F478735
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 744 | 240 | 744 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10143429|Ga0105242_101434293 |
| Length | 243 |
| Sequence | MAPALPQWRTTVEPGRAPVHLVADRRPVIASLRGKLRRKLEDRVVVEAAGVGYEVFVPPVTQQELVHAKAADGDAADEVALEIHYHATQNQPKPVLIGFTSELDREFFEKLITVKDVGPMVAARSLAAPVGEIAAAIARQDEGYLRRLPGIGPQKAKNIVAQLQAKVAKFALAKGDTASPEPAAVVAPDEEALRGMVFDILVKQLGYRPSEAAPIIGAALTRRPGVTTPEELLDEIYRGGRKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 166 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 178 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 179 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 180 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 181 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 239 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.81 |
| Rhizosphere | 99.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10028175 | 3300003203 | Bacteria | 2143 |
| 2 | Ga0070676_10000920 | 3300005328 | Bacteria | 14563 |
| 3 | Ga0070690_100110993 | 3300005330 | Bacteria | 1830 |
| 4 | Ga0070670_100056748 | 3300005331 | Bacteria | 3361 |
| 5 | Ga0068869_100006522 | 3300005334 | Bacteria | 7407 |
| 6 | Ga0068869_100012050 | 3300005334 | Bacteria | 5697 |
| 7 | Ga0068869_100100593 | 3300005334 | Bacteria | 2186 |
| 8 | Ga0068869_100752900 | 3300005334 | Bacteria | 834 |
| 9 | Ga0070680_100004576 | 3300005336 | Bacteria | 10399 |
| 10 | Ga0070680_100072211 | 3300005336 | Bacteria | 2837 |
| 11 | Ga0070680_100184864 | 3300005336 | Bacteria | 1755 |
| 12 | Ga0070682_100005442 | 3300005337 | Bacteria | 7097 |
| 13 | Ga0068868_100089220 | 3300005338 | Bacteria | 2482 |
| 14 | Ga0068868_100364000 | 3300005338 | Bacteria | 1241 |
| 15 | Ga0070660_100000332 | 3300005339 | Bacteria | 31219 |
| 16 | Ga0070691_10017004 | 3300005341 | Bacteria | 3346 |
| 17 | Ga0070691_10024098 | 3300005341 | Bacteria | 2828 |
| 18 | Ga0070687_100010610 | 3300005343 | Bacteria | 3994 |
| 19 | Ga0070692_10002146 | 3300005345 | Bacteria | 7559 |
| 20 | Ga0070668_100034892 | 3300005347 | Bacteria | 3834 |
| 21 | Ga0070668_100113259 | 3300005347 | Bacteria | 2161 |
| 22 | Ga0070668_100669352 | 3300005347 | Bacteria | 913 |
| 23 | Ga0070669_100002755 | 3300005353 | Bacteria | 12681 |
| 24 | Ga0070669_100137124 | 3300005353 | Bacteria | 1883 |
| 25 | Ga0070669_100435668 | 3300005353 | Bacteria | 1078 |
| 26 | Ga0070673_100707712 | 3300005364 | Bacteria | 925 |
| 27 | Ga0070688_100360128 | 3300005365 | Bacteria | 1067 |
| 28 | Ga0070659_100001428 | 3300005366 | Bacteria | 17225 |
| 29 | Ga0070667_100292925 | 3300005367 | Bacteria | 1464 |
| 30 | Ga0070703_10007460 | 3300005406 | Bacteria | 3072 |
| 31 | Ga0070703_10014072 | 3300005406 | Bacteria | 2275 |
| 32 | Ga0070703_10052798 | 3300005406 | Bacteria | 1305 |
| 33 | Ga0070709_10026406 | 3300005434 | Bacteria | 3442 |
| 34 | Ga0070701_10005551 | 3300005438 | Bacteria | 5220 |
| 35 | Ga0070705_100000542 | 3300005440 | Bacteria | 21855 |
| 36 | Ga0070705_100049365 | 3300005440 | Bacteria | 2443 |
| 37 | Ga0070705_100072301 | 3300005440 | Bacteria | 2089 |
| 38 | Ga0070705_100092202 | 3300005440 | Bacteria | 1890 |
| 39 | Ga0070705_100402726 | 3300005440 | Bacteria | 1014 |
| 40 | Ga0070700_100005861 | 3300005441 | Bacteria | 6525 |
| 41 | Ga0070694_100000839 | 3300005444 | Bacteria | 17297 |
| 42 | Ga0070694_100003904 | 3300005444 | Bacteria | 8915 |
| 43 | Ga0070694_100010230 | 3300005444 | Bacteria | 5778 |
| 44 | Ga0070694_100019487 | 3300005444 | Bacteria | 4315 |
| 45 | Ga0070694_100081405 | 3300005444 | Bacteria | 2252 |
| 46 | Ga0070708_100022796 | 3300005445 | Bacteria | 5316 |
| 47 | Ga0070708_100028980 | 3300005445 | Bacteria | 4770 |
| 48 | Ga0070708_100057528 | 3300005445 | Bacteria | 3462 |
| 49 | Ga0070708_100151506 | 3300005445 | Bacteria | 2157 |
| 50 | Ga0070708_100191878 | 3300005445 | Bacteria | 1911 |
| 51 | Ga0070708_100219312 | 3300005445 | Bacteria | 1783 |
| 52 | Ga0070708_100262388 | 3300005445 | Bacteria | 1624 |
| 53 | Ga0070708_100349950 | 3300005445 | Bacteria | 1392 |
| 54 | Ga0070663_100002069 | 3300005455 | Bacteria | 11198 |
| 55 | Ga0070662_100009230 | 3300005457 | Bacteria | 6441 |
| 56 | Ga0070662_100130905 | 3300005457 | Bacteria | 1934 |
| 57 | Ga0070681_10018854 | 3300005458 | Bacteria | 6904 |
| 58 | Ga0070681_10172144 | 3300005458 | Bacteria | 2087 |
| 59 | Ga0068867_100000884 | 3300005459 | Bacteria | 20270 |
| 60 | Ga0068867_100268865 | 3300005459 | Bacteria | 1393 |
| 61 | Ga0070706_100024514 | 3300005467 | Bacteria | 5554 |
| 62 | Ga0070706_100024833 | 3300005467 | Bacteria | 5517 |
| 63 | Ga0070706_100036412 | 3300005467 | Bacteria | 4545 |
| 64 | Ga0070706_100057489 | 3300005467 | Bacteria | 3589 |
| 65 | Ga0070706_100194901 | 3300005467 | Bacteria | 1893 |
| 66 | Ga0070706_100210726 | 3300005467 | Unclassified | 1815 |
| 67 | Ga0070706_100245027 | 3300005467 | Bacteria | 1673 |
| 68 | Ga0070706_100435422 | 3300005467 | Bacteria | 1220 |
| 69 | Ga0070707_100005653 | 3300005468 | Bacteria | 11677 |
| 70 | Ga0070707_100007265 | 3300005468 | Bacteria | 10285 |
| 71 | Ga0070707_100027866 | 3300005468 | Bacteria | 5374 |
| 72 | Ga0070707_100032051 | 3300005468 | Bacteria | 5006 |
| 73 | Ga0070707_100036260 | 3300005468 | Bacteria | 4705 |
| 74 | Ga0070707_100088877 | 3300005468 | Bacteria | 2989 |
| 75 | Ga0070707_100195730 | 3300005468 | Bacteria | 1971 |
| 76 | Ga0070707_100353405 | 3300005468 | Bacteria | 1427 |
| 77 | Ga0070707_100400511 | 3300005468 | Unclassified | 1332 |
| 78 | Ga0070707_100556716 | 3300005468 | Bacteria | 1109 |
| 79 | Ga0070707_100621872 | 3300005468 | Bacteria | 1042 |
| 80 | Ga0070698_100006077 | 3300005471 | Bacteria | 13151 |
| 81 | Ga0070698_100014079 | 3300005471 | Bacteria | 8457 |
| 82 | Ga0070698_100063516 | 3300005471 | Bacteria | 3723 |
| 83 | Ga0070698_100175074 | 3300005471 | Bacteria | 2085 |
| 84 | Ga0070699_100001741 | 3300005518 | Bacteria | 19879 |
| 85 | Ga0070699_100002451 | 3300005518 | Bacteria | 16672 |
| 86 | Ga0070699_100009282 | 3300005518 | Bacteria | 8521 |
| 87 | Ga0070699_100022694 | 3300005518 | Bacteria | 5409 |
| 88 | Ga0070699_100028105 | 3300005518 | Bacteria | 4850 |
| 89 | Ga0070699_100038935 | 3300005518 | Bacteria | 4116 |
| 90 | Ga0070699_100058928 | 3300005518 | Bacteria | 3327 |
| 91 | Ga0070699_100110951 | 3300005518 | Bacteria | 2408 |
| 92 | Ga0070699_100119845 | 3300005518 | Bacteria | 2313 |
| 93 | Ga0070699_100558353 | 3300005518 | Bacteria | 1042 |
| 94 | Ga0070679_100000895 | 3300005530 | Bacteria | 25859 |
| 95 | Ga0070684_100046493 | 3300005535 | Bacteria | 3761 |
| 96 | Ga0070697_100000846 | 3300005536 | Bacteria | 23019 |
| 97 | Ga0070697_100012093 | 3300005536 | Bacteria | 6758 |
| 98 | Ga0070697_100020579 | 3300005536 | Bacteria | 5221 |
| 99 | Ga0070697_100031758 | 3300005536 | Bacteria | 4248 |
| 100 | Ga0070697_100037568 | 3300005536 | Bacteria | 3912 |
| 101 | Ga0070697_100199133 | 3300005536 | Bacteria | 1702 |
| 102 | Ga0070697_100333478 | 3300005536 | Bacteria | 1308 |
| 103 | Ga0070697_100352934 | 3300005536 | Bacteria | 1270 |
| 104 | Ga0070697_100626186 | 3300005536 | Bacteria | 947 |
| 105 | Ga0068853_100002471 | 3300005539 | Bacteria | 13838 |
| 106 | Ga0070672_100054067 | 3300005543 | Bacteria | 3142 |
| 107 | Ga0070672_100100497 | 3300005543 | Bacteria | 2346 |
| 108 | Ga0070686_100243475 | 3300005544 | Bacteria | 1311 |
| 109 | Ga0070695_100000685 | 3300005545 | Bacteria | 18104 |
| 110 | Ga0070695_100004819 | 3300005545 | Bacteria | 7939 |
| 111 | Ga0070695_100006806 | 3300005545 | Bacteria | 6768 |
| 112 | Ga0070695_100031556 | 3300005545 | Bacteria | 3307 |
| 113 | Ga0070696_100006243 | 3300005546 | Bacteria | 7975 |
| 114 | Ga0070696_100008767 | 3300005546 | Bacteria | 6766 |
| 115 | Ga0070696_100026432 | 3300005546 | Bacteria | 3948 |
| 116 | Ga0070696_100039506 | 3300005546 | Bacteria | 3258 |
| 117 | Ga0070696_100063987 | 3300005546 | Bacteria | 2577 |
| 118 | Ga0070696_100078406 | 3300005546 | Bacteria | 2336 |
| 119 | Ga0070693_100001933 | 3300005547 | Bacteria | 9483 |
| 120 | Ga0070693_100031434 | 3300005547 | Bacteria | 2909 |
| 121 | Ga0070704_100000570 | 3300005549 | Bacteria | 17791 |
| 122 | Ga0070704_100007035 | 3300005549 | Bacteria | 6674 |
| 123 | Ga0070704_100008324 | 3300005549 | Bacteria | 6213 |
| 124 | Ga0070704_100043264 | 3300005549 | Bacteria | 3121 |
| 125 | Ga0070704_100132303 | 3300005549 | Bacteria | 1935 |
| 126 | Ga0070704_100327970 | 3300005549 | Unclassified | 1285 |
| 127 | Ga0068855_100002792 | 3300005563 | Bacteria | 21489 |
| 128 | Ga0070664_100014425 | 3300005564 | Bacteria | 6443 |
| 129 | Ga0068857_100015332 | 3300005577 | Bacteria | 6692 |
| 130 | Ga0068857_100303254 | 3300005577 | Bacteria | 1473 |
| 131 | Ga0068854_100000353 | 3300005578 | Bacteria | 29520 |
| 132 | Ga0068854_100257946 | 3300005578 | Bacteria | 1395 |
| 133 | Ga0068856_100015448 | 3300005614 | Bacteria | 7377 |
| 134 | Ga0070702_100552628 | 3300005615 | Bacteria | 855 |
| 135 | Ga0068852_100467626 | 3300005616 | Bacteria | 1251 |
| 136 | Ga0068859_100002575 | 3300005617 | Bacteria | 18433 |
| 137 | Ga0068864_100019308 | 3300005618 | Bacteria | 5698 |
| 138 | Ga0068866_10200476 | 3300005718 | Bacteria | 1192 |
| 139 | Ga0068861_100018163 | 3300005719 | Bacteria | 5004 |
| 140 | Ga0068861_100093024 | 3300005719 | Bacteria | 2383 |
| 141 | Ga0068861_100984354 | 3300005719 | Bacteria | 804 |
| 142 | Ga0068870_10001193 | 3300005840 | Bacteria | 10423 |
| 143 | Ga0068863_100009799 | 3300005841 | Bacteria | 9338 |
| 144 | Ga0068863_100018065 | 3300005841 | Bacteria | 6753 |
| 145 | Ga0068858_100404130 | 3300005842 | Bacteria | 1312 |
| 146 | Ga0068860_100004896 | 3300005843 | Bacteria | 13649 |
| 147 | Ga0068860_100094803 | 3300005843 | Bacteria | 2844 |
| 148 | Ga0068860_100145056 | 3300005843 | Bacteria | 2284 |
| 149 | Ga0068862_100014194 | 3300005844 | Bacteria | 6605 |
| 150 | Ga0068862_100120208 | 3300005844 | Bacteria | 2315 |
| 151 | Ga0068862_100291596 | 3300005844 | Bacteria | 1498 |
| 152 | Ga0068862_100352237 | 3300005844 | Bacteria | 1366 |
| 153 | Ga0068862_100407535 | 3300005844 | Bacteria | 1273 |
| 154 | Ga0081455_10000208 | 3300005937 | Bacteria | 74660 |
| 155 | Ga0081538_10013563 | 3300005981 | Bacteria | 6444 |
| 156 | Ga0081540_1015632 | 3300005983 | Bacteria | 4795 |
| 157 | Ga0081540_1031201 | 3300005983 | Bacteria | 2935 |
| 158 | Ga0081539_10000009 | 3300005985 | Bacteria | 509286 |
| 159 | Ga0070715_10041481 | 3300006163 | Bacteria | 1929 |
| 160 | Ga0070716_100035601 | 3300006173 | Bacteria | 2738 |
| 161 | Ga0070712_100013158 | 3300006175 | Bacteria | 5279 |
| 162 | Ga0075427_10018899 | 3300006194 | Bacteria | 1084 |
| 163 | Ga0075428_100002164 | 3300006844 | Bacteria | 21251 |
| 164 | Ga0075428_100004920 | 3300006844 | Bacteria | 14840 |
| 165 | Ga0075428_100026706 | 3300006844 | Bacteria | 6393 |
| 166 | Ga0075428_100136149 | 3300006844 | Bacteria | 2670 |
| 167 | Ga0075428_100513343 | 3300006844 | Bacteria | 1282 |
| 168 | Ga0075430_100000893 | 3300006846 | Bacteria | 23384 |
| 169 | Ga0075430_100004400 | 3300006846 | Bacteria | 11896 |
| 170 | Ga0075430_100014245 | 3300006846 | Bacteria | 6780 |
| 171 | Ga0075430_100040160 | 3300006846 | Bacteria | 3961 |
| 172 | Ga0075430_100068786 | 3300006846 | Bacteria | 2971 |
| 173 | Ga0075430_100159814 | 3300006846 | Bacteria | 1876 |
| 174 | Ga0075430_100197153 | 3300006846 | Bacteria | 1673 |
| 175 | Ga0075430_100206652 | 3300006846 | Bacteria | 1629 |
| 176 | Ga0075430_100362221 | 3300006846 | Unclassified | 1197 |
| 177 | Ga0075431_100000158 | 3300006847 | Bacteria | 46980 |
| 178 | Ga0075431_100004465 | 3300006847 | Bacteria | 13728 |
| 179 | Ga0075431_100006168 | 3300006847 | Bacteria | 11896 |
| 180 | Ga0075431_100006780 | 3300006847 | Bacteria | 11370 |
| 181 | Ga0075431_100022517 | 3300006847 | Bacteria | 6442 |
| 182 | Ga0075431_100028177 | 3300006847 | Bacteria | 5768 |
| 183 | Ga0075431_100054782 | 3300006847 | Bacteria | 4113 |
| 184 | Ga0075431_100085845 | 3300006847 | Bacteria | 3248 |
| 185 | Ga0075431_100185939 | 3300006847 | Bacteria | 2130 |
| 186 | Ga0075431_100194061 | 3300006847 | Bacteria | 2080 |
| 187 | Ga0075431_100213890 | 3300006847 | Bacteria | 1968 |
| 188 | Ga0075431_100231413 | 3300006847 | Unclassified | 1883 |
| 189 | Ga0075431_100254142 | 3300006847 | Bacteria | 1785 |
| 190 | Ga0075433_10000230 | 3300006852 | Bacteria | 31980 |
| 191 | Ga0075433_10000972 | 3300006852 | Bacteria | 20350 |
| 192 | Ga0075433_10002435 | 3300006852 | Bacteria | 14167 |
| 193 | Ga0075433_10003721 | 3300006852 | Bacteria | 11804 |
| 194 | Ga0075433_10009354 | 3300006852 | Bacteria | 7835 |
| 195 | Ga0075433_10011237 | 3300006852 | Bacteria | 7208 |
| 196 | Ga0075433_10031005 | 3300006852 | Bacteria | 4566 |
| 197 | Ga0075433_10060888 | 3300006852 | Bacteria | 3306 |
| 198 | Ga0075433_10123928 | 3300006852 | Bacteria | 2296 |
| 199 | Ga0075433_10474659 | 3300006852 | Bacteria | 1102 |
| 200 | Ga0075434_100005150 | 3300006871 | Bacteria | 11874 |
| 201 | Ga0075434_100011156 | 3300006871 | Bacteria | 8455 |
| 202 | Ga0075434_100012438 | 3300006871 | Bacteria | 8070 |
| 203 | Ga0075434_100022709 | 3300006871 | Bacteria | 6109 |
| 204 | Ga0075434_100024062 | 3300006871 | Bacteria | 5949 |
| 205 | Ga0075434_100024250 | 3300006871 | Bacteria | 5929 |
| 206 | Ga0075434_100040276 | 3300006871 | Bacteria | 4627 |
| 207 | Ga0075434_100047469 | 3300006871 | Bacteria | 4262 |
| 208 | Ga0075434_100133814 | 3300006871 | Bacteria | 2499 |
| 209 | Ga0075434_100146970 | 3300006871 | Bacteria | 2377 |
| 210 | Ga0075434_100205232 | 3300006871 | Unclassified | 1991 |
| 211 | Ga0075434_100276426 | 3300006871 | Unclassified | 1699 |
| 212 | Ga0075434_100316441 | 3300006871 | Bacteria | 1581 |
| 213 | Ga0075429_100000757 | 3300006880 | Bacteria | 25402 |
| 214 | Ga0075429_100001793 | 3300006880 | Bacteria | 17793 |
| 215 | Ga0075429_100008188 | 3300006880 | Bacteria | 9087 |
| 216 | Ga0075429_100026975 | 3300006880 | Bacteria | 4988 |
| 217 | Ga0075429_100027715 | 3300006880 | Bacteria | 4917 |
| 218 | Ga0075429_100041111 | 3300006880 | Bacteria | 4026 |
| 219 | Ga0075429_100234775 | 3300006880 | Bacteria | 1606 |
| 220 | Ga0075429_100277124 | 3300006880 | Bacteria | 1468 |
| 221 | Ga0075429_100484202 | 3300006880 | Bacteria | 1084 |
| 222 | Ga0068865_100115771 | 3300006881 | Bacteria | 1985 |
| 223 | Ga0075436_100016217 | 3300006914 | Bacteria | 5100 |
| 224 | Ga0075436_100018220 | 3300006914 | Bacteria | 4809 |
| 225 | Ga0075436_100099568 | 3300006914 | Bacteria | 2024 |
| 226 | Ga0075436_100120872 | 3300006914 | Bacteria | 1832 |
| 227 | Ga0075436_100183308 | 3300006914 | Bacteria | 1480 |
| 228 | Ga0097620_100002575 | 3300006931 | Bacteria | 18433 |
| 229 | Ga0075435_100002502 | 3300007076 | Bacteria | 12221 |
| 230 | Ga0075435_100005683 | 3300007076 | Bacteria | 8742 |
| 231 | Ga0075435_100011827 | 3300007076 | Bacteria | 6443 |
| 232 | Ga0075435_100039378 | 3300007076 | Bacteria | 3771 |
| 233 | Ga0075435_100039630 | 3300007076 | Bacteria | 3760 |
| 234 | Ga0075435_100129917 | 3300007076 | Bacteria | 2107 |
| 235 | Ga0075435_100169695 | 3300007076 | Bacteria | 1840 |
| 236 | Ga0075435_100909057 | 3300007076 | Bacteria | 768 |
| 237 | Ga0099794_10003968 | 3300007265 | Bacteria | 5743 |
| 238 | Ga0099794_10013406 | 3300007265 | Bacteria | 3567 |
| 239 | Ga0099794_10069564 | 3300007265 | Bacteria | 1722 |
| 240 | Ga0099794_10164683 | 3300007265 | Bacteria | 1129 |
| 241 | Ga0099794_10167659 | 3300007265 | Bacteria | 1119 |
| 242 | Ga0099794_10171715 | 3300007265 | Bacteria | 1105 |
| 243 | Ga0105240_10533011 | 3300009093 | Bacteria | 1301 |
| 244 | Ga0111539_10000370 | 3300009094 | Bacteria | 55548 |
| 245 | Ga0111539_10004176 | 3300009094 | Bacteria | 18951 |
| 246 | Ga0111539_10007648 | 3300009094 | Bacteria | 13810 |
| 247 | Ga0111539_10008974 | 3300009094 | Bacteria | 12658 |
| 248 | Ga0111539_10187950 | 3300009094 | Bacteria | 2411 |
| 249 | Ga0111539_10440366 | 3300009094 | Bacteria | 1517 |
| 250 | Ga0111539_10516311 | 3300009094 | Bacteria | 1392 |
| 251 | Ga0111539_11067547 | 3300009094 | Bacteria | 938 |
| 252 | Ga0105247_10034856 | 3300009101 | Bacteria | 3066 |
| 253 | Ga0114129_10000078 | 3300009147 | Bacteria | 89074 |
| 254 | Ga0114129_10000443 | 3300009147 | Bacteria | 49208 |
| 255 | Ga0114129_10000599 | 3300009147 | Bacteria | 44461 |
| 256 | Ga0114129_10001075 | 3300009147 | Bacteria | 35911 |
| 257 | Ga0114129_10008029 | 3300009147 | Bacteria | 15033 |
| 258 | Ga0114129_10045651 | 3300009147 | Bacteria | 6158 |
| 259 | Ga0114129_10056055 | 3300009147 | Bacteria | 5522 |
| 260 | Ga0114129_10068941 | 3300009147 | Bacteria | 4930 |
| 261 | Ga0114129_10082634 | 3300009147 | Bacteria | 4463 |
| 262 | Ga0114129_10091152 | 3300009147 | Bacteria | 4224 |
| 263 | Ga0114129_10100951 | 3300009147 | Bacteria | 3993 |
| 264 | Ga0114129_10133835 | 3300009147 | Bacteria | 3403 |
| 265 | Ga0114129_10158841 | 3300009147 | Bacteria | 3090 |
| 266 | Ga0114129_10216347 | 3300009147 | Bacteria | 2587 |
| 267 | Ga0114129_10327274 | 3300009147 | Bacteria | 2036 |
| 268 | Ga0114129_10394652 | 3300009147 | Bacteria | 1824 |
| 269 | Ga0114129_10453015 | 3300009147 | Bacteria | 1683 |
| 270 | Ga0114129_10510338 | 3300009147 | Bacteria | 1569 |
| 271 | Ga0114129_10680498 | 3300009147 | Bacteria | 1324 |
| 272 | Ga0114129_11189518 | 3300009147 | Bacteria | 950 |
| 273 | Ga0114129_11199248 | 3300009147 | Bacteria | 945 |
| 274 | Ga0114129_11232827 | 3300009147 | Bacteria | 930 |
| 275 | Ga0105243_10016738 | 3300009148 | Bacteria | 5543 |
| 276 | Ga0105243_10527784 | 3300009148 | Bacteria | 1124 |
| 277 | Ga0105241_10000218 | 3300009174 | Bacteria | 43050 |
| 278 | Ga0105241_10067794 | 3300009174 | Bacteria | 2763 |
| 279 | Ga0105242_10006162 | 3300009176 | Bacteria | 9238 |
| 280 | Ga0105242_10143429 | 3300009176 | Bacteria | 2075 |
| 281 | Ga0105248_10056969 | 3300009177 | Bacteria | 4385 |
| 282 | Ga0105248_10120027 | 3300009177 | Bacteria | 2966 |
| 283 | Ga0105249_10095565 | 3300009553 | Bacteria | 2786 |
| 284 | Ga0105249_10413703 | 3300009553 | Bacteria | 1381 |
| 285 | Ga0105249_10784516 | 3300009553 | Bacteria | 1016 |
| 286 | Ga0157373_10000381 | 3300013100 | Bacteria | 35500 |
| 287 | Ga0157371_10057611 | 3300013102 | Bacteria | 2756 |
| 288 | Ga0157369_10021069 | 3300013105 | Bacteria | 7287 |
| 289 | Ga0157378_10751653 | 3300013297 | Bacteria | 998 |
| 290 | Ga0163162_10024603 | 3300013306 | Bacteria | 5946 |
| 291 | Ga0163162_10522023 | 3300013306 | Bacteria | 1317 |
| 292 | Ga0163162_10779799 | 3300013306 | Bacteria | 1074 |
| 293 | Ga0157372_10001479 | 3300013307 | Bacteria | 25510 |
| 294 | Ga0157375_10648749 | 3300013308 | Bacteria | 1212 |
| 295 | Ga0163163_10050672 | 3300014325 | Bacteria | 4089 |
| 296 | Ga0157377_10478851 | 3300014745 | Bacteria | 865 |
| 297 | Ga0182007_10029431 | 3300015262 | Bacteria | 1881 |
| 298 | Ga0207653_10002272 | 3300025885 | Bacteria | 6123 |
| 299 | Ga0207653_10003610 | 3300025885 | Bacteria | 4873 |
| 300 | Ga0207653_10066990 | 3300025885 | Bacteria | 1221 |
| 301 | Ga0207688_10013979 | 3300025901 | Bacteria | 4364 |
| 302 | Ga0207645_10002083 | 3300025907 | Bacteria | 16009 |
| 303 | Ga0207645_10066972 | 3300025907 | Bacteria | 2295 |
| 304 | Ga0207643_10000157 | 3300025908 | Bacteria | 46902 |
| 305 | Ga0207684_10000169 | 3300025910 | Bacteria | 109181 |
| 306 | Ga0207684_10010713 | 3300025910 | Bacteria | 8051 |
| 307 | Ga0207684_10043067 | 3300025910 | Bacteria | 3826 |
| 308 | Ga0207684_10049280 | 3300025910 | Bacteria | 3573 |
| 309 | Ga0207684_10051693 | 3300025910 | Bacteria | 3487 |
| 310 | Ga0207684_10075571 | 3300025910 | Bacteria | 2863 |
| 311 | Ga0207684_10204761 | 3300025910 | Bacteria | 1702 |
| 312 | Ga0207684_10231548 | 3300025910 | Bacteria | 1594 |
| 313 | Ga0207684_10424533 | 3300025910 | Bacteria | 1142 |
| 314 | Ga0207654_10028703 | 3300025911 | Bacteria | 3036 |
| 315 | Ga0207654_10039930 | 3300025911 | Bacteria | 2642 |
| 316 | Ga0207707_10000258 | 3300025912 | Bacteria | 57257 |
| 317 | Ga0207693_10001303 | 3300025915 | Bacteria | 22126 |
| 318 | Ga0207660_10001383 | 3300025917 | Bacteria | 16275 |
| 319 | Ga0207660_10005203 | 3300025917 | Bacteria | 8450 |
| 320 | Ga0207660_10059601 | 3300025917 | Bacteria | 2741 |
| 321 | Ga0207662_10019281 | 3300025918 | Bacteria | 3879 |
| 322 | Ga0207662_10090015 | 3300025918 | Bacteria | 1886 |
| 323 | Ga0207657_10000373 | 3300025919 | Bacteria | 47375 |
| 324 | Ga0207649_10002783 | 3300025920 | Bacteria | 9659 |
| 325 | Ga0207652_10092848 | 3300025921 | Bacteria | 2655 |
| 326 | Ga0207646_10003463 | 3300025922 | Bacteria | 17818 |
| 327 | Ga0207646_10026953 | 3300025922 | Bacteria | 5239 |
| 328 | Ga0207646_10027112 | 3300025922 | Bacteria | 5224 |
| 329 | Ga0207646_10046844 | 3300025922 | Bacteria | 3879 |
| 330 | Ga0207646_10066823 | 3300025922 | Bacteria | 3210 |
| 331 | Ga0207646_10069778 | 3300025922 | Bacteria | 3139 |
| 332 | Ga0207646_10093447 | 3300025922 | Bacteria | 2693 |
| 333 | Ga0207646_10121000 | 3300025922 | Bacteria | 2352 |
| 334 | Ga0207646_10136983 | 3300025922 | Bacteria | 2204 |
| 335 | Ga0207646_10204991 | 3300025922 | Bacteria | 1781 |
| 336 | Ga0207646_10236519 | 3300025922 | Bacteria | 1650 |
| 337 | Ga0207646_10382215 | 3300025922 | Bacteria | 1272 |
| 338 | Ga0207681_10014404 | 3300025923 | Bacteria | 4913 |
| 339 | Ga0207681_10251962 | 3300025923 | Bacteria | 1379 |
| 340 | Ga0207650_10013539 | 3300025925 | Bacteria | 5649 |
| 341 | Ga0207687_10591315 | 3300025927 | Bacteria | 935 |
| 342 | Ga0207690_10391692 | 3300025932 | Bacteria | 1106 |
| 343 | Ga0207706_10001857 | 3300025933 | Bacteria | 20682 |
| 344 | Ga0207706_10049930 | 3300025933 | Bacteria | 3697 |
| 345 | Ga0207709_10012241 | 3300025935 | Bacteria | 4728 |
| 346 | Ga0207670_10010126 | 3300025936 | Bacteria | 5414 |
| 347 | Ga0207704_10466954 | 3300025938 | Bacteria | 1010 |
| 348 | Ga0207665_10003678 | 3300025939 | Bacteria | 10237 |
| 349 | Ga0207665_10129404 | 3300025939 | Bacteria | 1790 |
| 350 | Ga0207691_10066559 | 3300025940 | Bacteria | 3259 |
| 351 | Ga0207691_10251353 | 3300025940 | Bacteria | 1526 |
| 352 | Ga0207711_10166723 | 3300025941 | Bacteria | 1997 |
| 353 | Ga0207711_10905625 | 3300025941 | Bacteria | 820 |
| 354 | Ga0207689_10001419 | 3300025942 | Bacteria | 22891 |
| 355 | Ga0207689_10009967 | 3300025942 | Bacteria | 8194 |
| 356 | Ga0207689_10022157 | 3300025942 | Bacteria | 5342 |
| 357 | Ga0207661_10178524 | 3300025944 | Bacteria | 1853 |
| 358 | Ga0207679_10003101 | 3300025945 | Bacteria | 10292 |
| 359 | Ga0207667_10000857 | 3300025949 | Bacteria | 39178 |
| 360 | Ga0207712_10100206 | 3300025961 | Bacteria | 2152 |
| 361 | Ga0207668_10014274 | 3300025972 | Bacteria | 4915 |
| 362 | Ga0207668_10093678 | 3300025972 | Bacteria | 2214 |
| 363 | Ga0207640_10003102 | 3300025981 | Bacteria | 8939 |
| 364 | Ga0207677_10054008 | 3300026023 | Bacteria | 2739 |
| 365 | Ga0207703_10458633 | 3300026035 | Bacteria | 1192 |
| 366 | Ga0207639_10012434 | 3300026041 | Bacteria | 5928 |
| 367 | Ga0207678_10002143 | 3300026067 | Bacteria | 17878 |
| 368 | Ga0207708_10061594 | 3300026075 | Bacteria | 2865 |
| 369 | Ga0207708_10064125 | 3300026075 | Bacteria | 2806 |
| 370 | Ga0207708_10071539 | 3300026075 | Bacteria | 2657 |
| 371 | Ga0207702_10001041 | 3300026078 | Bacteria | 28384 |
| 372 | Ga0207641_10082848 | 3300026088 | Bacteria | 2788 |
| 373 | Ga0207648_10001790 | 3300026089 | Bacteria | 23546 |
| 374 | Ga0207648_10597915 | 3300026089 | Bacteria | 1016 |
| 375 | Ga0207676_10192802 | 3300026095 | Bacteria | 1794 |
| 376 | Ga0207674_10011931 | 3300026116 | Bacteria | 9742 |
| 377 | Ga0207674_10028729 | 3300026116 | Bacteria | 5866 |
| 378 | Ga0207675_100011619 | 3300026118 | Bacteria | 8233 |
| 379 | Ga0207675_100027101 | 3300026118 | Bacteria | 5336 |
| 380 | Ga0207675_100035611 | 3300026118 | Bacteria | 4642 |
| 381 | Ga0207675_100235570 | 3300026118 | Bacteria | 1767 |
| 382 | Ga0207698_10467679 | 3300026142 | Bacteria | 1221 |
| 383 | Ga0210000_1006537 | 3300027462 | Bacteria | 1697 |
| 384 | Ga0209999_1002588 | 3300027543 | Bacteria | 3201 |
| 385 | Ga0209970_1020572 | 3300027614 | Bacteria | 1115 |
| 386 | Ga0209983_1005174 | 3300027665 | Bacteria | 2711 |
| 387 | Ga0209588_1003997 | 3300027671 | Bacteria | 4126 |
| 388 | Ga0209588_1009645 | 3300027671 | Bacteria | 2887 |
| 389 | Ga0209588_1051416 | 3300027671 | Bacteria | 1333 |
| 390 | Ga0209588_1072873 | 3300027671 | Bacteria | 1109 |
| 391 | Ga0209588_1078208 | 3300027671 | Bacteria | 1068 |
| 392 | Ga0209971_1000031 | 3300027682 | Bacteria | 50315 |
| 393 | Ga0209971_1010932 | 3300027682 | Bacteria | 2150 |
| 394 | Ga0209966_1000020 | 3300027695 | Bacteria | 68386 |
| 395 | Ga0209998_10000024 | 3300027717 | Bacteria | 64123 |
| 396 | Ga0209974_10005110 | 3300027876 | Bacteria | 4633 |
| 397 | Ga0207428_10000138 | 3300027907 | Bacteria | 98359 |
| 398 | Ga0207428_10000409 | 3300027907 | Bacteria | 53318 |
| 399 | Ga0207428_10012663 | 3300027907 | Bacteria | 7396 |
| 400 | Ga0207428_10080226 | 3300027907 | Bacteria | 2550 |
| 401 | Ga0268265_10020408 | 3300028380 | Bacteria | 4624 |
| 402 | Ga0268265_10051901 | 3300028380 | Bacteria | 3098 |
| 403 | Ga0268265_10052643 | 3300028380 | Bacteria | 3080 |
| 404 | Ga0268264_10026465 | 3300028381 | Bacteria | 4741 |
| 405 | Ga0268264_10147829 | 3300028381 | Bacteria | 2103 |
| 406 | Ga0268264_10234512 | 3300028381 | Bacteria | 1696 |
| 407 | Ga0268264_10288131 | 3300028381 | Bacteria | 1541 |
| 408 | Ga0268264_10784770 | 3300028381 | Unclassified | 951 |
| 409 | Ga0307408_100024853 | 3300031548 | Bacteria | 4096 |
| 410 | Ga0307408_100140660 | 3300031548 | Bacteria | 1894 |
| 411 | Ga0307408_100235812 | 3300031548 | Bacteria | 1501 |
| 412 | Ga0307408_100343939 | 3300031548 | Bacteria | 1263 |
| 413 | Ga0307410_10028158 | 3300031852 | Bacteria | 3561 |
| 414 | Ga0307406_10452266 | 3300031901 | Bacteria | 1031 |
| 415 | Ga0307407_10262197 | 3300031903 | Bacteria | 1189 |
| 416 | Ga0307412_10316842 | 3300031911 | Bacteria | 1239 |
| 417 | Ga0307409_100276974 | 3300031995 | Bacteria | 1548 |
| 418 | Ga0307409_100531001 | 3300031995 | Bacteria | 1151 |
| 419 | Ga0307416_100042740 | 3300032002 | Bacteria | 3541 |
| 420 | Ga0307411_10147962 | 3300032005 | Bacteria | 1741 |
| 421 | Ga0307411_10281958 | 3300032005 | Bacteria | 1323 |
| 422 | Ga0307411_10392343 | 3300032005 | Bacteria | 1145 |
| 423 | Ga0307415_100834938 | 3300032126 | Bacteria | 844 |
| 424 | Ga0373948_0007102 | 3300034817 | Bacteria | 1874 |
| 425 | Ga0373928_0029543 | 3300035084 | Bacteria | 1206 |
| 426 | Ga0373929_0011061 | 3300035085 | Bacteria | 1695 |
| 427 | Ga0373940_0006109 | 3300035088 | Bacteria | 2650 |
| 428 | Ga0373940_0015581 | 3300035088 | Bacteria | 1872 |
| 429 | Ga0373949_0005165 | 3300035090 | Bacteria | 2930 |
| 430 | Ga0373949_0019112 | 3300035090 | Bacteria | 1558 |
| 431 | Ga0373939_0009908 | 3300035114 | Bacteria | 2372 |
| 432 | Ga0373941_0024074 | 3300035115 | Bacteria | 1745 |
| 433 | Ga0373941_0071947 | 3300035115 | Bacteria | 1150 |
| 434 | Ga0373960_0103883 | 3300035121 | Bacteria | 924 |
| 435 | Ga0373962_0115907 | 3300035242 | Bacteria | 850 |
| 436 | Ga0373931_0001837 | 3300035691 | Bacteria | 9229 |
| 437 | Ga0373931_0017353 | 3300035691 | Bacteria | 3559 |
| 438 | Ga0373931_0078337 | 3300035691 | Bacteria | 1818 |
| 439 | Ga0395900_0013033 | 3300037418 | Bacteria | 8496 |
| 440 | Ga0395900_0077489 | 3300037418 | Bacteria | 3415 |
| 441 | Ga0395898_0017571 | 3300037466 | Bacteria | 7299 |
| 442 | Ga0395898_0367769 | 3300037466 | Bacteria | 1371 |
| 443 | Ga0395905_0063962 | 3300037471 | Bacteria | 3442 |
| 444 | Ga0395901_0000399 | 3300038443 | Bacteria | 51867 |
| 445 | Ga0439448_0003645 | 3300042005 | Bacteria | 4291 |
| 446 | Ga0439450_020251 | 3300042008 | Bacteria | 1418 |
| 447 | Ga0439455_0032411 | 3300042012 | Bacteria | 1306 |
| 448 | Ga0439459_0008936 | 3300042438 | Bacteria | 1724 |
| 449 | Ga0439460_0000450 | 3300042461 | Bacteria | 8829 |
| 450 | Ga0439460_0188863 | 3300042461 | Bacteria | 699 |
| 451 | Ga0451577_0003197 | 3300042876 | Bacteria | 18404 |
| 452 | Ga0451577_0023850 | 3300042876 | Bacteria | 5573 |
| 453 | Ga0451577_0134764 | 3300042876 | Bacteria | 2217 |
| 454 | Ga0439440_0112885 | 3300042993 | Bacteria | 749 |
| 455 | Ga0453683_0016978 | 3300044673 | Bacteria | 4691 |
| 456 | Ga0453683_0316639 | 3300044673 | Bacteria | 999 |
| 457 | Ga0453684_0015160 | 3300044712 | Bacteria | 12228 |
| 458 | Ga0453684_0464953 | 3300044712 | Bacteria | 1406 |
| 459 | Ga0453684_0743273 | 3300044712 | Bacteria | 1062 |
| 460 | Ga0451576_0013787 | 3300045051 | Bacteria | 9030 |
| 461 | Ga0451576_0019829 | 3300045051 | Bacteria | 7333 |
| 462 | Ga0451576_0042741 | 3300045051 | Bacteria | 4784 |
| 463 | Ga0451576_0052940 | 3300045051 | Bacteria | 4253 |
| 464 | Ga0451576_0075083 | 3300045051 | Bacteria | 3517 |
| 465 | Ga0451576_0174733 | 3300045051 | Bacteria | 2242 |
| 466 | Ga0451576_0175287 | 3300045051 | Bacteria | 2238 |
| 467 | Ga0451576_0251356 | 3300045051 | Bacteria | 1848 |
| 468 | Ga0451576_0274098 | 3300045051 | Bacteria | 1764 |
| 469 | Ga0495580_0000331 | 3300046472 | Bacteria | 38649 |
| 470 | Ga0495584_0134496 | 3300046491 | Bacteria | 1255 |
| 471 | Ga0495642_0033480 | 3300046528 | Bacteria | 2066 |
| 472 | Ga0495659_0029601 | 3300046664 | Bacteria | 1902 |
| 473 | Ga0495659_0233319 | 3300046664 | Bacteria | 763 |
| 474 | Ga0495669_0046440 | 3300046684 | Bacteria | 1938 |
| 475 | Ga0495636_0024339 | 3300047318 | Bacteria | 2455 |
| 476 | Ga0496102_0037829 | 3300048905 | Bacteria | 4353 |
| 477 | Ga0496102_0053609 | 3300048905 | Bacteria | 3676 |
| 478 | Ga0496103_0030162 | 3300048906 | Bacteria | 3299 |
| 479 | Ga0496112_0785337 | 3300048915 | Bacteria | 877 |
| 480 | Ga0496113_0278880 | 3300048916 | Bacteria | 1336 |
| 481 | Ga0496115_0614128 | 3300048918 | Unclassified | 863 |
| 482 | Ga0501031_0386765 | 3300049568 | Bacteria | 905 |
| 483 | Ga0501033_0068100 | 3300049570 | Bacteria | 2618 |
| 484 | Ga0501033_0276558 | 3300049570 | Bacteria | 1186 |
| 485 | Ga0501036_0407724 | 3300049572 | Unclassified | 1134 |
| 486 | Ga0501037_0302819 | 3300049573 | Bacteria | 1110 |
| 487 | Ga0501038_0040865 | 3300049574 | Bacteria | 4047 |
| 488 | Ga0501038_0073341 | 3300049574 | Bacteria | 2899 |
| 489 | Ga0501038_0233488 | 3300049574 | Bacteria | 1463 |
| 490 | Ga0501038_0280173 | 3300049574 | Bacteria | 1313 |
| 491 | Ga0501039_0007391 | 3300049575 | Bacteria | 8377 |
| 492 | Ga0501039_0160118 | 3300049575 | Bacteria | 1769 |
| 493 | Ga0501039_0287629 | 3300049575 | Bacteria | 1292 |
| 494 | Ga0501039_0341983 | 3300049575 | Bacteria | 1176 |
| 495 | Ga0501039_0373475 | 3300049575 | Bacteria | 1120 |
| 496 | Ga0501040_0006872 | 3300049576 | Bacteria | 7374 |
| 497 | Ga0501040_0021010 | 3300049576 | Bacteria | 4354 |
| 498 | Ga0501040_0050462 | 3300049576 | Bacteria | 2846 |
| 499 | Ga0501040_0074291 | 3300049576 | Bacteria | 2349 |
| 500 | Ga0501040_0177550 | 3300049576 | Bacteria | 1509 |
| 501 | Ga0501040_0204180 | 3300049576 | Bacteria | 1404 |
| 502 | Ga0501040_0388784 | 3300049576 | Bacteria | 1001 |
| 503 | Ga0501040_0449011 | 3300049576 | Bacteria | 928 |
| 504 | Ga0501041_0001517 | 3300049577 | Bacteria | 12876 |
| 505 | Ga0501041_0014739 | 3300049577 | Bacteria | 4642 |
| 506 | Ga0501041_0065151 | 3300049577 | Bacteria | 2232 |
| 507 | Ga0501041_0144203 | 3300049577 | Bacteria | 1486 |
| 508 | Ga0501042_0065187 | 3300049578 | Bacteria | 2603 |
| 509 | Ga0501042_0090362 | 3300049578 | Bacteria | 2198 |
| 510 | Ga0501042_0156550 | 3300049578 | Bacteria | 1643 |
| 511 | Ga0501042_0438186 | 3300049578 | Bacteria | 947 |
| 512 | Ga0501042_0550834 | 3300049578 | Bacteria | 838 |
| 513 | Ga0501043_0119680 | 3300049579 | Bacteria | 2065 |
| 514 | Ga0501043_0321239 | 3300049579 | Unclassified | 1180 |
| 515 | Ga0501046_0000607 | 3300049580 | Bacteria | 35214 |
| 516 | Ga0501046_0089977 | 3300049580 | Bacteria | 2362 |
| 517 | Ga0501046_0204573 | 3300049580 | Unclassified | 1468 |
| 518 | Ga0501046_0286860 | 3300049580 | Bacteria | 1205 |
| 519 | Ga0501046_0508218 | 3300049580 | Unclassified | 862 |
| 520 | Ga0501047_0043661 | 3300049581 | Bacteria | 4330 |
| 521 | Ga0501048_0007236 | 3300049582 | Bacteria | 8420 |
| 522 | Ga0501048_0073608 | 3300049582 | Bacteria | 2411 |
| 523 | Ga0501048_0120245 | 3300049582 | Bacteria | 1856 |
| 524 | Ga0501048_0140314 | 3300049582 | Bacteria | 1709 |
| 525 | Ga0501048_0205952 | 3300049582 | Bacteria | 1395 |
| 526 | Ga0501048_0369783 | 3300049582 | Unclassified | 1023 |
| 527 | Ga0501067_0075070 | 3300049583 | Bacteria | 1873 |
| 528 | Ga0501067_0174383 | 3300049583 | Bacteria | 1198 |
| 529 | Ga0501068_0052084 | 3300049584 | Bacteria | 2477 |
| 530 | Ga0501068_0381120 | 3300049584 | Bacteria | 908 |
| 531 | Ga0501068_0455525 | 3300049584 | Bacteria | 828 |
| 532 | Ga0501069_0082927 | 3300049585 | Bacteria | 1807 |
| 533 | Ga0501069_0190127 | 3300049585 | Bacteria | 1188 |
| 534 | Ga0501069_0259851 | 3300049585 | Bacteria | 1014 |
| 535 | Ga0501070_0220407 | 3300049586 | Bacteria | 1556 |
| 536 | Ga0501071_0106449 | 3300049587 | Bacteria | 2071 |
| 537 | Ga0501071_0106603 | 3300049587 | Bacteria | 2069 |
| 538 | Ga0501071_0142678 | 3300049587 | Bacteria | 1784 |
| 539 | Ga0501071_0388243 | 3300049587 | Unclassified | 1065 |
| 540 | Ga0501071_0613131 | 3300049587 | Bacteria | 837 |
| 541 | Ga0501072_0003099 | 3300049588 | Bacteria | 12529 |
| 542 | Ga0501072_0034179 | 3300049588 | Bacteria | 3984 |
| 543 | Ga0501072_0041240 | 3300049588 | Bacteria | 3625 |
| 544 | Ga0501072_0094719 | 3300049588 | Bacteria | 2372 |
| 545 | Ga0501072_0104005 | 3300049588 | Bacteria | 2257 |
| 546 | Ga0501072_0193684 | 3300049588 | Bacteria | 1621 |
| 547 | Ga0501072_0348627 | 3300049588 | Bacteria | 1175 |
| 548 | Ga0501072_0680128 | 3300049588 | Bacteria | 809 |
| 549 | Ga0501072_0884108 | 3300049588 | Bacteria | 698 |
| 550 | Ga0501074_0009258 | 3300049590 | Bacteria | 7155 |
| 551 | Ga0501074_0039206 | 3300049590 | Bacteria | 3431 |
| 552 | Ga0501074_0342906 | 3300049590 | Bacteria | 1060 |
| 553 | Ga0501074_0583236 | 3300049590 | Bacteria | 791 |
| 554 | Ga0501075_0001457 | 3300049591 | Bacteria | 15394 |
| 555 | Ga0501075_0011581 | 3300049591 | Bacteria | 6245 |
| 556 | Ga0501075_0020084 | 3300049591 | Bacteria | 4852 |
| 557 | Ga0501075_0025612 | 3300049591 | Bacteria | 4334 |
| 558 | Ga0501075_0048326 | 3300049591 | Bacteria | 3198 |
| 559 | Ga0501075_0050577 | 3300049591 | Bacteria | 3124 |
| 560 | Ga0501075_0062232 | 3300049591 | Bacteria | 2813 |
| 561 | Ga0501075_0072520 | 3300049591 | Bacteria | 2603 |
| 562 | Ga0501075_0107835 | 3300049591 | Bacteria | 2117 |
| 563 | Ga0501075_0109282 | 3300049591 | Bacteria | 2102 |
| 564 | Ga0501075_0132683 | 3300049591 | Bacteria | 1897 |
| 565 | Ga0501075_0264737 | 3300049591 | Unclassified | 1310 |
| 566 | Ga0501075_0300045 | 3300049591 | Bacteria | 1224 |
| 567 | Ga0501075_0377253 | 3300049591 | Bacteria | 1081 |
| 568 | Ga0501075_0491194 | 3300049591 | Bacteria | 936 |
| 569 | Ga0501076_0004888 | 3300049592 | Bacteria | 9581 |
| 570 | Ga0501076_0023309 | 3300049592 | Bacteria | 4770 |
| 571 | Ga0501076_0028537 | 3300049592 | Bacteria | 4334 |
| 572 | Ga0501076_0029517 | 3300049592 | Bacteria | 4264 |
| 573 | Ga0501076_0043424 | 3300049592 | Bacteria | 3542 |
| 574 | Ga0501076_0070352 | 3300049592 | Bacteria | 2797 |
| 575 | Ga0501076_0138877 | 3300049592 | Bacteria | 1974 |
| 576 | Ga0501076_0153622 | 3300049592 | Bacteria | 1873 |
| 577 | Ga0501076_0193132 | 3300049592 | Bacteria | 1662 |
| 578 | Ga0501076_0202293 | 3300049592 | Bacteria | 1622 |
| 579 | Ga0501076_0365349 | 3300049592 | Bacteria | 1186 |
| 580 | Ga0501076_0371846 | 3300049592 | Bacteria | 1174 |
| 581 | Ga0501077_0007562 | 3300049593 | Bacteria | 6704 |
| 582 | Ga0501077_0007616 | 3300049593 | Bacteria | 6682 |
| 583 | Ga0501077_0019750 | 3300049593 | Bacteria | 4262 |
| 584 | Ga0501077_0026293 | 3300049593 | Bacteria | 3694 |
| 585 | Ga0501077_0035501 | 3300049593 | Bacteria | 3173 |
| 586 | Ga0501077_0043469 | 3300049593 | Bacteria | 2855 |
| 587 | Ga0501077_0050565 | 3300049593 | Bacteria | 2642 |
| 588 | Ga0501077_0137967 | 3300049593 | Bacteria | 1546 |
| 589 | Ga0501077_0208685 | 3300049593 | Bacteria | 1241 |
| 590 | Ga0501079_0004364 | 3300049741 | Bacteria | 10492 |
| 591 | Ga0501079_0005322 | 3300049741 | Bacteria | 9577 |
| 592 | Ga0501079_0005375 | 3300049741 | Bacteria | 9536 |
| 593 | Ga0501079_0008589 | 3300049741 | Bacteria | 7753 |
| 594 | Ga0501079_0012404 | 3300049741 | Bacteria | 6503 |
| 595 | Ga0501079_0137027 | 3300049741 | Bacteria | 1906 |
| 596 | Ga0501079_0185493 | 3300049741 | Bacteria | 1624 |
| 597 | Ga0501079_0489411 | 3300049741 | Bacteria | 967 |
| 598 | Ga0501080_0076967 | 3300049742 | Bacteria | 3102 |
| 599 | Ga0501080_0174382 | 3300049742 | Bacteria | 1982 |
| 600 | Ga0501080_0212253 | 3300049742 | Bacteria | 1774 |
| 601 | Ga0501080_0246285 | 3300049742 | Bacteria | 1630 |
| 602 | Ga0501081_0008094 | 3300049743 | Bacteria | 6823 |
| 603 | Ga0501081_0019526 | 3300049743 | Bacteria | 4513 |
| 604 | Ga0501081_0066508 | 3300049743 | Bacteria | 2507 |
| 605 | Ga0501081_0109535 | 3300049743 | Bacteria | 1959 |
| 606 | Ga0501081_0135062 | 3300049743 | Bacteria | 1765 |
| 607 | Ga0501081_0172389 | 3300049743 | Bacteria | 1562 |
| 608 | Ga0501081_0174832 | 3300049743 | Bacteria | 1551 |
| 609 | Ga0501081_0184231 | 3300049743 | Bacteria | 1511 |
| 610 | Ga0501081_0532837 | 3300049743 | Bacteria | 876 |
| 611 | Ga0501083_0109881 | 3300049744 | Bacteria | 1813 |
| 612 | Ga0501035_0168011 | 3300049822 | Bacteria | 1896 |
| 613 | Ga0501035_0327865 | 3300049822 | Bacteria | 1285 |
| 614 | Ga0501035_0556140 | 3300049822 | Bacteria | 939 |
| 615 | Ga0501044_0541039 | 3300049823 | Bacteria | 1063 |
| 616 | Ga0501045_0001608 | 3300049824 | Bacteria | 15107 |
| 617 | Ga0501045_0016844 | 3300049824 | Bacteria | 5192 |
| 618 | Ga0501045_0019327 | 3300049824 | Bacteria | 4855 |
| 619 | Ga0501045_0023563 | 3300049824 | Bacteria | 4415 |
| 620 | Ga0501045_0041923 | 3300049824 | Bacteria | 3331 |
| 621 | Ga0501045_0088616 | 3300049824 | Bacteria | 2286 |
| 622 | Ga0501045_0182204 | 3300049824 | Bacteria | 1565 |
| 623 | nmdc:mga05p37_1126565_c1 | 3300050507 | Bacteria | 819 |
| 624 | nmdc:mga05p37_1275777_c1 | 3300050507 | Unclassified | 751 |
| 625 | nmdc:mga05p37_199_c1 | 3300050507 | Bacteria | 59838 |
| 626 | nmdc:mga05p37_204587_c1 | 3300050507 | Bacteria | 2389 |
| 627 | nmdc:mga05p37_205700_c1 | 3300050507 | Bacteria | 2381 |
| 628 | nmdc:mga05p37_224852_c1 | 3300050507 | Bacteria | 2263 |
| 629 | nmdc:mga05p37_22487_c1 | 3300050507 | Bacteria | 7645 |
| 630 | nmdc:mga05p37_26965_c1 | 3300050507 | Bacteria | 6990 |
| 631 | nmdc:mga05p37_307277_c1 | 3300050507 | Bacteria | 1881 |
| 632 | nmdc:mga05p37_369731_c1 | 3300050507 | Bacteria | 1683 |
| 633 | nmdc:mga05p37_38692_c1 | 3300050507 | Bacteria | 5853 |
| 634 | nmdc:mga05p37_38_c1 | 3300050507 | Bacteria | 109166 |
| 635 | nmdc:mga05p37_57280_c1 | 3300050507 | Bacteria | 4800 |
| 636 | nmdc:mga05p37_662783_c1 | 3300050507 | Bacteria | 1166 |
| 637 | nmdc:mga05p37_68944_c1 | 3300050507 | Bacteria | 4349 |
| 638 | nmdc:mga05p37_78211_c1 | 3300050507 | Bacteria | 4073 |
| 639 | nmdc:mga05p37_7885_c1 | 3300050507 | Bacteria | 12567 |
| 640 | nmdc:mga05p37_88173_c1 | 3300050507 | Bacteria | 3825 |
| 641 | nmdc:mga05p37_93330_c1 | 3300050507 | Bacteria | 3709 |
| 642 | nmdc:mga05p37_94383_c1 | 3300050507 | Bacteria | 3686 |
| 643 | nmdc:mga05p37_96455_c1 | 3300050507 | Bacteria | 3643 |
| 644 | nmdc:mga09592_1012_c1 | 3300050508 | Bacteria | 22338 |
| 645 | nmdc:mga09592_10352_c1 | 3300050508 | Bacteria | 7589 |
| 646 | nmdc:mga09592_168686_c1 | 3300050508 | Bacteria | 1892 |
| 647 | nmdc:mga09592_31298_c1 | 3300050508 | Bacteria | 4433 |
| 648 | nmdc:mga09592_33850_c1 | 3300050508 | Bacteria | 4269 |
| 649 | nmdc:mga09592_4445_c1 | 3300050508 | Bacteria | 11343 |
| 650 | nmdc:mga09592_73228_c1 | 3300050508 | Bacteria | 2910 |
| 651 | nmdc:mga09592_92879_c1 | 3300050508 | Bacteria | 2580 |
| 652 | nmdc:mga0qj67_107659_c1 | 3300050509 | Bacteria | 2249 |
| 653 | nmdc:mga0qj67_14460_c1 | 3300050509 | Bacteria | 5968 |
| 654 | nmdc:mga0qj67_161756_c1 | 3300050509 | Bacteria | 1817 |
| 655 | nmdc:mga0qj67_195369_c1 | 3300050509 | Bacteria | 1644 |
| 656 | nmdc:mga0qj67_2246_c1 | 3300050509 | Bacteria | 13729 |
| 657 | nmdc:mga0qj67_70653_c1 | 3300050509 | Bacteria | 1541 |
| 658 | nmdc:mga0qj67_86808_c1 | 3300050509 | Bacteria | 2510 |
| 659 | nmdc:mga06r32_113820_c1 | 3300050510 | Bacteria | 2663 |
| 660 | nmdc:mga06r32_1254_c1 | 3300050510 | Bacteria | 22817 |
| 661 | nmdc:mga06r32_126946_c1 | 3300050510 | Bacteria | 2520 |
| 662 | nmdc:mga06r32_1549_c1 | 3300050510 | Bacteria | 20719 |
| 663 | nmdc:mga06r32_171864_c1 | 3300050510 | Bacteria | 2151 |
| 664 | nmdc:mga06r32_200044_c1 | 3300050510 | Bacteria | 1986 |
| 665 | nmdc:mga06r32_223680_c1 | 3300050510 | Unclassified | 1870 |
| 666 | nmdc:mga06r32_22559_c1 | 3300050510 | Bacteria | 5821 |
| 667 | nmdc:mga06r32_287_c1 | 3300050510 | Bacteria | 41922 |
| 668 | nmdc:mga06r32_3471_c1 | 3300050510 | Bacteria | 14077 |
| 669 | nmdc:mga06r32_396971_c1 | 3300050510 | Bacteria | 1361 |
| 670 | nmdc:mga06r32_6047_c1 | 3300050510 | Bacteria | 10878 |
| 671 | nmdc:mga06r32_61109_c1 | 3300050510 | Bacteria | 3626 |
| 672 | nmdc:mga06r32_67198_c1 | 3300050510 | Bacteria | 3460 |
| 673 | nmdc:mga06r32_76307_c1 | 3300050510 | Bacteria | 3254 |
| 674 | nmdc:mga06r32_90387_c1 | 3300050510 | Bacteria | 2991 |
| 675 | nmdc:mga08y16_11942_c1 | 3300050511 | Bacteria | 9122 |
| 676 | nmdc:mga08y16_191654_c2 | 3300050511 | Bacteria | 1769 |
| 677 | nmdc:mga08y16_1957_c1 | 3300050511 | Bacteria | 20989 |
| 678 | nmdc:mga08y16_2476_c1 | 3300050511 | Bacteria | 18964 |
| 679 | nmdc:mga08y16_29427_c1 | 3300050511 | Bacteria | 5787 |
| 680 | nmdc:mga08y16_967917_c1 | 3300050511 | Bacteria | 833 |
| 681 | nmdc:mga0n895_111725_c1 | 3300050512 | Bacteria | 2749 |
| 682 | nmdc:mga0n895_126103_c1 | 3300050512 | Bacteria | 2584 |
| 683 | nmdc:mga0n895_12611_c1 | 3300050512 | Bacteria | 7587 |
| 684 | nmdc:mga0n895_302619_c1 | 3300050512 | Unclassified | 1621 |
| 685 | nmdc:mga0n895_34456_c1 | 3300050512 | Bacteria | 4874 |
| 686 | nmdc:mga0n895_5572_c1 | 3300050512 | Bacteria | 10541 |
| 687 | nmdc:mga0n895_61_c1 | 3300050512 | Bacteria | 63108 |
| 688 | nmdc:mga0n895_69982_c1 | 3300050512 | Bacteria | 3477 |
| 689 | nmdc:mga0n895_78605_c1 | 3300050512 | Bacteria | 3284 |
| 690 | nmdc:mga0n895_80201_c1 | 3300050512 | Bacteria | 3252 |
| 691 | nmdc:mga0n895_8027_c1 | 3300050512 | Bacteria | 9106 |
| 692 | nmdc:mga0n895_84364_c1 | 3300050512 | Bacteria | 3170 |
| 693 | nmdc:mga0rr50_133858_c1 | 3300050513 | Bacteria | 1988 |
| 694 | nmdc:mga0rr50_15155_c1 | 3300050513 | Bacteria | 5082 |
| 695 | nmdc:mga0rr50_165341_c1 | 3300050513 | Bacteria | 1799 |
| 696 | nmdc:mga0rr50_226090_c1 | 3300050513 | Bacteria | 1547 |
| 697 | nmdc:mga0rr50_3069_c1 | 3300050513 | Bacteria | 9562 |
| 698 | nmdc:mga0rr50_36119_c1 | 3300050513 | Bacteria | 3556 |
| 699 | nmdc:mga0rr50_62639_c1 | 3300050513 | Bacteria | 2807 |
| 700 | nmdc:mga0rr50_7191_c1 | 3300050513 | Bacteria | 6841 |
| 701 | nmdc:mga08x19_22559_c1 | 3300050514 | Bacteria | 1448 |
| 702 | nmdc:mga08x19_2391_c1 | 3300050514 | Bacteria | 11377 |
| 703 | nmdc:mga08x19_359253_c1 | 3300050514 | Bacteria | 1018 |
| 704 | nmdc:mga08x19_9023_c1 | 3300050514 | Bacteria | 5956 |
| 705 | nmdc:mga0a205_11305_c1 | 3300050515 | Bacteria | 8219 |
| 706 | nmdc:mga0a205_122_c1 | 3300050515 | Bacteria | 47141 |
| 707 | nmdc:mga0a205_12408_c1 | 3300050515 | Bacteria | 7881 |
| 708 | nmdc:mga0a205_243123_c1 | 3300050515 | Bacteria | 1681 |
| 709 | nmdc:mga0a205_34506_c1 | 3300050515 | Bacteria | 4853 |
| 710 | nmdc:mga0a205_46561_c1 | 3300050515 | Bacteria | 4183 |
| 711 | nmdc:mga0a205_471770_c1 | 3300050515 | Unclassified | 1114 |
| 712 | nmdc:mga0a205_49897_c1 | 3300050515 | Bacteria | 4041 |
| 713 | nmdc:mga0a205_895_c1 | 3300050515 | Bacteria | 17939 |
| 714 | nmdc:mga0a205_90400_c1 | 3300050515 | Bacteria | 2959 |
| 715 | Ga0501084_0003947 | 3300054114 | Bacteria | 12085 |
| 716 | Ga0501084_0006427 | 3300054114 | Bacteria | 9660 |
| 717 | Ga0501084_0013112 | 3300054114 | Bacteria | 6860 |
| 718 | Ga0501084_0020335 | 3300054114 | Bacteria | 5535 |
| 719 | Ga0501084_0024768 | 3300054114 | Bacteria | 5008 |
| 720 | Ga0501084_0116108 | 3300054114 | Bacteria | 2250 |
| 721 | Ga0501084_0117216 | 3300054114 | Bacteria | 2239 |
| 722 | Ga0501084_0136774 | 3300054114 | Bacteria | 2063 |
| 723 | Ga0501084_0355655 | 3300054114 | Bacteria | 1237 |
| 724 | Ga0501084_0477825 | 3300054114 | Bacteria | 1053 |
| 725 | Ga0501084_0501245 | 3300054114 | Bacteria | 1026 |
| 726 | Ga0590071_068191 | 3300059421 | Bacteria | 875 |
| 727 | Ga0501082_0000058 | 3300060353 | Bacteria | 78173 |
| 728 | Ga0501082_0006322 | 3300060353 | Bacteria | 10275 |
| 729 | Ga0501082_0007387 | 3300060353 | Bacteria | 9483 |
| 730 | Ga0501082_0019798 | 3300060353 | Bacteria | 5803 |
| 731 | Ga0501082_0363165 | 3300060353 | Bacteria | 1263 |
| 732 | Ga0501082_0376291 | 3300060353 | Bacteria | 1239 |
| 733 | Ga0501082_0419070 | 3300060353 | Bacteria | 1169 |
| 734 | Ga0501082_0455497 | 3300060353 | Unclassified | 1118 |
| 735 | Ga0530510_0000450 | 3300061734 | Bacteria | 26655 |
| 736 | Ga0530510_0019190 | 3300061734 | Bacteria | 4850 |
| 737 | Ga0530510_0041498 | 3300061734 | Bacteria | 3322 |
| 738 | Ga0530510_0057884 | 3300061734 | Bacteria | 2802 |
| 739 | Ga0530510_0064169 | 3300061734 | Bacteria | 2660 |
| 740 | Ga0530510_0090245 | 3300061734 | Bacteria | 2235 |
| 741 | Ga0530510_0112264 | 3300061734 | Bacteria | 1997 |
| 742 | Ga0530510_0118621 | 3300061734 | Bacteria | 1941 |
| 743 | Ga0530510_0215052 | 3300061734 | Bacteria | 1428 |
| 744 | Ga0530510_0607403 | 3300061734 | Bacteria | 832 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100005150 | Ga0075434_1000051507 | 194 |
| 2 | 3300007076 | Ga0075435_100039378 | Ga0075435_1000393784 | 194 |
| 3 | 3300005328 | Ga0070676_10000920 | Ga0070676_100009209 | 198 |
| 4 | 3300005331 | Ga0070670_100056748 | Ga0070670_1000567484 | 198 |
| 5 | 3300005334 | Ga0068869_100006522 | Ga0068869_1000065225 | 198 |
| 6 | 3300005336 | Ga0070680_100004576 | Ga0070680_1000045767 | 198 |
| 7 | 3300005337 | Ga0070682_100005442 | Ga0070682_1000054424 | 198 |
| 8 | 3300005338 | Ga0068868_100089220 | Ga0068868_1000892202 | 198 |
| 9 | 3300005339 | Ga0070660_100000332 | Ga0070660_10000033231 | 198 |
| 10 | 3300005343 | Ga0070687_100010610 | Ga0070687_1000106105 | 198 |
| 11 | 3300005345 | Ga0070692_10002146 | Ga0070692_100021464 | 198 |
| 12 | 3300005347 | Ga0070668_100669352 | Ga0070668_1006693522 | 198 |
| 13 | 3300005364 | Ga0070673_100707712 | Ga0070673_1007077122 | 198 |
| 14 | 3300005365 | Ga0070688_100360128 | Ga0070688_1003601282 | 198 |
| 15 | 3300005366 | Ga0070659_100001428 | Ga0070659_10000142811 | 198 |
| 16 | 3300005406 | Ga0070703_10007460 | Ga0070703_100074601 | 198 |
| 17 | 3300005440 | Ga0070705_100000542 | Ga0070705_1000005429 | 198 |
| 18 | 3300005444 | Ga0070694_100000839 | Ga0070694_10000083911 | 198 |
| 19 | 3300005455 | Ga0070663_100002069 | Ga0070663_1000020691 | 198 |
| 20 | 3300005457 | Ga0070662_100009230 | Ga0070662_1000092306 | 198 |
| 21 | 3300005458 | Ga0070681_10018854 | Ga0070681_100188544 | 198 |
| 22 | 3300005459 | Ga0068867_100000884 | Ga0068867_10000088413 | 198 |
| 23 | 3300005530 | Ga0070679_100000895 | Ga0070679_10000089513 | 198 |
| 24 | 3300005535 | Ga0070684_100046493 | Ga0070684_1000464931 | 198 |
| 25 | 3300005539 | Ga0068853_100002471 | Ga0068853_1000024715 | 198 |
| 26 | 3300005543 | Ga0070672_100100497 | Ga0070672_1001004972 | 198 |
| 27 | 3300005546 | Ga0070696_100008767 | Ga0070696_1000087674 | 198 |
| 28 | 3300005547 | Ga0070693_100001933 | Ga0070693_1000019334 | 198 |
| 29 | 3300005549 | Ga0070704_100000570 | Ga0070704_1000005707 | 198 |
| 30 | 3300005563 | Ga0068855_100002792 | Ga0068855_10000279211 | 198 |
| 31 | 3300005564 | Ga0070664_100014425 | Ga0070664_1000144255 | 198 |
| 32 | 3300005577 | Ga0068857_100015332 | Ga0068857_1000153324 | 198 |
| 33 | 3300005578 | Ga0068854_100000353 | Ga0068854_1000003533 | 198 |
| 34 | 3300005614 | Ga0068856_100015448 | Ga0068856_1000154485 | 198 |
| 35 | 3300005616 | Ga0068852_100467626 | Ga0068852_1004676262 | 198 |
| 36 | 3300005617 | Ga0068859_100002575 | Ga0068859_1000025755 | 198 |
| 37 | 3300005618 | Ga0068864_100019308 | Ga0068864_1000193085 | 198 |
| 38 | 3300005719 | Ga0068861_100093024 | Ga0068861_1000930243 | 198 |
| 39 | 3300005840 | Ga0068870_10001193 | Ga0068870_100011935 | 198 |
| 40 | 3300005841 | Ga0068863_100009799 | Ga0068863_1000097999 | 198 |
| 41 | 3300005843 | Ga0068860_100004896 | Ga0068860_10000489615 | 198 |
| 42 | 3300005844 | Ga0068862_100014194 | Ga0068862_1000141944 | 198 |
| 43 | 3300006852 | Ga0075433_10003721 | Ga0075433_100037211 | 198 |
| 44 | 3300006871 | Ga0075434_100022709 | Ga0075434_1000227095 | 198 |
| 45 | 3300006914 | Ga0075436_100099568 | Ga0075436_1000995682 | 198 |
| 46 | 3300006931 | Ga0097620_100002575 | Ga0097620_1000025755 | 198 |
| 47 | 3300007076 | Ga0075435_100002502 | Ga0075435_10000250211 | 198 |
| 48 | 3300025885 | Ga0207653_10002272 | Ga0207653_100022721 | 198 |
| 49 | 3300025901 | Ga0207688_10013979 | Ga0207688_100139792 | 198 |
| 50 | 3300025907 | Ga0207645_10002083 | Ga0207645_100020837 | 198 |
| 51 | 3300025908 | Ga0207643_10000157 | Ga0207643_1000015736 | 198 |
| 52 | 3300025911 | Ga0207654_10028703 | Ga0207654_100287032 | 198 |
| 53 | 3300025912 | Ga0207707_10000258 | Ga0207707_1000025819 | 198 |
| 54 | 3300025917 | Ga0207660_10001383 | Ga0207660_1000138313 | 198 |
| 55 | 3300025918 | Ga0207662_10019281 | Ga0207662_100192811 | 198 |
| 56 | 3300025919 | Ga0207657_10000373 | Ga0207657_100003735 | 198 |
| 57 | 3300025920 | Ga0207649_10002783 | Ga0207649_100027834 | 198 |
| 58 | 3300025921 | Ga0207652_10092848 | Ga0207652_100928481 | 198 |
| 59 | 3300025925 | Ga0207650_10013539 | Ga0207650_100135397 | 198 |
| 60 | 3300025932 | Ga0207690_10391692 | Ga0207690_103916922 | 198 |
| 61 | 3300025933 | Ga0207706_10001857 | Ga0207706_1000185715 | 198 |
| 62 | 3300025936 | Ga0207670_10010126 | Ga0207670_100101266 | 198 |
| 63 | 3300025942 | Ga0207689_10001419 | Ga0207689_1000141910 | 198 |
| 64 | 3300025944 | Ga0207661_10178524 | Ga0207661_101785242 | 198 |
| 65 | 3300025945 | Ga0207679_10003101 | Ga0207679_100031012 | 198 |
| 66 | 3300025949 | Ga0207667_10000857 | Ga0207667_1000085715 | 198 |
| 67 | 3300025981 | Ga0207640_10003102 | Ga0207640_100031023 | 198 |
| 68 | 3300026023 | Ga0207677_10054008 | Ga0207677_100540082 | 198 |
| 69 | 3300026035 | Ga0207703_10458633 | Ga0207703_104586331 | 198 |
| 70 | 3300026041 | Ga0207639_10012434 | Ga0207639_100124347 | 198 |
| 71 | 3300026067 | Ga0207678_10002143 | Ga0207678_1000214317 | 198 |
| 72 | 3300026075 | Ga0207708_10071539 | Ga0207708_100715392 | 198 |
| 73 | 3300026078 | Ga0207702_10001041 | Ga0207702_1000104124 | 198 |
| 74 | 3300026089 | Ga0207648_10001790 | Ga0207648_1000179010 | 198 |
| 75 | 3300026095 | Ga0207676_10192802 | Ga0207676_101928021 | 198 |
| 76 | 3300026116 | Ga0207674_10011931 | Ga0207674_100119317 | 198 |
| 77 | 3300026118 | Ga0207675_100035611 | Ga0207675_1000356112 | 198 |
| 78 | 3300026142 | Ga0207698_10467679 | Ga0207698_104676792 | 198 |
| 79 | 3300028380 | Ga0268265_10020408 | Ga0268265_100204083 | 198 |
| 80 | 3300028381 | Ga0268264_10026465 | Ga0268264_100264651 | 198 |
| 81 | 3300035121 | Ga0373960_0103883 | Ga0373960_0103883_43_645 | 198 |
| 82 | 3300028380 | Ga0268265_10051901 | Ga0268265_100519014 | 199 |
| 83 | 3300049591 | Ga0501075_0300045 | Ga0501075_0300045_51_728 | 200 |
| 84 | 3300050511 | nmdc:mga08y16_967917_c1 | nmdc:mga08y16_967917_c1_10_621 | 201 |
| 85 | 3300009101 | Ga0105247_10034856 | Ga0105247_100348564 | 202 |
| 86 | 3300009147 | Ga0114129_10394652 | Ga0114129_103946522 | 202 |
| 87 | 3300013306 | Ga0163162_10522023 | Ga0163162_105220232 | 202 |
| 88 | 3300027907 | Ga0207428_10080226 | Ga0207428_100802262 | 202 |
| 89 | 3300050515 | nmdc:mga0a205_11305_c1 | nmdc:mga0a205_11305_c1_4437_5117 | 202 |
| 90 | 3300005549 | Ga0070704_100132303 | Ga0070704_1001323032 | 203 |
| 91 | 3300005578 | Ga0068854_100257946 | Ga0068854_1002579462 | 203 |
| 92 | 3300005842 | Ga0068858_100404130 | Ga0068858_1004041302 | 203 |
| 93 | 3300005843 | Ga0068860_100094803 | Ga0068860_1000948032 | 203 |
| 94 | 3300025918 | Ga0207662_10090015 | Ga0207662_100900153 | 203 |
| 95 | 3300026075 | Ga0207708_10064125 | Ga0207708_100641254 | 203 |
| 96 | 3300026118 | Ga0207675_100011619 | Ga0207675_1000116197 | 203 |
| 97 | 3300028381 | Ga0268264_10234512 | Ga0268264_102345122 | 203 |
| 98 | 3300007265 | Ga0099794_10013406 | Ga0099794_100134064 | 204 |
| 99 | 3300027671 | Ga0209588_1003997 | Ga0209588_10039974 | 204 |
| 100 | 3300005440 | Ga0070705_100092202 | Ga0070705_1000922022 | 205 |
| 101 | 3300005518 | Ga0070699_100001741 | Ga0070699_1000017417 | 205 |
| 102 | 3300005518 | Ga0070699_100038935 | Ga0070699_1000389352 | 205 |
| 103 | 3300005536 | Ga0070697_100012093 | Ga0070697_1000120935 | 205 |
| 104 | 3300005546 | Ga0070696_100039506 | Ga0070696_1000395063 | 205 |
| 105 | 3300005549 | Ga0070704_100043264 | Ga0070704_1000432644 | 205 |
| 106 | 3300007265 | Ga0099794_10164683 | Ga0099794_101646832 | 205 |
| 107 | 3300009148 | Ga0105243_10016738 | Ga0105243_100167387 | 205 |
| 108 | 3300009553 | Ga0105249_10095565 | Ga0105249_100955654 | 205 |
| 109 | 3300026089 | Ga0207648_10597915 | Ga0207648_105979152 | 205 |
| 110 | 3300027671 | Ga0209588_1078208 | Ga0209588_10782082 | 205 |
| 111 | 3300006852 | Ga0075433_10011237 | Ga0075433_100112375 | 206 |
| 112 | 3300006871 | Ga0075434_100047469 | Ga0075434_1000474695 | 206 |
| 113 | 3300006914 | Ga0075436_100016217 | Ga0075436_1000162172 | 206 |
| 114 | 3300049576 | Ga0501040_0050462 | Ga0501040_0050462_829_1485 | 206 |
| 115 | 3300050507 | nmdc:mga05p37_96455_c1 | nmdc:mga05p37_96455_c1_2644_3270 | 206 |
| 116 | 3300050512 | nmdc:mga0n895_12611_c1 | nmdc:mga0n895_12611_c1_3819_4469 | 206 |
| 117 | 3300050513 | nmdc:mga0rr50_15155_c1 | nmdc:mga0rr50_15155_c1_3536_4186 | 206 |
| 118 | 3300050514 | nmdc:mga08x19_2391_c1 | nmdc:mga08x19_2391_c1_10000_10650 | 206 |
| 119 | 3300049574 | Ga0501038_0073341 | Ga0501038_0073341_1993_2640 | 207 |
| 120 | 3300049575 | Ga0501039_0160118 | Ga0501039_0160118_859_1506 | 207 |
| 121 | 3300049577 | Ga0501041_0001517 | Ga0501041_0001517_2046_2693 | 207 |
| 122 | 3300049578 | Ga0501042_0156550 | Ga0501042_0156550_651_1298 | 207 |
| 123 | 3300049591 | Ga0501075_0020084 | Ga0501075_0020084_2446_3093 | 207 |
| 124 | 3300049592 | Ga0501076_0004888 | Ga0501076_0004888_1678_2325 | 207 |
| 125 | 3300049593 | Ga0501077_0007616 | Ga0501077_0007616_4034_4681 | 207 |
| 126 | 3300049741 | Ga0501079_0004364 | Ga0501079_0004364_4741_5388 | 207 |
| 127 | 3300049743 | Ga0501081_0008094 | Ga0501081_0008094_4243_4890 | 207 |
| 128 | 3300049822 | Ga0501035_0556140 | Ga0501035_0556140_52_699 | 207 |
| 129 | 3300049824 | Ga0501045_0041923 | Ga0501045_0041923_469_1116 | 207 |
| 130 | 3300060353 | Ga0501082_0006322 | Ga0501082_0006322_4884_5531 | 207 |
| 131 | 3300061734 | Ga0530510_0019190 | Ga0530510_0019190_1914_2561 | 207 |
| 132 | 3300049578 | Ga0501042_0065187 | Ga0501042_0065187_330_998 | 208 |
| 133 | 3300049579 | Ga0501043_0119680 | Ga0501043_0119680_803_1471 | 208 |
| 134 | 3300049580 | Ga0501046_0089977 | Ga0501046_0089977_446_1114 | 208 |
| 135 | 3300049584 | Ga0501068_0052084 | Ga0501068_0052084_1779_2447 | 208 |
| 136 | 3300049587 | Ga0501071_0106449 | Ga0501071_0106449_817_1485 | 208 |
| 137 | 3300049593 | Ga0501077_0035501 | Ga0501077_0035501_1533_2201 | 208 |
| 138 | 3300049742 | Ga0501080_0212253 | Ga0501080_0212253_534_1202 | 208 |
| 139 | 3300049822 | Ga0501035_0168011 | Ga0501035_0168011_70_738 | 208 |
| 140 | 3300006844 | Ga0075428_100136149 | Ga0075428_1001361492 | 209 |
| 141 | 3300006846 | Ga0075430_100206652 | Ga0075430_1002066523 | 209 |
| 142 | 3300006847 | Ga0075431_100085845 | Ga0075431_1000858452 | 209 |
| 143 | 3300006880 | Ga0075429_100277124 | Ga0075429_1002771243 | 209 |
| 144 | 3300009147 | Ga0114129_10082634 | Ga0114129_100826344 | 209 |
| 145 | 3300044673 | Ga0453683_0316639 | Ga0453683_0316639_59_715 | 209 |
| 146 | 3300049588 | Ga0501072_0884108 | Ga0501072_0884108_23_670 | 209 |
| 147 | 3300049592 | Ga0501076_0028537 | Ga0501076_0028537_3364_4011 | 209 |
| 148 | 3300049593 | Ga0501077_0050565 | Ga0501077_0050565_1165_1812 | 209 |
| 149 | 3300050507 | nmdc:mga05p37_68944_c1 | nmdc:mga05p37_68944_c1_474_1142 | 209 |
| 150 | 3300050508 | nmdc:mga09592_168686_c1 | nmdc:mga09592_168686_c1_638_1306 | 209 |
| 151 | 3300050509 | nmdc:mga0qj67_70653_c1 | nmdc:mga0qj67_70653_c1_165_833 | 209 |
| 152 | 3300050510 | nmdc:mga06r32_67198_c1 | nmdc:mga06r32_67198_c1_95_763 | 209 |
| 153 | 3300005338 | Ga0068868_100364000 | Ga0068868_1003640001 | 210 |
| 154 | 3300005367 | Ga0070667_100292925 | Ga0070667_1002929251 | 210 |
| 155 | 3300005445 | Ga0070708_100028980 | Ga0070708_1000289804 | 210 |
| 156 | 3300005445 | Ga0070708_100191878 | Ga0070708_1001918782 | 210 |
| 157 | 3300005445 | Ga0070708_100219312 | Ga0070708_1002193123 | 210 |
| 158 | 3300005445 | Ga0070708_100262388 | Ga0070708_1002623883 | 210 |
| 159 | 3300005467 | Ga0070706_100194901 | Ga0070706_1001949012 | 210 |
| 160 | 3300005841 | Ga0068863_100018065 | Ga0068863_1000180654 | 210 |
| 161 | 3300005981 | Ga0081538_10013563 | Ga0081538_100135634 | 210 |
| 162 | 3300005983 | Ga0081540_1015632 | Ga0081540_10156326 | 210 |
| 163 | 3300006163 | Ga0070715_10041481 | Ga0070715_100414812 | 210 |
| 164 | 3300006173 | Ga0070716_100035601 | Ga0070716_1000356013 | 210 |
| 165 | 3300006175 | Ga0070712_100013158 | Ga0070712_1000131584 | 210 |
| 166 | 3300006914 | Ga0075436_100183308 | Ga0075436_1001833082 | 210 |
| 167 | 3300009094 | Ga0111539_11067547 | Ga0111539_110675471 | 210 |
| 168 | 3300009177 | Ga0105248_10056969 | Ga0105248_100569694 | 210 |
| 169 | 3300009177 | Ga0105248_10120027 | Ga0105248_101200273 | 210 |
| 170 | 3300009553 | Ga0105249_10784516 | Ga0105249_107845161 | 210 |
| 171 | 3300025910 | Ga0207684_10204761 | Ga0207684_102047613 | 210 |
| 172 | 3300025915 | Ga0207693_10001303 | Ga0207693_100013036 | 210 |
| 173 | 3300025939 | Ga0207665_10129404 | Ga0207665_101294042 | 210 |
| 174 | 3300025941 | Ga0207711_10166723 | Ga0207711_101667232 | 210 |
| 175 | 3300049580 | Ga0501046_0508218 | Ga0501046_0508218_151_822 | 210 |
| 176 | 3300049585 | Ga0501069_0190127 | Ga0501069_0190127_207_875 | 210 |
| 177 | 3300049590 | Ga0501074_0039206 | Ga0501074_0039206_767_1435 | 210 |
| 178 | 3300049591 | Ga0501075_0001457 | Ga0501075_0001457_3002_3670 | 210 |
| 179 | 3300049591 | Ga0501075_0072520 | Ga0501075_0072520_102_773 | 210 |
| 180 | 3300049591 | Ga0501075_0491194 | Ga0501075_0491194_71_715 | 210 |
| 181 | 3300049592 | Ga0501076_0029517 | Ga0501076_0029517_439_1107 | 210 |
| 182 | 3300049592 | Ga0501076_0138877 | Ga0501076_0138877_413_1084 | 210 |
| 183 | 3300049592 | Ga0501076_0193132 | Ga0501076_0193132_144_788 | 210 |
| 184 | 3300049593 | Ga0501077_0208685 | Ga0501077_0208685_120_764 | 210 |
| 185 | 3300049741 | Ga0501079_0012404 | Ga0501079_0012404_2286_2954 | 210 |
| 186 | 3300049742 | Ga0501080_0174382 | Ga0501080_0174382_1067_1711 | 210 |
| 187 | 3300049743 | Ga0501081_0019526 | Ga0501081_0019526_49_693 | 210 |
| 188 | 3300049824 | Ga0501045_0019327 | Ga0501045_0019327_1141_1809 | 210 |
| 189 | 3300050512 | nmdc:mga0n895_69982_c1 | nmdc:mga0n895_69982_c1_1755_2408 | 210 |
| 190 | 3300050513 | nmdc:mga0rr50_133858_c1 | nmdc:mga0rr50_133858_c1_646_1299 | 210 |
| 191 | 3300050514 | nmdc:mga08x19_22559_c1 | nmdc:mga08x19_22559_c1_293_946 | 210 |
| 192 | 3300054114 | Ga0501084_0024768 | Ga0501084_0024768_1807_2475 | 210 |
| 193 | 3300054114 | Ga0501084_0477825 | Ga0501084_0477825_250_894 | 210 |
| 194 | 3300059421 | Ga0590071_068191 | Ga0590071_068191_91_762 | 210 |
| 195 | 3300060353 | Ga0501082_0019798 | Ga0501082_0019798_2819_3487 | 210 |
| 196 | 3300061734 | Ga0530510_0118621 | Ga0530510_0118621_527_1195 | 210 |
| 197 | 3300061734 | Ga0530510_0215052 | Ga0530510_0215052_478_1122 | 210 |
| 198 | 3300005445 | Ga0070708_100057528 | Ga0070708_1000575284 | 211 |
| 199 | 3300005467 | Ga0070706_100024514 | Ga0070706_1000245142 | 211 |
| 200 | 3300005467 | Ga0070706_100024833 | Ga0070706_1000248336 | 211 |
| 201 | 3300005467 | Ga0070706_100036412 | Ga0070706_1000364124 | 211 |
| 202 | 3300005468 | Ga0070707_100007265 | Ga0070707_1000072655 | 211 |
| 203 | 3300005468 | Ga0070707_100032051 | Ga0070707_1000320513 | 211 |
| 204 | 3300005468 | Ga0070707_100088877 | Ga0070707_1000888774 | 211 |
| 205 | 3300005468 | Ga0070707_100195730 | Ga0070707_1001957302 | 211 |
| 206 | 3300005468 | Ga0070707_100400511 | Ga0070707_1004005112 | 211 |
| 207 | 3300005518 | Ga0070699_100009282 | Ga0070699_1000092826 | 211 |
| 208 | 3300005518 | Ga0070699_100058928 | Ga0070699_1000589282 | 211 |
| 209 | 3300006871 | Ga0075434_100205232 | Ga0075434_1002052322 | 211 |
| 210 | 3300009147 | Ga0114129_10000078 | Ga0114129_1000007890 | 211 |
| 211 | 3300009147 | Ga0114129_10056055 | Ga0114129_100560552 | 211 |
| 212 | 3300025910 | Ga0207684_10051693 | Ga0207684_100516933 | 211 |
| 213 | 3300025922 | Ga0207646_10026953 | Ga0207646_100269534 | 211 |
| 214 | 3300025922 | Ga0207646_10066823 | Ga0207646_100668234 | 211 |
| 215 | 3300025922 | Ga0207646_10069778 | Ga0207646_100697784 | 211 |
| 216 | 3300025922 | Ga0207646_10136983 | Ga0207646_101369833 | 211 |
| 217 | 3300025922 | Ga0207646_10204991 | Ga0207646_102049912 | 211 |
| 218 | 3300049574 | Ga0501038_0233488 | Ga0501038_0233488_461_1108 | 211 |
| 219 | 3300049575 | Ga0501039_0287629 | Ga0501039_0287629_38_685 | 211 |
| 220 | 3300049579 | Ga0501043_0321239 | Ga0501043_0321239_222_869 | 211 |
| 221 | 3300049582 | Ga0501048_0140314 | Ga0501048_0140314_350_997 | 211 |
| 222 | 3300049588 | Ga0501072_0034179 | Ga0501072_0034179_1000_1647 | 211 |
| 223 | 3300049592 | Ga0501076_0070352 | Ga0501076_0070352_467_1114 | 211 |
| 224 | 3300049743 | Ga0501081_0109535 | Ga0501081_0109535_195_842 | 211 |
| 225 | 3300049824 | Ga0501045_0023563 | Ga0501045_0023563_3510_4157 | 211 |
| 226 | 3300050507 | nmdc:mga05p37_1275777_c1 | nmdc:mga05p37_1275777_c1_33_680 | 211 |
| 227 | 3300050507 | nmdc:mga05p37_26965_c1 | nmdc:mga05p37_26965_c1_4746_5393 | 211 |
| 228 | 3300050510 | nmdc:mga06r32_3471_c1 | nmdc:mga06r32_3471_c1_10848_11510 | 211 |
| 229 | 3300054114 | Ga0501084_0116108 | Ga0501084_0116108_563_1210 | 211 |
| 230 | 3300061734 | Ga0530510_0041498 | Ga0530510_0041498_2121_2768 | 211 |
| 231 | 3300005330 | Ga0070690_100110993 | Ga0070690_1001109931 | 212 |
| 232 | 3300005544 | Ga0070686_100243475 | Ga0070686_1002434751 | 212 |
| 233 | 3300009148 | Ga0105243_10527784 | Ga0105243_105277841 | 212 |
| 234 | 3300009553 | Ga0105249_10413703 | Ga0105249_104137032 | 212 |
| 235 | 3300045051 | Ga0451576_0251356 | Ga0451576_0251356_1072_1749 | 212 |
| 236 | 3300005440 | Ga0070705_100072301 | Ga0070705_1000723012 | 213 |
| 237 | 3300005937 | Ga0081455_10000208 | Ga0081455_1000020828 | 213 |
| 238 | 3300006846 | Ga0075430_100362221 | Ga0075430_1003622212 | 213 |
| 239 | 3300006847 | Ga0075431_100231413 | Ga0075431_1002314133 | 213 |
| 240 | 3300009147 | Ga0114129_10327274 | Ga0114129_103272743 | 213 |
| 241 | 3300049576 | Ga0501040_0177550 | Ga0501040_0177550_234_881 | 213 |
| 242 | 3300049577 | Ga0501041_0144203 | Ga0501041_0144203_53_700 | 213 |
| 243 | 3300049582 | Ga0501048_0369783 | Ga0501048_0369783_204_848 | 213 |
| 244 | 3300049587 | Ga0501071_0388243 | Ga0501071_0388243_102_746 | 213 |
| 245 | 3300049591 | Ga0501075_0050577 | Ga0501075_0050577_359_1006 | 213 |
| 246 | 3300049591 | Ga0501075_0377253 | Ga0501075_0377253_201_845 | 213 |
| 247 | 3300050507 | nmdc:mga05p37_224852_c1 | nmdc:mga05p37_224852_c1_377_1024 | 213 |
| 248 | 3300050507 | nmdc:mga05p37_662783_c1 | nmdc:mga05p37_662783_c1_144_794 | 213 |
| 249 | 3300050509 | nmdc:mga0qj67_161756_c1 | nmdc:mga0qj67_161756_c1_1104_1754 | 213 |
| 250 | 3300050510 | nmdc:mga06r32_223680_c1 | nmdc:mga06r32_223680_c1_213_863 | 213 |
| 251 | 3300054114 | Ga0501084_0003947 | Ga0501084_0003947_1225_1869 | 213 |
| 252 | 3300005334 | Ga0068869_100012050 | Ga0068869_1000120505 | 214 |
| 253 | 3300005334 | Ga0068869_100100593 | Ga0068869_1001005933 | 214 |
| 254 | 3300005336 | Ga0070680_100184864 | Ga0070680_1001848642 | 214 |
| 255 | 3300005341 | Ga0070691_10017004 | Ga0070691_100170045 | 214 |
| 256 | 3300005341 | Ga0070691_10024098 | Ga0070691_100240982 | 214 |
| 257 | 3300005406 | Ga0070703_10014072 | Ga0070703_100140722 | 214 |
| 258 | 3300005406 | Ga0070703_10052798 | Ga0070703_100527981 | 214 |
| 259 | 3300005434 | Ga0070709_10026406 | Ga0070709_100264063 | 214 |
| 260 | 3300005438 | Ga0070701_10005551 | Ga0070701_100055514 | 214 |
| 261 | 3300005441 | Ga0070700_100005861 | Ga0070700_1000058614 | 214 |
| 262 | 3300005444 | Ga0070694_100003904 | Ga0070694_1000039047 | 214 |
| 263 | 3300005444 | Ga0070694_100010230 | Ga0070694_1000102305 | 214 |
| 264 | 3300005444 | Ga0070694_100019487 | Ga0070694_1000194873 | 214 |
| 265 | 3300005444 | Ga0070694_100081405 | Ga0070694_1000814052 | 214 |
| 266 | 3300005457 | Ga0070662_100130905 | Ga0070662_1001309052 | 214 |
| 267 | 3300005467 | Ga0070706_100435422 | Ga0070706_1004354221 | 214 |
| 268 | 3300005468 | Ga0070707_100036260 | Ga0070707_1000362605 | 214 |
| 269 | 3300005471 | Ga0070698_100014079 | Ga0070698_1000140796 | 214 |
| 270 | 3300005471 | Ga0070698_100063516 | Ga0070698_1000635163 | 214 |
| 271 | 3300005518 | Ga0070699_100022694 | Ga0070699_1000226942 | 214 |
| 272 | 3300005518 | Ga0070699_100028105 | Ga0070699_1000281056 | 214 |
| 273 | 3300005518 | Ga0070699_100119845 | Ga0070699_1001198453 | 214 |
| 274 | 3300005536 | Ga0070697_100031758 | Ga0070697_1000317584 | 214 |
| 275 | 3300005536 | Ga0070697_100199133 | Ga0070697_1001991333 | 214 |
| 276 | 3300005545 | Ga0070695_100000685 | Ga0070695_10000068520 | 214 |
| 277 | 3300005545 | Ga0070695_100004819 | Ga0070695_1000048197 | 214 |
| 278 | 3300005545 | Ga0070695_100006806 | Ga0070695_1000068063 | 214 |
| 279 | 3300005545 | Ga0070695_100031556 | Ga0070695_1000315564 | 214 |
| 280 | 3300005546 | Ga0070696_100026432 | Ga0070696_1000264322 | 214 |
| 281 | 3300005547 | Ga0070693_100031434 | Ga0070693_1000314342 | 214 |
| 282 | 3300005549 | Ga0070704_100008324 | Ga0070704_1000083243 | 214 |
| 283 | 3300005549 | Ga0070704_100327970 | Ga0070704_1003279702 | 214 |
| 284 | 3300005577 | Ga0068857_100303254 | Ga0068857_1003032542 | 214 |
| 285 | 3300005844 | Ga0068862_100291596 | Ga0068862_1002915963 | 214 |
| 286 | 3300005844 | Ga0068862_100407535 | Ga0068862_1004075352 | 214 |
| 287 | 3300006847 | Ga0075431_100004465 | Ga0075431_10000446515 | 214 |
| 288 | 3300006847 | Ga0075431_100185939 | Ga0075431_1001859392 | 214 |
| 289 | 3300006852 | Ga0075433_10002435 | Ga0075433_100024353 | 214 |
| 290 | 3300006852 | Ga0075433_10009354 | Ga0075433_100093549 | 214 |
| 291 | 3300006880 | Ga0075429_100027715 | Ga0075429_1000277155 | 214 |
| 292 | 3300006881 | Ga0068865_100115771 | Ga0068865_1001157712 | 214 |
| 293 | 3300007265 | Ga0099794_10171715 | Ga0099794_101717152 | 214 |
| 294 | 3300009094 | Ga0111539_10000370 | Ga0111539_100003703 | 214 |
| 295 | 3300009094 | Ga0111539_10440366 | Ga0111539_104403662 | 214 |
| 296 | 3300009147 | Ga0114129_10068941 | Ga0114129_100689412 | 214 |
| 297 | 3300009147 | Ga0114129_11199248 | Ga0114129_111992482 | 214 |
| 298 | 3300009176 | Ga0105242_10006162 | Ga0105242_100061625 | 214 |
| 299 | 3300009176 | Ga0105242_10143429 | Ga0105242_101434293 | 214 |
| 300 | 3300025885 | Ga0207653_10003610 | Ga0207653_100036105 | 214 |
| 301 | 3300025885 | Ga0207653_10066990 | Ga0207653_100669902 | 214 |
| 302 | 3300025907 | Ga0207645_10066972 | Ga0207645_100669724 | 214 |
| 303 | 3300025910 | Ga0207684_10010713 | Ga0207684_100107136 | 214 |
| 304 | 3300025910 | Ga0207684_10231548 | Ga0207684_102315482 | 214 |
| 305 | 3300025917 | Ga0207660_10005203 | Ga0207660_100052032 | 214 |
| 306 | 3300025922 | Ga0207646_10046844 | Ga0207646_100468442 | 214 |
| 307 | 3300025922 | Ga0207646_10093447 | Ga0207646_100934472 | 214 |
| 308 | 3300025922 | Ga0207646_10236519 | Ga0207646_102365192 | 214 |
| 309 | 3300025927 | Ga0207687_10591315 | Ga0207687_105913152 | 214 |
| 310 | 3300025935 | Ga0207709_10012241 | Ga0207709_100122415 | 214 |
| 311 | 3300025938 | Ga0207704_10466954 | Ga0207704_104669541 | 214 |
| 312 | 3300025939 | Ga0207665_10003678 | Ga0207665_100036787 | 214 |
| 313 | 3300025942 | Ga0207689_10009967 | Ga0207689_100099677 | 214 |
| 314 | 3300025942 | Ga0207689_10022157 | Ga0207689_100221572 | 214 |
| 315 | 3300025961 | Ga0207712_10100206 | Ga0207712_101002061 | 214 |
| 316 | 3300026075 | Ga0207708_10061594 | Ga0207708_100615942 | 214 |
| 317 | 3300026116 | Ga0207674_10028729 | Ga0207674_100287296 | 214 |
| 318 | 3300027462 | Ga0210000_1006537 | Ga0210000_10065372 | 214 |
| 319 | 3300027543 | Ga0209999_1002588 | Ga0209999_10025882 | 214 |
| 320 | 3300027614 | Ga0209970_1020572 | Ga0209970_10205722 | 214 |
| 321 | 3300027665 | Ga0209983_1005174 | Ga0209983_10051744 | 214 |
| 322 | 3300027671 | Ga0209588_1051416 | Ga0209588_10514161 | 214 |
| 323 | 3300027682 | Ga0209971_1000031 | Ga0209971_10000319 | 214 |
| 324 | 3300027695 | Ga0209966_1000020 | Ga0209966_100002036 | 214 |
| 325 | 3300027717 | Ga0209998_10000024 | Ga0209998_1000002440 | 214 |
| 326 | 3300027876 | Ga0209974_10005110 | Ga0209974_100051104 | 214 |
| 327 | 3300027907 | Ga0207428_10000409 | Ga0207428_1000040946 | 214 |
| 328 | 3300028381 | Ga0268264_10147829 | Ga0268264_101478292 | 214 |
| 329 | 3300028381 | Ga0268264_10784770 | Ga0268264_107847702 | 214 |
| 330 | 3300031852 | Ga0307410_10028158 | Ga0307410_100281584 | 214 |
| 331 | 3300031995 | Ga0307409_100531001 | Ga0307409_1005310012 | 214 |
| 332 | 3300032126 | Ga0307415_100834938 | Ga0307415_1008349382 | 214 |
| 333 | 3300037466 | Ga0395898_0367769 | Ga0395898_0367769_285_935 | 214 |
| 334 | 3300042008 | Ga0439450_020251 | Ga0439450_020251_229_879 | 214 |
| 335 | 3300042461 | Ga0439460_0000450 | Ga0439460_0000450_970_1620 | 214 |
| 336 | 3300042876 | Ga0451577_0003197 | Ga0451577_0003197_13752_14435 | 214 |
| 337 | 3300042876 | Ga0451577_0134764 | Ga0451577_0134764_399_1049 | 214 |
| 338 | 3300042993 | Ga0439440_0112885 | Ga0439440_0112885_35_685 | 214 |
| 339 | 3300044673 | Ga0453683_0016978 | Ga0453683_0016978_184_834 | 214 |
| 340 | 3300044712 | Ga0453684_0015160 | Ga0453684_0015160_3236_3919 | 214 |
| 341 | 3300044712 | Ga0453684_0464953 | Ga0453684_0464953_121_771 | 214 |
| 342 | 3300044712 | Ga0453684_0743273 | Ga0453684_0743273_231_881 | 214 |
| 343 | 3300045051 | Ga0451576_0013787 | Ga0451576_0013787_7653_8336 | 214 |
| 344 | 3300045051 | Ga0451576_0019829 | Ga0451576_0019829_3858_4508 | 214 |
| 345 | 3300045051 | Ga0451576_0052940 | Ga0451576_0052940_813_1463 | 214 |
| 346 | 3300045051 | Ga0451576_0174733 | Ga0451576_0174733_1361_2011 | 214 |
| 347 | 3300045051 | Ga0451576_0274098 | Ga0451576_0274098_227_877 | 214 |
| 348 | 3300046664 | Ga0495659_0233319 | Ga0495659_0233319_58_708 | 214 |
| 349 | 3300049570 | Ga0501033_0068100 | Ga0501033_0068100_1490_2140 | 214 |
| 350 | 3300049570 | Ga0501033_0276558 | Ga0501033_0276558_503_1171 | 214 |
| 351 | 3300049573 | Ga0501037_0302819 | Ga0501037_0302819_347_994 | 214 |
| 352 | 3300049574 | Ga0501038_0040865 | Ga0501038_0040865_1166_1816 | 214 |
| 353 | 3300049574 | Ga0501038_0280173 | Ga0501038_0280173_218_868 | 214 |
| 354 | 3300049575 | Ga0501039_0007391 | Ga0501039_0007391_7404_8054 | 214 |
| 355 | 3300049575 | Ga0501039_0341983 | Ga0501039_0341983_80_730 | 214 |
| 356 | 3300049575 | Ga0501039_0373475 | Ga0501039_0373475_447_1097 | 214 |
| 357 | 3300049576 | Ga0501040_0006872 | Ga0501040_0006872_3851_4501 | 214 |
| 358 | 3300049576 | Ga0501040_0204180 | Ga0501040_0204180_544_1194 | 214 |
| 359 | 3300049577 | Ga0501041_0014739 | Ga0501041_0014739_1099_1749 | 214 |
| 360 | 3300049578 | Ga0501042_0438186 | Ga0501042_0438186_42_692 | 214 |
| 361 | 3300049578 | Ga0501042_0550834 | Ga0501042_0550834_46_720 | 214 |
| 362 | 3300049580 | Ga0501046_0000607 | Ga0501046_0000607_30716_31366 | 214 |
| 363 | 3300049581 | Ga0501047_0043661 | Ga0501047_0043661_1027_1677 | 214 |
| 364 | 3300049582 | Ga0501048_0007236 | Ga0501048_0007236_3923_4573 | 214 |
| 365 | 3300049582 | Ga0501048_0205952 | Ga0501048_0205952_11_661 | 214 |
| 366 | 3300049583 | Ga0501067_0174383 | Ga0501067_0174383_474_1124 | 214 |
| 367 | 3300049585 | Ga0501069_0259851 | Ga0501069_0259851_249_899 | 214 |
| 368 | 3300049586 | Ga0501070_0220407 | Ga0501070_0220407_14_664 | 214 |
| 369 | 3300049587 | Ga0501071_0106603 | Ga0501071_0106603_651_1301 | 214 |
| 370 | 3300049588 | Ga0501072_0104005 | Ga0501072_0104005_1234_1884 | 214 |
| 371 | 3300049588 | Ga0501072_0193684 | Ga0501072_0193684_581_1228 | 214 |
| 372 | 3300049588 | Ga0501072_0348627 | Ga0501072_0348627_73_723 | 214 |
| 373 | 3300049590 | Ga0501074_0009258 | Ga0501074_0009258_322_972 | 214 |
| 374 | 3300049590 | Ga0501074_0583236 | Ga0501074_0583236_101_751 | 214 |
| 375 | 3300049591 | Ga0501075_0107835 | Ga0501075_0107835_1324_1974 | 214 |
| 376 | 3300049591 | Ga0501075_0109282 | Ga0501075_0109282_846_1496 | 214 |
| 377 | 3300049591 | Ga0501075_0132683 | Ga0501075_0132683_20_670 | 214 |
| 378 | 3300049592 | Ga0501076_0023309 | Ga0501076_0023309_1230_1880 | 214 |
| 379 | 3300049592 | Ga0501076_0371846 | Ga0501076_0371846_467_1117 | 214 |
| 380 | 3300049593 | Ga0501077_0019750 | Ga0501077_0019750_1879_2526 | 214 |
| 381 | 3300049593 | Ga0501077_0026293 | Ga0501077_0026293_2867_3517 | 214 |
| 382 | 3300049593 | Ga0501077_0043469 | Ga0501077_0043469_1048_1722 | 214 |
| 383 | 3300049741 | Ga0501079_0005375 | Ga0501079_0005375_292_942 | 214 |
| 384 | 3300049741 | Ga0501079_0008589 | Ga0501079_0008589_3943_4617 | 214 |
| 385 | 3300049741 | Ga0501079_0185493 | Ga0501079_0185493_401_1051 | 214 |
| 386 | 3300049742 | Ga0501080_0076967 | Ga0501080_0076967_1930_2580 | 214 |
| 387 | 3300049742 | Ga0501080_0246285 | Ga0501080_0246285_686_1336 | 214 |
| 388 | 3300049743 | Ga0501081_0532837 | Ga0501081_0532837_189_839 | 214 |
| 389 | 3300049744 | Ga0501083_0109881 | Ga0501083_0109881_804_1454 | 214 |
| 390 | 3300049822 | Ga0501035_0327865 | Ga0501035_0327865_497_1147 | 214 |
| 391 | 3300049823 | Ga0501044_0541039 | Ga0501044_0541039_22_672 | 214 |
| 392 | 3300049824 | Ga0501045_0001608 | Ga0501045_0001608_1887_2537 | 214 |
| 393 | 3300049824 | Ga0501045_0088616 | Ga0501045_0088616_1603_2253 | 214 |
| 394 | 3300049824 | Ga0501045_0182204 | Ga0501045_0182204_716_1366 | 214 |
| 395 | 3300050510 | nmdc:mga06r32_1254_c1 | nmdc:mga06r32_1254_c1_14_697 | 214 |
| 396 | 3300050510 | nmdc:mga06r32_126946_c1 | nmdc:mga06r32_126946_c1_1810_2460 | 214 |
| 397 | 3300050510 | nmdc:mga06r32_76307_c1 | nmdc:mga06r32_76307_c1_1540_2229 | 214 |
| 398 | 3300050510 | nmdc:mga06r32_90387_c1 | nmdc:mga06r32_90387_c1_49_699 | 214 |
| 399 | 3300050511 | nmdc:mga08y16_11942_c1 | nmdc:mga08y16_11942_c1_6588_7271 | 214 |
| 400 | 3300050515 | nmdc:mga0a205_49897_c1 | nmdc:mga0a205_49897_c1_1296_1979 | 214 |
| 401 | 3300050515 | nmdc:mga0a205_895_c1 | nmdc:mga0a205_895_c1_16229_16912 | 214 |
| 402 | 3300054114 | Ga0501084_0013112 | Ga0501084_0013112_5877_6551 | 214 |
| 403 | 3300054114 | Ga0501084_0020335 | Ga0501084_0020335_3860_4510 | 214 |
| 404 | 3300054114 | Ga0501084_0355655 | Ga0501084_0355655_530_1180 | 214 |
| 405 | 3300060353 | Ga0501082_0000058 | Ga0501082_0000058_74660_75310 | 214 |
| 406 | 3300060353 | Ga0501082_0419070 | Ga0501082_0419070_196_870 | 214 |
| 407 | 3300061734 | Ga0530510_0000450 | Ga0530510_0000450_2472_3119 | 214 |
| 408 | 3300061734 | Ga0530510_0057884 | Ga0530510_0057884_1699_2346 | 214 |
| 409 | 3300061734 | Ga0530510_0064169 | Ga0530510_0064169_969_1619 | 214 |
| 410 | 3300005334 | Ga0068869_100752900 | Ga0068869_1007529001 | 215 |
| 411 | 3300005347 | Ga0070668_100113259 | Ga0070668_1001132592 | 215 |
| 412 | 3300005353 | Ga0070669_100137124 | Ga0070669_1001371241 | 215 |
| 413 | 3300005353 | Ga0070669_100435668 | Ga0070669_1004356681 | 215 |
| 414 | 3300005440 | Ga0070705_100049365 | Ga0070705_1000493654 | 215 |
| 415 | 3300005440 | Ga0070705_100402726 | Ga0070705_1004027261 | 215 |
| 416 | 3300005445 | Ga0070708_100151506 | Ga0070708_1001515061 | 215 |
| 417 | 3300005445 | Ga0070708_100349950 | Ga0070708_1003499503 | 215 |
| 418 | 3300005468 | Ga0070707_100353405 | Ga0070707_1003534052 | 215 |
| 419 | 3300005468 | Ga0070707_100621872 | Ga0070707_1006218722 | 215 |
| 420 | 3300005471 | Ga0070698_100175074 | Ga0070698_1001750743 | 215 |
| 421 | 3300005518 | Ga0070699_100558353 | Ga0070699_1005583532 | 215 |
| 422 | 3300005536 | Ga0070697_100037568 | Ga0070697_1000375685 | 215 |
| 423 | 3300005536 | Ga0070697_100333478 | Ga0070697_1003334782 | 215 |
| 424 | 3300005536 | Ga0070697_100352934 | Ga0070697_1003529342 | 215 |
| 425 | 3300005536 | Ga0070697_100626186 | Ga0070697_1006261862 | 215 |
| 426 | 3300005546 | Ga0070696_100063987 | Ga0070696_1000639873 | 215 |
| 427 | 3300005615 | Ga0070702_100552628 | Ga0070702_1005526282 | 215 |
| 428 | 3300005843 | Ga0068860_100145056 | Ga0068860_1001450563 | 215 |
| 429 | 3300005844 | Ga0068862_100120208 | Ga0068862_1001202082 | 215 |
| 430 | 3300005983 | Ga0081540_1031201 | Ga0081540_10312012 | 215 |
| 431 | 3300006194 | Ga0075427_10018899 | Ga0075427_100188992 | 215 |
| 432 | 3300006846 | Ga0075430_100014245 | Ga0075430_1000142454 | 215 |
| 433 | 3300006847 | Ga0075431_100194061 | Ga0075431_1001940611 | 215 |
| 434 | 3300006847 | Ga0075431_100213890 | Ga0075431_1002138902 | 215 |
| 435 | 3300006852 | Ga0075433_10000230 | Ga0075433_100002306 | 215 |
| 436 | 3300006852 | Ga0075433_10031005 | Ga0075433_100310054 | 215 |
| 437 | 3300006852 | Ga0075433_10060888 | Ga0075433_100608884 | 215 |
| 438 | 3300006871 | Ga0075434_100011156 | Ga0075434_1000111566 | 215 |
| 439 | 3300006871 | Ga0075434_100024250 | Ga0075434_1000242505 | 215 |
| 440 | 3300006871 | Ga0075434_100146970 | Ga0075434_1001469701 | 215 |
| 441 | 3300006871 | Ga0075434_100316441 | Ga0075434_1003164413 | 215 |
| 442 | 3300006880 | Ga0075429_100001793 | Ga0075429_1000017936 | 215 |
| 443 | 3300006880 | Ga0075429_100041111 | Ga0075429_1000411112 | 215 |
| 444 | 3300006880 | Ga0075429_100234775 | Ga0075429_1002347752 | 215 |
| 445 | 3300007076 | Ga0075435_100039630 | Ga0075435_1000396304 | 215 |
| 446 | 3300007076 | Ga0075435_100129917 | Ga0075435_1001299173 | 215 |
| 447 | 3300007076 | Ga0075435_100169695 | Ga0075435_1001696952 | 215 |
| 448 | 3300007265 | Ga0099794_10003968 | Ga0099794_100039683 | 215 |
| 449 | 3300009093 | Ga0105240_10533011 | Ga0105240_105330111 | 215 |
| 450 | 3300009094 | Ga0111539_10004176 | Ga0111539_1000417615 | 215 |
| 451 | 3300009094 | Ga0111539_10008974 | Ga0111539_1000897410 | 215 |
| 452 | 3300009094 | Ga0111539_10516311 | Ga0111539_105163112 | 215 |
| 453 | 3300009147 | Ga0114129_10008029 | Ga0114129_1000802912 | 215 |
| 454 | 3300009147 | Ga0114129_10100951 | Ga0114129_101009514 | 215 |
| 455 | 3300009147 | Ga0114129_10216347 | Ga0114129_102163473 | 215 |
| 456 | 3300009147 | Ga0114129_10680498 | Ga0114129_106804982 | 215 |
| 457 | 3300009147 | Ga0114129_11232827 | Ga0114129_112328272 | 215 |
| 458 | 3300009174 | Ga0105241_10000218 | Ga0105241_100002184 | 215 |
| 459 | 3300013100 | Ga0157373_10000381 | Ga0157373_1000038112 | 215 |
| 460 | 3300013102 | Ga0157371_10057611 | Ga0157371_100576112 | 215 |
| 461 | 3300013105 | Ga0157369_10021069 | Ga0157369_100210697 | 215 |
| 462 | 3300013297 | Ga0157378_10751653 | Ga0157378_107516531 | 215 |
| 463 | 3300013306 | Ga0163162_10779799 | Ga0163162_107797992 | 215 |
| 464 | 3300013307 | Ga0157372_10001479 | Ga0157372_1000147913 | 215 |
| 465 | 3300014325 | Ga0163163_10050672 | Ga0163163_100506725 | 215 |
| 466 | 3300014745 | Ga0157377_10478851 | Ga0157377_104788512 | 215 |
| 467 | 3300015262 | Ga0182007_10029431 | Ga0182007_100294313 | 215 |
| 468 | 3300025910 | Ga0207684_10043067 | Ga0207684_100430674 | 215 |
| 469 | 3300025910 | Ga0207684_10075571 | Ga0207684_100755713 | 215 |
| 470 | 3300025922 | Ga0207646_10121000 | Ga0207646_101210002 | 215 |
| 471 | 3300025940 | Ga0207691_10251353 | Ga0207691_102513532 | 215 |
| 472 | 3300025972 | Ga0207668_10093678 | Ga0207668_100936783 | 215 |
| 473 | 3300027671 | Ga0209588_1009645 | Ga0209588_10096454 | 215 |
| 474 | 3300027907 | Ga0207428_10000138 | Ga0207428_1000013899 | 215 |
| 475 | 3300028380 | Ga0268265_10052643 | Ga0268265_100526432 | 215 |
| 476 | 3300028381 | Ga0268264_10288131 | Ga0268264_102881312 | 215 |
| 477 | 3300035084 | Ga0373928_0029543 | Ga0373928_0029543_16_666 | 215 |
| 478 | 3300035085 | Ga0373929_0011061 | Ga0373929_0011061_881_1534 | 215 |
| 479 | 3300035088 | Ga0373940_0006109 | Ga0373940_0006109_1754_2407 | 215 |
| 480 | 3300035088 | Ga0373940_0015581 | Ga0373940_0015581_1022_1672 | 215 |
| 481 | 3300035090 | Ga0373949_0005165 | Ga0373949_0005165_1340_1993 | 215 |
| 482 | 3300035090 | Ga0373949_0019112 | Ga0373949_0019112_184_834 | 215 |
| 483 | 3300035114 | Ga0373939_0009908 | Ga0373939_0009908_878_1528 | 215 |
| 484 | 3300035115 | Ga0373941_0071947 | Ga0373941_0071947_115_765 | 215 |
| 485 | 3300035242 | Ga0373962_0115907 | Ga0373962_0115907_109_759 | 215 |
| 486 | 3300035691 | Ga0373931_0017353 | Ga0373931_0017353_178_828 | 215 |
| 487 | 3300035691 | Ga0373931_0078337 | Ga0373931_0078337_229_879 | 215 |
| 488 | 3300042005 | Ga0439448_0003645 | Ga0439448_0003645_817_1470 | 215 |
| 489 | 3300042012 | Ga0439455_0032411 | Ga0439455_0032411_240_893 | 215 |
| 490 | 3300042438 | Ga0439459_0008936 | Ga0439459_0008936_113_766 | 215 |
| 491 | 3300042876 | Ga0451577_0023850 | Ga0451577_0023850_2868_3521 | 215 |
| 492 | 3300045051 | Ga0451576_0042741 | Ga0451576_0042741_876_1526 | 215 |
| 493 | 3300045051 | Ga0451576_0075083 | Ga0451576_0075083_2173_2823 | 215 |
| 494 | 3300045051 | Ga0451576_0175287 | Ga0451576_0175287_1408_2061 | 215 |
| 495 | 3300046472 | Ga0495580_0000331 | Ga0495580_0000331_3831_4481 | 215 |
| 496 | 3300046491 | Ga0495584_0134496 | Ga0495584_0134496_354_1004 | 215 |
| 497 | 3300046528 | Ga0495642_0033480 | Ga0495642_0033480_204_854 | 215 |
| 498 | 3300046664 | Ga0495659_0029601 | Ga0495659_0029601_1032_1682 | 215 |
| 499 | 3300047318 | Ga0495636_0024339 | Ga0495636_0024339_32_682 | 215 |
| 500 | 3300048905 | Ga0496102_0053609 | Ga0496102_0053609_149_802 | 215 |
| 501 | 3300048915 | Ga0496112_0785337 | Ga0496112_0785337_45_698 | 215 |
| 502 | 3300049580 | Ga0501046_0204573 | Ga0501046_0204573_740_1390 | 215 |
| 503 | 3300049743 | Ga0501081_0184231 | Ga0501081_0184231_121_774 | 215 |
| 504 | 3300050507 | nmdc:mga05p37_204587_c1 | nmdc:mga05p37_204587_c1_978_1628 | 215 |
| 505 | 3300050507 | nmdc:mga05p37_205700_c1 | nmdc:mga05p37_205700_c1_121_771 | 215 |
| 506 | 3300050507 | nmdc:mga05p37_307277_c1 | nmdc:mga05p37_307277_c1_134_787 | 215 |
| 507 | 3300050507 | nmdc:mga05p37_57280_c1 | nmdc:mga05p37_57280_c1_2615_3265 | 215 |
| 508 | 3300050507 | nmdc:mga05p37_88173_c1 | nmdc:mga05p37_88173_c1_1213_1863 | 215 |
| 509 | 3300050508 | nmdc:mga09592_33850_c1 | nmdc:mga09592_33850_c1_1268_1918 | 215 |
| 510 | 3300050508 | nmdc:mga09592_92879_c1 | nmdc:mga09592_92879_c1_1545_2195 | 215 |
| 511 | 3300050509 | nmdc:mga0qj67_14460_c1 | nmdc:mga0qj67_14460_c1_3077_3727 | 215 |
| 512 | 3300050510 | nmdc:mga06r32_113820_c1 | nmdc:mga06r32_113820_c1_228_878 | 215 |
| 513 | 3300050510 | nmdc:mga06r32_6047_c1 | nmdc:mga06r32_6047_c1_2931_3581 | 215 |
| 514 | 3300050511 | nmdc:mga08y16_2476_c1 | nmdc:mga08y16_2476_c1_3908_4558 | 215 |
| 515 | 3300050511 | nmdc:mga08y16_29427_c1 | nmdc:mga08y16_29427_c1_1963_2613 | 215 |
| 516 | 3300050512 | nmdc:mga0n895_126103_c1 | nmdc:mga0n895_126103_c1_1005_1658 | 215 |
| 517 | 3300050512 | nmdc:mga0n895_34456_c1 | nmdc:mga0n895_34456_c1_1282_1932 | 215 |
| 518 | 3300050512 | nmdc:mga0n895_78605_c1 | nmdc:mga0n895_78605_c1_541_1191 | 215 |
| 519 | 3300050512 | nmdc:mga0n895_80201_c1 | nmdc:mga0n895_80201_c1_170_820 | 215 |
| 520 | 3300050512 | nmdc:mga0n895_84364_c1 | nmdc:mga0n895_84364_c1_1854_2504 | 215 |
| 521 | 3300050513 | nmdc:mga0rr50_165341_c1 | nmdc:mga0rr50_165341_c1_441_1091 | 215 |
| 522 | 3300050513 | nmdc:mga0rr50_226090_c1 | nmdc:mga0rr50_226090_c1_504_1154 | 215 |
| 523 | 3300050513 | nmdc:mga0rr50_36119_c1 | nmdc:mga0rr50_36119_c1_602_1252 | 215 |
| 524 | 3300050513 | nmdc:mga0rr50_62639_c1 | nmdc:mga0rr50_62639_c1_1100_1750 | 215 |
| 525 | 3300050514 | nmdc:mga08x19_359253_c1 | nmdc:mga08x19_359253_c1_183_836 | 215 |
| 526 | 3300050515 | nmdc:mga0a205_12408_c1 | nmdc:mga0a205_12408_c1_2967_3617 | 215 |
| 527 | 3300050515 | nmdc:mga0a205_243123_c1 | nmdc:mga0a205_243123_c1_17_667 | 215 |
| 528 | 3300050515 | nmdc:mga0a205_34506_c1 | nmdc:mga0a205_34506_c1_1249_1899 | 215 |
| 529 | 3300050515 | nmdc:mga0a205_46561_c1 | nmdc:mga0a205_46561_c1_2083_2736 | 215 |
| 530 | 3300054114 | Ga0501084_0136774 | Ga0501084_0136774_240_890 | 215 |
| 531 | 3300005467 | Ga0070706_100210726 | Ga0070706_1002107263 | 216 |
| 532 | 3300005546 | Ga0070696_100006243 | Ga0070696_1000062437 | 216 |
| 533 | 3300007265 | Ga0099794_10069564 | Ga0099794_100695642 | 216 |
| 534 | 3300042461 | Ga0439460_0188863 | Ga0439460_0188863_15_677 | 216 |
| 535 | 3300005468 | Ga0070707_100027866 | Ga0070707_1000278665 | 217 |
| 536 | 3300005468 | Ga0070707_100556716 | Ga0070707_1005567162 | 217 |
| 537 | 3300005518 | Ga0070699_100110951 | Ga0070699_1001109513 | 217 |
| 538 | 3300006844 | Ga0075428_100513343 | Ga0075428_1005133432 | 217 |
| 539 | 3300006847 | Ga0075431_100254142 | Ga0075431_1002541423 | 217 |
| 540 | 3300006871 | Ga0075434_100133814 | Ga0075434_1001338142 | 217 |
| 541 | 3300007076 | Ga0075435_100005683 | Ga0075435_1000056834 | 217 |
| 542 | 3300009147 | Ga0114129_10000599 | Ga0114129_1000059938 | 217 |
| 543 | 3300009147 | Ga0114129_10453015 | Ga0114129_104530152 | 217 |
| 544 | 3300025910 | Ga0207684_10424533 | Ga0207684_104245332 | 217 |
| 545 | 3300025922 | Ga0207646_10027112 | Ga0207646_100271126 | 217 |
| 546 | 3300025922 | Ga0207646_10382215 | Ga0207646_103822152 | 217 |
| 547 | 3300025923 | Ga0207681_10251962 | Ga0207681_102519622 | 217 |
| 548 | 3300034817 | Ga0373948_0007102 | Ga0373948_0007102_962_1624 | 217 |
| 549 | 3300049576 | Ga0501040_0021010 | Ga0501040_0021010_357_1013 | 217 |
| 550 | 3300050507 | nmdc:mga05p37_369731_c1 | nmdc:mga05p37_369731_c1_416_1075 | 217 |
| 551 | 3300050507 | nmdc:mga05p37_93330_c1 | nmdc:mga05p37_93330_c1_517_1176 | 217 |
| 552 | 3300050510 | nmdc:mga06r32_171864_c1 | nmdc:mga06r32_171864_c1_399_1058 | 217 |
| 553 | 3300050512 | nmdc:mga0n895_111725_c1 | nmdc:mga0n895_111725_c1_1153_1809 | 217 |
| 554 | 3300050513 | nmdc:mga0rr50_3069_c1 | nmdc:mga0rr50_3069_c1_6297_6953 | 217 |
| 555 | 3300005459 | Ga0068867_100268865 | Ga0068867_1002688652 | 218 |
| 556 | 3300005467 | Ga0070706_100057489 | Ga0070706_1000574893 | 218 |
| 557 | 3300005546 | Ga0070696_100078406 | Ga0070696_1000784062 | 218 |
| 558 | 3300005718 | Ga0068866_10200476 | Ga0068866_102004761 | 218 |
| 559 | 3300006852 | Ga0075433_10474659 | Ga0075433_104746592 | 218 |
| 560 | 3300006871 | Ga0075434_100012438 | Ga0075434_1000124387 | 218 |
| 561 | 3300006871 | Ga0075434_100040276 | Ga0075434_1000402764 | 218 |
| 562 | 3300007076 | Ga0075435_100909057 | Ga0075435_1009090572 | 218 |
| 563 | 3300009094 | Ga0111539_10187950 | Ga0111539_101879504 | 218 |
| 564 | 3300009147 | Ga0114129_10091152 | Ga0114129_100911523 | 218 |
| 565 | 3300009147 | Ga0114129_11189518 | Ga0114129_111895182 | 218 |
| 566 | 3300025910 | Ga0207684_10049280 | Ga0207684_100492804 | 218 |
| 567 | 3300025941 | Ga0207711_10905625 | Ga0207711_109056251 | 218 |
| 568 | 3300026118 | Ga0207675_100235570 | Ga0207675_1002355702 | 218 |
| 569 | 3300031548 | Ga0307408_100235812 | Ga0307408_1002358122 | 218 |
| 570 | 3300035115 | Ga0373941_0024074 | Ga0373941_0024074_986_1645 | 218 |
| 571 | 3300037471 | Ga0395905_0063962 | Ga0395905_0063962_1642_2298 | 218 |
| 572 | 3300048916 | Ga0496113_0278880 | Ga0496113_0278880_264_926 | 218 |
| 573 | 3300049572 | Ga0501036_0407724 | Ga0501036_0407724_367_1029 | 218 |
| 574 | 3300050512 | nmdc:mga0n895_5572_c1 | nmdc:mga0n895_5572_c1_5699_6361 | 218 |
| 575 | 3300050512 | nmdc:mga0n895_8027_c1 | nmdc:mga0n895_8027_c1_1212_1874 | 218 |
| 576 | 3300050515 | nmdc:mga0a205_471770_c1 | nmdc:mga0a205_471770_c1_364_1026 | 218 |
| 577 | 3300005336 | Ga0070680_100072211 | Ga0070680_1000722114 | 219 |
| 578 | 3300005347 | Ga0070668_100034892 | Ga0070668_1000348923 | 219 |
| 579 | 3300005353 | Ga0070669_100002755 | Ga0070669_10000275511 | 219 |
| 580 | 3300005458 | Ga0070681_10172144 | Ga0070681_101721443 | 219 |
| 581 | 3300005543 | Ga0070672_100054067 | Ga0070672_1000540674 | 219 |
| 582 | 3300005549 | Ga0070704_100007035 | Ga0070704_1000070351 | 219 |
| 583 | 3300005719 | Ga0068861_100018163 | Ga0068861_1000181632 | 219 |
| 584 | 3300005719 | Ga0068861_100984354 | Ga0068861_1009843541 | 219 |
| 585 | 3300005844 | Ga0068862_100352237 | Ga0068862_1003522373 | 219 |
| 586 | 3300006844 | Ga0075428_100002164 | Ga0075428_1000021643 | 219 |
| 587 | 3300006844 | Ga0075428_100026706 | Ga0075428_1000267067 | 219 |
| 588 | 3300006846 | Ga0075430_100000893 | Ga0075430_1000008937 | 219 |
| 589 | 3300006846 | Ga0075430_100004400 | Ga0075430_1000044008 | 219 |
| 590 | 3300006846 | Ga0075430_100197153 | Ga0075430_1001971533 | 219 |
| 591 | 3300006847 | Ga0075431_100006168 | Ga0075431_1000061688 | 219 |
| 592 | 3300006847 | Ga0075431_100022517 | Ga0075431_1000225177 | 219 |
| 593 | 3300006852 | Ga0075433_10123928 | Ga0075433_101239283 | 219 |
| 594 | 3300006880 | Ga0075429_100000757 | Ga0075429_10000075723 | 219 |
| 595 | 3300006914 | Ga0075436_100120872 | Ga0075436_1001208722 | 219 |
| 596 | 3300009094 | Ga0111539_10007648 | Ga0111539_100076487 | 219 |
| 597 | 3300009147 | Ga0114129_10133835 | Ga0114129_101338354 | 219 |
| 598 | 3300009174 | Ga0105241_10067794 | Ga0105241_100677944 | 219 |
| 599 | 3300013306 | Ga0163162_10024603 | Ga0163162_100246034 | 219 |
| 600 | 3300013308 | Ga0157375_10648749 | Ga0157375_106487492 | 219 |
| 601 | 3300025911 | Ga0207654_10039930 | Ga0207654_100399303 | 219 |
| 602 | 3300025917 | Ga0207660_10059601 | Ga0207660_100596013 | 219 |
| 603 | 3300025923 | Ga0207681_10014404 | Ga0207681_100144048 | 219 |
| 604 | 3300025933 | Ga0207706_10049930 | Ga0207706_100499304 | 219 |
| 605 | 3300025940 | Ga0207691_10066559 | Ga0207691_100665592 | 219 |
| 606 | 3300025972 | Ga0207668_10014274 | Ga0207668_100142745 | 219 |
| 607 | 3300026088 | Ga0207641_10082848 | Ga0207641_100828482 | 219 |
| 608 | 3300026118 | Ga0207675_100027101 | Ga0207675_1000271012 | 219 |
| 609 | 3300027907 | Ga0207428_10012663 | Ga0207428_100126632 | 219 |
| 610 | 3300031548 | Ga0307408_100024853 | Ga0307408_1000248536 | 219 |
| 611 | 3300031548 | Ga0307408_100140660 | Ga0307408_1001406602 | 219 |
| 612 | 3300031901 | Ga0307406_10452266 | Ga0307406_104522662 | 219 |
| 613 | 3300031911 | Ga0307412_10316842 | Ga0307412_103168422 | 219 |
| 614 | 3300032002 | Ga0307416_100042740 | Ga0307416_1000427404 | 219 |
| 615 | 3300032005 | Ga0307411_10147962 | Ga0307411_101479623 | 219 |
| 616 | 3300032005 | Ga0307411_10392343 | Ga0307411_103923432 | 219 |
| 617 | 3300035691 | Ga0373931_0001837 | Ga0373931_0001837_5876_6538 | 219 |
| 618 | 3300037418 | Ga0395900_0013033 | Ga0395900_0013033_1415_2077 | 219 |
| 619 | 3300037466 | Ga0395898_0017571 | Ga0395898_0017571_1909_2571 | 219 |
| 620 | 3300038443 | Ga0395901_0000399 | Ga0395901_0000399_3250_3912 | 219 |
| 621 | 3300046684 | Ga0495669_0046440 | Ga0495669_0046440_1221_1886 | 219 |
| 622 | 3300048905 | Ga0496102_0037829 | Ga0496102_0037829_1152_1814 | 219 |
| 623 | 3300048906 | Ga0496103_0030162 | Ga0496103_0030162_1055_1717 | 219 |
| 624 | 3300048918 | Ga0496115_0614128 | Ga0496115_0614128_29_694 | 219 |
| 625 | 3300049576 | Ga0501040_0388784 | Ga0501040_0388784_118_780 | 219 |
| 626 | 3300049576 | Ga0501040_0449011 | Ga0501040_0449011_129_791 | 219 |
| 627 | 3300049580 | Ga0501046_0286860 | Ga0501046_0286860_380_1042 | 219 |
| 628 | 3300049582 | Ga0501048_0073608 | Ga0501048_0073608_933_1595 | 219 |
| 629 | 3300049584 | Ga0501068_0455525 | Ga0501068_0455525_117_785 | 219 |
| 630 | 3300049587 | Ga0501071_0142678 | Ga0501071_0142678_183_848 | 219 |
| 631 | 3300049587 | Ga0501071_0613131 | Ga0501071_0613131_129_791 | 219 |
| 632 | 3300049588 | Ga0501072_0041240 | Ga0501072_0041240_1294_1956 | 219 |
| 633 | 3300049588 | Ga0501072_0094719 | Ga0501072_0094719_1577_2242 | 219 |
| 634 | 3300049588 | Ga0501072_0680128 | Ga0501072_0680128_43_705 | 219 |
| 635 | 3300049590 | Ga0501074_0342906 | Ga0501074_0342906_354_1019 | 219 |
| 636 | 3300049591 | Ga0501075_0025612 | Ga0501075_0025612_3146_3811 | 219 |
| 637 | 3300049591 | Ga0501075_0048326 | Ga0501075_0048326_274_936 | 219 |
| 638 | 3300049592 | Ga0501076_0202293 | Ga0501076_0202293_162_824 | 219 |
| 639 | 3300049592 | Ga0501076_0365349 | Ga0501076_0365349_357_1022 | 219 |
| 640 | 3300049593 | Ga0501077_0137967 | Ga0501077_0137967_818_1480 | 219 |
| 641 | 3300049741 | Ga0501079_0137027 | Ga0501079_0137027_653_1315 | 219 |
| 642 | 3300049741 | Ga0501079_0489411 | Ga0501079_0489411_155_820 | 219 |
| 643 | 3300049743 | Ga0501081_0174832 | Ga0501081_0174832_186_851 | 219 |
| 644 | 3300049824 | Ga0501045_0016844 | Ga0501045_0016844_2328_2990 | 219 |
| 645 | 3300050507 | nmdc:mga05p37_38692_c1 | nmdc:mga05p37_38692_c1_1958_2620 | 219 |
| 646 | 3300050507 | nmdc:mga05p37_7885_c1 | nmdc:mga05p37_7885_c1_1280_1942 | 219 |
| 647 | 3300050508 | nmdc:mga09592_1012_c1 | nmdc:mga09592_1012_c1_15753_16415 | 219 |
| 648 | 3300050508 | nmdc:mga09592_73228_c1 | nmdc:mga09592_73228_c1_2026_2688 | 219 |
| 649 | 3300050509 | nmdc:mga0qj67_107659_c1 | nmdc:mga0qj67_107659_c1_400_1062 | 219 |
| 650 | 3300050509 | nmdc:mga0qj67_195369_c1 | nmdc:mga0qj67_195369_c1_385_1056 | 219 |
| 651 | 3300050509 | nmdc:mga0qj67_2246_c1 | nmdc:mga0qj67_2246_c1_7603_8265 | 219 |
| 652 | 3300050510 | nmdc:mga06r32_1549_c1 | nmdc:mga06r32_1549_c1_10810_11472 | 219 |
| 653 | 3300050510 | nmdc:mga06r32_22559_c1 | nmdc:mga06r32_22559_c1_3744_4406 | 219 |
| 654 | 3300050510 | nmdc:mga06r32_396971_c1 | nmdc:mga06r32_396971_c1_247_909 | 219 |
| 655 | 3300050511 | nmdc:mga08y16_191654_c2 | nmdc:mga08y16_191654_c2_565_1227 | 219 |
| 656 | 3300050511 | nmdc:mga08y16_1957_c1 | nmdc:mga08y16_1957_c1_16195_16866 | 219 |
| 657 | 3300050515 | nmdc:mga0a205_90400_c1 | nmdc:mga0a205_90400_c1_1026_1688 | 219 |
| 658 | 3300054114 | Ga0501084_0117216 | Ga0501084_0117216_349_1014 | 219 |
| 659 | 3300054114 | Ga0501084_0501245 | Ga0501084_0501245_286_948 | 219 |
| 660 | 3300060353 | Ga0501082_0363165 | Ga0501082_0363165_460_1125 | 219 |
| 661 | 3300060353 | Ga0501082_0376291 | Ga0501082_0376291_460_1125 | 219 |
| 662 | 3300061734 | Ga0530510_0090245 | Ga0530510_0090245_103_765 | 219 |
| 663 | 3300061734 | Ga0530510_0112264 | Ga0530510_0112264_350_1015 | 219 |
| 664 | 3300061734 | Ga0530510_0607403 | Ga0530510_0607403_17_682 | 219 |
| 665 | 3300003203 | JGI25406J46586_10028175 | JGI25406J46586_100281752 | 220 |
| 666 | 3300005445 | Ga0070708_100022796 | Ga0070708_1000227964 | 220 |
| 667 | 3300005467 | Ga0070706_100245027 | Ga0070706_1002450271 | 220 |
| 668 | 3300005468 | Ga0070707_100005653 | Ga0070707_10000565311 | 220 |
| 669 | 3300005471 | Ga0070698_100006077 | Ga0070698_10000607711 | 220 |
| 670 | 3300005518 | Ga0070699_100002451 | Ga0070699_1000024519 | 220 |
| 671 | 3300005536 | Ga0070697_100000846 | Ga0070697_10000084614 | 220 |
| 672 | 3300005536 | Ga0070697_100020579 | Ga0070697_1000205794 | 220 |
| 673 | 3300005985 | Ga0081539_10000009 | Ga0081539_10000009152 | 220 |
| 674 | 3300006844 | Ga0075428_100004920 | Ga0075428_1000049207 | 220 |
| 675 | 3300006846 | Ga0075430_100040160 | Ga0075430_1000401604 | 220 |
| 676 | 3300006846 | Ga0075430_100068786 | Ga0075430_1000687862 | 220 |
| 677 | 3300006846 | Ga0075430_100159814 | Ga0075430_1001598142 | 220 |
| 678 | 3300006847 | Ga0075431_100000158 | Ga0075431_10000015839 | 220 |
| 679 | 3300006847 | Ga0075431_100006780 | Ga0075431_1000067802 | 220 |
| 680 | 3300006847 | Ga0075431_100028177 | Ga0075431_1000281772 | 220 |
| 681 | 3300006847 | Ga0075431_100054782 | Ga0075431_1000547824 | 220 |
| 682 | 3300006852 | Ga0075433_10000972 | Ga0075433_1000097221 | 220 |
| 683 | 3300006871 | Ga0075434_100024062 | Ga0075434_1000240628 | 220 |
| 684 | 3300006871 | Ga0075434_100276426 | Ga0075434_1002764263 | 220 |
| 685 | 3300006880 | Ga0075429_100008188 | Ga0075429_1000081887 | 220 |
| 686 | 3300006880 | Ga0075429_100026975 | Ga0075429_1000269754 | 220 |
| 687 | 3300006880 | Ga0075429_100484202 | Ga0075429_1004842022 | 220 |
| 688 | 3300006914 | Ga0075436_100018220 | Ga0075436_1000182204 | 220 |
| 689 | 3300007076 | Ga0075435_100011827 | Ga0075435_1000118276 | 220 |
| 690 | 3300007265 | Ga0099794_10167659 | Ga0099794_101676592 | 220 |
| 691 | 3300009147 | Ga0114129_10000443 | Ga0114129_1000044311 | 220 |
| 692 | 3300009147 | Ga0114129_10001075 | Ga0114129_1000107512 | 220 |
| 693 | 3300009147 | Ga0114129_10045651 | Ga0114129_100456514 | 220 |
| 694 | 3300009147 | Ga0114129_10158841 | Ga0114129_101588413 | 220 |
| 695 | 3300009147 | Ga0114129_10510338 | Ga0114129_105103382 | 220 |
| 696 | 3300025910 | Ga0207684_10000169 | Ga0207684_1000016929 | 220 |
| 697 | 3300025922 | Ga0207646_10003463 | Ga0207646_100034637 | 220 |
| 698 | 3300027671 | Ga0209588_1072873 | Ga0209588_10728732 | 220 |
| 699 | 3300027682 | Ga0209971_1010932 | Ga0209971_10109323 | 220 |
| 700 | 3300031548 | Ga0307408_100343939 | Ga0307408_1003439392 | 220 |
| 701 | 3300031903 | Ga0307407_10262197 | Ga0307407_102621972 | 220 |
| 702 | 3300031995 | Ga0307409_100276974 | Ga0307409_1002769742 | 220 |
| 703 | 3300032005 | Ga0307411_10281958 | Ga0307411_102819582 | 220 |
| 704 | 3300037418 | Ga0395900_0077489 | Ga0395900_0077489_2453_3115 | 220 |
| 705 | 3300049568 | Ga0501031_0386765 | Ga0501031_0386765_26_694 | 220 |
| 706 | 3300049576 | Ga0501040_0074291 | Ga0501040_0074291_331_999 | 220 |
| 707 | 3300049577 | Ga0501041_0065151 | Ga0501041_0065151_933_1601 | 220 |
| 708 | 3300049578 | Ga0501042_0090362 | Ga0501042_0090362_67_735 | 220 |
| 709 | 3300049582 | Ga0501048_0120245 | Ga0501048_0120245_661_1329 | 220 |
| 710 | 3300049583 | Ga0501067_0075070 | Ga0501067_0075070_822_1487 | 220 |
| 711 | 3300049584 | Ga0501068_0381120 | Ga0501068_0381120_29_694 | 220 |
| 712 | 3300049585 | Ga0501069_0082927 | Ga0501069_0082927_16_681 | 220 |
| 713 | 3300049588 | Ga0501072_0003099 | Ga0501072_0003099_11827_12495 | 220 |
| 714 | 3300049591 | Ga0501075_0011581 | Ga0501075_0011581_2410_3078 | 220 |
| 715 | 3300049591 | Ga0501075_0062232 | Ga0501075_0062232_1153_1821 | 220 |
| 716 | 3300049591 | Ga0501075_0264737 | Ga0501075_0264737_515_1180 | 220 |
| 717 | 3300049592 | Ga0501076_0043424 | Ga0501076_0043424_2618_3286 | 220 |
| 718 | 3300049592 | Ga0501076_0153622 | Ga0501076_0153622_463_1131 | 220 |
| 719 | 3300049593 | Ga0501077_0007562 | Ga0501077_0007562_3031_3699 | 220 |
| 720 | 3300049741 | Ga0501079_0005322 | Ga0501079_0005322_2076_2744 | 220 |
| 721 | 3300049743 | Ga0501081_0066508 | Ga0501081_0066508_1571_2236 | 220 |
| 722 | 3300049743 | Ga0501081_0135062 | Ga0501081_0135062_782_1450 | 220 |
| 723 | 3300049743 | Ga0501081_0172389 | Ga0501081_0172389_881_1549 | 220 |
| 724 | 3300050507 | nmdc:mga05p37_1126565_c1 | nmdc:mga05p37_1126565_c1_130_792 | 220 |
| 725 | 3300050507 | nmdc:mga05p37_199_c1 | nmdc:mga05p37_199_c1_9129_9791 | 220 |
| 726 | 3300050507 | nmdc:mga05p37_22487_c1 | nmdc:mga05p37_22487_c1_228_896 | 220 |
| 727 | 3300050507 | nmdc:mga05p37_38_c1 | nmdc:mga05p37_38_c1_30179_30841 | 220 |
| 728 | 3300050507 | nmdc:mga05p37_78211_c1 | nmdc:mga05p37_78211_c1_144_806 | 220 |
| 729 | 3300050507 | nmdc:mga05p37_94383_c1 | nmdc:mga05p37_94383_c1_60_725 | 220 |
| 730 | 3300050508 | nmdc:mga09592_10352_c1 | nmdc:mga09592_10352_c1_4029_4697 | 220 |
| 731 | 3300050508 | nmdc:mga09592_31298_c1 | nmdc:mga09592_31298_c1_1147_1815 | 220 |
| 732 | 3300050508 | nmdc:mga09592_4445_c1 | nmdc:mga09592_4445_c1_4206_4868 | 220 |
| 733 | 3300050509 | nmdc:mga0qj67_86808_c1 | nmdc:mga0qj67_86808_c1_1585_2247 | 220 |
| 734 | 3300050510 | nmdc:mga06r32_200044_c1 | nmdc:mga06r32_200044_c1_1262_1930 | 220 |
| 735 | 3300050510 | nmdc:mga06r32_287_c1 | nmdc:mga06r32_287_c1_7472_8134 | 220 |
| 736 | 3300050510 | nmdc:mga06r32_61109_c1 | nmdc:mga06r32_61109_c1_2484_3146 | 220 |
| 737 | 3300050512 | nmdc:mga0n895_302619_c1 | nmdc:mga0n895_302619_c1_885_1547 | 220 |
| 738 | 3300050512 | nmdc:mga0n895_61_c1 | nmdc:mga0n895_61_c1_33933_34595 | 220 |
| 739 | 3300050513 | nmdc:mga0rr50_7191_c1 | nmdc:mga0rr50_7191_c1_2788_3450 | 220 |
| 740 | 3300050514 | nmdc:mga08x19_9023_c1 | nmdc:mga08x19_9023_c1_4859_5521 | 220 |
| 741 | 3300050515 | nmdc:mga0a205_122_c1 | nmdc:mga0a205_122_c1_19987_20649 | 220 |
| 742 | 3300054114 | Ga0501084_0006427 | Ga0501084_0006427_4204_4872 | 220 |
| 743 | 3300060353 | Ga0501082_0007387 | Ga0501082_0007387_8281_8949 | 220 |
| 744 | 3300060353 | Ga0501082_0455497 | Ga0501082_0455497_428_1096 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1d8l-assembly1.cif.gz_A | e. coli holliday junction binding protein ruva nh2 region lacking domain iii | 0.9188 | 1 | 141 |
| 7pbu-assembly1.cif.gz_F | ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] | 0.91 | 1 | 139 |
| 7x7q-assembly1.cif.gz_G | cryoem structure of ruva-ruvb-holliday junction complex | 0.9089 | 1 | 142 |
| 2zte-assembly1.cif.gz_A | mtruva form iv | 0.9028 | 2 | 139 |
| 1ixr-assembly1.cif.gz_A | ruva-ruvb complex | 0.8997 | 1 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zteA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9484 | 74 | 139 | 1.10.150.20 |
| 2h5xB02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9454 | 76 | 139 | 1.10.150.20 |
| 2h5xC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9448 | 76 | 140 | 1.10.150.20 |
| 2h5xD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9393 | 76 | 139 | 1.10.150.20 |
| 1bvsB02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9347 | 77 | 139 | 1.10.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6PAU5-F1-model_v4 | Holliday junction DNA helicase RuvA | 0.9704 | 1 | 141 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A2V6PAU5-F1-model_v4 | Holliday junction DNA helicase RuvA | 0.9504 | 1 | 141 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A661TB17-F1-model_v4 | Holliday junction DNA helicase RuvA | 0.9397 | 1 | 139 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A1W9T6H9-F1-model_v4 | Holliday junction DNA helicase RuvA | 0.9362 | 1 | 136 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A350PD89-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.9289 | 1 | 136 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar