420 3300053086 Bacteria 795
731 Ga0500646_0005658 3300053090 Bacteria 3165
732 Ga0500583_0046978 3300053092 Bacteria 1988
733 Ga0500641_0172941 3300053096 Bacteria 929
734 Ga0500594_0062483 3300053118 Bacteria 1077
735 Ga0500642_0083252 3300053130 Bacteria 1472
736 Ga0500652_076832 3300053131 Bacteria 1388
737 Ga0500588_0166184 3300053146 Bacteria 805
738 Ga0500622_0001463 3300053156 Bacteria 18819
739 Ga0500639_133926 3300053163 Bacteria 1170
740 Ga0500637_0168951 3300053178 Bacteria 1258
741 Ga0500611_000034 3300053727 Bacteria 78957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0344330 Ga0451577_0344330_791_1249 150
2 3300005337 Ga0070682_100165344 Ga0070682_1001653442 167
3 3300049574 Ga0501038_0033809 Ga0501038_0033809_3969_4481 169
4 3300011119 Ga0105246_11082137 Ga0105246_110821371 171
5 3300048913 Ga0496110_0105873 Ga0496110_0105873_1962_2510 175
6 3300026023 Ga0207677_11029291 Ga0207677_110292911 178
7 3300049765 Ga0501268_031161 Ga0501268_031161_287_853 178
8 3300009093 Ga0105240_10078410 Ga0105240_100784103 181
9 3300009174 Ga0105241_11012972 Ga0105241_110129721 181
10 3300005617 Ga0068859_101312257 Ga0068859_1013122571 183
11 3300006931 Ga0097620_101312299 Ga0097620_1013122991 183
12 3300047472 Ga0495686_0000004 Ga0495686_0000004_416172_416726 183
13 3300005841 Ga0068863_100093702 Ga0068863_1000937024 184
14 3300026088 Ga0207641_10001217 Ga0207641_1000121717 184
15 iso_pu_bacteria 2738541283 2738755937 184
16 3300005577 Ga0068857_100481509 Ga0068857_1004815092 185
17 3300009147 Ga0114129_10020916 Ga0114129_100209169 185
18 3300009553 Ga0105249_10499074 Ga0105249_104990741 185
19 3300025961 Ga0207712_10172872 Ga0207712_101728722 185
20 3300050507 nmdc:mga05p37_5498_c1 nmdc:mga05p37_5498_c1_12808_13494 185
21 iso_pu_bacteria 2818991444 2819588779 185
22 3300005578 Ga0068854_100577392 Ga0068854_1005773922 186
23 3300009545 Ga0105237_10000088 Ga0105237_1000008877 186
24 3300003322 rootL2_10134929 rootL2_101349292 187
25 3300005289 Ga0065704_10260033 Ga0065704_102600331 187
26 3300005290 Ga0065712_10015823 Ga0065712_100158232 187
27 3300005328 Ga0070676_10167649 Ga0070676_101676491 187
28 3300005331 Ga0070670_100066481 Ga0070670_1000664812 187
29 3300005331 Ga0070670_100086833 Ga0070670_1000868332 187
30 3300005334 Ga0068869_100102808 Ga0068869_1001028082 187
31 3300005335 Ga0070666_10082177 Ga0070666_100821772 187
32 3300005340 Ga0070689_100014808 Ga0070689_1000148087 187
33 3300005353 Ga0070669_100052700 Ga0070669_1000527002 187
34 3300005354 Ga0070675_100013600 Ga0070675_1000136002 187
35 3300005364 Ga0070673_100010151 Ga0070673_1000101511 187
36 3300005365 Ga0070688_100008021 Ga0070688_1000080214 187
37 3300005459 Ga0068867_100898685 Ga0068867_1008986851 187
38 3300005466 Ga0070685_10152592 Ga0070685_101525922 187
39 3300005539 Ga0068853_100000221 Ga0068853_10000022138 187
40 3300005548 Ga0070665_100000001 Ga0070665_100000001712 187
41 3300005548 Ga0070665_100060884 Ga0070665_1000608842 187
42 3300005564 Ga0070664_100283673 Ga0070664_1002836732 187
43 3300005719 Ga0068861_100009306 Ga0068861_1000093068 187
44 3300005840 Ga0068870_10008007 Ga0068870_100080072 187
45 3300005840 Ga0068870_10119725 Ga0068870_101197252 187
46 3300005843 Ga0068860_100000046 Ga0068860_10000004625 187
47 3300005844 Ga0068862_100848336 Ga0068862_1008483362 187
48 3300006237 Ga0097621_100604977 Ga0097621_1006049772 187
49 3300006880 Ga0075429_100235957 Ga0075429_1002359572 187
50 3300006881 Ga0068865_100483566 Ga0068865_1004835662 187
51 3300009093 Ga0105240_10075581 Ga0105240_100755813 187
52 3300009094 Ga0111539_10015483 Ga0111539_100154838 187
53 3300009176 Ga0105242_10012454 Ga0105242_100124546 187
54 3300009545 Ga0105237_10419151 Ga0105237_104191512 187
55 3300009551 Ga0105238_10035958 Ga0105238_100359583 187
56 3300009553 Ga0105249_10111257 Ga0105249_101112572 187
57 3300010375 Ga0105239_10219692 Ga0105239_102196921 187
58 3300013297 Ga0157378_10546870 Ga0157378_105468702 187
59 3300013297 Ga0157378_10886177 Ga0157378_108861772 187
60 3300013306 Ga0163162_10000331 Ga0163162_100003317 187
61 3300013306 Ga0163162_10051850 Ga0163162_100518504 187
62 3300013307 Ga0157372_10086814 Ga0157372_100868143 187
63 3300014326 Ga0157380_10033396 Ga0157380_100333962 187
64 3300014326 Ga0157380_10113725 Ga0157380_101137252 187
65 3300014745 Ga0157377_10000932 Ga0157377_100009323 187
66 3300025315 Ga0207697_10130302 Ga0207697_101303022 187
67 3300025904 Ga0207647_10146594 Ga0207647_101465942 187
68 3300025907 Ga0207645_10665467 Ga0207645_106654671 187
69 3300025908 Ga0207643_10029894 Ga0207643_100298942 187
70 3300025913 Ga0207695_10000323 Ga0207695_1000032365 187
71 3300025913 Ga0207695_10020015 Ga0207695_1002001510 187
72 3300025914 Ga0207671_10084251 Ga0207671_100842512 187
73 3300025923 Ga0207681_10042348 Ga0207681_100423482 187
74 3300025925 Ga0207650_10231947 Ga0207650_102319472 187
75 3300025936 Ga0207670_10179608 Ga0207670_101796083 187
76 3300025937 Ga0207669_10313165 Ga0207669_103131652 187
77 3300025938 Ga0207704_10694134 Ga0207704_106941341 187
78 3300025942 Ga0207689_10376390 Ga0207689_103763901 187
79 3300025961 Ga0207712_10131927 Ga0207712_101319273 187
80 3300025972 Ga0207668_10593479 Ga0207668_105934792 187
81 3300026035 Ga0207703_10974627 Ga0207703_109746271 187
82 3300026041 Ga0207639_10003645 Ga0207639_100036454 187
83 3300026041 Ga0207639_10580071 Ga0207639_105800712 187
84 3300026089 Ga0207648_11440962 Ga0207648_114409621 187
85 3300026116 Ga0207674_10068485 Ga0207674_100684853 187
86 3300026118 Ga0207675_100000124 Ga0207675_10000012424 187
87 3300027907 Ga0207428_10371677 Ga0207428_103716771 187
88 3300028379 Ga0268266_10000049 Ga0268266_1000004973 187
89 3300028381 Ga0268264_10000041 Ga0268264_10000041302 187
90 3300028786 Ga0307517_10141504 Ga0307517_101415042 187
91 3300031727 Ga0316576_10136585 Ga0316576_101365853 187
92 3300033180 Ga0307510_10000091 Ga0307510_1000009125 187
93 3300035398 Ga0316574_0218021 Ga0316574_0218021_83_670 187
94 3300036647 Ga0316582_0004909 Ga0316582_0004909_876_1463 187
95 3300036712 Ga0316584_0653165 Ga0316584_0653165_32_601 187
96 3300042876 Ga0451577_0587167 Ga0451577_0587167_405_977 187
97 3300044658 Ga0466972_0003815 Ga0466972_0003815_5653_6222 187
98 3300044673 Ga0453683_0062951 Ga0453683_0062951_1705_2274 187
99 3300044673 Ga0453683_0105467 Ga0453683_0105467_661_1230 187
100 3300044683 Ga0466965_0023948 Ga0466965_0023948_850_1416 187
101 3300044712 Ga0453684_0001141 Ga0453684_0001141_5880_6452 187
102 3300044712 Ga0453684_0011041 Ga0453684_0011041_10450_11028 187
103 3300044712 Ga0453684_0065811 Ga0453684_0065811_1485_2057 187
104 3300044712 Ga0453684_0086354 Ga0453684_0086354_2825_3403 187
105 3300044712 Ga0453684_0116758 Ga0453684_0116758_1291_1863 187
106 3300044712 Ga0453684_0223413 Ga0453684_0223413_1549_2118 187
107 3300044901 Ga0466960_0109903 Ga0466960_0109903_106_675 187
108 3300045051 Ga0451576_0161967 Ga0451576_0161967_977_1555 187
109 3300045976 Ga0466967_0231916 Ga0466967_0231916_794_1387 187
110 3300046460 Ga0495638_0037856 Ga0495638_0037856_2327_2896 187
111 3300046524 Ga0495648_0003874 Ga0495648_0003874_10750_11319 187
112 3300046542 Ga0495597_0160117 Ga0495597_0160117_43_612 187
113 3300047443 Ga0495687_000001 Ga0495687_000001_347703_348272 187
114 3300049513 Ga0501290_006192 Ga0501290_006192_251_817 187
115 3300049520 Ga0501297_001092 Ga0501297_001092_396_962 187
116 3300049521 Ga0501298_004277 Ga0501298_004277_980_1546 187
117 3300049523 Ga0501300_019512 Ga0501300_019512_348_914 187
118 3300049649 Ga0501198_002350 Ga0501198_002350_1265_1831 187
119 3300049652 Ga0501202_000823 Ga0501202_000823_3742_4308 187
120 3300049654 Ga0501207_000761 Ga0501207_000761_2787_3353 187
121 3300049661 Ga0501217_000618 Ga0501217_000618_3854_4420 187
122 3300049662 Ga0501222_004886 Ga0501222_004886_221_787 187
123 3300049664 Ga0501224_002993 Ga0501224_002993_925_1491 187
124 3300049665 Ga0501227_041075 Ga0501227_041075_160_726 187
125 3300049669 Ga0501235_005341 Ga0501235_005341_1150_1716 187
126 3300049675 Ga0501243_000451 Ga0501243_000451_2334_2900 187
127 3300049681 Ga0501251_005468 Ga0501251_005468_84_650 187
128 3300049685 Ga0501256_011026 Ga0501256_011026_66_632 187
129 3300049686 Ga0501257_016382 Ga0501257_016382_930_1496 187
130 3300049688 Ga0501259_000660 Ga0501259_000660_3562_4128 187
131 3300049690 Ga0501261_002743 Ga0501261_002743_1512_2078 187
132 3300049704 Ga0501221_000044 Ga0501221_000044_11414_11980 187
133 3300049705 Ga0501225_0004470 Ga0501225_0004470_1154_1720 187
134 3300049707 Ga0501234_008484 Ga0501234_008484_127_693 187
135 3300049765 Ga0501268_029809 Ga0501268_029809_23_589 187
136 3300049767 Ga0501270_002824 Ga0501270_002824_381_947 187
137 3300049768 Ga0501271_002637 Ga0501271_002637_705_1271 187
138 3300049775 Ga0501279_004209 Ga0501279_004209_1284_1850 187
139 3300049776 Ga0501280_017470 Ga0501280_017470_391_957 187
140 3300049851 Ga0501212_003582 Ga0501212_003582_720_1286 187
141 3300050508 nmdc:mga09592_763746_c1 nmdc:mga09592_763746_c1_101_667 187
142 3300050511 nmdc:mga08y16_23575_c1 nmdc:mga08y16_23575_c1_204_770 187
143 3300053092 Ga0500583_0046978 Ga0500583_0046978_1202_1771 187
144 3300053130 Ga0500642_0083252 Ga0500642_0083252_718_1287 187
145 3300053156 Ga0500622_0001463 Ga0500622_0001463_16436_17005 187
146 3300005331 Ga0070670_100174030 Ga0070670_1001740302 188
147 3300005353 Ga0070669_100048455 Ga0070669_1000484553 188
148 3300005441 Ga0070700_100632254 Ga0070700_1006322541 188
149 3300005549 Ga0070704_100554975 Ga0070704_1005549751 188
150 3300005617 Ga0068859_100104665 Ga0068859_1001046653 188
151 3300005844 Ga0068862_100085090 Ga0068862_1000850901 188
152 3300006844 Ga0075428_100024587 Ga0075428_1000245872 188
153 3300006844 Ga0075428_100401541 Ga0075428_1004015412 188
154 3300006846 Ga0075430_100010054 Ga0075430_1000100545 188
155 3300006847 Ga0075431_100182263 Ga0075431_1001822632 188
156 3300006880 Ga0075429_100005840 Ga0075429_1000058409 188
157 3300006880 Ga0075429_100022996 Ga0075429_1000229963 188
158 3300006880 Ga0075429_100032161 Ga0075429_1000321612 188
159 3300006931 Ga0097620_100104665 Ga0097620_1001046653 188
160 3300007076 Ga0075435_100795357 Ga0075435_1007953571 188
161 3300009094 Ga0111539_10067948 Ga0111539_100679484 188
162 3300009147 Ga0114129_10187025 Ga0114129_101870254 188
163 3300009147 Ga0114129_10762050 Ga0114129_107620502 188
164 3300009553 Ga0105249_10000607 Ga0105249_100006072 188
165 3300013100 Ga0157373_10469408 Ga0157373_104694082 188
166 3300014325 Ga0163163_10237616 Ga0163163_102376162 188
167 3300025923 Ga0207681_10110966 Ga0207681_101109662 188
168 3300025925 Ga0207650_10421948 Ga0207650_104219482 188
169 3300025926 Ga0207659_10116002 Ga0207659_101160022 188
170 3300026041 Ga0207639_10014405 Ga0207639_100144052 188
171 3300026095 Ga0207676_10006014 Ga0207676_100060143 188
172 3300026142 Ga0207698_10454905 Ga0207698_104549052 188
173 3300047320 Ga0495672_0031178 Ga0495672_0031178_38_607 188
174 3300047320 Ga0495672_0092697 Ga0495672_0092697_277_846 188
175 3300049570 Ga0501033_0029523 Ga0501033_0029523_2167_2736 188
176 3300049571 Ga0501034_0004012 Ga0501034_0004012_6399_6968 188
177 3300049572 Ga0501036_0121343 Ga0501036_0121343_556_1125 188
178 3300049573 Ga0501037_0007826 Ga0501037_0007826_185_754 188
179 3300049579 Ga0501043_0015257 Ga0501043_0015257_5371_5940 188
180 3300049579 Ga0501043_0069140 Ga0501043_0069140_482_1048 188
181 3300049580 Ga0501046_0409747 Ga0501046_0409747_310_879 188
182 3300049581 Ga0501047_0009183 Ga0501047_0009183_1788_2357 188
183 3300049675 Ga0501243_076963 Ga0501243_076963_47_616 188
184 3300049822 Ga0501035_0042854 Ga0501035_0042854_1963_2532 188
185 3300049823 Ga0501044_0021863 Ga0501044_0021863_2385_2954 188
186 3300050507 nmdc:mga05p37_285602_c1 nmdc:mga05p37_285602_c1_254_823 188
187 3300050508 nmdc:mga09592_28583_c1 nmdc:mga09592_28583_c1_3190_3759 188
188 3300050511 nmdc:mga08y16_1403890_c1 nmdc:mga08y16_1403890_c1_66_635 188
189 3300050511 nmdc:mga08y16_65269_c1 nmdc:mga08y16_65269_c1_2587_3156 188
190 3300053090 Ga0500646_0005658 Ga0500646_0005658_2004_2573 188
191 3300053096 Ga0500641_0172941 Ga0500641_0172941_211_783 188
192 3300053163 Ga0500639_133926 Ga0500639_133926_175_852 188
193 iso_pu_bacteria 2929154850 2929157421 188
194 3300005985 Ga0081539_10000531 Ga0081539_1000053136 189
195 3300009094 Ga0111539_10817704 Ga0111539_108177042 189
196 3300025986 Ga0207658_10385801 Ga0207658_103858012 189
197 3300031456 Ga0307513_10189486 Ga0307513_101894862 189
198 3300050005 Ga0501284_00029 Ga0501284_00029_15410_15982 189
199 3300005344 Ga0070661_100117915 Ga0070661_1001179152 190
200 3300005564 Ga0070664_100164472 Ga0070664_1001644722 190
201 3300005577 Ga0068857_100667183 Ga0068857_1006671831 190
202 3300005616 Ga0068852_100002446 Ga0068852_1000024469 190
203 3300009545 Ga0105237_10009395 Ga0105237_100093953 190
204 3300009551 Ga0105238_10001132 Ga0105238_1000113219 190
205 3300010375 Ga0105239_10217240 Ga0105239_102172401 190
206 3300013105 Ga0157369_10063536 Ga0157369_100635364 190
207 3300013307 Ga0157372_10072860 Ga0157372_100728602 190
208 3300013307 Ga0157372_10085260 Ga0157372_100852605 190
209 3300025904 Ga0207647_10000288 Ga0207647_1000028844 190
210 3300025914 Ga0207671_10002907 Ga0207671_1000290710 190
211 3300025920 Ga0207649_10356417 Ga0207649_103564172 190
212 3300025924 Ga0207694_10007231 Ga0207694_100072315 190
213 3300025932 Ga0207690_10004421 Ga0207690_100044216 190
214 3300025945 Ga0207679_10642983 Ga0207679_106429832 190
215 3300026041 Ga0207639_10361586 Ga0207639_103615862 190
216 3300026142 Ga0207698_10023926 Ga0207698_100239262 190
217 3300030521 Ga0307511_10000042 Ga0307511_1000004277 190
218 3300030744 Ga0316181_1134347 Ga0316181_11343472 190
219 3300031730 Ga0307516_10172302 Ga0307516_101723022 190
220 3300031901 Ga0307406_10157134 Ga0307406_101571341 190
221 3300041496 Ga0451839_0226574 Ga0451839_0226574_302_895 190
222 3300044673 Ga0453683_0174959 Ga0453683_0174959_581_1156 190
223 3300046460 Ga0495638_0029092 Ga0495638_0029092_1731_2306 190
224 3300046660 Ga0495625_0487995 Ga0495625_0487995_151_726 190
225 3300053178 Ga0500637_0168951 Ga0500637_0168951_212_787 190
226 3300005329 Ga0070683_100042317 Ga0070683_1000423172 191
227 3300005344 Ga0070661_100003143 Ga0070661_10000314314 191
228 3300005539 Ga0068853_100020583 Ga0068853_1000205835 191
229 3300005577 Ga0068857_100007157 Ga0068857_1000071579 191
230 3300013100 Ga0157373_10105335 Ga0157373_101053352 191
231 3300025920 Ga0207649_10009815 Ga0207649_100098155 191
232 3300025933 Ga0207706_10450269 Ga0207706_104502692 191
233 3300025944 Ga0207661_10009253 Ga0207661_100092537 191
234 3300026041 Ga0207639_10183268 Ga0207639_101832682 191
235 3300026116 Ga0207674_10009363 Ga0207674_100093635 191
236 3300046511 Ga0495608_0363958 Ga0495608_0363958_78_716 191
237 3300046535 Ga0495586_0089623 Ga0495586_0089623_965_1603 191
238 3300046663 Ga0495635_0143355 Ga0495635_0143355_572_1210 191
239 3300047320 Ga0495672_0025973 Ga0495672_0025973_2957_3544 191
240 3300047444 Ga0495675_0177873 Ga0495675_0177873_222_860 191
241 3300049572 Ga0501036_0930959 Ga0501036_0930959_102_686 191
242 3300049573 Ga0501037_0058879 Ga0501037_0058879_841_1425 191
243 3300005290 Ga0065712_10076829 Ga0065712_100768292 192
244 3300005293 Ga0065715_10018814 Ga0065715_100188142 192
245 3300005293 Ga0065715_10453070 Ga0065715_104530702 192
246 3300005327 Ga0070658_10005995 Ga0070658_100059952 192
247 3300005327 Ga0070658_10010748 Ga0070658_100107485 192
248 3300005327 Ga0070658_10294859 Ga0070658_102948592 192
249 3300005328 Ga0070676_10000336 Ga0070676_100003365 192
250 3300005328 Ga0070676_10688637 Ga0070676_106886371 192
251 3300005331 Ga0070670_100446724 Ga0070670_1004467242 192
252 3300005334 Ga0068869_100069980 Ga0068869_1000699801 192
253 3300005334 Ga0068869_100070355 Ga0068869_1000703552 192
254 3300005334 Ga0068869_100167679 Ga0068869_1001676792 192
255 3300005334 Ga0068869_100454782 Ga0068869_1004547822 192
256 3300005335 Ga0070666_10000051 Ga0070666_1000005121 192
257 3300005335 Ga0070666_10010156 Ga0070666_100101564 192
258 3300005335 Ga0070666_10013609 Ga0070666_100136092 192
259 3300005337 Ga0070682_100026905 Ga0070682_1000269054 192
260 3300005338 Ga0068868_100016530 Ga0068868_1000165304 192
261 3300005338 Ga0068868_100048846 Ga0068868_1000488462 192
262 3300005338 Ga0068868_100080003 Ga0068868_1000800032 192
263 3300005338 Ga0068868_100421421 Ga0068868_1004214211 192
264 3300005338 Ga0068868_100777718 Ga0068868_1007777181 192
265 3300005339 Ga0070660_100119555 Ga0070660_1001195552 192
266 3300005340 Ga0070689_100137929 Ga0070689_1001379292 192
267 3300005340 Ga0070689_100570904 Ga0070689_1005709041 192
268 3300005344 Ga0070661_100673780 Ga0070661_1006737802 192
269 3300005347 Ga0070668_100002494 Ga0070668_1000024943 192
270 3300005354 Ga0070675_100025711 Ga0070675_1000257115 192
271 3300005354 Ga0070675_100159310 Ga0070675_1001593102 192
272 3300005355 Ga0070671_100270865 Ga0070671_1002708652 192
273 3300005355 Ga0070671_100712370 Ga0070671_1007123702 192
274 3300005356 Ga0070674_100816167 Ga0070674_1008161671 192
275 3300005364 Ga0070673_100001990 Ga0070673_1000019904 192
276 3300005364 Ga0070673_100413714 Ga0070673_1004137141 192
277 3300005364 Ga0070673_100614313 Ga0070673_1006143132 192
278 3300005365 Ga0070688_100097236 Ga0070688_1000972362 192
279 3300005367 Ga0070667_100000492 Ga0070667_10000049227 192
280 3300005367 Ga0070667_100001349 Ga0070667_10000134923 192
281 3300005367 Ga0070667_100047694 Ga0070667_1000476942 192
282 3300005367 Ga0070667_100115083 Ga0070667_1001150832 192
283 3300005367 Ga0070667_100530306 Ga0070667_1005303062 192
284 3300005367 Ga0070667_100557987 Ga0070667_1005579872 192
285 3300005455 Ga0070663_100474002 Ga0070663_1004740021 192
286 3300005456 Ga0070678_100072331 Ga0070678_1000723313 192
287 3300005457 Ga0070662_100004086 Ga0070662_1000040864 192
288 3300005457 Ga0070662_100520692 Ga0070662_1005206922 192
289 3300005459 Ga0068867_100099372 Ga0068867_1000993722 192
290 3300005459 Ga0068867_100409940 Ga0068867_1004099402 192
291 3300005466 Ga0070685_10617184 Ga0070685_106171841 192
292 3300005530 Ga0070679_100062675 Ga0070679_1000626754 192
293 3300005530 Ga0070679_100108122 Ga0070679_1001081222 192
294 3300005539 Ga0068853_100008065 Ga0068853_1000080657 192
295 3300005539 Ga0068853_100093927 Ga0068853_1000939272 192
296 3300005539 Ga0068853_100317821 Ga0068853_1003178212 192
297 3300005539 Ga0068853_100808265 Ga0068853_1008082652 192
298 3300005539 Ga0068853_101275444 Ga0068853_1012754441 192
299 3300005543 Ga0070672_100039481 Ga0070672_1000394813 192
300 3300005543 Ga0070672_100379669 Ga0070672_1003796692 192
301 3300005545 Ga0070695_100759199 Ga0070695_1007591991 192
302 3300005548 Ga0070665_100005742 Ga0070665_1000057423 192
303 3300005563 Ga0068855_100075213 Ga0068855_1000752133 192
304 3300005563 Ga0068855_100204441 Ga0068855_1002044412 192
305 3300005563 Ga0068855_100396115 Ga0068855_1003961152 192
306 3300005564 Ga0070664_100223776 Ga0070664_1002237762 192
307 3300005577 Ga0068857_100323828 Ga0068857_1003238282 192
308 3300005578 Ga0068854_100074699 Ga0068854_1000746993 192
309 3300005578 Ga0068854_100296132 Ga0068854_1002961322 192
310 3300005578 Ga0068854_100939242 Ga0068854_1009392421 192
311 3300005614 Ga0068856_100021412 Ga0068856_1000214126 192
312 3300005616 Ga0068852_100023547 Ga0068852_1000235475 192
313 3300005616 Ga0068852_100041003 Ga0068852_1000410032 192
314 3300005616 Ga0068852_100069230 Ga0068852_1000692302 192
315 3300005616 Ga0068852_101761884 Ga0068852_1017618841 192
316 3300005617 Ga0068859_100000023 Ga0068859_100000023229 192
317 3300005617 Ga0068859_100009853 Ga0068859_10000985310 192
318 3300005617 Ga0068859_100085184 Ga0068859_1000851842 192
319 3300005617 Ga0068859_100171254 Ga0068859_1001712543 192
320 3300005617 Ga0068859_100837033 Ga0068859_1008370332 192
321 3300005618 Ga0068864_100005800 Ga0068864_1000058006 192
322 3300005618 Ga0068864_100007839 Ga0068864_1000078392 192
323 3300005718 Ga0068866_10101263 Ga0068866_101012631 192
324 3300005719 Ga0068861_100375244 Ga0068861_1003752442 192
325 3300005834 Ga0068851_10011215 Ga0068851_100112154 192
326 3300005834 Ga0068851_10025307 Ga0068851_100253072 192
327 3300005834 Ga0068851_10048024 Ga0068851_100480242 192
328 3300005840 Ga0068870_10039396 Ga0068870_100393962 192
329 3300005840 Ga0068870_10226282 Ga0068870_102262822 192
330 3300005840 Ga0068870_10566938 Ga0068870_105669382 192
331 3300005841 Ga0068863_100001812 Ga0068863_10000181222 192
332 3300005841 Ga0068863_100038028 Ga0068863_1000380282 192
333 3300005842 Ga0068858_100048079 Ga0068858_1000480794 192
334 3300005842 Ga0068858_100246166 Ga0068858_1002461662 192
335 3300005842 Ga0068858_100246655 Ga0068858_1002466552 192
336 3300005843 Ga0068860_100000916 Ga0068860_10000091631 192
337 3300005843 Ga0068860_100007358 Ga0068860_10000735815 192
338 3300005843 Ga0068860_100025753 Ga0068860_1000257536 192
339 3300005843 Ga0068860_100034035 Ga0068860_1000340352 192
340 3300005843 Ga0068860_101010487 Ga0068860_1010104872 192
341 3300005844 Ga0068862_100944806 Ga0068862_1009448062 192
342 3300006237 Ga0097621_100028478 Ga0097621_1000284784 192
343 3300006237 Ga0097621_100062269 Ga0097621_1000622692 192
344 3300006237 Ga0097621_100152415 Ga0097621_1001524152 192
345 3300006237 Ga0097621_100470061 Ga0097621_1004700612 192
346 3300006358 Ga0068871_100039645 Ga0068871_1000396452 192
347 3300006358 Ga0068871_100077547 Ga0068871_1000775473 192
348 3300006358 Ga0068871_100314977 Ga0068871_1003149772 192
349 3300006358 Ga0068871_100749459 Ga0068871_1007494592 192
350 3300006844 Ga0075428_100074722 Ga0075428_1000747222 192
351 3300006844 Ga0075428_100484987 Ga0075428_1004849872 192
352 3300006881 Ga0068865_100020901 Ga0068865_1000209014 192
353 3300006881 Ga0068865_100023102 Ga0068865_1000231022 192
354 3300006881 Ga0068865_100300336 Ga0068865_1003003362 192
355 3300006931 Ga0097620_100000023 Ga0097620_100000023229 192
356 3300006931 Ga0097620_100009853 Ga0097620_10000985310 192
357 3300006931 Ga0097620_100085179 Ga0097620_1000851794 192
358 3300006931 Ga0097620_100171243 Ga0097620_1001712433 192
359 3300006931 Ga0097620_100837037 Ga0097620_1008370372 192
360 3300009093 Ga0105240_10015708 Ga0105240_100157087 192
361 3300009093 Ga0105240_10393330 Ga0105240_103933302 192
362 3300009094 Ga0111539_10516316 Ga0111539_105163163 192
363 3300009101 Ga0105247_10005412 Ga0105247_100054129 192
364 3300009101 Ga0105247_10037118 Ga0105247_100371183 192
365 3300009174 Ga0105241_10003116 Ga0105241_1000311616 192
366 3300009174 Ga0105241_10034893 Ga0105241_100348935 192
367 3300009176 Ga0105242_10040286 Ga0105242_100402863 192
368 3300009176 Ga0105242_10071155 Ga0105242_100711553 192
369 3300009176 Ga0105242_10490816 Ga0105242_104908162 192
370 3300009177 Ga0105248_10059502 Ga0105248_100595024 192
371 3300009177 Ga0105248_10236470 Ga0105248_102364702 192
372 3300009545 Ga0105237_10000755 Ga0105237_1000075550 192
373 3300009545 Ga0105237_10124916 Ga0105237_101249162 192
374 3300009551 Ga0105238_10436812 Ga0105238_104368122 192
375 3300009553 Ga0105249_10012834 Ga0105249_100128344 192
376 3300009553 Ga0105249_10027191 Ga0105249_100271915 192
377 3300009553 Ga0105249_10059671 Ga0105249_100596713 192
378 3300009553 Ga0105249_11217466 Ga0105249_112174662 192
379 3300010375 Ga0105239_10053117 Ga0105239_100531172 192
380 3300010375 Ga0105239_10088168 Ga0105239_100881683 192
381 3300010375 Ga0105239_10328796 Ga0105239_103287962 192
382 3300011119 Ga0105246_10237822 Ga0105246_102378223 192
383 3300011119 Ga0105246_10364957 Ga0105246_103649572 192
384 3300013100 Ga0157373_10004820 Ga0157373_100048202 192
385 3300013102 Ga0157371_10179271 Ga0157371_101792712 192
386 3300013105 Ga0157369_10009235 Ga0157369_100092352 192
387 3300013296 Ga0157374_10008464 Ga0157374_100084649 192
388 3300013296 Ga0157374_10050525 Ga0157374_100505252 192
389 3300013296 Ga0157374_10312841 Ga0157374_103128412 192
390 3300013296 Ga0157374_10349682 Ga0157374_103496821 192
391 3300013297 Ga0157378_10011078 Ga0157378_100110782 192
392 3300013297 Ga0157378_10011450 Ga0157378_100114503 192
393 3300013297 Ga0157378_10016222 Ga0157378_100162225 192
394 3300013297 Ga0157378_11647535 Ga0157378_116475351 192
395 3300013306 Ga0163162_10000967 Ga0163162_1000096727 192
396 3300013306 Ga0163162_10001657 Ga0163162_1000165720 192
397 3300013306 Ga0163162_10005839 Ga0163162_100058392 192
398 3300013306 Ga0163162_10362438 Ga0163162_103624382 192
399 3300013306 Ga0163162_10875028 Ga0163162_108750282 192
400 3300013307 Ga0157372_10057945 Ga0157372_100579452 192
401 3300013307 Ga0157372_10237683 Ga0157372_102376832 192
402 3300013308 Ga0157375_10108563 Ga0157375_101085634 192
403 3300013308 Ga0157375_10260424 Ga0157375_102604242 192
404 3300013308 Ga0157375_10286076 Ga0157375_102860762 192
405 3300013308 Ga0157375_10367809 Ga0157375_103678092 192
406 3300013308 Ga0157375_10686684 Ga0157375_106866841 192
407 3300013308 Ga0157375_11931552 Ga0157375_119315521 192
408 3300014325 Ga0163163_10000653 Ga0163163_100006539 192
409 3300014325 Ga0163163_10170202 Ga0163163_101702022 192
410 3300014325 Ga0163163_11244039 Ga0163163_112440391 192
411 3300014326 Ga0157380_10083353 Ga0157380_100833532 192
412 3300014745 Ga0157377_10018348 Ga0157377_100183482 192
413 3300014968 Ga0157379_10002723 Ga0157379_1000272315 192
414 3300014968 Ga0157379_10551241 Ga0157379_105512412 192
415 3300014969 Ga0157376_10002682 Ga0157376_1000268215 192
416 3300014969 Ga0157376_10005888 Ga0157376_100058882 192
417 3300014969 Ga0157376_10251467 Ga0157376_102514673 192
418 3300017792 Ga0163161_10107559 Ga0163161_101075592 192
419 3300025271 Ga0207666_1019755 Ga0207666_10197552 192
420 3300025315 Ga0207697_10132021 Ga0207697_101320212 192
421 3300025321 Ga0207656_10007257 Ga0207656_100072572 192
422 3300025321 Ga0207656_10018296 Ga0207656_100182963 192
423 3300025900 Ga0207710_10002748 Ga0207710_100027483 192
424 3300025903 Ga0207680_10000162 Ga0207680_1000016223 192
425 3300025903 Ga0207680_10011575 Ga0207680_100115755 192
426 3300025903 Ga0207680_10022369 Ga0207680_100223691 192
427 3300025907 Ga0207645_10248999 Ga0207645_102489992 192
428 3300025908 Ga0207643_10003598 Ga0207643_100035983 192
429 3300025908 Ga0207643_10084438 Ga0207643_100844381 192
430 3300025909 Ga0207705_10017561 Ga0207705_100175613 192
431 3300025909 Ga0207705_10050880 Ga0207705_100508802 192
432 3300025909 Ga0207705_10073058 Ga0207705_100730583 192
433 3300025911 Ga0207654_10108045 Ga0207654_101080452 192
434 3300025911 Ga0207654_10623912 Ga0207654_106239122 192
435 3300025913 Ga0207695_10023342 Ga0207695_100233426 192
436 3300025913 Ga0207695_10275692 Ga0207695_102756922 192
437 3300025914 Ga0207671_10003799 Ga0207671_100037994 192
438 3300025917 Ga0207660_10013171 Ga0207660_100131713 192
439 3300025918 Ga0207662_10012024 Ga0207662_100120242 192
440 3300025918 Ga0207662_10341713 Ga0207662_103417132 192
441 3300025919 Ga0207657_10010433 Ga0207657_100104332 192
442 3300025921 Ga0207652_10157540 Ga0207652_101575402 192
443 3300025921 Ga0207652_10473432 Ga0207652_104734322 192
444 3300025923 Ga0207681_10109432 Ga0207681_101094323 192
445 3300025923 Ga0207681_10723578 Ga0207681_107235781 192
446 3300025925 Ga0207650_10157728 Ga0207650_101577282 192
447 3300025925 Ga0207650_10556236 Ga0207650_105562361 192
448 3300025926 Ga0207659_10025862 Ga0207659_100258621 192
449 3300025926 Ga0207659_10239684 Ga0207659_102396842 192
450 3300025926 Ga0207659_10583690 Ga0207659_105836902 192
451 3300025931 Ga0207644_10041454 Ga0207644_100414542 192
452 3300025931 Ga0207644_10785067 Ga0207644_107850671 192
453 3300025933 Ga0207706_10006768 Ga0207706_1000676811 192
454 3300025933 Ga0207706_10095175 Ga0207706_100951753 192
455 3300025934 Ga0207686_10003538 Ga0207686_100035386 192
456 3300025934 Ga0207686_10083379 Ga0207686_100833792 192
457 3300025934 Ga0207686_10108703 Ga0207686_101087032 192
458 3300025934 Ga0207686_10359897 Ga0207686_103598972 192
459 3300025936 Ga0207670_10249622 Ga0207670_102496222 192
460 3300025937 Ga0207669_10363358 Ga0207669_103633582 192
461 3300025938 Ga0207704_10033238 Ga0207704_100332382 192
462 3300025938 Ga0207704_10063914 Ga0207704_100639142 192
463 3300025938 Ga0207704_10090396 Ga0207704_100903962 192
464 3300025940 Ga0207691_10002527 Ga0207691_100025273 192
465 3300025940 Ga0207691_10082409 Ga0207691_100824092 192
466 3300025940 Ga0207691_10107984 Ga0207691_101079842 192
467 3300025940 Ga0207691_10752318 Ga0207691_107523181 192
468 3300025942 Ga0207689_10001006 Ga0207689_100010062 192
469 3300025942 Ga0207689_10060757 Ga0207689_100607572 192
470 3300025942 Ga0207689_10200519 Ga0207689_102005192 192
471 3300025949 Ga0207667_10427815 Ga0207667_104278152 192
472 3300025949 Ga0207667_10831718 Ga0207667_108317182 192
473 3300025960 Ga0207651_10001099 Ga0207651_100010994 192
474 3300025960 Ga0207651_10075842 Ga0207651_100758422 192
475 3300025960 Ga0207651_10076768 Ga0207651_100767682 192
476 3300025960 Ga0207651_10268235 Ga0207651_102682352 192
477 3300025960 Ga0207651_10469765 Ga0207651_104697651 192
478 3300025961 Ga0207712_10004495 Ga0207712_1000449512 192
479 3300025961 Ga0207712_10033754 Ga0207712_100337543 192
480 3300025961 Ga0207712_10060416 Ga0207712_100604162 192
481 3300025961 Ga0207712_10243039 Ga0207712_102430391 192
482 3300025961 Ga0207712_10265368 Ga0207712_102653682 192
483 3300025972 Ga0207668_10000843 Ga0207668_100008433 192
484 3300025972 Ga0207668_10542887 Ga0207668_105428873 192
485 3300025981 Ga0207640_10317263 Ga0207640_103172631 192
486 3300025981 Ga0207640_10877622 Ga0207640_108776221 192
487 3300025986 Ga0207658_10007260 Ga0207658_1000726010 192
488 3300025986 Ga0207658_10015834 Ga0207658_100158343 192
489 3300025986 Ga0207658_10266122 Ga0207658_102661222 192
490 3300026023 Ga0207677_10190599 Ga0207677_101905992 192
491 3300026023 Ga0207677_10275415 Ga0207677_102754151 192
492 3300026035 Ga0207703_10004370 Ga0207703_1000437013 192
493 3300026035 Ga0207703_10005016 Ga0207703_100050162 192
494 3300026041 Ga0207639_10022108 Ga0207639_100221082 192
495 3300026041 Ga0207639_10106484 Ga0207639_101064842 192
496 3300026041 Ga0207639_10254627 Ga0207639_102546272 192
497 3300026041 Ga0207639_10473485 Ga0207639_104734851 192
498 3300026041 Ga0207639_10835455 Ga0207639_108354552 192
499 3300026078 Ga0207702_10083520 Ga0207702_100835202 192
500 3300026078 Ga0207702_10147106 Ga0207702_101471062 192
501 3300026088 Ga0207641_10000226 Ga0207641_1000022652 192
502 3300026088 Ga0207641_10004894 Ga0207641_1000489413 192
503 3300026088 Ga0207641_10039269 Ga0207641_100392694 192
504 3300026089 Ga0207648_10003442 Ga0207648_1000344214 192
505 3300026089 Ga0207648_10064003 Ga0207648_100640033 192
506 3300026095 Ga0207676_10009837 Ga0207676_100098375 192
507 3300026095 Ga0207676_10022211 Ga0207676_100222116 192
508 3300026095 Ga0207676_10180863 Ga0207676_101808632 192
509 3300026116 Ga0207674_10260707 Ga0207674_102607072 192
510 3300026118 Ga0207675_100311867 Ga0207675_1003118672 192
511 3300026118 Ga0207675_100331231 Ga0207675_1003312312 192
512 3300026118 Ga0207675_100521626 Ga0207675_1005216262 192
513 3300026121 Ga0207683_10010911 Ga0207683_100109114 192
514 3300026121 Ga0207683_10286707 Ga0207683_102867072 192
515 3300026142 Ga0207698_10004520 Ga0207698_100045209 192
516 3300026142 Ga0207698_10129774 Ga0207698_101297742 192
517 3300026142 Ga0207698_10209554 Ga0207698_102095542 192
518 3300026142 Ga0207698_10702823 Ga0207698_107028232 192
519 3300028379 Ga0268266_10052240 Ga0268266_100522404 192
520 3300028380 Ga0268265_10304887 Ga0268265_103048872 192
521 3300028381 Ga0268264_10001720 Ga0268264_100017204 192
522 3300028381 Ga0268264_10018061 Ga0268264_100180613 192
523 3300028381 Ga0268264_10021208 Ga0268264_100212086 192
524 3300028381 Ga0268264_10076166 Ga0268264_100761661 192
525 3300028381 Ga0268264_10186553 Ga0268264_101865532 192
526 3300028381 Ga0268264_10340194 Ga0268264_103401942 192
527 3300031507 Ga0307509_10202995 Ga0307509_102029952 192
528 3300046648 Ga0495611_0001116 Ga0495611_0001116_4099_4680 192
529 3300050509 nmdc:mga0qj67_96975_c1 nmdc:mga0qj67_96975_c1_997_1596 192
530 3300050510 nmdc:mga06r32_277465_c1 nmdc:mga06r32_277465_c1_468_1067 192
531 3300050511 nmdc:mga08y16_466503_c1 nmdc:mga08y16_466503_c1_23_619 192
532 3300053146 Ga0500588_0166184 Ga0500588_0166184_63_644 192
533 3300005459 Ga0068867_100050069 Ga0068867_1000500692 193
534 3300006881 Ga0068865_100058333 Ga0068865_1000583332 193
535 3300009176 Ga0105242_10058423 Ga0105242_100584233 193
536 3300014325 Ga0163163_10195451 Ga0163163_101954512 193
537 3300014326 Ga0157380_10091846 Ga0157380_100918462 193
538 3300025938 Ga0207704_10017923 Ga0207704_100179232 193
539 3300026089 Ga0207648_10003412 Ga0207648_100034123 193
540 3300026095 Ga0207676_10406462 Ga0207676_104064622 193
541 3300026118 Ga0207675_100226570 Ga0207675_1002265702 193
542 3300005843 Ga0068860_100642203 Ga0068860_1006422032 195
543 3300009101 Ga0105247_10204453 Ga0105247_102044532 195
544 3300025900 Ga0207710_10284001 Ga0207710_102840012 195
545 3300025914 Ga0207671_10001044 Ga0207671_100010442 195
546 3300036401 Ga0373937_0148271 Ga0373937_0148271_125_784 195
547 3300046516 Ga0495628_0277620 Ga0495628_0277620_223_882 195
548 3300046642 Ga0495634_0045371 Ga0495634_0045371_2278_2937 195
549 3300047317 Ga0495604_0433740 Ga0495604_0433740_28_687 195
550 3300047322 Ga0495680_0077801 Ga0495680_0077801_103_762 195
551 3300053086 Ga0500578_0000694 Ga0500578_0000694_2253_2921 195
552 3300014326 Ga0157380_10074259 Ga0157380_100742593 196
553 3300025942 Ga0207689_10051842 Ga0207689_100518425 196
554 3300050507 nmdc:mga05p37_930469_c1 nmdc:mga05p37_930469_c1_26_619 196
555 3300005331 Ga0070670_100097335 Ga0070670_1000973353 197
556 3300009553 Ga0105249_10317110 Ga0105249_103171102 197
557 3300011119 Ga0105246_10317599 Ga0105246_103175992 197
558 3300013296 Ga0157374_10004285 Ga0157374_100042859 197
559 3300013306 Ga0163162_10152015 Ga0163162_101520153 197
560 3300013307 Ga0157372_10889853 Ga0157372_108898532 197
561 3300014325 Ga0163163_10000538 Ga0163163_1000053824 197
562 3300031730 Ga0307516_10001558 Ga0307516_100015584 197
563 3300053727 Ga0500611_000034 Ga0500611_000034_11424_12023 197
564 3300005331 Ga0070670_100082144 Ga0070670_1000821444 199
565 3300005334 Ga0068869_100043129 Ga0068869_1000431291 200
566 3300005338 Ga0068868_100042340 Ga0068868_1000423404 200
567 3300005344 Ga0070661_100002702 Ga0070661_1000027028 200
568 3300005354 Ga0070675_100381663 Ga0070675_1003816632 200
569 3300005455 Ga0070663_100550253 Ga0070663_1005502531 200
570 3300005535 Ga0070684_100060191 Ga0070684_1000601914 200
571 3300005548 Ga0070665_101061000 Ga0070665_1010610001 200
572 3300005564 Ga0070664_100189218 Ga0070664_1001892182 200
573 3300005617 Ga0068859_100353882 Ga0068859_1003538822 200
574 3300005618 Ga0068864_100045381 Ga0068864_1000453813 200
575 3300005842 Ga0068858_100105929 Ga0068858_1001059292 200
576 3300005843 Ga0068860_100168734 Ga0068860_1001687341 200
577 3300005985 Ga0081539_10179039 Ga0081539_101790391 200
578 3300006881 Ga0068865_100042350 Ga0068865_1000423502 200
579 3300006931 Ga0097620_100353883 Ga0097620_1003538832 200
580 3300014326 Ga0157380_10535593 Ga0157380_105355931 200
581 3300025315 Ga0207697_10093977 Ga0207697_100939772 200
582 3300025919 Ga0207657_10259810 Ga0207657_102598102 200
583 3300025920 Ga0207649_10070948 Ga0207649_100709482 200
584 3300025926 Ga0207659_11075588 Ga0207659_110755881 200
585 3300025931 Ga0207644_10535329 Ga0207644_105353292 200
586 3300025936 Ga0207670_10158600 Ga0207670_101586002 200
587 3300025938 Ga0207704_10032550 Ga0207704_100325503 200
588 3300025940 Ga0207691_10032248 Ga0207691_100322482 200
589 3300025942 Ga0207689_10015929 Ga0207689_100159294 200
590 3300025944 Ga0207661_10006982 Ga0207661_100069826 200
591 3300025945 Ga0207679_10249779 Ga0207679_102497791 200
592 3300025961 Ga0207712_10681437 Ga0207712_106814371 200
593 3300025986 Ga0207658_10428469 Ga0207658_104284692 200
594 3300026067 Ga0207678_10056544 Ga0207678_100565443 200
595 3300026075 Ga0207708_10361988 Ga0207708_103619882 200
596 3300026088 Ga0207641_10177428 Ga0207641_101774282 200
597 3300026089 Ga0207648_10598109 Ga0207648_105981092 200
598 3300026095 Ga0207676_11111609 Ga0207676_111116091 200
599 3300026116 Ga0207674_10017713 Ga0207674_100177137 200
600 3300026142 Ga0207698_10293318 Ga0207698_102933182 200
601 3300028381 Ga0268264_10341671 Ga0268264_103416712 200
602 3300053086 Ga0500578_0397420 Ga0500578_0397420_85_762 200
603 3300031251 Ga0265327_10023894 Ga0265327_100238942 201
604 3300005616 Ga0068852_100018674 Ga0068852_1000186746 202
605 3300005842 Ga0068858_100521910 Ga0068858_1005219101 202
606 3300010375 Ga0105239_10421120 Ga0105239_104211202 202
607 3300014968 Ga0157379_10620243 Ga0157379_106202432 202
608 3300017792 Ga0163161_10303496 Ga0163161_103034962 202
609 3300025942 Ga0207689_10045025 Ga0207689_100450253 202
610 3300026035 Ga0207703_10942432 Ga0207703_109424321 202
611 3300026095 Ga0207676_10154929 Ga0207676_101549292 202
612 3300005331 Ga0070670_100111799 Ga0070670_1001117992 203
613 3300005334 Ga0068869_100039941 Ga0068869_1000399412 203
614 3300005340 Ga0070689_101163802 Ga0070689_1011638021 203
615 3300005344 Ga0070661_100097142 Ga0070661_1000971422 203
616 3300005355 Ga0070671_100335321 Ga0070671_1003353212 203
617 3300005364 Ga0070673_100085256 Ga0070673_1000852562 203
618 3300005364 Ga0070673_101316908 Ga0070673_1013169081 203
619 3300005564 Ga0070664_100070355 Ga0070664_1000703552 203
620 3300005564 Ga0070664_100226291 Ga0070664_1002262912 203
621 3300005617 Ga0068859_100377129 Ga0068859_1003771292 203
622 3300005618 Ga0068864_100123054 Ga0068864_1001230542 203
623 3300005719 Ga0068861_100365929 Ga0068861_1003659292 203
624 3300005841 Ga0068863_100538827 Ga0068863_1005388271 203
625 3300006931 Ga0097620_100377120 Ga0097620_1003771202 203
626 3300009177 Ga0105248_10487872 Ga0105248_104878722 203
627 3300013296 Ga0157374_10017511 Ga0157374_100175116 203
628 3300013296 Ga0157374_10168221 Ga0157374_101682213 203
629 3300013306 Ga0163162_10023196 Ga0163162_100231965 203
630 3300013307 Ga0157372_11230511 Ga0157372_112305112 203
631 3300013308 Ga0157375_10200199 Ga0157375_102001992 203
632 3300014325 Ga0163163_10005525 Ga0163163_100055255 203
633 3300014968 Ga0157379_10025305 Ga0157379_100253055 203
634 3300017792 Ga0163161_10020165 Ga0163161_100201652 203
635 3300025901 Ga0207688_10383576 Ga0207688_103835762 203
636 3300025907 Ga0207645_10009564 Ga0207645_100095646 203
637 3300025920 Ga0207649_10250061 Ga0207649_102500612 203
638 3300025923 Ga0207681_10126163 Ga0207681_101261632 203
639 3300025925 Ga0207650_10506709 Ga0207650_105067092 203
640 3300025931 Ga0207644_10093954 Ga0207644_100939541 203
641 3300025933 Ga0207706_10060615 Ga0207706_100606152 203
642 3300025942 Ga0207689_10058122 Ga0207689_100581221 203
643 3300025944 Ga0207661_10042612 Ga0207661_100426124 203
644 3300025945 Ga0207679_10067172 Ga0207679_100671722 203
645 3300025945 Ga0207679_10188865 Ga0207679_101888652 203
646 3300025960 Ga0207651_10087618 Ga0207651_100876182 203
647 3300025960 Ga0207651_10143507 Ga0207651_101435072 203
648 3300026023 Ga0207677_10008700 Ga0207677_100087005 203
649 3300026023 Ga0207677_10404649 Ga0207677_104046492 203
650 3300026095 Ga0207676_10221680 Ga0207676_102216803 203
651 3300026118 Ga0207675_100450664 Ga0207675_1004506642 203
652 3300031595 Ga0265313_10025091 Ga0265313_100250912 203
653 3300046471 Ga0495650_0081148 Ga0495650_0081148_114_728 203
654 3300005290 Ga0065712_10190799 Ga0065712_101907992 204
655 3300005331 Ga0070670_100259146 Ga0070670_1002591462 204
656 3300005334 Ga0068869_100072563 Ga0068869_1000725632 204
657 3300005335 Ga0070666_10010207 Ga0070666_100102072 204
658 3300005338 Ga0068868_100729983 Ga0068868_1007299832 204
659 3300005340 Ga0070689_100001732 Ga0070689_10000173215 204
660 3300005355 Ga0070671_100277870 Ga0070671_1002778702 204
661 3300005367 Ga0070667_100089181 Ga0070667_1000891812 204
662 3300005367 Ga0070667_100263906 Ga0070667_1002639062 204
663 3300005441 Ga0070700_100288470 Ga0070700_1002884702 204
664 3300005456 Ga0070678_100013945 Ga0070678_1000139458 204
665 3300005466 Ga0070685_10464825 Ga0070685_104648251 204
666 3300005563 Ga0068855_100539238 Ga0068855_1005392382 204
667 3300005564 Ga0070664_100050688 Ga0070664_1000506883 204
668 3300005578 Ga0068854_100369934 Ga0068854_1003699342 204
669 3300005842 Ga0068858_100030828 Ga0068858_1000308284 204
670 3300006237 Ga0097621_100602606 Ga0097621_1006026061 204
671 3300009093 Ga0105240_10856083 Ga0105240_108560832 204
672 3300009174 Ga0105241_10868579 Ga0105241_108685792 204
673 3300009176 Ga0105242_11095849 Ga0105242_110958491 204
674 3300013297 Ga0157378_10234420 Ga0157378_102344203 204
675 3300013306 Ga0163162_10389701 Ga0163162_103897011 204
676 3300014969 Ga0157376_10011043 Ga0157376_100110434 204
677 3300025904 Ga0207647_10031048 Ga0207647_100310484 204
678 3300025932 Ga0207690_10121523 Ga0207690_101215232 204
679 3300025945 Ga0207679_10236036 Ga0207679_102360362 204
680 3300025945 Ga0207679_10461495 Ga0207679_104614952 204
681 3300025986 Ga0207658_10014240 Ga0207658_100142406 204
682 3300025986 Ga0207658_10094747 Ga0207658_100947472 204
683 3300026067 Ga0207678_10227486 Ga0207678_102274861 204
684 3300028380 Ga0268265_10372668 Ga0268265_103726682 204
685 3300050512 nmdc:mga0n895_347485_c1 nmdc:mga0n895_347485_c1_34_654 204
686 3300005329 Ga0070683_100008329 Ga0070683_1000083298 205
687 3300005330 Ga0070690_100083796 Ga0070690_1000837962 205
688 3300005339 Ga0070660_100190842 Ga0070660_1001908421 205
689 3300005340 Ga0070689_100173058 Ga0070689_1001730581 205
690 3300005344 Ga0070661_100022549 Ga0070661_1000225492 205
691 3300005354 Ga0070675_100106309 Ga0070675_1001063092 205
692 3300005356 Ga0070674_100171178 Ga0070674_1001711783 205
693 3300005366 Ga0070659_100024762 Ga0070659_1000247622 205
694 3300005457 Ga0070662_100230387 Ga0070662_1002303872 205
695 3300005530 Ga0070679_100045741 Ga0070679_1000457413 205
696 3300005535 Ga0070684_100021275 Ga0070684_1000212753 205
697 3300005539 Ga0068853_100057721 Ga0068853_1000577213 205
698 3300005547 Ga0070693_100045539 Ga0070693_1000455392 205
699 3300005563 Ga0068855_100174590 Ga0068855_1001745902 205
700 3300005564 Ga0070664_100003241 Ga0070664_1000032415 205
701 3300005577 Ga0068857_100021607 Ga0068857_1000216076 205
702 3300005578 Ga0068854_100095714 Ga0068854_1000957142 205
703 3300005614 Ga0068856_100073361 Ga0068856_1000733613 205
704 3300005616 Ga0068852_100158679 Ga0068852_1001586792 205
705 3300005719 Ga0068861_100017858 Ga0068861_1000178584 205
706 3300005841 Ga0068863_100038562 Ga0068863_1000385623 205
707 3300006237 Ga0097621_100005409 Ga0097621_1000054092 205
708 3300009094 Ga0111539_10037386 Ga0111539_100373865 205
709 3300013100 Ga0157373_10016186 Ga0157373_100161862 205
710 3300013102 Ga0157371_10064516 Ga0157371_100645162 205
711 3300013104 Ga0157370_10055354 Ga0157370_100553542 205
712 3300013105 Ga0157369_10039285 Ga0157369_100392852 205
713 3300013297 Ga0157378_10034378 Ga0157378_100343784 205
714 3300013306 Ga0163162_10041570 Ga0163162_100415703 205
715 3300013308 Ga0157375_10608000 Ga0157375_106080002 205
716 3300014325 Ga0163163_10240688 Ga0163163_102406882 205
717 3300014745 Ga0157377_10017538 Ga0157377_100175382 205
718 3300014969 Ga0157376_10536282 Ga0157376_105362821 205
719 3300025921 Ga0207652_10232748 Ga0207652_102327481 205
720 3300025931 Ga0207644_10268536 Ga0207644_102685361 205
721 3300025933 Ga0207706_10009505 Ga0207706_100095057 205
722 3300025936 Ga0207670_10317551 Ga0207670_103175512 205
723 3300025937 Ga0207669_10161037 Ga0207669_101610373 205
724 3300025942 Ga0207689_10011687 Ga0207689_100116877 205
725 3300025945 Ga0207679_10026932 Ga0207679_100269321 205
726 3300025949 Ga0207667_10083849 Ga0207667_100838493 205
727 3300025949 Ga0207667_10197981 Ga0207667_101979811 205
728 3300025960 Ga0207651_10291655 Ga0207651_102916552 205
729 3300025972 Ga0207668_10350783 Ga0207668_103507831 205
730 3300025981 Ga0207640_10410609 Ga0207640_104106092 205
731 3300026088 Ga0207641_10093013 Ga0207641_100930133 205
732 3300026116 Ga0207674_10174613 Ga0207674_101746132 205
733 3300026118 Ga0207675_100042901 Ga0207675_1000429011 205
734 3300026118 Ga0207675_100420382 Ga0207675_1004203822 205
735 3300026142 Ga0207698_10492303 Ga0207698_104923032 205
736 3300028380 Ga0268265_10405035 Ga0268265_104050352 205
737 3300028381 Ga0268264_10460701 Ga0268264_104607012 205
738 3300037068 Ga0373925_0382776 Ga0373925_0382776_75_734 205
739 3300005338 Ga0068868_100076548 Ga0068868_1000765481 207
740 3300053118 Ga0500594_0062483 Ga0500594_0062483_43_729 207
741 3300053131 Ga0500652_076832 Ga0500652_076832_465_1151 207
742 3300014969 Ga0157376_10037066 Ga0157376_100370664 208
743 3300046514 Ga0495618_0191190 Ga0495618_0191190_320_958 208
744 3300003203 JGI25406J46586_10019773 JGI25406J46586_100197732 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

24

225

0.87

PF07722

Peptidase_C26

Peptidase C26

81

209

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9081 21 223
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9022 23 224
8hx8-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate 0.9021 21 224
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.8942 21 224
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.8928 23 225
ID Description Score Start End Superfamily
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.934 23 224 3.40.50.880
af_Q2FYR8_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9337 23 224 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9302 23 224 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.917 22 224 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.911 23 224 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1Q3ZA09-F1-model_v4 deleted 0.9768 22 224
AF-A0A7X8JLR0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9749 22 124 GO:0000162
GO:0004049
GO:0005829
AF-A0A7Y2YPC8-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9744 21 110 GO:0000162
GO:0004049
GO:0005829
AF-A0A4Q3SID1-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9742 22 125 GO:0000162
GO:0004049
GO:0005829
AF-A0A368MXV3-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9733 22 225 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Feature Viewer

pLDDT pTM Quality
85.18 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map