F478735

General Info

Members Datasets Scaffolds Average Seq Length
744 240 744 215

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10143429|Ga0105242_101434293
Length 243
Sequence MAPALPQWRTTVEPGRAPVHLVADRRPVIASLRGKLRRKLEDRVVVEAAGVGYEVFVPPVTQQELVHAKAADGDAADEVALEIHYHATQNQPKPVLIGFTSELDREFFEKLITVKDVGPMVAARSLAAPVGEIAAAIARQDEGYLRRLPGIGPQKAKNIVAQLQAKVAKFALAKGDTASPEPAAVVAPDEEALRGMVFDILVKQLGYRPSEAAPIIGAALTRRPGVTTPEELLDEIYRGGRKG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 99.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10028175 3300003203 Bacteria 2143
2 Ga0070676_10000920 3300005328 Bacteria 14563
3 Ga0070690_100110993 3300005330 Bacteria 1830
4 Ga0070670_100056748 3300005331 Bacteria 3361
5 Ga0068869_100006522 3300005334 Bacteria 7407
6 Ga0068869_100012050 3300005334 Bacteria 5697
7 Ga0068869_100100593 3300005334 Bacteria 2186
8 Ga0068869_100752900 3300005334 Bacteria 834
9 Ga0070680_100004576 3300005336 Bacteria 10399
10 Ga0070680_100072211 3300005336 Bacteria 2837
11 Ga0070680_100184864 3300005336 Bacteria 1755
12 Ga0070682_100005442 3300005337 Bacteria 7097
13 Ga0068868_100089220 3300005338 Bacteria 2482
14 Ga0068868_100364000 3300005338 Bacteria 1241
15 Ga0070660_100000332 3300005339 Bacteria 31219
16 Ga0070691_10017004 3300005341 Bacteria 3346
17 Ga0070691_10024098 3300005341 Bacteria 2828
18 Ga0070687_100010610 3300005343 Bacteria 3994
19 Ga0070692_10002146 3300005345 Bacteria 7559
20 Ga0070668_100034892 3300005347 Bacteria 3834
21 Ga0070668_100113259 3300005347 Bacteria 2161
22 Ga0070668_100669352 3300005347 Bacteria 913
23 Ga0070669_100002755 3300005353 Bacteria 12681
24 Ga0070669_100137124 3300005353 Bacteria 1883
25 Ga0070669_100435668 3300005353 Bacteria 1078
26 Ga0070673_100707712 3300005364 Bacteria 925
27 Ga0070688_100360128 3300005365 Bacteria 1067
28 Ga0070659_100001428 3300005366 Bacteria 17225
29 Ga0070667_100292925 3300005367 Bacteria 1464
30 Ga0070703_10007460 3300005406 Bacteria 3072
31 Ga0070703_10014072 3300005406 Bacteria 2275
32 Ga0070703_10052798 3300005406 Bacteria 1305
33 Ga0070709_10026406 3300005434 Bacteria 3442
34 Ga0070701_10005551 3300005438 Bacteria 5220
35 Ga0070705_100000542 3300005440 Bacteria 21855
36 Ga0070705_100049365 3300005440 Bacteria 2443
37 Ga0070705_100072301 3300005440 Bacteria 2089
38 Ga0070705_100092202 3300005440 Bacteria 1890
39 Ga0070705_100402726 3300005440 Bacteria 1014
40 Ga0070700_100005861 3300005441 Bacteria 6525
41 Ga0070694_100000839 3300005444 Bacteria 17297
42 Ga0070694_100003904 3300005444 Bacteria 8915
43 Ga0070694_100010230 3300005444 Bacteria 5778
44 Ga0070694_100019487 3300005444 Bacteria 4315
45 Ga0070694_100081405 3300005444 Bacteria 2252
46 Ga0070708_100022796 3300005445 Bacteria 5316
47 Ga0070708_100028980 3300005445 Bacteria 4770
48 Ga0070708_100057528 3300005445 Bacteria 3462
49 Ga0070708_100151506 3300005445 Bacteria 2157
50 Ga0070708_100191878 3300005445 Bacteria 1911
51 Ga0070708_100219312 3300005445 Bacteria 1783
52 Ga0070708_100262388 3300005445 Bacteria 1624
53 Ga0070708_100349950 3300005445 Bacteria 1392
54 Ga0070663_100002069 3300005455 Bacteria 11198
55 Ga0070662_100009230 3300005457 Bacteria 6441
56 Ga0070662_100130905 3300005457 Bacteria 1934
57 Ga0070681_10018854 3300005458 Bacteria 6904
58 Ga0070681_10172144 3300005458 Bacteria 2087
59 Ga0068867_100000884 3300005459 Bacteria 20270
60 Ga0068867_100268865 3300005459 Bacteria 1393
61 Ga0070706_100024514 3300005467 Bacteria 5554
62 Ga0070706_100024833 3300005467 Bacteria 5517
63 Ga0070706_100036412 3300005467 Bacteria 4545
64 Ga0070706_100057489 3300005467 Bacteria 3589
65 Ga0070706_100194901 3300005467 Bacteria 1893
66 Ga0070706_100210726 3300005467 Unclassified 1815
67 Ga0070706_100245027 3300005467 Bacteria 1673
68 Ga0070706_100435422 3300005467 Bacteria 1220
69 Ga0070707_100005653 3300005468 Bacteria 11677
70 Ga0070707_100007265 3300005468 Bacteria 10285
71 Ga0070707_100027866 3300005468 Bacteria 5374
72 Ga0070707_100032051 3300005468 Bacteria 5006
73 Ga0070707_100036260 3300005468 Bacteria 4705
74 Ga0070707_100088877 3300005468 Bacteria 2989
75 Ga0070707_100195730 3300005468 Bacteria 1971
76 Ga0070707_100353405 3300005468 Bacteria 1427
77 Ga0070707_100400511 3300005468 Unclassified 1332
78 Ga0070707_100556716 3300005468 Bacteria 1109
79 Ga0070707_100621872 3300005468 Bacteria 1042
80 Ga0070698_100006077 3300005471 Bacteria 13151
81 Ga0070698_100014079 3300005471 Bacteria 8457
82 Ga0070698_100063516 3300005471 Bacteria 3723
83 Ga0070698_100175074 3300005471 Bacteria 2085
84 Ga0070699_100001741 3300005518 Bacteria 19879
85 Ga0070699_100002451 3300005518 Bacteria 16672
86 Ga0070699_100009282 3300005518 Bacteria 8521
87 Ga0070699_100022694 3300005518 Bacteria 5409
88 Ga0070699_100028105 3300005518 Bacteria 4850
89 Ga0070699_100038935 3300005518 Bacteria 4116
90 Ga0070699_100058928 3300005518 Bacteria 3327
91 Ga0070699_100110951 3300005518 Bacteria 2408
92 Ga0070699_100119845 3300005518 Bacteria 2313
93 Ga0070699_100558353 3300005518 Bacteria 1042
94 Ga0070679_100000895 3300005530 Bacteria 25859
95 Ga0070684_100046493 3300005535 Bacteria 3761
96 Ga0070697_100000846 3300005536 Bacteria 23019
97 Ga0070697_100012093 3300005536 Bacteria 6758
98 Ga0070697_100020579 3300005536 Bacteria 5221
99 Ga0070697_100031758 3300005536 Bacteria 4248
100 Ga0070697_100037568 3300005536 Bacteria 3912
101 Ga0070697_100199133 3300005536 Bacteria 1702
102 Ga0070697_100333478 3300005536 Bacteria 1308
103 Ga0070697_100352934 3300005536 Bacteria 1270
104 Ga0070697_100626186 3300005536 Bacteria 947
105 Ga0068853_100002471 3300005539 Bacteria 13838
106 Ga0070672_100054067 3300005543 Bacteria 3142
107 Ga0070672_100100497 3300005543 Bacteria 2346
108 Ga0070686_100243475 3300005544 Bacteria 1311
109 Ga0070695_100000685 3300005545 Bacteria 18104
110 Ga0070695_100004819 3300005545 Bacteria 7939
111 Ga0070695_100006806 3300005545 Bacteria 6768
112 Ga0070695_100031556 3300005545 Bacteria 3307
113 Ga0070696_100006243 3300005546 Bacteria 7975
114 Ga0070696_100008767 3300005546 Bacteria 6766
115 Ga0070696_100026432 3300005546 Bacteria 3948
116 Ga0070696_100039506 3300005546 Bacteria 3258
117 Ga0070696_100063987 3300005546 Bacteria 2577
118 Ga0070696_100078406 3300005546 Bacteria 2336
119 Ga0070693_100001933 3300005547 Bacteria 9483
120 Ga0070693_100031434 3300005547 Bacteria 2909
121 Ga0070704_100000570 3300005549 Bacteria 17791
122 Ga0070704_100007035 3300005549 Bacteria 6674
123 Ga0070704_100008324 3300005549 Bacteria 6213
124 Ga0070704_100043264 3300005549 Bacteria 3121
125 Ga0070704_100132303 3300005549 Bacteria 1935
126 Ga0070704_100327970 3300005549 Unclassified 1285
127 Ga0068855_100002792 3300005563 Bacteria 21489
128 Ga0070664_100014425 3300005564 Bacteria 6443
129 Ga0068857_100015332 3300005577 Bacteria 6692
130 Ga0068857_100303254 3300005577 Bacteria 1473
131 Ga0068854_100000353 3300005578 Bacteria 29520
132 Ga0068854_100257946 3300005578 Bacteria 1395
133 Ga0068856_100015448 3300005614 Bacteria 7377
134 Ga0070702_100552628 3300005615 Bacteria 855
135 Ga0068852_100467626 3300005616 Bacteria 1251
136 Ga0068859_100002575 3300005617 Bacteria 18433
137 Ga0068864_100019308 3300005618 Bacteria 5698
138 Ga0068866_10200476 3300005718 Bacteria 1192
139 Ga0068861_100018163 3300005719 Bacteria 5004
140 Ga0068861_100093024 3300005719 Bacteria 2383
141 Ga0068861_100984354 3300005719 Bacteria 804
142 Ga0068870_10001193 3300005840 Bacteria 10423
143 Ga0068863_100009799 3300005841 Bacteria 9338
144 Ga0068863_100018065 3300005841 Bacteria 6753
145 Ga0068858_100404130 3300005842 Bacteria 1312
146 Ga0068860_100004896 3300005843 Bacteria 13649
147 Ga0068860_100094803 3300005843 Bacteria 2844
148 Ga0068860_100145056 3300005843 Bacteria 2284
149 Ga0068862_100014194 3300005844 Bacteria 6605
150 Ga0068862_100120208 3300005844 Bacteria 2315
151 Ga0068862_100291596 3300005844 Bacteria 1498
152 Ga0068862_100352237 3300005844 Bacteria 1366
153 Ga0068862_100407535 3300005844 Bacteria 1273
154 Ga0081455_10000208 3300005937 Bacteria 74660
155 Ga0081538_10013563 3300005981 Bacteria 6444
156 Ga0081540_1015632 3300005983 Bacteria 4795
157 Ga0081540_1031201 3300005983 Bacteria 2935
158 Ga0081539_10000009 3300005985 Bacteria 509286
159 Ga0070715_10041481 3300006163 Bacteria 1929
160 Ga0070716_100035601 3300006173 Bacteria 2738
161 Ga0070712_100013158 3300006175 Bacteria 5279
162 Ga0075427_10018899 3300006194 Bacteria 1084
163 Ga0075428_100002164 3300006844 Bacteria 21251
164 Ga0075428_100004920 3300006844 Bacteria 14840
165 Ga0075428_100026706 3300006844 Bacteria 6393
166 Ga0075428_100136149 3300006844 Bacteria 2670
167 Ga0075428_100513343 3300006844 Bacteria 1282
168 Ga0075430_100000893 3300006846 Bacteria 23384
169 Ga0075430_100004400 3300006846 Bacteria 11896
170 Ga0075430_100014245 3300006846 Bacteria 6780
171 Ga0075430_100040160 3300006846 Bacteria 3961
172 Ga0075430_100068786 3300006846 Bacteria 2971
173 Ga0075430_100159814 3300006846 Bacteria 1876
174 Ga0075430_100197153 3300006846 Bacteria 1673
175 Ga0075430_100206652 3300006846 Bacteria 1629
176 Ga0075430_100362221 3300006846 Unclassified 1197
177 Ga0075431_100000158 3300006847 Bacteria 46980
178 Ga0075431_100004465 3300006847 Bacteria 13728
179 Ga0075431_100006168 3300006847 Bacteria 11896
180 Ga0075431_100006780 3300006847 Bacteria 11370
181 Ga0075431_100022517 3300006847 Bacteria 6442
182 Ga0075431_100028177 3300006847 Bacteria 5768
183 Ga0075431_100054782 3300006847 Bacteria 4113
184 Ga0075431_100085845 3300006847 Bacteria 3248
185 Ga0075431_100185939 3300006847 Bacteria 2130
186 Ga0075431_100194061 3300006847 Bacteria 2080
187 Ga0075431_100213890 3300006847 Bacteria 1968
188 Ga0075431_100231413 3300006847 Unclassified 1883
189 Ga0075431_100254142 3300006847 Bacteria 1785
190 Ga0075433_10000230 3300006852 Bacteria 31980
191 Ga0075433_10000972 3300006852 Bacteria 20350
192 Ga0075433_10002435 3300006852 Bacteria 14167
193 Ga0075433_10003721 3300006852 Bacteria 11804
194 Ga0075433_10009354 3300006852 Bacteria 7835
195 Ga0075433_10011237 3300006852 Bacteria 7208
196 Ga0075433_10031005 3300006852 Bacteria 4566
197 Ga0075433_10060888 3300006852 Bacteria 3306
198 Ga0075433_10123928 3300006852 Bacteria 2296
199 Ga0075433_10474659 3300006852 Bacteria 1102
200 Ga0075434_100005150 3300006871 Bacteria 11874
201 Ga0075434_100011156 3300006871 Bacteria 8455
202 Ga0075434_100012438 3300006871 Bacteria 8070
203 Ga0075434_100022709 3300006871 Bacteria 6109
204 Ga0075434_100024062 3300006871 Bacteria 5949
205 Ga0075434_100024250 3300006871 Bacteria 5929
206 Ga0075434_100040276 3300006871 Bacteria 4627
207 Ga0075434_100047469 3300006871 Bacteria 4262
208 Ga0075434_100133814 3300006871 Bacteria 2499
209 Ga0075434_100146970 3300006871 Bacteria 2377
210 Ga0075434_100205232 3300006871 Unclassified 1991
211 Ga0075434_100276426 3300006871 Unclassified 1699
212 Ga0075434_100316441 3300006871 Bacteria 1581
213 Ga0075429_100000757 3300006880 Bacteria 25402
214 Ga0075429_100001793 3300006880 Bacteria 17793
215 Ga0075429_100008188 3300006880 Bacteria 9087
216 Ga0075429_100026975 3300006880 Bacteria 4988
217 Ga0075429_100027715 3300006880 Bacteria 4917
218 Ga0075429_100041111 3300006880 Bacteria 4026
219 Ga0075429_100234775 3300006880 Bacteria 1606
220 Ga0075429_100277124 3300006880 Bacteria 1468
221 Ga0075429_100484202 3300006880 Bacteria 1084
222 Ga0068865_100115771 3300006881 Bacteria 1985
223 Ga0075436_100016217 3300006914 Bacteria 5100
224 Ga0075436_100018220 3300006914 Bacteria 4809
225 Ga0075436_100099568 3300006914 Bacteria 2024
226 Ga0075436_100120872 3300006914 Bacteria 1832
227 Ga0075436_100183308 3300006914 Bacteria 1480
228 Ga0097620_100002575 3300006931 Bacteria 18433
229 Ga0075435_100002502 3300007076 Bacteria 12221
230 Ga0075435_100005683 3300007076 Bacteria 8742
231 Ga0075435_100011827 3300007076 Bacteria 6443
232 Ga0075435_100039378 3300007076 Bacteria 3771
233 Ga0075435_100039630 3300007076 Bacteria 3760
234 Ga0075435_100129917 3300007076 Bacteria 2107
235 Ga0075435_100169695 3300007076 Bacteria 1840
236 Ga0075435_100909057 3300007076 Bacteria 768
237 Ga0099794_10003968 3300007265 Bacteria 5743
238 Ga0099794_10013406 3300007265 Bacteria 3567
239 Ga0099794_10069564 3300007265 Bacteria 1722
240 Ga0099794_10164683 3300007265 Bacteria 1129
241 Ga0099794_10167659 3300007265 Bacteria 1119
242 Ga0099794_10171715 3300007265 Bacteria 1105
243 Ga0105240_10533011 3300009093 Bacteria 1301
244 Ga0111539_10000370 3300009094 Bacteria 55548
245 Ga0111539_10004176 3300009094 Bacteria 18951
246 Ga0111539_10007648 3300009094 Bacteria 13810
247 Ga0111539_10008974 3300009094 Bacteria 12658
248 Ga0111539_10187950 3300009094 Bacteria 2411
249 Ga0111539_10440366 3300009094 Bacteria 1517
250 Ga0111539_10516311 3300009094 Bacteria 1392
251 Ga0111539_11067547 3300009094 Bacteria 938
252 Ga0105247_10034856 3300009101 Bacteria 3066
253 Ga0114129_10000078 3300009147 Bacteria 89074
254 Ga0114129_10000443 3300009147 Bacteria 49208
255 Ga0114129_10000599 3300009147 Bacteria 44461
256 Ga0114129_10001075 3300009147 Bacteria 35911
257 Ga0114129_10008029 3300009147 Bacteria 15033
258 Ga0114129_10045651 3300009147 Bacteria 6158
259 Ga0114129_10056055 3300009147 Bacteria 5522
260 Ga0114129_10068941 3300009147 Bacteria 4930
261 Ga0114129_10082634 3300009147 Bacteria 4463
262 Ga0114129_10091152 3300009147 Bacteria 4224
263 Ga0114129_10100951 3300009147 Bacteria 3993
264 Ga0114129_10133835 3300009147 Bacteria 3403
265 Ga0114129_10158841 3300009147 Bacteria 3090
266 Ga0114129_10216347 3300009147 Bacteria 2587
267 Ga0114129_10327274 3300009147 Bacteria 2036
268 Ga0114129_10394652 3300009147 Bacteria 1824
269 Ga0114129_10453015 3300009147 Bacteria 1683
270 Ga0114129_10510338 3300009147 Bacteria 1569
271 Ga0114129_10680498 3300009147 Bacteria 1324
272 Ga0114129_11189518 3300009147 Bacteria 950
273 Ga0114129_11199248 3300009147 Bacteria 945
274 Ga0114129_11232827 3300009147 Bacteria 930
275 Ga0105243_10016738 3300009148 Bacteria 5543
276 Ga0105243_10527784 3300009148 Bacteria 1124
277 Ga0105241_10000218 3300009174 Bacteria 43050
278 Ga0105241_10067794 3300009174 Bacteria 2763
279 Ga0105242_10006162 3300009176 Bacteria 9238
280 Ga0105242_10143429 3300009176 Bacteria 2075
281 Ga0105248_10056969 3300009177 Bacteria 4385
282 Ga0105248_10120027 3300009177 Bacteria 2966
283 Ga0105249_10095565 3300009553 Bacteria 2786
284 Ga0105249_10413703 3300009553 Bacteria 1381
285 Ga0105249_10784516 3300009553 Bacteria 1016
286 Ga0157373_10000381 3300013100 Bacteria 35500
287 Ga0157371_10057611 3300013102 Bacteria 2756
288 Ga0157369_10021069 3300013105 Bacteria 7287
289 Ga0157378_10751653 3300013297 Bacteria 998
290 Ga0163162_10024603 3300013306 Bacteria 5946
291 Ga0163162_10522023 3300013306 Bacteria 1317
292 Ga0163162_10779799 3300013306 Bacteria 1074
293 Ga0157372_10001479 3300013307 Bacteria 25510
294 Ga0157375_10648749 3300013308 Bacteria 1212
295 Ga0163163_10050672 3300014325 Bacteria 4089
296 Ga0157377_10478851 3300014745 Bacteria 865
297 Ga0182007_10029431 3300015262 Bacteria 1881
298 Ga0207653_10002272 3300025885 Bacteria 6123
299 Ga0207653_10003610 3300025885 Bacteria 4873
300 Ga0207653_10066990 3300025885 Bacteria 1221
301 Ga0207688_10013979 3300025901 Bacteria 4364
302 Ga0207645_10002083 3300025907 Bacteria 16009
303 Ga0207645_10066972 3300025907 Bacteria 2295
304 Ga0207643_10000157 3300025908 Bacteria 46902
305 Ga0207684_10000169 3300025910 Bacteria 109181
306 Ga0207684_10010713 3300025910 Bacteria 8051
307 Ga0207684_10043067 3300025910 Bacteria 3826
308 Ga0207684_10049280 3300025910 Bacteria 3573
309 Ga0207684_10051693 3300025910 Bacteria 3487
310 Ga0207684_10075571 3300025910 Bacteria 2863
311 Ga0207684_10204761 3300025910 Bacteria 1702
312 Ga0207684_10231548 3300025910 Bacteria 1594
313 Ga0207684_10424533 3300025910 Bacteria 1142
314 Ga0207654_10028703 3300025911 Bacteria 3036
315 Ga0207654_10039930 3300025911 Bacteria 2642
316 Ga0207707_10000258 3300025912 Bacteria 57257
317 Ga0207693_10001303 3300025915 Bacteria 22126
318 Ga0207660_10001383 3300025917 Bacteria 16275
319 Ga0207660_10005203 3300025917 Bacteria 8450
320 Ga0207660_10059601 3300025917 Bacteria 2741
321 Ga0207662_10019281 3300025918 Bacteria 3879
322 Ga0207662_10090015 3300025918 Bacteria 1886
323 Ga0207657_10000373 3300025919 Bacteria 47375
324 Ga0207649_10002783 3300025920 Bacteria 9659
325 Ga0207652_10092848 3300025921 Bacteria 2655
326 Ga0207646_10003463 3300025922 Bacteria 17818
327 Ga0207646_10026953 3300025922 Bacteria 5239
328 Ga0207646_10027112 3300025922 Bacteria 5224
329 Ga0207646_10046844 3300025922 Bacteria 3879
330 Ga0207646_10066823 3300025922 Bacteria 3210
331 Ga0207646_10069778 3300025922 Bacteria 3139
332 Ga0207646_10093447 3300025922 Bacteria 2693
333 Ga0207646_10121000 3300025922 Bacteria 2352
334 Ga0207646_10136983 3300025922 Bacteria 2204
335 Ga0207646_10204991 3300025922 Bacteria 1781
336 Ga0207646_10236519 3300025922 Bacteria 1650
337 Ga0207646_10382215 3300025922 Bacteria 1272
338 Ga0207681_10014404 3300025923 Bacteria 4913
339 Ga0207681_10251962 3300025923 Bacteria 1379
340 Ga0207650_10013539 3300025925 Bacteria 5649
341 Ga0207687_10591315 3300025927 Bacteria 935
342 Ga0207690_10391692 3300025932 Bacteria 1106
343 Ga0207706_10001857 3300025933 Bacteria 20682
344 Ga0207706_10049930 3300025933 Bacteria 3697
345 Ga0207709_10012241 3300025935 Bacteria 4728
346 Ga0207670_10010126 3300025936 Bacteria 5414
347 Ga0207704_10466954 3300025938 Bacteria 1010
348 Ga0207665_10003678 3300025939 Bacteria 10237
349 Ga0207665_10129404 3300025939 Bacteria 1790
350 Ga0207691_10066559 3300025940 Bacteria 3259
351 Ga0207691_10251353 3300025940 Bacteria 1526
352 Ga0207711_10166723 3300025941 Bacteria 1997
353 Ga0207711_10905625 3300025941 Bacteria 820
354 Ga0207689_10001419 3300025942 Bacteria 22891
355 Ga0207689_10009967 3300025942 Bacteria 8194
356 Ga0207689_10022157 3300025942 Bacteria 5342
357 Ga0207661_10178524 3300025944 Bacteria 1853
358 Ga0207679_10003101 3300025945 Bacteria 10292
359 Ga0207667_10000857 3300025949 Bacteria 39178
360 Ga0207712_10100206 3300025961 Bacteria 2152
361 Ga0207668_10014274 3300025972 Bacteria 4915
362 Ga0207668_10093678 3300025972 Bacteria 2214
363 Ga0207640_10003102 3300025981 Bacteria 8939
364 Ga0207677_10054008 3300026023 Bacteria 2739
365 Ga0207703_10458633 3300026035 Bacteria 1192
366 Ga0207639_10012434 3300026041 Bacteria 5928
367 Ga0207678_10002143 3300026067 Bacteria 17878
368 Ga0207708_10061594 3300026075 Bacteria 2865
369 Ga0207708_10064125 3300026075 Bacteria 2806
370 Ga0207708_10071539 3300026075 Bacteria 2657
371 Ga0207702_10001041 3300026078 Bacteria 28384
372 Ga0207641_10082848 3300026088 Bacteria 2788
373 Ga0207648_10001790 3300026089 Bacteria 23546
374 Ga0207648_10597915 3300026089 Bacteria 1016
375 Ga0207676_10192802 3300026095 Bacteria 1794
376 Ga0207674_10011931 3300026116 Bacteria 9742
377 Ga0207674_10028729 3300026116 Bacteria 5866
378 Ga0207675_100011619 3300026118 Bacteria 8233
379 Ga0207675_100027101 3300026118 Bacteria 5336
380 Ga0207675_100035611 3300026118 Bacteria 4642
381 Ga0207675_100235570 3300026118 Bacteria 1767
382 Ga0207698_10467679 3300026142 Bacteria 1221
383 Ga0210000_1006537 3300027462 Bacteria 1697
384 Ga0209999_1002588 3300027543 Bacteria 3201
385 Ga0209970_1020572 3300027614 Bacteria 1115
386 Ga0209983_1005174 3300027665 Bacteria 2711
387 Ga0209588_1003997 3300027671 Bacteria 4126
388 Ga0209588_1009645 3300027671 Bacteria 2887
389 Ga0209588_1051416 3300027671 Bacteria 1333
390 Ga0209588_1072873 3300027671 Bacteria 1109
391 Ga0209588_1078208 3300027671 Bacteria 1068
392 Ga0209971_1000031 3300027682 Bacteria 50315
393 Ga0209971_1010932 3300027682 Bacteria 2150
394 Ga0209966_1000020 3300027695 Bacteria 68386
395 Ga0209998_10000024 3300027717 Bacteria 64123
396 Ga0209974_10005110 3300027876 Bacteria 4633
397 Ga0207428_10000138 3300027907 Bacteria 98359
398 Ga0207428_10000409 3300027907 Bacteria 53318
399 Ga0207428_10012663 3300027907 Bacteria 7396
400 Ga0207428_10080226 3300027907 Bacteria 2550
401 Ga0268265_10020408 3300028380 Bacteria 4624
402 Ga0268265_10051901 3300028380 Bacteria 3098
403 Ga0268265_10052643 3300028380 Bacteria 3080
404 Ga0268264_10026465 3300028381 Bacteria 4741
405 Ga0268264_10147829 3300028381 Bacteria 2103
406 Ga0268264_10234512 3300028381 Bacteria 1696
407 Ga0268264_10288131 3300028381 Bacteria 1541
408 Ga0268264_10784770 3300028381 Unclassified 951
409 Ga0307408_100024853 3300031548 Bacteria 4096
410 Ga0307408_100140660 3300031548 Bacteria 1894
411 Ga0307408_100235812 3300031548 Bacteria 1501
412 Ga0307408_100343939 3300031548 Bacteria 1263
413 Ga0307410_10028158 3300031852 Bacteria 3561
414 Ga0307406_10452266 3300031901 Bacteria 1031
415 Ga0307407_10262197 3300031903 Bacteria 1189
416 Ga0307412_10316842 3300031911 Bacteria 1239
417 Ga0307409_100276974 3300031995 Bacteria 1548
418 Ga0307409_100531001 3300031995 Bacteria 1151
419 Ga0307416_100042740 3300032002 Bacteria 3541
420 Ga0307411_10147962 3300032005 Bacteria 1741
421 Ga0307411_10281958 3300032005 Bacteria 1323
422 Ga0307411_10392343 3300032005 Bacteria 1145
423 Ga0307415_100834938 3300032126 Bacteria 844
424 Ga0373948_0007102 3300034817 Bacteria 1874
425 Ga0373928_0029543 3300035084 Bacteria 1206
426 Ga0373929_0011061 3300035085 Bacteria 1695
427 Ga0373940_0006109 3300035088 Bacteria 2650
428 Ga0373940_0015581 3300035088 Bacteria 1872
429 Ga0373949_0005165 3300035090 Bacteria 2930
430 Ga0373949_0019112 3300035090 Bacteria 1558
431 Ga0373939_0009908 3300035114 Bacteria 2372
432 Ga0373941_0024074 3300035115 Bacteria 1745
433 Ga0373941_0071947 3300035115 Bacteria 1150
434 Ga0373960_0103883 3300035121 Bacteria 924
435 Ga0373962_0115907 3300035242 Bacteria 850
436 Ga0373931_0001837 3300035691 Bacteria 9229
437 Ga0373931_0017353 3300035691 Bacteria 3559
438 Ga0373931_0078337 3300035691 Bacteria 1818
439 Ga0395900_0013033 3300037418 Bacteria 8496
440 Ga0395900_0077489 3300037418 Bacteria 3415
441 Ga0395898_0017571 3300037466 Bacteria 7299
442 Ga0395898_0367769 3300037466 Bacteria 1371
443 Ga0395905_0063962 3300037471 Bacteria 3442
444 Ga0395901_0000399 3300038443 Bacteria 51867
445 Ga0439448_0003645 3300042005 Bacteria 4291
446 Ga0439450_020251 3300042008 Bacteria 1418
447 Ga0439455_0032411 3300042012 Bacteria 1306
448 Ga0439459_0008936 3300042438 Bacteria 1724
449 Ga0439460_0000450 3300042461 Bacteria 8829
450 Ga0439460_0188863 3300042461 Bacteria 699
451 Ga0451577_0003197 3300042876 Bacteria 18404
452 Ga0451577_0023850 3300042876 Bacteria 5573
453 Ga0451577_0134764 3300042876 Bacteria 2217
454 Ga0439440_0112885 3300042993 Bacteria 749
455 Ga0453683_0016978 3300044673 Bacteria 4691
456 Ga0453683_0316639 3300044673 Bacteria 999
457 Ga0453684_0015160 3300044712 Bacteria 12228
458 Ga0453684_0464953 3300044712 Bacteria 1406
459 Ga0453684_0743273 3300044712 Bacteria 1062
460 Ga0451576_0013787 3300045051 Bacteria 9030
461 Ga0451576_0019829 3300045051 Bacteria 7333
462 Ga0451576_0042741 3300045051 Bacteria 4784
463 Ga0451576_0052940 3300045051 Bacteria 4253
464 Ga0451576_0075083 3300045051 Bacteria 3517
465 Ga0451576_0174733 3300045051 Bacteria 2242
466 Ga0451576_0175287 3300045051 Bacteria 2238
467 Ga0451576_0251356 3300045051 Bacteria 1848
468 Ga0451576_0274098 3300045051 Bacteria 1764
469 Ga0495580_0000331 3300046472 Bacteria 38649
470 Ga0495584_0134496 3300046491 Bacteria 1255
471 Ga0495642_0033480 3300046528 Bacteria 2066
472 Ga0495659_0029601 3300046664 Bacteria 1902
473 Ga0495659_0233319 3300046664 Bacteria 763
474 Ga0495669_0046440 3300046684 Bacteria 1938
475 Ga0495636_0024339 3300047318 Bacteria 2455
476 Ga0496102_0037829 3300048905 Bacteria 4353
477 Ga0496102_0053609 3300048905 Bacteria 3676
478 Ga0496103_0030162 3300048906 Bacteria 3299
479 Ga0496112_0785337 3300048915 Bacteria 877
480 Ga0496113_0278880 3300048916 Bacteria 1336
481 Ga0496115_0614128 3300048918 Unclassified 863
482 Ga0501031_0386765 3300049568 Bacteria 905
483 Ga0501033_0068100 3300049570 Bacteria 2618
484 Ga0501033_0276558 3300049570 Bacteria 1186
485 Ga0501036_0407724 3300049572 Unclassified 1134
486 Ga0501037_0302819 3300049573 Bacteria 1110
487 Ga0501038_0040865 3300049574 Bacteria 4047
488 Ga0501038_0073341 3300049574 Bacteria 2899
489 Ga0501038_0233488 3300049574 Bacteria 1463
490 Ga0501038_0280173 3300049574 Bacteria 1313
491 Ga0501039_0007391 3300049575 Bacteria 8377
492 Ga0501039_0160118 3300049575 Bacteria 1769
493 Ga0501039_0287629 3300049575 Bacteria 1292
494 Ga0501039_0341983 3300049575 Bacteria 1176
495 Ga0501039_0373475 3300049575 Bacteria 1120
496 Ga0501040_0006872 3300049576 Bacteria 7374
497 Ga0501040_0021010 3300049576 Bacteria 4354
498 Ga0501040_0050462 3300049576 Bacteria 2846
499 Ga0501040_0074291 3300049576 Bacteria 2349
500 Ga0501040_0177550 3300049576 Bacteria 1509
501 Ga0501040_0204180 3300049576 Bacteria 1404
502 Ga0501040_0388784 3300049576 Bacteria 1001
503 Ga0501040_0449011 3300049576 Bacteria 928
504 Ga0501041_0001517 3300049577 Bacteria 12876
505 Ga0501041_0014739 3300049577 Bacteria 4642
506 Ga0501041_0065151 3300049577 Bacteria 2232
507 Ga0501041_0144203 3300049577 Bacteria 1486
508 Ga0501042_0065187 3300049578 Bacteria 2603
509 Ga0501042_0090362 3300049578 Bacteria 2198
510 Ga0501042_0156550 3300049578 Bacteria 1643
511 Ga0501042_0438186 3300049578 Bacteria 947
512 Ga0501042_0550834 3300049578 Bacteria 838
513 Ga0501043_0119680 3300049579 Bacteria 2065
514 Ga0501043_0321239 3300049579 Unclassified 1180
515 Ga0501046_0000607 3300049580 Bacteria 35214
516 Ga0501046_0089977 3300049580 Bacteria 2362
517 Ga0501046_0204573 3300049580 Unclassified 1468
518 Ga0501046_0286860 3300049580 Bacteria 1205
519 Ga0501046_0508218 3300049580 Unclassified 862
520 Ga0501047_0043661 3300049581 Bacteria 4330
521 Ga0501048_0007236 3300049582 Bacteria 8420
522 Ga0501048_0073608 3300049582 Bacteria 2411
523 Ga0501048_0120245 3300049582 Bacteria 1856
524 Ga0501048_0140314 3300049582 Bacteria 1709
525 Ga0501048_0205952 3300049582 Bacteria 1395
526 Ga0501048_0369783 3300049582 Unclassified 1023
527 Ga0501067_0075070 3300049583 Bacteria 1873
528 Ga0501067_0174383 3300049583 Bacteria 1198
529 Ga0501068_0052084 3300049584 Bacteria 2477
530 Ga0501068_0381120 3300049584 Bacteria 908
531 Ga0501068_0455525 3300049584 Bacteria 828
532 Ga0501069_0082927 3300049585 Bacteria 1807
533 Ga0501069_0190127 3300049585 Bacteria 1188
534 Ga0501069_0259851 3300049585 Bacteria 1014
535 Ga0501070_0220407 3300049586 Bacteria 1556
536 Ga0501071_0106449 3300049587 Bacteria 2071
537 Ga0501071_0106603 3300049587 Bacteria 2069
538 Ga0501071_0142678 3300049587 Bacteria 1784
539 Ga0501071_0388243 3300049587 Unclassified 1065
540 Ga0501071_0613131 3300049587 Bacteria 837
541 Ga0501072_0003099 3300049588 Bacteria 12529
542 Ga0501072_0034179 3300049588 Bacteria 3984
543 Ga0501072_0041240 3300049588 Bacteria 3625
544 Ga0501072_0094719 3300049588 Bacteria 2372
545 Ga0501072_0104005 3300049588 Bacteria 2257
546 Ga0501072_0193684 3300049588 Bacteria 1621
547 Ga0501072_0348627 3300049588 Bacteria 1175
548 Ga0501072_0680128 3300049588 Bacteria 809
549 Ga0501072_0884108 3300049588 Bacteria 698
550 Ga0501074_0009258 3300049590 Bacteria 7155
551 Ga0501074_0039206 3300049590 Bacteria 3431
552 Ga0501074_0342906 3300049590 Bacteria 1060
553 Ga0501074_0583236 3300049590 Bacteria 791
554 Ga0501075_0001457 3300049591 Bacteria 15394
555 Ga0501075_0011581 3300049591 Bacteria 6245
556 Ga0501075_0020084 3300049591 Bacteria 4852
557 Ga0501075_0025612 3300049591 Bacteria 4334
558 Ga0501075_0048326 3300049591 Bacteria 3198
559 Ga0501075_0050577 3300049591 Bacteria 3124
560 Ga0501075_0062232 3300049591 Bacteria 2813
561 Ga0501075_0072520 3300049591 Bacteria 2603
562 Ga0501075_0107835 3300049591 Bacteria 2117
563 Ga0501075_0109282 3300049591 Bacteria 2102
564 Ga0501075_0132683 3300049591 Bacteria 1897
565 Ga0501075_0264737 3300049591 Unclassified 1310
566 Ga0501075_0300045 3300049591 Bacteria 1224
567 Ga0501075_0377253 3300049591 Bacteria 1081
568 Ga0501075_0491194 3300049591 Bacteria 936
569 Ga0501076_0004888 3300049592 Bacteria 9581
570 Ga0501076_0023309 3300049592 Bacteria 4770
571 Ga0501076_0028537 3300049592 Bacteria 4334
572 Ga0501076_0029517 3300049592 Bacteria 4264
573 Ga0501076_0043424 3300049592 Bacteria 3542
574 Ga0501076_0070352 3300049592 Bacteria 2797
575 Ga0501076_0138877 3300049592 Bacteria 1974
576 Ga0501076_0153622 3300049592 Bacteria 1873
577 Ga0501076_0193132 3300049592 Bacteria 1662
578 Ga0501076_0202293 3300049592 Bacteria 1622
579 Ga0501076_0365349 3300049592 Bacteria 1186
580 Ga0501076_0371846 3300049592 Bacteria 1174
581 Ga0501077_0007562 3300049593 Bacteria 6704
582 Ga0501077_0007616 3300049593 Bacteria 6682
583 Ga0501077_0019750 3300049593 Bacteria 4262
584 Ga0501077_0026293 3300049593 Bacteria 3694
585 Ga0501077_0035501 3300049593 Bacteria 3173
586 Ga0501077_0043469 3300049593 Bacteria 2855
587 Ga0501077_0050565 3300049593 Bacteria 2642
588 Ga0501077_0137967 3300049593 Bacteria 1546
589 Ga0501077_0208685 3300049593 Bacteria 1241
590 Ga0501079_0004364 3300049741 Bacteria 10492
591 Ga0501079_0005322 3300049741 Bacteria 9577
592 Ga0501079_0005375 3300049741 Bacteria 9536
593 Ga0501079_0008589 3300049741 Bacteria 7753
594 Ga0501079_0012404 3300049741 Bacteria 6503
595 Ga0501079_0137027 3300049741 Bacteria 1906
596 Ga0501079_0185493 3300049741 Bacteria 1624
597 Ga0501079_0489411 3300049741 Bacteria 967
598 Ga0501080_0076967 3300049742 Bacteria 3102
599 Ga0501080_0174382 3300049742 Bacteria 1982
600 Ga0501080_0212253 3300049742 Bacteria 1774
601 Ga0501080_0246285 3300049742 Bacteria 1630
602 Ga0501081_0008094 3300049743 Bacteria 6823
603 Ga0501081_0019526 3300049743 Bacteria 4513
604 Ga0501081_0066508 3300049743 Bacteria 2507
605 Ga0501081_0109535 3300049743 Bacteria 1959
606 Ga0501081_0135062 3300049743 Bacteria 1765
607 Ga0501081_0172389 3300049743 Bacteria 1562
608 Ga0501081_0174832 3300049743 Bacteria 1551
609 Ga0501081_0184231 3300049743 Bacteria 1511
610 Ga0501081_0532837 3300049743 Bacteria 876
611 Ga0501083_0109881 3300049744 Bacteria 1813
612 Ga0501035_0168011 3300049822 Bacteria 1896
613 Ga0501035_0327865 3300049822 Bacteria 1285
614 Ga0501035_0556140 3300049822 Bacteria 939
615 Ga0501044_0541039 3300049823 Bacteria 1063
616 Ga0501045_0001608 3300049824 Bacteria 15107
617 Ga0501045_0016844 3300049824 Bacteria 5192
618 Ga0501045_0019327 3300049824 Bacteria 4855
619 Ga0501045_0023563 3300049824 Bacteria 4415
620 Ga0501045_0041923 3300049824 Bacteria 3331
621 Ga0501045_0088616 3300049824 Bacteria 2286
622 Ga0501045_0182204 3300049824 Bacteria 1565
623 nmdc:mga05p37_1126565_c1 3300050507 Bacteria 819
624 nmdc:mga05p37_1275777_c1 3300050507 Unclassified 751
625 nmdc:mga05p37_199_c1 3300050507 Bacteria 59838
626 nmdc:mga05p37_204587_c1 3300050507 Bacteria 2389
627 nmdc:mga05p37_205700_c1 3300050507 Bacteria 2381
628 nmdc:mga05p37_224852_c1 3300050507 Bacteria 2263
629 nmdc:mga05p37_22487_c1 3300050507 Bacteria 7645
630 nmdc:mga05p37_26965_c1 3300050507 Bacteria 6990
631 nmdc:mga05p37_307277_c1 3300050507 Bacteria 1881
632 nmdc:mga05p37_369731_c1 3300050507 Bacteria 1683
633 nmdc:mga05p37_38692_c1 3300050507 Bacteria 5853
634 nmdc:mga05p37_38_c1 3300050507 Bacteria 109166
635 nmdc:mga05p37_57280_c1 3300050507 Bacteria 4800
636 nmdc:mga05p37_662783_c1 3300050507 Bacteria 1166
637 nmdc:mga05p37_68944_c1 3300050507 Bacteria 4349
638 nmdc:mga05p37_78211_c1 3300050507 Bacteria 4073
639 nmdc:mga05p37_7885_c1 3300050507 Bacteria 12567
640 nmdc:mga05p37_88173_c1 3300050507 Bacteria 3825
641 nmdc:mga05p37_93330_c1 3300050507 Bacteria 3709
642 nmdc:mga05p37_94383_c1 3300050507 Bacteria 3686
643 nmdc:mga05p37_96455_c1 3300050507 Bacteria 3643
644 nmdc:mga09592_1012_c1 3300050508 Bacteria 22338
645 nmdc:mga09592_10352_c1 3300050508 Bacteria 7589
646 nmdc:mga09592_168686_c1 3300050508 Bacteria 1892
647 nmdc:mga09592_31298_c1 3300050508 Bacteria 4433
648 nmdc:mga09592_33850_c1 3300050508 Bacteria 4269
649 nmdc:mga09592_4445_c1 3300050508 Bacteria 11343
650 nmdc:mga09592_73228_c1 3300050508 Bacteria 2910
651 nmdc:mga09592_92879_c1 3300050508 Bacteria 2580
652 nmdc:mga0qj67_107659_c1 3300050509 Bacteria 2249
653 nmdc:mga0qj67_14460_c1 3300050509 Bacteria 5968
654 nmdc:mga0qj67_161756_c1 3300050509 Bacteria 1817
655 nmdc:mga0qj67_195369_c1 3300050509 Bacteria 1644
656 nmdc:mga0qj67_2246_c1 3300050509 Bacteria 13729
657 nmdc:mga0qj67_70653_c1 3300050509 Bacteria 1541
658 nmdc:mga0qj67_86808_c1 3300050509 Bacteria 2510
659 nmdc:mga06r32_113820_c1 3300050510 Bacteria 2663
660 nmdc:mga06r32_1254_c1 3300050510 Bacteria 22817
661 nmdc:mga06r32_126946_c1 3300050510 Bacteria 2520
662 nmdc:mga06r32_1549_c1 3300050510 Bacteria 20719
663 nmdc:mga06r32_171864_c1 3300050510 Bacteria 2151
664 nmdc:mga06r32_200044_c1 3300050510 Bacteria 1986
665 nmdc:mga06r32_223680_c1 3300050510 Unclassified 1870
666 nmdc:mga06r32_22559_c1 3300050510 Bacteria 5821
667 nmdc:mga06r32_287_c1 3300050510 Bacteria 41922
668 nmdc:mga06r32_3471_c1 3300050510 Bacteria 14077
669 nmdc:mga06r32_396971_c1 3300050510 Bacteria 1361
670 nmdc:mga06r32_6047_c1 3300050510 Bacteria 10878
671 nmdc:mga06r32_61109_c1 3300050510 Bacteria 3626
672 nmdc:mga06r32_67198_c1 3300050510 Bacteria 3460
673 nmdc:mga06r32_76307_c1 3300050510 Bacteria 3254
674 nmdc:mga06r32_90387_c1 3300050510 Bacteria 2991
675 nmdc:mga08y16_11942_c1 3300050511 Bacteria 9122
676 nmdc:mga08y16_191654_c2 3300050511 Bacteria 1769
677 nmdc:mga08y16_1957_c1 3300050511 Bacteria 20989
678 nmdc:mga08y16_2476_c1 3300050511 Bacteria 18964
679 nmdc:mga08y16_29427_c1 3300050511 Bacteria 5787
680 nmdc:mga08y16_967917_c1 3300050511 Bacteria 833
681 nmdc:mga0n895_111725_c1 3300050512 Bacteria 2749
682 nmdc:mga0n895_126103_c1 3300050512 Bacteria 2584
683 nmdc:mga0n895_12611_c1 3300050512 Bacteria 7587
684 nmdc:mga0n895_302619_c1 3300050512 Unclassified 1621
685 nmdc:mga0n895_34456_c1 3300050512 Bacteria 4874
686 nmdc:mga0n895_5572_c1 3300050512 Bacteria 10541
687 nmdc:mga0n895_61_c1 3300050512 Bacteria 63108
688 nmdc:mga0n895_69982_c1 3300050512 Bacteria 3477
689 nmdc:mga0n895_78605_c1 3300050512 Bacteria 3284
690 nmdc:mga0n895_80201_c1 3300050512 Bacteria 3252
691 nmdc:mga0n895_8027_c1 3300050512 Bacteria 9106
692 nmdc:mga0n895_84364_c1 3300050512 Bacteria 3170
693 nmdc:mga0rr50_133858_c1 3300050513 Bacteria 1988
694 nmdc:mga0rr50_15155_c1 3300050513 Bacteria 5082
695 nmdc:mga0rr50_165341_c1 3300050513 Bacteria 1799
696 nmdc:mga0rr50_226090_c1 3300050513 Bacteria 1547
697 nmdc:mga0rr50_3069_c1 3300050513 Bacteria 9562
698 nmdc:mga0rr50_36119_c1 3300050513 Bacteria 3556
699 nmdc:mga0rr50_62639_c1 3300050513 Bacteria 2807
700 nmdc:mga0rr50_7191_c1 3300050513 Bacteria 6841
701 nmdc:mga08x19_22559_c1 3300050514 Bacteria 1448
702 nmdc:mga08x19_2391_c1 3300050514 Bacteria 11377
703 nmdc:mga08x19_359253_c1 3300050514 Bacteria 1018
704 nmdc:mga08x19_9023_c1 3300050514 Bacteria 5956
705 nmdc:mga0a205_11305_c1 3300050515 Bacteria 8219
706 nmdc:mga0a205_122_c1 3300050515 Bacteria 47141
707 nmdc:mga0a205_12408_c1 3300050515 Bacteria 7881
708 nmdc:mga0a205_243123_c1 3300050515 Bacteria 1681
709 nmdc:mga0a205_34506_c1 3300050515 Bacteria 4853
710 nmdc:mga0a205_46561_c1 3300050515 Bacteria 4183
711 nmdc:mga0a205_471770_c1 3300050515 Unclassified 1114
712 nmdc:mga0a205_49897_c1 3300050515 Bacteria 4041
713 nmdc:mga0a205_895_c1 3300050515 Bacteria 17939
714 nmdc:mga0a205_90400_c1 3300050515 Bacteria 2959
715 Ga0501084_0003947 3300054114 Bacteria 12085
716 Ga0501084_0006427 3300054114 Bacteria 9660
717 Ga0501084_0013112 3300054114 Bacteria 6860
718 Ga0501084_0020335 3300054114 Bacteria 5535
719 Ga0501084_0024768 3300054114 Bacteria 5008
720 Ga0501084_0116108 3300054114 Bacteria 2250
721 Ga0501084_0117216 3300054114 Bacteria 2239
722 Ga0501084_0136774 3300054114 Bacteria 2063
723 Ga0501084_0355655 3300054114 Bacteria 1237
724 Ga0501084_0477825 3300054114 Bacteria 1053
725 Ga0501084_0501245 3300054114 Bacteria 1026
726 Ga0590071_068191 3300059421 Bacteria 875
727 Ga0501082_0000058 3300060353 Bacteria 78173
728 Ga0501082_0006322 3300060353 Bacteria 10275
729 Ga0501082_0007387 3300060353 Bacteria 9483
730 Ga0501082_0019798 3300060353 Bacteria 5803
731 Ga0501082_0363165 3300060353 Bacteria 1263
732 Ga0501082_0376291 3300060353 Bacteria 1239
733 Ga0501082_0419070 3300060353 Bacteria 1169
734 Ga0501082_0455497 3300060353 Unclassified 1118
735 Ga0530510_0000450 3300061734 Bacteria 26655
736 Ga0530510_0019190 3300061734 Bacteria 4850
737 Ga0530510_0041498 3300061734 Bacteria 3322
738 Ga0530510_0057884 3300061734 Bacteria 2802
739 Ga0530510_0064169 3300061734 Bacteria 2660
740 Ga0530510_0090245 3300061734 Bacteria 2235
741 Ga0530510_0112264 3300061734 Bacteria 1997
742 Ga0530510_0118621 3300061734 Bacteria 1941
743 Ga0530510_0215052 3300061734 Bacteria 1428
744 Ga0530510_0607403 3300061734 Bacteria 832

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100005150 Ga0075434_1000051507 194
2 3300007076 Ga0075435_100039378 Ga0075435_1000393784 194
3 3300005328 Ga0070676_10000920 Ga0070676_100009209 198
4 3300005331 Ga0070670_100056748 Ga0070670_1000567484 198
5 3300005334 Ga0068869_100006522 Ga0068869_1000065225 198
6 3300005336 Ga0070680_100004576 Ga0070680_1000045767 198
7 3300005337 Ga0070682_100005442 Ga0070682_1000054424 198
8 3300005338 Ga0068868_100089220 Ga0068868_1000892202 198
9 3300005339 Ga0070660_100000332 Ga0070660_10000033231 198
10 3300005343 Ga0070687_100010610 Ga0070687_1000106105 198
11 3300005345 Ga0070692_10002146 Ga0070692_100021464 198
12 3300005347 Ga0070668_100669352 Ga0070668_1006693522 198
13 3300005364 Ga0070673_100707712 Ga0070673_1007077122 198
14 3300005365 Ga0070688_100360128 Ga0070688_1003601282 198
15 3300005366 Ga0070659_100001428 Ga0070659_10000142811 198
16 3300005406 Ga0070703_10007460 Ga0070703_100074601 198
17 3300005440 Ga0070705_100000542 Ga0070705_1000005429 198
18 3300005444 Ga0070694_100000839 Ga0070694_10000083911 198
19 3300005455 Ga0070663_100002069 Ga0070663_1000020691 198
20 3300005457 Ga0070662_100009230 Ga0070662_1000092306 198
21 3300005458 Ga0070681_10018854 Ga0070681_100188544 198
22 3300005459 Ga0068867_100000884 Ga0068867_10000088413 198
23 3300005530 Ga0070679_100000895 Ga0070679_10000089513 198
24 3300005535 Ga0070684_100046493 Ga0070684_1000464931 198
25 3300005539 Ga0068853_100002471 Ga0068853_1000024715 198
26 3300005543 Ga0070672_100100497 Ga0070672_1001004972 198
27 3300005546 Ga0070696_100008767 Ga0070696_1000087674 198
28 3300005547 Ga0070693_100001933 Ga0070693_1000019334 198
29 3300005549 Ga0070704_100000570 Ga0070704_1000005707 198
30 3300005563 Ga0068855_100002792 Ga0068855_10000279211 198
31 3300005564 Ga0070664_100014425 Ga0070664_1000144255 198
32 3300005577 Ga0068857_100015332 Ga0068857_1000153324 198
33 3300005578 Ga0068854_100000353 Ga0068854_1000003533 198
34 3300005614 Ga0068856_100015448 Ga0068856_1000154485 198
35 3300005616 Ga0068852_100467626 Ga0068852_1004676262 198
36 3300005617 Ga0068859_100002575 Ga0068859_1000025755 198
37 3300005618 Ga0068864_100019308 Ga0068864_1000193085 198
38 3300005719 Ga0068861_100093024 Ga0068861_1000930243 198
39 3300005840 Ga0068870_10001193 Ga0068870_100011935 198
40 3300005841 Ga0068863_100009799 Ga0068863_1000097999 198
41 3300005843 Ga0068860_100004896 Ga0068860_10000489615 198
42 3300005844 Ga0068862_100014194 Ga0068862_1000141944 198
43 3300006852 Ga0075433_10003721 Ga0075433_100037211 198
44 3300006871 Ga0075434_100022709 Ga0075434_1000227095 198
45 3300006914 Ga0075436_100099568 Ga0075436_1000995682 198
46 3300006931 Ga0097620_100002575 Ga0097620_1000025755 198
47 3300007076 Ga0075435_100002502 Ga0075435_10000250211 198
48 3300025885 Ga0207653_10002272 Ga0207653_100022721 198
49 3300025901 Ga0207688_10013979 Ga0207688_100139792 198
50 3300025907 Ga0207645_10002083 Ga0207645_100020837 198
51 3300025908 Ga0207643_10000157 Ga0207643_1000015736 198
52 3300025911 Ga0207654_10028703 Ga0207654_100287032 198
53 3300025912 Ga0207707_10000258 Ga0207707_1000025819 198
54 3300025917 Ga0207660_10001383 Ga0207660_1000138313 198
55 3300025918 Ga0207662_10019281 Ga0207662_100192811 198
56 3300025919 Ga0207657_10000373 Ga0207657_100003735 198
57 3300025920 Ga0207649_10002783 Ga0207649_100027834 198
58 3300025921 Ga0207652_10092848 Ga0207652_100928481 198
59 3300025925 Ga0207650_10013539 Ga0207650_100135397 198
60 3300025932 Ga0207690_10391692 Ga0207690_103916922 198
61 3300025933 Ga0207706_10001857 Ga0207706_1000185715 198
62 3300025936 Ga0207670_10010126 Ga0207670_100101266 198
63 3300025942 Ga0207689_10001419 Ga0207689_1000141910 198
64 3300025944 Ga0207661_10178524 Ga0207661_101785242 198
65 3300025945 Ga0207679_10003101 Ga0207679_100031012 198
66 3300025949 Ga0207667_10000857 Ga0207667_1000085715 198
67 3300025981 Ga0207640_10003102 Ga0207640_100031023 198
68 3300026023 Ga0207677_10054008 Ga0207677_100540082 198
69 3300026035 Ga0207703_10458633 Ga0207703_104586331 198
70 3300026041 Ga0207639_10012434 Ga0207639_100124347 198
71 3300026067 Ga0207678_10002143 Ga0207678_1000214317 198
72 3300026075 Ga0207708_10071539 Ga0207708_100715392 198
73 3300026078 Ga0207702_10001041 Ga0207702_1000104124 198
74 3300026089 Ga0207648_10001790 Ga0207648_1000179010 198
75 3300026095 Ga0207676_10192802 Ga0207676_101928021 198
76 3300026116 Ga0207674_10011931 Ga0207674_100119317 198
77 3300026118 Ga0207675_100035611 Ga0207675_1000356112 198
78 3300026142 Ga0207698_10467679 Ga0207698_104676792 198
79 3300028380 Ga0268265_10020408 Ga0268265_100204083 198
80 3300028381 Ga0268264_10026465 Ga0268264_100264651 198
81 3300035121 Ga0373960_0103883 Ga0373960_0103883_43_645 198
82 3300028380 Ga0268265_10051901 Ga0268265_100519014 199
83 3300049591 Ga0501075_0300045 Ga0501075_0300045_51_728 200
84 3300050511 nmdc:mga08y16_967917_c1 nmdc:mga08y16_967917_c1_10_621 201
85 3300009101 Ga0105247_10034856 Ga0105247_100348564 202
86 3300009147 Ga0114129_10394652 Ga0114129_103946522 202
87 3300013306 Ga0163162_10522023 Ga0163162_105220232 202
88 3300027907 Ga0207428_10080226 Ga0207428_100802262 202
89 3300050515 nmdc:mga0a205_11305_c1 nmdc:mga0a205_11305_c1_4437_5117 202
90 3300005549 Ga0070704_100132303 Ga0070704_1001323032 203
91 3300005578 Ga0068854_100257946 Ga0068854_1002579462 203
92 3300005842 Ga0068858_100404130 Ga0068858_1004041302 203
93 3300005843 Ga0068860_100094803 Ga0068860_1000948032 203
94 3300025918 Ga0207662_10090015 Ga0207662_100900153 203
95 3300026075 Ga0207708_10064125 Ga0207708_100641254 203
96 3300026118 Ga0207675_100011619 Ga0207675_1000116197 203
97 3300028381 Ga0268264_10234512 Ga0268264_102345122 203
98 3300007265 Ga0099794_10013406 Ga0099794_100134064 204
99 3300027671 Ga0209588_1003997 Ga0209588_10039974 204
100 3300005440 Ga0070705_100092202 Ga0070705_1000922022 205
101 3300005518 Ga0070699_100001741 Ga0070699_1000017417 205
102 3300005518 Ga0070699_100038935 Ga0070699_1000389352 205
103 3300005536 Ga0070697_100012093 Ga0070697_1000120935 205
104 3300005546 Ga0070696_100039506 Ga0070696_1000395063 205
105 3300005549 Ga0070704_100043264 Ga0070704_1000432644 205
106 3300007265 Ga0099794_10164683 Ga0099794_101646832 205
107 3300009148 Ga0105243_10016738 Ga0105243_100167387 205
108 3300009553 Ga0105249_10095565 Ga0105249_100955654 205
109 3300026089 Ga0207648_10597915 Ga0207648_105979152 205
110 3300027671 Ga0209588_1078208 Ga0209588_10782082 205
111 3300006852 Ga0075433_10011237 Ga0075433_100112375 206
112 3300006871 Ga0075434_100047469 Ga0075434_1000474695 206
113 3300006914 Ga0075436_100016217 Ga0075436_1000162172 206
114 3300049576 Ga0501040_0050462 Ga0501040_0050462_829_1485 206
115 3300050507 nmdc:mga05p37_96455_c1 nmdc:mga05p37_96455_c1_2644_3270 206
116 3300050512 nmdc:mga0n895_12611_c1 nmdc:mga0n895_12611_c1_3819_4469 206
117 3300050513 nmdc:mga0rr50_15155_c1 nmdc:mga0rr50_15155_c1_3536_4186 206
118 3300050514 nmdc:mga08x19_2391_c1 nmdc:mga08x19_2391_c1_10000_10650 206
119 3300049574 Ga0501038_0073341 Ga0501038_0073341_1993_2640 207
120 3300049575 Ga0501039_0160118 Ga0501039_0160118_859_1506 207
121 3300049577 Ga0501041_0001517 Ga0501041_0001517_2046_2693 207
122 3300049578 Ga0501042_0156550 Ga0501042_0156550_651_1298 207
123 3300049591 Ga0501075_0020084 Ga0501075_0020084_2446_3093 207
124 3300049592 Ga0501076_0004888 Ga0501076_0004888_1678_2325 207
125 3300049593 Ga0501077_0007616 Ga0501077_0007616_4034_4681 207
126 3300049741 Ga0501079_0004364 Ga0501079_0004364_4741_5388 207
127 3300049743 Ga0501081_0008094 Ga0501081_0008094_4243_4890 207
128 3300049822 Ga0501035_0556140 Ga0501035_0556140_52_699 207
129 3300049824 Ga0501045_0041923 Ga0501045_0041923_469_1116 207
130 3300060353 Ga0501082_0006322 Ga0501082_0006322_4884_5531 207
131 3300061734 Ga0530510_0019190 Ga0530510_0019190_1914_2561 207
132 3300049578 Ga0501042_0065187 Ga0501042_0065187_330_998 208
133 3300049579 Ga0501043_0119680 Ga0501043_0119680_803_1471 208
134 3300049580 Ga0501046_0089977 Ga0501046_0089977_446_1114 208
135 3300049584 Ga0501068_0052084 Ga0501068_0052084_1779_2447 208
136 3300049587 Ga0501071_0106449 Ga0501071_0106449_817_1485 208
137 3300049593 Ga0501077_0035501 Ga0501077_0035501_1533_2201 208
138 3300049742 Ga0501080_0212253 Ga0501080_0212253_534_1202 208
139 3300049822 Ga0501035_0168011 Ga0501035_0168011_70_738 208
140 3300006844 Ga0075428_100136149 Ga0075428_1001361492 209
141 3300006846 Ga0075430_100206652 Ga0075430_1002066523 209
142 3300006847 Ga0075431_100085845 Ga0075431_1000858452 209
143 3300006880 Ga0075429_100277124 Ga0075429_1002771243 209
144 3300009147 Ga0114129_10082634 Ga0114129_100826344 209
145 3300044673 Ga0453683_0316639 Ga0453683_0316639_59_715 209
146 3300049588 Ga0501072_0884108 Ga0501072_0884108_23_670 209
147 3300049592 Ga0501076_0028537 Ga0501076_0028537_3364_4011 209
148 3300049593 Ga0501077_0050565 Ga0501077_0050565_1165_1812 209
149 3300050507 nmdc:mga05p37_68944_c1 nmdc:mga05p37_68944_c1_474_1142 209
150 3300050508 nmdc:mga09592_168686_c1 nmdc:mga09592_168686_c1_638_1306 209
151 3300050509 nmdc:mga0qj67_70653_c1 nmdc:mga0qj67_70653_c1_165_833 209
152 3300050510 nmdc:mga06r32_67198_c1 nmdc:mga06r32_67198_c1_95_763 209
153 3300005338 Ga0068868_100364000 Ga0068868_1003640001 210
154 3300005367 Ga0070667_100292925 Ga0070667_1002929251 210
155 3300005445 Ga0070708_100028980 Ga0070708_1000289804 210
156 3300005445 Ga0070708_100191878 Ga0070708_1001918782 210
157 3300005445 Ga0070708_100219312 Ga0070708_1002193123 210
158 3300005445 Ga0070708_100262388 Ga0070708_1002623883 210
159 3300005467 Ga0070706_100194901 Ga0070706_1001949012 210
160 3300005841 Ga0068863_100018065 Ga0068863_1000180654 210
161 3300005981 Ga0081538_10013563 Ga0081538_100135634 210
162 3300005983 Ga0081540_1015632 Ga0081540_10156326 210
163 3300006163 Ga0070715_10041481 Ga0070715_100414812 210
164 3300006173 Ga0070716_100035601 Ga0070716_1000356013 210
165 3300006175 Ga0070712_100013158 Ga0070712_1000131584 210
166 3300006914 Ga0075436_100183308 Ga0075436_1001833082 210
167 3300009094 Ga0111539_11067547 Ga0111539_110675471 210
168 3300009177 Ga0105248_10056969 Ga0105248_100569694 210
169 3300009177 Ga0105248_10120027 Ga0105248_101200273 210
170 3300009553 Ga0105249_10784516 Ga0105249_107845161 210
171 3300025910 Ga0207684_10204761 Ga0207684_102047613 210
172 3300025915 Ga0207693_10001303 Ga0207693_100013036 210
173 3300025939 Ga0207665_10129404 Ga0207665_101294042 210
174 3300025941 Ga0207711_10166723 Ga0207711_101667232 210
175 3300049580 Ga0501046_0508218 Ga0501046_0508218_151_822 210
176 3300049585 Ga0501069_0190127 Ga0501069_0190127_207_875 210
177 3300049590 Ga0501074_0039206 Ga0501074_0039206_767_1435 210
178 3300049591 Ga0501075_0001457 Ga0501075_0001457_3002_3670 210
179 3300049591 Ga0501075_0072520 Ga0501075_0072520_102_773 210
180 3300049591 Ga0501075_0491194 Ga0501075_0491194_71_715 210
181 3300049592 Ga0501076_0029517 Ga0501076_0029517_439_1107 210
182 3300049592 Ga0501076_0138877 Ga0501076_0138877_413_1084 210
183 3300049592 Ga0501076_0193132 Ga0501076_0193132_144_788 210
184 3300049593 Ga0501077_0208685 Ga0501077_0208685_120_764 210
185 3300049741 Ga0501079_0012404 Ga0501079_0012404_2286_2954 210
186 3300049742 Ga0501080_0174382 Ga0501080_0174382_1067_1711 210
187 3300049743 Ga0501081_0019526 Ga0501081_0019526_49_693 210
188 3300049824 Ga0501045_0019327 Ga0501045_0019327_1141_1809 210
189 3300050512 nmdc:mga0n895_69982_c1 nmdc:mga0n895_69982_c1_1755_2408 210
190 3300050513 nmdc:mga0rr50_133858_c1 nmdc:mga0rr50_133858_c1_646_1299 210
191 3300050514 nmdc:mga08x19_22559_c1 nmdc:mga08x19_22559_c1_293_946 210
192 3300054114 Ga0501084_0024768 Ga0501084_0024768_1807_2475 210
193 3300054114 Ga0501084_0477825 Ga0501084_0477825_250_894 210
194 3300059421 Ga0590071_068191 Ga0590071_068191_91_762 210
195 3300060353 Ga0501082_0019798 Ga0501082_0019798_2819_3487 210
196 3300061734 Ga0530510_0118621 Ga0530510_0118621_527_1195 210
197 3300061734 Ga0530510_0215052 Ga0530510_0215052_478_1122 210
198 3300005445 Ga0070708_100057528 Ga0070708_1000575284 211
199 3300005467 Ga0070706_100024514 Ga0070706_1000245142 211
200 3300005467 Ga0070706_100024833 Ga0070706_1000248336 211
201 3300005467 Ga0070706_100036412 Ga0070706_1000364124 211
202 3300005468 Ga0070707_100007265 Ga0070707_1000072655 211
203 3300005468 Ga0070707_100032051 Ga0070707_1000320513 211
204 3300005468 Ga0070707_100088877 Ga0070707_1000888774 211
205 3300005468 Ga0070707_100195730 Ga0070707_1001957302 211
206 3300005468 Ga0070707_100400511 Ga0070707_1004005112 211
207 3300005518 Ga0070699_100009282 Ga0070699_1000092826 211
208 3300005518 Ga0070699_100058928 Ga0070699_1000589282 211
209 3300006871 Ga0075434_100205232 Ga0075434_1002052322 211
210 3300009147 Ga0114129_10000078 Ga0114129_1000007890 211
211 3300009147 Ga0114129_10056055 Ga0114129_100560552 211
212 3300025910 Ga0207684_10051693 Ga0207684_100516933 211
213 3300025922 Ga0207646_10026953 Ga0207646_100269534 211
214 3300025922 Ga0207646_10066823 Ga0207646_100668234 211
215 3300025922 Ga0207646_10069778 Ga0207646_100697784 211
216 3300025922 Ga0207646_10136983 Ga0207646_101369833 211
217 3300025922 Ga0207646_10204991 Ga0207646_102049912 211
218 3300049574 Ga0501038_0233488 Ga0501038_0233488_461_1108 211
219 3300049575 Ga0501039_0287629 Ga0501039_0287629_38_685 211
220 3300049579 Ga0501043_0321239 Ga0501043_0321239_222_869 211
221 3300049582 Ga0501048_0140314 Ga0501048_0140314_350_997 211
222 3300049588 Ga0501072_0034179 Ga0501072_0034179_1000_1647 211
223 3300049592 Ga0501076_0070352 Ga0501076_0070352_467_1114 211
224 3300049743 Ga0501081_0109535 Ga0501081_0109535_195_842 211
225 3300049824 Ga0501045_0023563 Ga0501045_0023563_3510_4157 211
226 3300050507 nmdc:mga05p37_1275777_c1 nmdc:mga05p37_1275777_c1_33_680 211
227 3300050507 nmdc:mga05p37_26965_c1 nmdc:mga05p37_26965_c1_4746_5393 211
228 3300050510 nmdc:mga06r32_3471_c1 nmdc:mga06r32_3471_c1_10848_11510 211
229 3300054114 Ga0501084_0116108 Ga0501084_0116108_563_1210 211
230 3300061734 Ga0530510_0041498 Ga0530510_0041498_2121_2768 211
231 3300005330 Ga0070690_100110993 Ga0070690_1001109931 212
232 3300005544 Ga0070686_100243475 Ga0070686_1002434751 212
233 3300009148 Ga0105243_10527784 Ga0105243_105277841 212
234 3300009553 Ga0105249_10413703 Ga0105249_104137032 212
235 3300045051 Ga0451576_0251356 Ga0451576_0251356_1072_1749 212
236 3300005440 Ga0070705_100072301 Ga0070705_1000723012 213
237 3300005937 Ga0081455_10000208 Ga0081455_1000020828 213
238 3300006846 Ga0075430_100362221 Ga0075430_1003622212 213
239 3300006847 Ga0075431_100231413 Ga0075431_1002314133 213
240 3300009147 Ga0114129_10327274 Ga0114129_103272743 213
241 3300049576 Ga0501040_0177550 Ga0501040_0177550_234_881 213
242 3300049577 Ga0501041_0144203 Ga0501041_0144203_53_700 213
243 3300049582 Ga0501048_0369783 Ga0501048_0369783_204_848 213
244 3300049587 Ga0501071_0388243 Ga0501071_0388243_102_746 213
245 3300049591 Ga0501075_0050577 Ga0501075_0050577_359_1006 213
246 3300049591 Ga0501075_0377253 Ga0501075_0377253_201_845 213
247 3300050507 nmdc:mga05p37_224852_c1 nmdc:mga05p37_224852_c1_377_1024 213
248 3300050507 nmdc:mga05p37_662783_c1 nmdc:mga05p37_662783_c1_144_794 213
249 3300050509 nmdc:mga0qj67_161756_c1 nmdc:mga0qj67_161756_c1_1104_1754 213
250 3300050510 nmdc:mga06r32_223680_c1 nmdc:mga06r32_223680_c1_213_863 213
251 3300054114 Ga0501084_0003947 Ga0501084_0003947_1225_1869 213
252 3300005334 Ga0068869_100012050 Ga0068869_1000120505 214
253 3300005334 Ga0068869_100100593 Ga0068869_1001005933 214
254 3300005336 Ga0070680_100184864 Ga0070680_1001848642 214
255 3300005341 Ga0070691_10017004 Ga0070691_100170045 214
256 3300005341 Ga0070691_10024098 Ga0070691_100240982 214
257 3300005406 Ga0070703_10014072 Ga0070703_100140722 214
258 3300005406 Ga0070703_10052798 Ga0070703_100527981 214
259 3300005434 Ga0070709_10026406 Ga0070709_100264063 214
260 3300005438 Ga0070701_10005551 Ga0070701_100055514 214
261 3300005441 Ga0070700_100005861 Ga0070700_1000058614 214
262 3300005444 Ga0070694_100003904 Ga0070694_1000039047 214
263 3300005444 Ga0070694_100010230 Ga0070694_1000102305 214
264 3300005444 Ga0070694_100019487 Ga0070694_1000194873 214
265 3300005444 Ga0070694_100081405 Ga0070694_1000814052 214
266 3300005457 Ga0070662_100130905 Ga0070662_1001309052 214
267 3300005467 Ga0070706_100435422 Ga0070706_1004354221 214
268 3300005468 Ga0070707_100036260 Ga0070707_1000362605 214
269 3300005471 Ga0070698_100014079 Ga0070698_1000140796 214
270 3300005471 Ga0070698_100063516 Ga0070698_1000635163 214
271 3300005518 Ga0070699_100022694 Ga0070699_1000226942 214
272 3300005518 Ga0070699_100028105 Ga0070699_1000281056 214
273 3300005518 Ga0070699_100119845 Ga0070699_1001198453 214
274 3300005536 Ga0070697_100031758 Ga0070697_1000317584 214
275 3300005536 Ga0070697_100199133 Ga0070697_1001991333 214
276 3300005545 Ga0070695_100000685 Ga0070695_10000068520 214
277 3300005545 Ga0070695_100004819 Ga0070695_1000048197 214
278 3300005545 Ga0070695_100006806 Ga0070695_1000068063 214
279 3300005545 Ga0070695_100031556 Ga0070695_1000315564 214
280 3300005546 Ga0070696_100026432 Ga0070696_1000264322 214
281 3300005547 Ga0070693_100031434 Ga0070693_1000314342 214
282 3300005549 Ga0070704_100008324 Ga0070704_1000083243 214
283 3300005549 Ga0070704_100327970 Ga0070704_1003279702 214
284 3300005577 Ga0068857_100303254 Ga0068857_1003032542 214
285 3300005844 Ga0068862_100291596 Ga0068862_1002915963 214
286 3300005844 Ga0068862_100407535 Ga0068862_1004075352 214
287 3300006847 Ga0075431_100004465 Ga0075431_10000446515 214
288 3300006847 Ga0075431_100185939 Ga0075431_1001859392 214
289 3300006852 Ga0075433_10002435 Ga0075433_100024353 214
290 3300006852 Ga0075433_10009354 Ga0075433_100093549 214
291 3300006880 Ga0075429_100027715 Ga0075429_1000277155 214
292 3300006881 Ga0068865_100115771 Ga0068865_1001157712 214
293 3300007265 Ga0099794_10171715 Ga0099794_101717152 214
294 3300009094 Ga0111539_10000370 Ga0111539_100003703 214
295 3300009094 Ga0111539_10440366 Ga0111539_104403662 214
296 3300009147 Ga0114129_10068941 Ga0114129_100689412 214
297 3300009147 Ga0114129_11199248 Ga0114129_111992482 214
298 3300009176 Ga0105242_10006162 Ga0105242_100061625 214
299 3300009176 Ga0105242_10143429 Ga0105242_101434293 214
300 3300025885 Ga0207653_10003610 Ga0207653_100036105 214
301 3300025885 Ga0207653_10066990 Ga0207653_100669902 214
302 3300025907 Ga0207645_10066972 Ga0207645_100669724 214
303 3300025910 Ga0207684_10010713 Ga0207684_100107136 214
304 3300025910 Ga0207684_10231548 Ga0207684_102315482 214
305 3300025917 Ga0207660_10005203 Ga0207660_100052032 214
306 3300025922 Ga0207646_10046844 Ga0207646_100468442 214
307 3300025922 Ga0207646_10093447 Ga0207646_100934472 214
308 3300025922 Ga0207646_10236519 Ga0207646_102365192 214
309 3300025927 Ga0207687_10591315 Ga0207687_105913152 214
310 3300025935 Ga0207709_10012241 Ga0207709_100122415 214
311 3300025938 Ga0207704_10466954 Ga0207704_104669541 214
312 3300025939 Ga0207665_10003678 Ga0207665_100036787 214
313 3300025942 Ga0207689_10009967 Ga0207689_100099677 214
314 3300025942 Ga0207689_10022157 Ga0207689_100221572 214
315 3300025961 Ga0207712_10100206 Ga0207712_101002061 214
316 3300026075 Ga0207708_10061594 Ga0207708_100615942 214
317 3300026116 Ga0207674_10028729 Ga0207674_100287296 214
318 3300027462 Ga0210000_1006537 Ga0210000_10065372 214
319 3300027543 Ga0209999_1002588 Ga0209999_10025882 214
320 3300027614 Ga0209970_1020572 Ga0209970_10205722 214
321 3300027665 Ga0209983_1005174 Ga0209983_10051744 214
322 3300027671 Ga0209588_1051416 Ga0209588_10514161 214
323 3300027682 Ga0209971_1000031 Ga0209971_10000319 214
324 3300027695 Ga0209966_1000020 Ga0209966_100002036 214
325 3300027717 Ga0209998_10000024 Ga0209998_1000002440 214
326 3300027876 Ga0209974_10005110 Ga0209974_100051104 214
327 3300027907 Ga0207428_10000409 Ga0207428_1000040946 214
328 3300028381 Ga0268264_10147829 Ga0268264_101478292 214
329 3300028381 Ga0268264_10784770 Ga0268264_107847702 214
330 3300031852 Ga0307410_10028158 Ga0307410_100281584 214
331 3300031995 Ga0307409_100531001 Ga0307409_1005310012 214
332 3300032126 Ga0307415_100834938 Ga0307415_1008349382 214
333 3300037466 Ga0395898_0367769 Ga0395898_0367769_285_935 214
334 3300042008 Ga0439450_020251 Ga0439450_020251_229_879 214
335 3300042461 Ga0439460_0000450 Ga0439460_0000450_970_1620 214
336 3300042876 Ga0451577_0003197 Ga0451577_0003197_13752_14435 214
337 3300042876 Ga0451577_0134764 Ga0451577_0134764_399_1049 214
338 3300042993 Ga0439440_0112885 Ga0439440_0112885_35_685 214
339 3300044673 Ga0453683_0016978 Ga0453683_0016978_184_834 214
340 3300044712 Ga0453684_0015160 Ga0453684_0015160_3236_3919 214
341 3300044712 Ga0453684_0464953 Ga0453684_0464953_121_771 214
342 3300044712 Ga0453684_0743273 Ga0453684_0743273_231_881 214
343 3300045051 Ga0451576_0013787 Ga0451576_0013787_7653_8336 214
344 3300045051 Ga0451576_0019829 Ga0451576_0019829_3858_4508 214
345 3300045051 Ga0451576_0052940 Ga0451576_0052940_813_1463 214
346 3300045051 Ga0451576_0174733 Ga0451576_0174733_1361_2011 214
347 3300045051 Ga0451576_0274098 Ga0451576_0274098_227_877 214
348 3300046664 Ga0495659_0233319 Ga0495659_0233319_58_708 214
349 3300049570 Ga0501033_0068100 Ga0501033_0068100_1490_2140 214
350 3300049570 Ga0501033_0276558 Ga0501033_0276558_503_1171 214
351 3300049573 Ga0501037_0302819 Ga0501037_0302819_347_994 214
352 3300049574 Ga0501038_0040865 Ga0501038_0040865_1166_1816 214
353 3300049574 Ga0501038_0280173 Ga0501038_0280173_218_868 214
354 3300049575 Ga0501039_0007391 Ga0501039_0007391_7404_8054 214
355 3300049575 Ga0501039_0341983 Ga0501039_0341983_80_730 214
356 3300049575 Ga0501039_0373475 Ga0501039_0373475_447_1097 214
357 3300049576 Ga0501040_0006872 Ga0501040_0006872_3851_4501 214
358 3300049576 Ga0501040_0204180 Ga0501040_0204180_544_1194 214
359 3300049577 Ga0501041_0014739 Ga0501041_0014739_1099_1749 214
360 3300049578 Ga0501042_0438186 Ga0501042_0438186_42_692 214
361 3300049578 Ga0501042_0550834 Ga0501042_0550834_46_720 214
362 3300049580 Ga0501046_0000607 Ga0501046_0000607_30716_31366 214
363 3300049581 Ga0501047_0043661 Ga0501047_0043661_1027_1677 214
364 3300049582 Ga0501048_0007236 Ga0501048_0007236_3923_4573 214
365 3300049582 Ga0501048_0205952 Ga0501048_0205952_11_661 214
366 3300049583 Ga0501067_0174383 Ga0501067_0174383_474_1124 214
367 3300049585 Ga0501069_0259851 Ga0501069_0259851_249_899 214
368 3300049586 Ga0501070_0220407 Ga0501070_0220407_14_664 214
369 3300049587 Ga0501071_0106603 Ga0501071_0106603_651_1301 214
370 3300049588 Ga0501072_0104005 Ga0501072_0104005_1234_1884 214
371 3300049588 Ga0501072_0193684 Ga0501072_0193684_581_1228 214
372 3300049588 Ga0501072_0348627 Ga0501072_0348627_73_723 214
373 3300049590 Ga0501074_0009258 Ga0501074_0009258_322_972 214
374 3300049590 Ga0501074_0583236 Ga0501074_0583236_101_751 214
375 3300049591 Ga0501075_0107835 Ga0501075_0107835_1324_1974 214
376 3300049591 Ga0501075_0109282 Ga0501075_0109282_846_1496 214
377 3300049591 Ga0501075_0132683 Ga0501075_0132683_20_670 214
378 3300049592 Ga0501076_0023309 Ga0501076_0023309_1230_1880 214
379 3300049592 Ga0501076_0371846 Ga0501076_0371846_467_1117 214
380 3300049593 Ga0501077_0019750 Ga0501077_0019750_1879_2526 214
381 3300049593 Ga0501077_0026293 Ga0501077_0026293_2867_3517 214
382 3300049593 Ga0501077_0043469 Ga0501077_0043469_1048_1722 214
383 3300049741 Ga0501079_0005375 Ga0501079_0005375_292_942 214
384 3300049741 Ga0501079_0008589 Ga0501079_0008589_3943_4617 214
385 3300049741 Ga0501079_0185493 Ga0501079_0185493_401_1051 214
386 3300049742 Ga0501080_0076967 Ga0501080_0076967_1930_2580 214
387 3300049742 Ga0501080_0246285 Ga0501080_0246285_686_1336 214
388 3300049743 Ga0501081_0532837 Ga0501081_0532837_189_839 214
389 3300049744 Ga0501083_0109881 Ga0501083_0109881_804_1454 214
390 3300049822 Ga0501035_0327865 Ga0501035_0327865_497_1147 214
391 3300049823 Ga0501044_0541039 Ga0501044_0541039_22_672 214
392 3300049824 Ga0501045_0001608 Ga0501045_0001608_1887_2537 214
393 3300049824 Ga0501045_0088616 Ga0501045_0088616_1603_2253 214
394 3300049824 Ga0501045_0182204 Ga0501045_0182204_716_1366 214
395 3300050510 nmdc:mga06r32_1254_c1 nmdc:mga06r32_1254_c1_14_697 214
396 3300050510 nmdc:mga06r32_126946_c1 nmdc:mga06r32_126946_c1_1810_2460 214
397 3300050510 nmdc:mga06r32_76307_c1 nmdc:mga06r32_76307_c1_1540_2229 214
398 3300050510 nmdc:mga06r32_90387_c1 nmdc:mga06r32_90387_c1_49_699 214
399 3300050511 nmdc:mga08y16_11942_c1 nmdc:mga08y16_11942_c1_6588_7271 214
400 3300050515 nmdc:mga0a205_49897_c1 nmdc:mga0a205_49897_c1_1296_1979 214
401 3300050515 nmdc:mga0a205_895_c1 nmdc:mga0a205_895_c1_16229_16912 214
402 3300054114 Ga0501084_0013112 Ga0501084_0013112_5877_6551 214
403 3300054114 Ga0501084_0020335 Ga0501084_0020335_3860_4510 214
404 3300054114 Ga0501084_0355655 Ga0501084_0355655_530_1180 214
405 3300060353 Ga0501082_0000058 Ga0501082_0000058_74660_75310 214
406 3300060353 Ga0501082_0419070 Ga0501082_0419070_196_870 214
407 3300061734 Ga0530510_0000450 Ga0530510_0000450_2472_3119 214
408 3300061734 Ga0530510_0057884 Ga0530510_0057884_1699_2346 214
409 3300061734 Ga0530510_0064169 Ga0530510_0064169_969_1619 214
410 3300005334 Ga0068869_100752900 Ga0068869_1007529001 215
411 3300005347 Ga0070668_100113259 Ga0070668_1001132592 215
412 3300005353 Ga0070669_100137124 Ga0070669_1001371241 215
413 3300005353 Ga0070669_100435668 Ga0070669_1004356681 215
414 3300005440 Ga0070705_100049365 Ga0070705_1000493654 215
415 3300005440 Ga0070705_100402726 Ga0070705_1004027261 215
416 3300005445 Ga0070708_100151506 Ga0070708_1001515061 215
417 3300005445 Ga0070708_100349950 Ga0070708_1003499503 215
418 3300005468 Ga0070707_100353405 Ga0070707_1003534052 215
419 3300005468 Ga0070707_100621872 Ga0070707_1006218722 215
420 3300005471 Ga0070698_100175074 Ga0070698_1001750743 215
421 3300005518 Ga0070699_100558353 Ga0070699_1005583532 215
422 3300005536 Ga0070697_100037568 Ga0070697_1000375685 215
423 3300005536 Ga0070697_100333478 Ga0070697_1003334782 215
424 3300005536 Ga0070697_100352934 Ga0070697_1003529342 215
425 3300005536 Ga0070697_100626186 Ga0070697_1006261862 215
426 3300005546 Ga0070696_100063987 Ga0070696_1000639873 215
427 3300005615 Ga0070702_100552628 Ga0070702_1005526282 215
428 3300005843 Ga0068860_100145056 Ga0068860_1001450563 215
429 3300005844 Ga0068862_100120208 Ga0068862_1001202082 215
430 3300005983 Ga0081540_1031201 Ga0081540_10312012 215
431 3300006194 Ga0075427_10018899 Ga0075427_100188992 215
432 3300006846 Ga0075430_100014245 Ga0075430_1000142454 215
433 3300006847 Ga0075431_100194061 Ga0075431_1001940611 215
434 3300006847 Ga0075431_100213890 Ga0075431_1002138902 215
435 3300006852 Ga0075433_10000230 Ga0075433_100002306 215
436 3300006852 Ga0075433_10031005 Ga0075433_100310054 215
437 3300006852 Ga0075433_10060888 Ga0075433_100608884 215
438 3300006871 Ga0075434_100011156 Ga0075434_1000111566 215
439 3300006871 Ga0075434_100024250 Ga0075434_1000242505 215
440 3300006871 Ga0075434_100146970 Ga0075434_1001469701 215
441 3300006871 Ga0075434_100316441 Ga0075434_1003164413 215
442 3300006880 Ga0075429_100001793 Ga0075429_1000017936 215
443 3300006880 Ga0075429_100041111 Ga0075429_1000411112 215
444 3300006880 Ga0075429_100234775 Ga0075429_1002347752 215
445 3300007076 Ga0075435_100039630 Ga0075435_1000396304 215
446 3300007076 Ga0075435_100129917 Ga0075435_1001299173 215
447 3300007076 Ga0075435_100169695 Ga0075435_1001696952 215
448 3300007265 Ga0099794_10003968 Ga0099794_100039683 215
449 3300009093 Ga0105240_10533011 Ga0105240_105330111 215
450 3300009094 Ga0111539_10004176 Ga0111539_1000417615 215
451 3300009094 Ga0111539_10008974 Ga0111539_1000897410 215
452 3300009094 Ga0111539_10516311 Ga0111539_105163112 215
453 3300009147 Ga0114129_10008029 Ga0114129_1000802912 215
454 3300009147 Ga0114129_10100951 Ga0114129_101009514 215
455 3300009147 Ga0114129_10216347 Ga0114129_102163473 215
456 3300009147 Ga0114129_10680498 Ga0114129_106804982 215
457 3300009147 Ga0114129_11232827 Ga0114129_112328272 215
458 3300009174 Ga0105241_10000218 Ga0105241_100002184 215
459 3300013100 Ga0157373_10000381 Ga0157373_1000038112 215
460 3300013102 Ga0157371_10057611 Ga0157371_100576112 215
461 3300013105 Ga0157369_10021069 Ga0157369_100210697 215
462 3300013297 Ga0157378_10751653 Ga0157378_107516531 215
463 3300013306 Ga0163162_10779799 Ga0163162_107797992 215
464 3300013307 Ga0157372_10001479 Ga0157372_1000147913 215
465 3300014325 Ga0163163_10050672 Ga0163163_100506725 215
466 3300014745 Ga0157377_10478851 Ga0157377_104788512 215
467 3300015262 Ga0182007_10029431 Ga0182007_100294313 215
468 3300025910 Ga0207684_10043067 Ga0207684_100430674 215
469 3300025910 Ga0207684_10075571 Ga0207684_100755713 215
470 3300025922 Ga0207646_10121000 Ga0207646_101210002 215
471 3300025940 Ga0207691_10251353 Ga0207691_102513532 215
472 3300025972 Ga0207668_10093678 Ga0207668_100936783 215
473 3300027671 Ga0209588_1009645 Ga0209588_10096454 215
474 3300027907 Ga0207428_10000138 Ga0207428_1000013899 215
475 3300028380 Ga0268265_10052643 Ga0268265_100526432 215
476 3300028381 Ga0268264_10288131 Ga0268264_102881312 215
477 3300035084 Ga0373928_0029543 Ga0373928_0029543_16_666 215
478 3300035085 Ga0373929_0011061 Ga0373929_0011061_881_1534 215
479 3300035088 Ga0373940_0006109 Ga0373940_0006109_1754_2407 215
480 3300035088 Ga0373940_0015581 Ga0373940_0015581_1022_1672 215
481 3300035090 Ga0373949_0005165 Ga0373949_0005165_1340_1993 215
482 3300035090 Ga0373949_0019112 Ga0373949_0019112_184_834 215
483 3300035114 Ga0373939_0009908 Ga0373939_0009908_878_1528 215
484 3300035115 Ga0373941_0071947 Ga0373941_0071947_115_765 215
485 3300035242 Ga0373962_0115907 Ga0373962_0115907_109_759 215
486 3300035691 Ga0373931_0017353 Ga0373931_0017353_178_828 215
487 3300035691 Ga0373931_0078337 Ga0373931_0078337_229_879 215
488 3300042005 Ga0439448_0003645 Ga0439448_0003645_817_1470 215
489 3300042012 Ga0439455_0032411 Ga0439455_0032411_240_893 215
490 3300042438 Ga0439459_0008936 Ga0439459_0008936_113_766 215
491 3300042876 Ga0451577_0023850 Ga0451577_0023850_2868_3521 215
492 3300045051 Ga0451576_0042741 Ga0451576_0042741_876_1526 215
493 3300045051 Ga0451576_0075083 Ga0451576_0075083_2173_2823 215
494 3300045051 Ga0451576_0175287 Ga0451576_0175287_1408_2061 215
495 3300046472 Ga0495580_0000331 Ga0495580_0000331_3831_4481 215
496 3300046491 Ga0495584_0134496 Ga0495584_0134496_354_1004 215
497 3300046528 Ga0495642_0033480 Ga0495642_0033480_204_854 215
498 3300046664 Ga0495659_0029601 Ga0495659_0029601_1032_1682 215
499 3300047318 Ga0495636_0024339 Ga0495636_0024339_32_682 215
500 3300048905 Ga0496102_0053609 Ga0496102_0053609_149_802 215
501 3300048915 Ga0496112_0785337 Ga0496112_0785337_45_698 215
502 3300049580 Ga0501046_0204573 Ga0501046_0204573_740_1390 215
503 3300049743 Ga0501081_0184231 Ga0501081_0184231_121_774 215
504 3300050507 nmdc:mga05p37_204587_c1 nmdc:mga05p37_204587_c1_978_1628 215
505 3300050507 nmdc:mga05p37_205700_c1 nmdc:mga05p37_205700_c1_121_771 215
506 3300050507 nmdc:mga05p37_307277_c1 nmdc:mga05p37_307277_c1_134_787 215
507 3300050507 nmdc:mga05p37_57280_c1 nmdc:mga05p37_57280_c1_2615_3265 215
508 3300050507 nmdc:mga05p37_88173_c1 nmdc:mga05p37_88173_c1_1213_1863 215
509 3300050508 nmdc:mga09592_33850_c1 nmdc:mga09592_33850_c1_1268_1918 215
510 3300050508 nmdc:mga09592_92879_c1 nmdc:mga09592_92879_c1_1545_2195 215
511 3300050509 nmdc:mga0qj67_14460_c1 nmdc:mga0qj67_14460_c1_3077_3727 215
512 3300050510 nmdc:mga06r32_113820_c1 nmdc:mga06r32_113820_c1_228_878 215
513 3300050510 nmdc:mga06r32_6047_c1 nmdc:mga06r32_6047_c1_2931_3581 215
514 3300050511 nmdc:mga08y16_2476_c1 nmdc:mga08y16_2476_c1_3908_4558 215
515 3300050511 nmdc:mga08y16_29427_c1 nmdc:mga08y16_29427_c1_1963_2613 215
516 3300050512 nmdc:mga0n895_126103_c1 nmdc:mga0n895_126103_c1_1005_1658 215
517 3300050512 nmdc:mga0n895_34456_c1 nmdc:mga0n895_34456_c1_1282_1932 215
518 3300050512 nmdc:mga0n895_78605_c1 nmdc:mga0n895_78605_c1_541_1191 215
519 3300050512 nmdc:mga0n895_80201_c1 nmdc:mga0n895_80201_c1_170_820 215
520 3300050512 nmdc:mga0n895_84364_c1 nmdc:mga0n895_84364_c1_1854_2504 215
521 3300050513 nmdc:mga0rr50_165341_c1 nmdc:mga0rr50_165341_c1_441_1091 215
522 3300050513 nmdc:mga0rr50_226090_c1 nmdc:mga0rr50_226090_c1_504_1154 215
523 3300050513 nmdc:mga0rr50_36119_c1 nmdc:mga0rr50_36119_c1_602_1252 215
524 3300050513 nmdc:mga0rr50_62639_c1 nmdc:mga0rr50_62639_c1_1100_1750 215
525 3300050514 nmdc:mga08x19_359253_c1 nmdc:mga08x19_359253_c1_183_836 215
526 3300050515 nmdc:mga0a205_12408_c1 nmdc:mga0a205_12408_c1_2967_3617 215
527 3300050515 nmdc:mga0a205_243123_c1 nmdc:mga0a205_243123_c1_17_667 215
528 3300050515 nmdc:mga0a205_34506_c1 nmdc:mga0a205_34506_c1_1249_1899 215
529 3300050515 nmdc:mga0a205_46561_c1 nmdc:mga0a205_46561_c1_2083_2736 215
530 3300054114 Ga0501084_0136774 Ga0501084_0136774_240_890 215
531 3300005467 Ga0070706_100210726 Ga0070706_1002107263 216
532 3300005546 Ga0070696_100006243 Ga0070696_1000062437 216
533 3300007265 Ga0099794_10069564 Ga0099794_100695642 216
534 3300042461 Ga0439460_0188863 Ga0439460_0188863_15_677 216
535 3300005468 Ga0070707_100027866 Ga0070707_1000278665 217
536 3300005468 Ga0070707_100556716 Ga0070707_1005567162 217
537 3300005518 Ga0070699_100110951 Ga0070699_1001109513 217
538 3300006844 Ga0075428_100513343 Ga0075428_1005133432 217
539 3300006847 Ga0075431_100254142 Ga0075431_1002541423 217
540 3300006871 Ga0075434_100133814 Ga0075434_1001338142 217
541 3300007076 Ga0075435_100005683 Ga0075435_1000056834 217
542 3300009147 Ga0114129_10000599 Ga0114129_1000059938 217
543 3300009147 Ga0114129_10453015 Ga0114129_104530152 217
544 3300025910 Ga0207684_10424533 Ga0207684_104245332 217
545 3300025922 Ga0207646_10027112 Ga0207646_100271126 217
546 3300025922 Ga0207646_10382215 Ga0207646_103822152 217
547 3300025923 Ga0207681_10251962 Ga0207681_102519622 217
548 3300034817 Ga0373948_0007102 Ga0373948_0007102_962_1624 217
549 3300049576 Ga0501040_0021010 Ga0501040_0021010_357_1013 217
550 3300050507 nmdc:mga05p37_369731_c1 nmdc:mga05p37_369731_c1_416_1075 217
551 3300050507 nmdc:mga05p37_93330_c1 nmdc:mga05p37_93330_c1_517_1176 217
552 3300050510 nmdc:mga06r32_171864_c1 nmdc:mga06r32_171864_c1_399_1058 217
553 3300050512 nmdc:mga0n895_111725_c1 nmdc:mga0n895_111725_c1_1153_1809 217
554 3300050513 nmdc:mga0rr50_3069_c1 nmdc:mga0rr50_3069_c1_6297_6953 217
555 3300005459 Ga0068867_100268865 Ga0068867_1002688652 218
556 3300005467 Ga0070706_100057489 Ga0070706_1000574893 218
557 3300005546 Ga0070696_100078406 Ga0070696_1000784062 218
558 3300005718 Ga0068866_10200476 Ga0068866_102004761 218
559 3300006852 Ga0075433_10474659 Ga0075433_104746592 218
560 3300006871 Ga0075434_100012438 Ga0075434_1000124387 218
561 3300006871 Ga0075434_100040276 Ga0075434_1000402764 218
562 3300007076 Ga0075435_100909057 Ga0075435_1009090572 218
563 3300009094 Ga0111539_10187950 Ga0111539_101879504 218
564 3300009147 Ga0114129_10091152 Ga0114129_100911523 218
565 3300009147 Ga0114129_11189518 Ga0114129_111895182 218
566 3300025910 Ga0207684_10049280 Ga0207684_100492804 218
567 3300025941 Ga0207711_10905625 Ga0207711_109056251 218
568 3300026118 Ga0207675_100235570 Ga0207675_1002355702 218
569 3300031548 Ga0307408_100235812 Ga0307408_1002358122 218
570 3300035115 Ga0373941_0024074 Ga0373941_0024074_986_1645 218
571 3300037471 Ga0395905_0063962 Ga0395905_0063962_1642_2298 218
572 3300048916 Ga0496113_0278880 Ga0496113_0278880_264_926 218
573 3300049572 Ga0501036_0407724 Ga0501036_0407724_367_1029 218
574 3300050512 nmdc:mga0n895_5572_c1 nmdc:mga0n895_5572_c1_5699_6361 218
575 3300050512 nmdc:mga0n895_8027_c1 nmdc:mga0n895_8027_c1_1212_1874 218
576 3300050515 nmdc:mga0a205_471770_c1 nmdc:mga0a205_471770_c1_364_1026 218
577 3300005336 Ga0070680_100072211 Ga0070680_1000722114 219
578 3300005347 Ga0070668_100034892 Ga0070668_1000348923 219
579 3300005353 Ga0070669_100002755 Ga0070669_10000275511 219
580 3300005458 Ga0070681_10172144 Ga0070681_101721443 219
581 3300005543 Ga0070672_100054067 Ga0070672_1000540674 219
582 3300005549 Ga0070704_100007035 Ga0070704_1000070351 219
583 3300005719 Ga0068861_100018163 Ga0068861_1000181632 219
584 3300005719 Ga0068861_100984354 Ga0068861_1009843541 219
585 3300005844 Ga0068862_100352237 Ga0068862_1003522373 219
586 3300006844 Ga0075428_100002164 Ga0075428_1000021643 219
587 3300006844 Ga0075428_100026706 Ga0075428_1000267067 219
588 3300006846 Ga0075430_100000893 Ga0075430_1000008937 219
589 3300006846 Ga0075430_100004400 Ga0075430_1000044008 219
590 3300006846 Ga0075430_100197153 Ga0075430_1001971533 219
591 3300006847 Ga0075431_100006168 Ga0075431_1000061688 219
592 3300006847 Ga0075431_100022517 Ga0075431_1000225177 219
593 3300006852 Ga0075433_10123928 Ga0075433_101239283 219
594 3300006880 Ga0075429_100000757 Ga0075429_10000075723 219
595 3300006914 Ga0075436_100120872 Ga0075436_1001208722 219
596 3300009094 Ga0111539_10007648 Ga0111539_100076487 219
597 3300009147 Ga0114129_10133835 Ga0114129_101338354 219
598 3300009174 Ga0105241_10067794 Ga0105241_100677944 219
599 3300013306 Ga0163162_10024603 Ga0163162_100246034 219
600 3300013308 Ga0157375_10648749 Ga0157375_106487492 219
601 3300025911 Ga0207654_10039930 Ga0207654_100399303 219
602 3300025917 Ga0207660_10059601 Ga0207660_100596013 219
603 3300025923 Ga0207681_10014404 Ga0207681_100144048 219
604 3300025933 Ga0207706_10049930 Ga0207706_100499304 219
605 3300025940 Ga0207691_10066559 Ga0207691_100665592 219
606 3300025972 Ga0207668_10014274 Ga0207668_100142745 219
607 3300026088 Ga0207641_10082848 Ga0207641_100828482 219
608 3300026118 Ga0207675_100027101 Ga0207675_1000271012 219
609 3300027907 Ga0207428_10012663 Ga0207428_100126632 219
610 3300031548 Ga0307408_100024853 Ga0307408_1000248536 219
611 3300031548 Ga0307408_100140660 Ga0307408_1001406602 219
612 3300031901 Ga0307406_10452266 Ga0307406_104522662 219
613 3300031911 Ga0307412_10316842 Ga0307412_103168422 219
614 3300032002 Ga0307416_100042740 Ga0307416_1000427404 219
615 3300032005 Ga0307411_10147962 Ga0307411_101479623 219
616 3300032005 Ga0307411_10392343 Ga0307411_103923432 219
617 3300035691 Ga0373931_0001837 Ga0373931_0001837_5876_6538 219
618 3300037418 Ga0395900_0013033 Ga0395900_0013033_1415_2077 219
619 3300037466 Ga0395898_0017571 Ga0395898_0017571_1909_2571 219
620 3300038443 Ga0395901_0000399 Ga0395901_0000399_3250_3912 219
621 3300046684 Ga0495669_0046440 Ga0495669_0046440_1221_1886 219
622 3300048905 Ga0496102_0037829 Ga0496102_0037829_1152_1814 219
623 3300048906 Ga0496103_0030162 Ga0496103_0030162_1055_1717 219
624 3300048918 Ga0496115_0614128 Ga0496115_0614128_29_694 219
625 3300049576 Ga0501040_0388784 Ga0501040_0388784_118_780 219
626 3300049576 Ga0501040_0449011 Ga0501040_0449011_129_791 219
627 3300049580 Ga0501046_0286860 Ga0501046_0286860_380_1042 219
628 3300049582 Ga0501048_0073608 Ga0501048_0073608_933_1595 219
629 3300049584 Ga0501068_0455525 Ga0501068_0455525_117_785 219
630 3300049587 Ga0501071_0142678 Ga0501071_0142678_183_848 219
631 3300049587 Ga0501071_0613131 Ga0501071_0613131_129_791 219
632 3300049588 Ga0501072_0041240 Ga0501072_0041240_1294_1956 219
633 3300049588 Ga0501072_0094719 Ga0501072_0094719_1577_2242 219
634 3300049588 Ga0501072_0680128 Ga0501072_0680128_43_705 219
635 3300049590 Ga0501074_0342906 Ga0501074_0342906_354_1019 219
636 3300049591 Ga0501075_0025612 Ga0501075_0025612_3146_3811 219
637 3300049591 Ga0501075_0048326 Ga0501075_0048326_274_936 219
638 3300049592 Ga0501076_0202293 Ga0501076_0202293_162_824 219
639 3300049592 Ga0501076_0365349 Ga0501076_0365349_357_1022 219
640 3300049593 Ga0501077_0137967 Ga0501077_0137967_818_1480 219
641 3300049741 Ga0501079_0137027 Ga0501079_0137027_653_1315 219
642 3300049741 Ga0501079_0489411 Ga0501079_0489411_155_820 219
643 3300049743 Ga0501081_0174832 Ga0501081_0174832_186_851 219
644 3300049824 Ga0501045_0016844 Ga0501045_0016844_2328_2990 219
645 3300050507 nmdc:mga05p37_38692_c1 nmdc:mga05p37_38692_c1_1958_2620 219
646 3300050507 nmdc:mga05p37_7885_c1 nmdc:mga05p37_7885_c1_1280_1942 219
647 3300050508 nmdc:mga09592_1012_c1 nmdc:mga09592_1012_c1_15753_16415 219
648 3300050508 nmdc:mga09592_73228_c1 nmdc:mga09592_73228_c1_2026_2688 219
649 3300050509 nmdc:mga0qj67_107659_c1 nmdc:mga0qj67_107659_c1_400_1062 219
650 3300050509 nmdc:mga0qj67_195369_c1 nmdc:mga0qj67_195369_c1_385_1056 219
651 3300050509 nmdc:mga0qj67_2246_c1 nmdc:mga0qj67_2246_c1_7603_8265 219
652 3300050510 nmdc:mga06r32_1549_c1 nmdc:mga06r32_1549_c1_10810_11472 219
653 3300050510 nmdc:mga06r32_22559_c1 nmdc:mga06r32_22559_c1_3744_4406 219
654 3300050510 nmdc:mga06r32_396971_c1 nmdc:mga06r32_396971_c1_247_909 219
655 3300050511 nmdc:mga08y16_191654_c2 nmdc:mga08y16_191654_c2_565_1227 219
656 3300050511 nmdc:mga08y16_1957_c1 nmdc:mga08y16_1957_c1_16195_16866 219
657 3300050515 nmdc:mga0a205_90400_c1 nmdc:mga0a205_90400_c1_1026_1688 219
658 3300054114 Ga0501084_0117216 Ga0501084_0117216_349_1014 219
659 3300054114 Ga0501084_0501245 Ga0501084_0501245_286_948 219
660 3300060353 Ga0501082_0363165 Ga0501082_0363165_460_1125 219
661 3300060353 Ga0501082_0376291 Ga0501082_0376291_460_1125 219
662 3300061734 Ga0530510_0090245 Ga0530510_0090245_103_765 219
663 3300061734 Ga0530510_0112264 Ga0530510_0112264_350_1015 219
664 3300061734 Ga0530510_0607403 Ga0530510_0607403_17_682 219
665 3300003203 JGI25406J46586_10028175 JGI25406J46586_100281752 220
666 3300005445 Ga0070708_100022796 Ga0070708_1000227964 220
667 3300005467 Ga0070706_100245027 Ga0070706_1002450271 220
668 3300005468 Ga0070707_100005653 Ga0070707_10000565311 220
669 3300005471 Ga0070698_100006077 Ga0070698_10000607711 220
670 3300005518 Ga0070699_100002451 Ga0070699_1000024519 220
671 3300005536 Ga0070697_100000846 Ga0070697_10000084614 220
672 3300005536 Ga0070697_100020579 Ga0070697_1000205794 220
673 3300005985 Ga0081539_10000009 Ga0081539_10000009152 220
674 3300006844 Ga0075428_100004920 Ga0075428_1000049207 220
675 3300006846 Ga0075430_100040160 Ga0075430_1000401604 220
676 3300006846 Ga0075430_100068786 Ga0075430_1000687862 220
677 3300006846 Ga0075430_100159814 Ga0075430_1001598142 220
678 3300006847 Ga0075431_100000158 Ga0075431_10000015839 220
679 3300006847 Ga0075431_100006780 Ga0075431_1000067802 220
680 3300006847 Ga0075431_100028177 Ga0075431_1000281772 220
681 3300006847 Ga0075431_100054782 Ga0075431_1000547824 220
682 3300006852 Ga0075433_10000972 Ga0075433_1000097221 220
683 3300006871 Ga0075434_100024062 Ga0075434_1000240628 220
684 3300006871 Ga0075434_100276426 Ga0075434_1002764263 220
685 3300006880 Ga0075429_100008188 Ga0075429_1000081887 220
686 3300006880 Ga0075429_100026975 Ga0075429_1000269754 220
687 3300006880 Ga0075429_100484202 Ga0075429_1004842022 220
688 3300006914 Ga0075436_100018220 Ga0075436_1000182204 220
689 3300007076 Ga0075435_100011827 Ga0075435_1000118276 220
690 3300007265 Ga0099794_10167659 Ga0099794_101676592 220
691 3300009147 Ga0114129_10000443 Ga0114129_1000044311 220
692 3300009147 Ga0114129_10001075 Ga0114129_1000107512 220
693 3300009147 Ga0114129_10045651 Ga0114129_100456514 220
694 3300009147 Ga0114129_10158841 Ga0114129_101588413 220
695 3300009147 Ga0114129_10510338 Ga0114129_105103382 220
696 3300025910 Ga0207684_10000169 Ga0207684_1000016929 220
697 3300025922 Ga0207646_10003463 Ga0207646_100034637 220
698 3300027671 Ga0209588_1072873 Ga0209588_10728732 220
699 3300027682 Ga0209971_1010932 Ga0209971_10109323 220
700 3300031548 Ga0307408_100343939 Ga0307408_1003439392 220
701 3300031903 Ga0307407_10262197 Ga0307407_102621972 220
702 3300031995 Ga0307409_100276974 Ga0307409_1002769742 220
703 3300032005 Ga0307411_10281958 Ga0307411_102819582 220
704 3300037418 Ga0395900_0077489 Ga0395900_0077489_2453_3115 220
705 3300049568 Ga0501031_0386765 Ga0501031_0386765_26_694 220
706 3300049576 Ga0501040_0074291 Ga0501040_0074291_331_999 220
707 3300049577 Ga0501041_0065151 Ga0501041_0065151_933_1601 220
708 3300049578 Ga0501042_0090362 Ga0501042_0090362_67_735 220
709 3300049582 Ga0501048_0120245 Ga0501048_0120245_661_1329 220
710 3300049583 Ga0501067_0075070 Ga0501067_0075070_822_1487 220
711 3300049584 Ga0501068_0381120 Ga0501068_0381120_29_694 220
712 3300049585 Ga0501069_0082927 Ga0501069_0082927_16_681 220
713 3300049588 Ga0501072_0003099 Ga0501072_0003099_11827_12495 220
714 3300049591 Ga0501075_0011581 Ga0501075_0011581_2410_3078 220
715 3300049591 Ga0501075_0062232 Ga0501075_0062232_1153_1821 220
716 3300049591 Ga0501075_0264737 Ga0501075_0264737_515_1180 220
717 3300049592 Ga0501076_0043424 Ga0501076_0043424_2618_3286 220
718 3300049592 Ga0501076_0153622 Ga0501076_0153622_463_1131 220
719 3300049593 Ga0501077_0007562 Ga0501077_0007562_3031_3699 220
720 3300049741 Ga0501079_0005322 Ga0501079_0005322_2076_2744 220
721 3300049743 Ga0501081_0066508 Ga0501081_0066508_1571_2236 220
722 3300049743 Ga0501081_0135062 Ga0501081_0135062_782_1450 220
723 3300049743 Ga0501081_0172389 Ga0501081_0172389_881_1549 220
724 3300050507 nmdc:mga05p37_1126565_c1 nmdc:mga05p37_1126565_c1_130_792 220
725 3300050507 nmdc:mga05p37_199_c1 nmdc:mga05p37_199_c1_9129_9791 220
726 3300050507 nmdc:mga05p37_22487_c1 nmdc:mga05p37_22487_c1_228_896 220
727 3300050507 nmdc:mga05p37_38_c1 nmdc:mga05p37_38_c1_30179_30841 220
728 3300050507 nmdc:mga05p37_78211_c1 nmdc:mga05p37_78211_c1_144_806 220
729 3300050507 nmdc:mga05p37_94383_c1 nmdc:mga05p37_94383_c1_60_725 220
730 3300050508 nmdc:mga09592_10352_c1 nmdc:mga09592_10352_c1_4029_4697 220
731 3300050508 nmdc:mga09592_31298_c1 nmdc:mga09592_31298_c1_1147_1815 220
732 3300050508 nmdc:mga09592_4445_c1 nmdc:mga09592_4445_c1_4206_4868 220
733 3300050509 nmdc:mga0qj67_86808_c1 nmdc:mga0qj67_86808_c1_1585_2247 220
734 3300050510 nmdc:mga06r32_200044_c1 nmdc:mga06r32_200044_c1_1262_1930 220
735 3300050510 nmdc:mga06r32_287_c1 nmdc:mga06r32_287_c1_7472_8134 220
736 3300050510 nmdc:mga06r32_61109_c1 nmdc:mga06r32_61109_c1_2484_3146 220
737 3300050512 nmdc:mga0n895_302619_c1 nmdc:mga0n895_302619_c1_885_1547 220
738 3300050512 nmdc:mga0n895_61_c1 nmdc:mga0n895_61_c1_33933_34595 220
739 3300050513 nmdc:mga0rr50_7191_c1 nmdc:mga0rr50_7191_c1_2788_3450 220
740 3300050514 nmdc:mga08x19_9023_c1 nmdc:mga08x19_9023_c1_4859_5521 220
741 3300050515 nmdc:mga0a205_122_c1 nmdc:mga0a205_122_c1_19987_20649 220
742 3300054114 Ga0501084_0006427 Ga0501084_0006427_4204_4872 220
743 3300060353 Ga0501082_0007387 Ga0501082_0007387_8281_8949 220
744 3300060353 Ga0501082_0455497 Ga0501082_0455497_428_1096 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14520

HHH_5

Helix-hairpin-helix domain

108

165

0.95

PF01330

RuvA_N

RuvA N terminal domain

29

93

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9188 1 141
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.91 1 139
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9089 1 142
2zte-assembly1.cif.gz_A mtruva form iv 0.9028 2 139
1ixr-assembly1.cif.gz_A ruva-ruvb complex 0.8997 1 140
ID Description Score Start End Superfamily
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9484 74 139 1.10.150.20
2h5xB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9454 76 139 1.10.150.20
2h5xC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9448 76 140 1.10.150.20
2h5xD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9393 76 139 1.10.150.20
1bvsB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9347 77 139 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A2V6PAU5-F1-model_v4 Holliday junction DNA helicase RuvA 0.9704 1 141 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A2V6PAU5-F1-model_v4 Holliday junction DNA helicase RuvA 0.9504 1 141 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A661TB17-F1-model_v4 Holliday junction DNA helicase RuvA 0.9397 1 139 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A1W9T6H9-F1-model_v4 Holliday junction DNA helicase RuvA 0.9362 1 136 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A350PD89-F1-model_v4 Holliday junction branch migration protein RuvA 0.9289 1 136 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378

Feature Viewer

pLDDT pTM Quality
86.25 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map