F478781
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 745 | 367 | 742 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10292388|Ga0070658_102923882 |
| Length | 95 |
| Sequence | MHSGLERAREMSAIIYSLCAATALVCACMLLSGYWRQNYRLLLWSGLCFAGLTLNNLLLVVDKVLLPEVDLSLWRTSVALISMIVLLYGLIWDME |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 3 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 4 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 87 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 190 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 191 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 198 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 199 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 200 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 201 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 202 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 203 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 204 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 205 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 206 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 207 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 208 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 211 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 212 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 213 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 261 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 262 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 263 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 264 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 265 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 266 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 267 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 293 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 294 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 295 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 296 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 297 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 304 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 305 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 308 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 309 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 310 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 311 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 313 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 320 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 322 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 323 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 324 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 327 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 328 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 329 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 344 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 345 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 346 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 347 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 348 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 349 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 350 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 354 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 355 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 356 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 357 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 359 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 361 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 363 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 364 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 365 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0.4 |
| Isolates | 0.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.7 |
| Nodule | 0 |
| Rhizoplane | 1.34 |
| Rhizosphere | 91.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10118784 | 3300003316 | Bacteria | 1134 |
| 2 | rootH1_10118784 | 3300003323 | Unclassified | 1831 |
| 3 | rootH2_10030263 | 3300003320 | Bacteria | 13059 |
| 4 | rootH2_10131974 | 3300003320 | Bacteria | 1798 |
| 5 | rootH2_10181915 | 3300003320 | Bacteria | 6096 |
| 6 | rootH2_10320555 | 3300003320 | Unclassified | 1151 |
| 7 | rootL2_10180144 | 3300003322 | Bacteria | 2134 |
| 8 | rootL2_10211209 | 3300003322 | Unclassified | 1274 |
| 9 | rootH1_10007381 | 3300003323 | Bacteria | 1599 |
| 10 | rootH1_10052430 | 3300003323 | Bacteria | 3891 |
| 11 | rootH1_10225615 | 3300003323 | Bacteria | 1129 |
| 12 | Ga0070658_10019362 | 3300005327 | Bacteria | 5451 |
| 13 | Ga0070658_10292388 | 3300005327 | Bacteria | 1388 |
| 14 | Ga0070658_11632665 | 3300005327 | Unclassified | 558 |
| 15 | Ga0070676_10795725 | 3300005328 | Unclassified | 697 |
| 16 | Ga0070683_100140667 | 3300005329 | Bacteria | 2287 |
| 17 | Ga0070683_100842435 | 3300005329 | Unclassified | 879 |
| 18 | Ga0070683_101494679 | 3300005329 | Unclassified | 649 |
| 19 | Ga0070690_100089951 | 3300005330 | Bacteria | 2020 |
| 20 | Ga0070670_100067057 | 3300005331 | Bacteria | 3080 |
| 21 | Ga0068869_100079823 | 3300005334 | Bacteria | 2439 |
| 22 | Ga0070666_10007725 | 3300005335 | Bacteria | 6640 |
| 23 | Ga0070666_10017120 | 3300005335 | Bacteria | 4645 |
| 24 | Ga0070666_10597381 | 3300005335 | Bacteria | 805 |
| 25 | Ga0070666_10862654 | 3300005335 | Bacteria | 668 |
| 26 | Ga0070680_100062558 | 3300005336 | Bacteria | 3048 |
| 27 | Ga0070680_100174647 | 3300005336 | Bacteria | 1809 |
| 28 | Ga0070680_100773526 | 3300005336 | Bacteria | 827 |
| 29 | Ga0070682_100001461 | 3300005337 | Bacteria | 13260 |
| 30 | Ga0070682_101572835 | 3300005337 | Bacteria | 567 |
| 31 | Ga0068868_100043411 | 3300005338 | Bacteria | 3512 |
| 32 | Ga0068868_100825859 | 3300005338 | Bacteria | 838 |
| 33 | Ga0070660_100001736 | 3300005339 | Bacteria | 14950 |
| 34 | Ga0070660_100039372 | 3300005339 | Bacteria | 3593 |
| 35 | Ga0070660_100081917 | 3300005339 | Bacteria | 2533 |
| 36 | Ga0070660_100368369 | 3300005339 | Bacteria | 1185 |
| 37 | Ga0070660_101393993 | 3300005339 | Unclassified | 595 |
| 38 | Ga0070689_100750536 | 3300005340 | Unclassified | 855 |
| 39 | Ga0070689_101795334 | 3300005340 | Unclassified | 559 |
| 40 | Ga0070691_10062657 | 3300005341 | Bacteria | 1791 |
| 41 | Ga0070661_100123254 | 3300005344 | Bacteria | 1942 |
| 42 | Ga0070661_100557396 | 3300005344 | Bacteria | 923 |
| 43 | Ga0070661_100825401 | 3300005344 | Unclassified | 762 |
| 44 | Ga0070661_100972063 | 3300005344 | Unclassified | 703 |
| 45 | Ga0070692_10246111 | 3300005345 | Bacteria | 1068 |
| 46 | Ga0070668_101475367 | 3300005347 | Unclassified | 621 |
| 47 | Ga0070671_100055483 | 3300005355 | Bacteria | 3296 |
| 48 | Ga0070671_100811193 | 3300005355 | Bacteria | 815 |
| 49 | Ga0070674_101173629 | 3300005356 | Unclassified | 681 |
| 50 | Ga0070659_101324417 | 3300005366 | Unclassified | 639 |
| 51 | Ga0070667_100029754 | 3300005367 | Bacteria | 4553 |
| 52 | Ga0070667_100778743 | 3300005367 | Bacteria | 887 |
| 53 | Ga0070667_101393311 | 3300005367 | Bacteria | 658 |
| 54 | Ga0070713_101145166 | 3300005436 | Bacteria | 752 |
| 55 | Ga0070705_100086660 | 3300005440 | Bacteria | 1939 |
| 56 | Ga0070705_101908757 | 3300005440 | Unclassified | 505 |
| 57 | Ga0070678_100006697 | 3300005456 | Bacteria | 6784 |
| 58 | Ga0070678_100033835 | 3300005456 | Bacteria | 3553 |
| 59 | Ga0070678_100739389 | 3300005456 | Unclassified | 889 |
| 60 | Ga0070678_101308697 | 3300005456 | Bacteria | 674 |
| 61 | Ga0070662_100004066 | 3300005457 | Bacteria | 9192 |
| 62 | Ga0070662_100273139 | 3300005457 | Bacteria | 1365 |
| 63 | Ga0070662_100316616 | 3300005457 | Bacteria | 1271 |
| 64 | Ga0070681_10499994 | 3300005458 | Bacteria | 1129 |
| 65 | Ga0070681_10638407 | 3300005458 | Unclassified | 980 |
| 66 | Ga0070681_11392370 | 3300005458 | Bacteria | 625 |
| 67 | Ga0070681_11537185 | 3300005458 | Bacteria | 590 |
| 68 | Ga0070681_11578690 | 3300005458 | Unclassified | 581 |
| 69 | Ga0068867_100490310 | 3300005459 | Unclassified | 1054 |
| 70 | Ga0070685_11380750 | 3300005466 | Unclassified | 540 |
| 71 | Ga0070679_100029565 | 3300005530 | Bacteria | 5406 |
| 72 | Ga0070679_100270413 | 3300005530 | Unclassified | 1654 |
| 73 | Ga0070679_100447828 | 3300005530 | Unclassified | 1236 |
| 74 | Ga0070684_100043554 | 3300005535 | Bacteria | 3877 |
| 75 | Ga0070684_100936329 | 3300005535 | Unclassified | 812 |
| 76 | Ga0068853_100112537 | 3300005539 | Bacteria | 2419 |
| 77 | Ga0068853_100134907 | 3300005539 | Bacteria | 2212 |
| 78 | Ga0068853_100559273 | 3300005539 | Bacteria | 1084 |
| 79 | Ga0068853_100679470 | 3300005539 | Unclassified | 981 |
| 80 | Ga0070672_102054673 | 3300005543 | Unclassified | 515 |
| 81 | Ga0070686_101371161 | 3300005544 | Bacteria | 592 |
| 82 | Ga0070693_100215621 | 3300005547 | Bacteria | 1255 |
| 83 | Ga0070665_100018314 | 3300005548 | Bacteria | 7020 |
| 84 | Ga0070665_100029825 | 3300005548 | Bacteria | 5489 |
| 85 | Ga0070665_100034575 | 3300005548 | Bacteria | 5082 |
| 86 | Ga0070665_100045787 | 3300005548 | Bacteria | 4393 |
| 87 | Ga0070665_100262334 | 3300005548 | Bacteria | 1729 |
| 88 | Ga0068855_100053704 | 3300005563 | Bacteria | 4739 |
| 89 | Ga0068855_100072858 | 3300005563 | Bacteria | 3992 |
| 90 | Ga0068855_101852321 | 3300005563 | Bacteria | 612 |
| 91 | Ga0070664_100012736 | 3300005564 | Bacteria | 6843 |
| 92 | Ga0070664_101636175 | 3300005564 | Unclassified | 610 |
| 93 | Ga0068857_100569882 | 3300005577 | Bacteria | 1068 |
| 94 | Ga0068857_101459701 | 3300005577 | Bacteria | 666 |
| 95 | Ga0068857_101924981 | 3300005577 | Unclassified | 579 |
| 96 | Ga0068854_100169036 | 3300005578 | Bacteria | 1700 |
| 97 | Ga0068854_101418124 | 3300005578 | Unclassified | 628 |
| 98 | Ga0068856_100081788 | 3300005614 | Bacteria | 3205 |
| 99 | Ga0068856_100263569 | 3300005614 | Unclassified | 1739 |
| 100 | Ga0068856_100577830 | 3300005614 | Unclassified | 1145 |
| 101 | Ga0070702_100082386 | 3300005615 | Bacteria | 1930 |
| 102 | Ga0070702_100536523 | 3300005615 | Bacteria | 866 |
| 103 | Ga0068852_100002916 | 3300005616 | Bacteria | 11878 |
| 104 | Ga0068852_100328381 | 3300005616 | Unclassified | 1487 |
| 105 | Ga0068859_100737747 | 3300005617 | Bacteria | 1074 |
| 106 | Ga0068859_101097950 | 3300005617 | Bacteria | 875 |
| 107 | Ga0068864_100872173 | 3300005618 | Bacteria | 888 |
| 108 | Ga0068864_101134080 | 3300005618 | Unclassified | 779 |
| 109 | Ga0068866_10799303 | 3300005718 | Bacteria | 655 |
| 110 | Ga0068861_100084560 | 3300005719 | Unclassified | 2491 |
| 111 | Ga0068861_100515744 | 3300005719 | Bacteria | 1083 |
| 112 | Ga0068861_100522092 | 3300005719 | Bacteria | 1077 |
| 113 | Ga0068851_10008911 | 3300005834 | Bacteria | 4653 |
| 114 | Ga0068851_10245111 | 3300005834 | Bacteria | 1015 |
| 115 | Ga0068851_10850221 | 3300005834 | Unclassified | 569 |
| 116 | Ga0068870_10008064 | 3300005840 | Bacteria | 4719 |
| 117 | Ga0068863_100144307 | 3300005841 | Bacteria | 2276 |
| 118 | Ga0068863_102329101 | 3300005841 | Unclassified | 545 |
| 119 | Ga0068858_100025035 | 3300005842 | Bacteria | 5553 |
| 120 | Ga0068858_101157146 | 3300005842 | Bacteria | 760 |
| 121 | Ga0068858_101399049 | 3300005842 | Bacteria | 689 |
| 122 | Ga0068860_100053160 | 3300005843 | Bacteria | 3852 |
| 123 | Ga0068860_100298956 | 3300005843 | Bacteria | 1576 |
| 124 | Ga0068860_100685311 | 3300005843 | Bacteria | 1034 |
| 125 | Ga0068862_100033951 | 3300005844 | Bacteria | 4315 |
| 126 | Ga0068862_100096066 | 3300005844 | Bacteria | 2586 |
| 127 | Ga0068862_101609208 | 3300005844 | Bacteria | 657 |
| 128 | Ga0081455_10257287 | 3300005937 | Bacteria | 1273 |
| 129 | Ga0081455_10382330 | 3300005937 | Bacteria | 983 |
| 130 | Ga0081455_11019343 | 3300005937 | Unclassified | 512 |
| 131 | Ga0081538_10005274 | 3300005981 | Bacteria | 11666 |
| 132 | Ga0081540_1002217 | 3300005983 | Bacteria | 16033 |
| 133 | Ga0075365_11129296 | 3300006038 | Unclassified | 552 |
| 134 | Ga0070712_100672001 | 3300006175 | Bacteria | 881 |
| 135 | Ga0070712_101883440 | 3300006175 | Bacteria | 524 |
| 136 | Ga0075362_10330953 | 3300006177 | Unclassified | 760 |
| 137 | Ga0075366_10560371 | 3300006195 | Unclassified | 708 |
| 138 | Ga0097621_100023872 | 3300006237 | Bacteria | 4767 |
| 139 | Ga0097621_100048974 | 3300006237 | Bacteria | 3431 |
| 140 | Ga0097621_100091415 | 3300006237 | Bacteria | 2547 |
| 141 | Ga0097621_100118877 | 3300006237 | Bacteria | 2240 |
| 142 | Ga0097621_100399683 | 3300006237 | Unclassified | 1230 |
| 143 | Ga0097621_101434075 | 3300006237 | Unclassified | 654 |
| 144 | Ga0097621_101592159 | 3300006237 | Unclassified | 621 |
| 145 | Ga0097621_102140767 | 3300006237 | Unclassified | 535 |
| 146 | Ga0075370_10293515 | 3300006353 | Unclassified | 966 |
| 147 | Ga0068871_100148925 | 3300006358 | Unclassified | 1995 |
| 148 | Ga0068871_100428289 | 3300006358 | Bacteria | 1183 |
| 149 | Ga0068871_100984462 | 3300006358 | Unclassified | 785 |
| 150 | Ga0075428_100007347 | 3300006844 | Bacteria | 12210 |
| 151 | Ga0075430_100117524 | 3300006846 | Unclassified | 2217 |
| 152 | Ga0075429_100035604 | 3300006880 | Bacteria | 4330 |
| 153 | Ga0075429_101605024 | 3300006880 | Bacteria | 565 |
| 154 | Ga0068865_100173560 | 3300006881 | Bacteria | 1655 |
| 155 | Ga0068865_100236578 | 3300006881 | Unclassified | 1435 |
| 156 | Ga0097620_100737680 | 3300006931 | Bacteria | 1074 |
| 157 | Ga0097620_101098023 | 3300006931 | Bacteria | 875 |
| 158 | Ga0075435_100833329 | 3300007076 | Unclassified | 803 |
| 159 | Ga0105240_10020426 | 3300009093 | Bacteria | 8834 |
| 160 | Ga0105240_10022197 | 3300009093 | Bacteria | 8419 |
| 161 | Ga0105240_10027089 | 3300009093 | Bacteria | 7510 |
| 162 | Ga0105240_10173560 | 3300009093 | Bacteria | 2550 |
| 163 | Ga0105240_10355467 | 3300009093 | Bacteria | 1661 |
| 164 | Ga0105240_10682076 | 3300009093 | Unclassified | 1123 |
| 165 | Ga0105240_11144763 | 3300009093 | Bacteria | 826 |
| 166 | Ga0105240_11636357 | 3300009093 | Unclassified | 673 |
| 167 | Ga0105240_12717551 | 3300009093 | Unclassified | 510 |
| 168 | Ga0111539_10013189 | 3300009094 | Bacteria | 10333 |
| 169 | Ga0111539_10888675 | 3300009094 | Unclassified | 1036 |
| 170 | Ga0105245_10006411 | 3300009098 | Bacteria | 10354 |
| 171 | Ga0105247_10333254 | 3300009101 | Bacteria | 1062 |
| 172 | Ga0105247_10735464 | 3300009101 | Bacteria | 746 |
| 173 | Ga0105241_10012157 | 3300009174 | Bacteria | 6320 |
| 174 | Ga0105241_10027763 | 3300009174 | Bacteria | 4214 |
| 175 | Ga0105241_10038341 | 3300009174 | Unclassified | 3612 |
| 176 | Ga0105241_10579751 | 3300009174 | Bacteria | 1011 |
| 177 | Ga0105241_10598501 | 3300009174 | Bacteria | 996 |
| 178 | Ga0105241_11936616 | 3300009174 | Unclassified | 579 |
| 179 | Ga0105241_12031721 | 3300009174 | Bacteria | 566 |
| 180 | Ga0105242_10017569 | 3300009176 | Bacteria | 5578 |
| 181 | Ga0105242_10635384 | 3300009176 | Unclassified | 1036 |
| 182 | Ga0105242_10937666 | 3300009176 | Unclassified | 869 |
| 183 | Ga0105242_11444559 | 3300009176 | Bacteria | 717 |
| 184 | Ga0105248_10080635 | 3300009177 | Bacteria | 3658 |
| 185 | Ga0105248_10085443 | 3300009177 | Bacteria | 3550 |
| 186 | Ga0105248_10976933 | 3300009177 | Unclassified | 956 |
| 187 | Ga0105248_11784842 | 3300009177 | Bacteria | 698 |
| 188 | Ga0105237_10066984 | 3300009545 | Bacteria | 3585 |
| 189 | Ga0105237_10097544 | 3300009545 | Bacteria | 2929 |
| 190 | Ga0105237_10575949 | 3300009545 | Bacteria | 1133 |
| 191 | Ga0105237_10789494 | 3300009545 | Bacteria | 956 |
| 192 | Ga0105237_11030562 | 3300009545 | Bacteria | 830 |
| 193 | Ga0105237_11963860 | 3300009545 | Bacteria | 593 |
| 194 | Ga0105238_10030103 | 3300009551 | Bacteria | 5525 |
| 195 | Ga0105238_10056714 | 3300009551 | Bacteria | 3929 |
| 196 | Ga0105238_10165875 | 3300009551 | Bacteria | 2184 |
| 197 | Ga0105238_10292394 | 3300009551 | Unclassified | 1612 |
| 198 | Ga0105238_10461865 | 3300009551 | Bacteria | 1267 |
| 199 | Ga0105238_10623108 | 3300009551 | Unclassified | 1088 |
| 200 | Ga0105249_10034353 | 3300009553 | Bacteria | 4595 |
| 201 | Ga0105249_10603195 | 3300009553 | Unclassified | 1153 |
| 202 | Ga0105249_10800348 | 3300009553 | Unclassified | 1007 |
| 203 | Ga0105249_11758797 | 3300009553 | Bacteria | 692 |
| 204 | Ga0105029_121233 | 3300009984 | Bacteria | 544 |
| 205 | Ga0105035_102226 | 3300009988 | Unclassified | 1415 |
| 206 | Ga0105239_10138614 | 3300010375 | Bacteria | 2710 |
| 207 | Ga0105239_10346115 | 3300010375 | Bacteria | 1678 |
| 208 | Ga0105239_10464766 | 3300010375 | Unclassified | 1436 |
| 209 | Ga0105239_11503569 | 3300010375 | Bacteria | 778 |
| 210 | Ga0105246_10045637 | 3300011119 | Bacteria | 2985 |
| 211 | Ga0105246_10247119 | 3300011119 | Unclassified | 1414 |
| 212 | Ga0157373_10693148 | 3300013100 | Unclassified | 746 |
| 213 | Ga0157373_10803377 | 3300013100 | Unclassified | 694 |
| 214 | Ga0157373_10880697 | 3300013100 | Bacteria | 663 |
| 215 | Ga0157371_11558776 | 3300013102 | Unclassified | 516 |
| 216 | Ga0157370_10017357 | 3300013104 | Bacteria | 7264 |
| 217 | Ga0157370_10190335 | 3300013104 | Unclassified | 1905 |
| 218 | Ga0157370_10378103 | 3300013104 | Bacteria | 1305 |
| 219 | Ga0157370_11284657 | 3300013104 | Unclassified | 660 |
| 220 | Ga0157369_10086109 | 3300013105 | Bacteria | 3356 |
| 221 | Ga0157369_12522948 | 3300013105 | Unclassified | 520 |
| 222 | Ga0157374_10007748 | 3300013296 | Bacteria | 9168 |
| 223 | Ga0157374_10104852 | 3300013296 | Bacteria | 2715 |
| 224 | Ga0157374_10204016 | 3300013296 | Bacteria | 1937 |
| 225 | Ga0157374_10770833 | 3300013296 | Bacteria | 977 |
| 226 | Ga0157378_10045609 | 3300013297 | Bacteria | 3895 |
| 227 | Ga0157378_10079286 | 3300013297 | Unclassified | 2964 |
| 228 | Ga0157378_10288068 | 3300013297 | Bacteria | 1585 |
| 229 | Ga0163162_10021649 | 3300013306 | Bacteria | 6332 |
| 230 | Ga0163162_10226760 | 3300013306 | Bacteria | 1998 |
| 231 | Ga0163162_12505640 | 3300013306 | Bacteria | 593 |
| 232 | Ga0157372_10051159 | 3300013307 | Bacteria | 4597 |
| 233 | Ga0157372_10100764 | 3300013307 | Bacteria | 3296 |
| 234 | Ga0157375_10420552 | 3300013308 | Bacteria | 1502 |
| 235 | Ga0157375_11611667 | 3300013308 | Unclassified | 767 |
| 236 | Ga0163163_10701991 | 3300014325 | Bacteria | 1075 |
| 237 | Ga0163163_13044929 | 3300014325 | Bacteria | 523 |
| 238 | Ga0157379_10349708 | 3300014968 | Bacteria | 1353 |
| 239 | Ga0157379_11613423 | 3300014968 | Unclassified | 634 |
| 240 | Ga0157376_11127613 | 3300014969 | Bacteria | 811 |
| 241 | Ga0157376_11680520 | 3300014969 | Unclassified | 670 |
| 242 | Ga0157376_12375424 | 3300014969 | Unclassified | 570 |
| 243 | Ga0206351_10618919 | 3300020077 | Unclassified | 824 |
| 244 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 245 | Ga0209758_1131233 | 3300025297 | Unclassified | 662 |
| 246 | Ga0209050_1002767 | 3300025298 | Bacteria | 14080 |
| 247 | Ga0207426_1086508 | 3300025302 | Unclassified | 839 |
| 248 | Ga0209051_1025241 | 3300025303 | Bacteria | 2423 |
| 249 | Ga0209257_1000574 | 3300025304 | Bacteria | 61789 |
| 250 | Ga0207656_10746750 | 3300025321 | Unclassified | 502 |
| 251 | Ga0207710_10268156 | 3300025900 | Bacteria | 857 |
| 252 | Ga0207680_10510499 | 3300025903 | Bacteria | 857 |
| 253 | Ga0207680_10575682 | 3300025903 | Bacteria | 805 |
| 254 | Ga0207680_10741393 | 3300025903 | Bacteria | 704 |
| 255 | Ga0207647_10245426 | 3300025904 | Bacteria | 1028 |
| 256 | Ga0207645_10671479 | 3300025907 | Unclassified | 704 |
| 257 | Ga0207643_10011617 | 3300025908 | Bacteria | 4755 |
| 258 | Ga0207705_10011204 | 3300025909 | Bacteria | 6500 |
| 259 | Ga0207705_10014846 | 3300025909 | Bacteria | 5601 |
| 260 | Ga0207705_10379860 | 3300025909 | Bacteria | 1091 |
| 261 | Ga0207705_10460770 | 3300025909 | Bacteria | 986 |
| 262 | Ga0207705_10518958 | 3300025909 | Unclassified | 926 |
| 263 | Ga0207705_11232334 | 3300025909 | Unclassified | 573 |
| 264 | Ga0207705_11475587 | 3300025909 | Unclassified | 515 |
| 265 | Ga0207654_10062683 | 3300025911 | Bacteria | 2179 |
| 266 | Ga0207654_10072421 | 3300025911 | Bacteria | 2051 |
| 267 | Ga0207654_10120282 | 3300025911 | Bacteria | 1648 |
| 268 | Ga0207654_10665831 | 3300025911 | Unclassified | 746 |
| 269 | Ga0207707_10218818 | 3300025912 | Bacteria | 1658 |
| 270 | Ga0207707_10561573 | 3300025912 | Bacteria | 969 |
| 271 | Ga0207707_11144795 | 3300025912 | Unclassified | 632 |
| 272 | Ga0207695_10005068 | 3300025913 | Bacteria | 17663 |
| 273 | Ga0207695_10053953 | 3300025913 | Bacteria | 4201 |
| 274 | Ga0207695_10069109 | 3300025913 | Bacteria | 3616 |
| 275 | Ga0207695_10248597 | 3300025913 | Bacteria | 1678 |
| 276 | Ga0207695_10404824 | 3300025913 | Bacteria | 1249 |
| 277 | Ga0207695_10642287 | 3300025913 | Unclassified | 942 |
| 278 | Ga0207695_11567841 | 3300025913 | Unclassified | 539 |
| 279 | Ga0207671_10133411 | 3300025914 | Bacteria | 1908 |
| 280 | Ga0207671_10345845 | 3300025914 | Bacteria | 1179 |
| 281 | Ga0207671_10512537 | 3300025914 | Bacteria | 956 |
| 282 | Ga0207671_10526506 | 3300025914 | Bacteria | 942 |
| 283 | Ga0207693_10655188 | 3300025915 | Unclassified | 815 |
| 284 | Ga0207660_10112270 | 3300025917 | Unclassified | 2053 |
| 285 | Ga0207660_10275511 | 3300025917 | Unclassified | 1334 |
| 286 | Ga0207660_10309861 | 3300025917 | Bacteria | 1259 |
| 287 | Ga0207660_10353014 | 3300025917 | Unclassified | 1179 |
| 288 | Ga0207660_11154599 | 3300025917 | Unclassified | 631 |
| 289 | Ga0207657_10003976 | 3300025919 | Bacteria | 15705 |
| 290 | Ga0207657_10022961 | 3300025919 | Bacteria | 5821 |
| 291 | Ga0207657_10302214 | 3300025919 | Bacteria | 1267 |
| 292 | Ga0207657_11488404 | 3300025919 | Bacteria | 506 |
| 293 | Ga0207649_10079732 | 3300025920 | Unclassified | 2116 |
| 294 | Ga0207649_10181066 | 3300025920 | Bacteria | 1475 |
| 295 | Ga0207649_11575989 | 3300025920 | Unclassified | 520 |
| 296 | Ga0207652_10065966 | 3300025921 | Bacteria | 3136 |
| 297 | Ga0207652_10073311 | 3300025921 | Bacteria | 2978 |
| 298 | Ga0207652_10274157 | 3300025921 | Bacteria | 1522 |
| 299 | Ga0207652_10327649 | 3300025921 | Unclassified | 1383 |
| 300 | Ga0207694_10030274 | 3300025924 | Bacteria | 4133 |
| 301 | Ga0207694_10034379 | 3300025924 | Bacteria | 3886 |
| 302 | Ga0207694_10320774 | 3300025924 | Bacteria | 1278 |
| 303 | Ga0207694_11036567 | 3300025924 | Unclassified | 694 |
| 304 | Ga0207650_10254409 | 3300025925 | Bacteria | 1423 |
| 305 | Ga0207650_10466932 | 3300025925 | Bacteria | 1052 |
| 306 | Ga0207687_10232982 | 3300025927 | Bacteria | 1455 |
| 307 | Ga0207687_11339678 | 3300025927 | Bacteria | 615 |
| 308 | Ga0207664_10000078 | 3300025929 | Bacteria | 97308 |
| 309 | Ga0207664_11955335 | 3300025929 | Unclassified | 509 |
| 310 | Ga0207644_10568380 | 3300025931 | Unclassified | 940 |
| 311 | Ga0207644_10899564 | 3300025931 | Unclassified | 742 |
| 312 | Ga0207706_10062067 | 3300025933 | Bacteria | 3292 |
| 313 | Ga0207706_10201290 | 3300025933 | Bacteria | 1747 |
| 314 | Ga0207706_10477081 | 3300025933 | Bacteria | 1078 |
| 315 | Ga0207686_10015197 | 3300025934 | Bacteria | 4301 |
| 316 | Ga0207686_10226218 | 3300025934 | Bacteria | 1354 |
| 317 | Ga0207686_11521884 | 3300025934 | Unclassified | 552 |
| 318 | Ga0207686_11683192 | 3300025934 | Unclassified | 524 |
| 319 | Ga0207669_11301755 | 3300025937 | Unclassified | 617 |
| 320 | Ga0207704_10153680 | 3300025938 | Bacteria | 1627 |
| 321 | Ga0207704_10198599 | 3300025938 | Bacteria | 1466 |
| 322 | Ga0207665_10105297 | 3300025939 | Bacteria | 1975 |
| 323 | Ga0207691_11674814 | 3300025940 | Unclassified | 515 |
| 324 | Ga0207711_10029833 | 3300025941 | Bacteria | 4601 |
| 325 | Ga0207711_10221420 | 3300025941 | Bacteria | 1731 |
| 326 | Ga0207711_10666514 | 3300025941 | Bacteria | 970 |
| 327 | Ga0207689_10062635 | 3300025942 | Bacteria | 3059 |
| 328 | Ga0207689_10064251 | 3300025942 | Bacteria | 3020 |
| 329 | Ga0207689_10287369 | 3300025942 | Unclassified | 1362 |
| 330 | Ga0207661_10112973 | 3300025944 | Bacteria | 2301 |
| 331 | Ga0207661_10287893 | 3300025944 | Unclassified | 1470 |
| 332 | Ga0207679_10426687 | 3300025945 | Unclassified | 1171 |
| 333 | Ga0207667_10006875 | 3300025949 | Bacteria | 13743 |
| 334 | Ga0207667_11618516 | 3300025949 | Bacteria | 616 |
| 335 | Ga0207712_11057512 | 3300025961 | Bacteria | 721 |
| 336 | Ga0207640_10262359 | 3300025981 | Unclassified | 1347 |
| 337 | Ga0207658_10287086 | 3300025986 | Bacteria | 1413 |
| 338 | Ga0207658_10379976 | 3300025986 | Unclassified | 1237 |
| 339 | Ga0207658_12084861 | 3300025986 | Unclassified | 515 |
| 340 | Ga0207658_12172721 | 3300025986 | Bacteria | 504 |
| 341 | Ga0207677_10000004 | 3300026023 | Bacteria | 299062 |
| 342 | Ga0207677_10063109 | 3300026023 | Bacteria | 2574 |
| 343 | Ga0207677_10268905 | 3300026023 | Bacteria | 1393 |
| 344 | Ga0207677_10543356 | 3300026023 | Bacteria | 1011 |
| 345 | Ga0207677_10700317 | 3300026023 | Bacteria | 899 |
| 346 | Ga0207703_10926979 | 3300026035 | Bacteria | 834 |
| 347 | Ga0207703_11516497 | 3300026035 | Unclassified | 645 |
| 348 | Ga0207703_11752130 | 3300026035 | Unclassified | 597 |
| 349 | Ga0207639_10071232 | 3300026041 | Bacteria | 2718 |
| 350 | Ga0207639_11624439 | 3300026041 | Bacteria | 606 |
| 351 | Ga0207702_10011606 | 3300026078 | Bacteria | 7341 |
| 352 | Ga0207702_10061064 | 3300026078 | Bacteria | 3214 |
| 353 | Ga0207702_10313340 | 3300026078 | Bacteria | 1492 |
| 354 | Ga0207702_11311975 | 3300026078 | Unclassified | 718 |
| 355 | Ga0207641_10743950 | 3300026088 | Bacteria | 967 |
| 356 | Ga0207641_10838505 | 3300026088 | Bacteria | 911 |
| 357 | Ga0207648_10673513 | 3300026089 | Unclassified | 957 |
| 358 | Ga0207648_11964412 | 3300026089 | Unclassified | 546 |
| 359 | Ga0207676_10800802 | 3300026095 | Unclassified | 919 |
| 360 | Ga0207676_11672544 | 3300026095 | Bacteria | 635 |
| 361 | Ga0207674_10420784 | 3300026116 | Bacteria | 1291 |
| 362 | Ga0207675_100528643 | 3300026118 | Bacteria | 1177 |
| 363 | Ga0207675_100724078 | 3300026118 | Bacteria | 1005 |
| 364 | Ga0207683_10029354 | 3300026121 | Bacteria | 4761 |
| 365 | Ga0207683_10128529 | 3300026121 | Bacteria | 2278 |
| 366 | Ga0207683_11176807 | 3300026121 | Bacteria | 711 |
| 367 | Ga0207683_11310176 | 3300026121 | Bacteria | 670 |
| 368 | Ga0207698_10143101 | 3300026142 | Bacteria | 2063 |
| 369 | Ga0207698_10582236 | 3300026142 | Unclassified | 1101 |
| 370 | Ga0210002_1023723 | 3300027617 | Unclassified | 999 |
| 371 | Ga0209971_1038461 | 3300027682 | Bacteria | 1152 |
| 372 | Ga0209974_10176473 | 3300027876 | Bacteria | 781 |
| 373 | Ga0207428_10158239 | 3300027907 | Unclassified | 1721 |
| 374 | Ga0268266_10066516 | 3300028379 | Bacteria | 3117 |
| 375 | Ga0268266_10118596 | 3300028379 | Bacteria | 2352 |
| 376 | Ga0268266_10131310 | 3300028379 | Bacteria | 2240 |
| 377 | Ga0268266_10135479 | 3300028379 | Bacteria | 2205 |
| 378 | Ga0268266_10347409 | 3300028379 | Bacteria | 1393 |
| 379 | Ga0268266_10551151 | 3300028379 | Bacteria | 1105 |
| 380 | Ga0268265_10002160 | 3300028380 | Bacteria | 15223 |
| 381 | Ga0268265_10528540 | 3300028380 | Bacteria | 1116 |
| 382 | Ga0268265_10884014 | 3300028380 | Bacteria | 876 |
| 383 | Ga0268265_12074366 | 3300028380 | Unclassified | 576 |
| 384 | Ga0268264_10048640 | 3300028381 | Unclassified | 3528 |
| 385 | Ga0268264_10283735 | 3300028381 | Bacteria | 1552 |
| 386 | Ga0268264_10684069 | 3300028381 | Bacteria | 1018 |
| 387 | Ga0307408_100035242 | 3300031548 | Bacteria | 3510 |
| 388 | Ga0307408_100105857 | 3300031548 | Bacteria | 2151 |
| 389 | Ga0307408_100129213 | 3300031548 | Bacteria | 1969 |
| 390 | Ga0307408_100310301 | 3300031548 | Bacteria | 1325 |
| 391 | Ga0307408_100925653 | 3300031548 | Unclassified | 799 |
| 392 | Ga0307405_10545051 | 3300031731 | Bacteria | 938 |
| 393 | Ga0307413_10089355 | 3300031824 | Bacteria | 2001 |
| 394 | Ga0307413_11116710 | 3300031824 | Bacteria | 682 |
| 395 | Ga0307413_11508145 | 3300031824 | Unclassified | 594 |
| 396 | Ga0307410_10053704 | 3300031852 | Bacteria | 2728 |
| 397 | Ga0307410_10073014 | 3300031852 | Bacteria | 2384 |
| 398 | Ga0307410_10749946 | 3300031852 | Bacteria | 827 |
| 399 | Ga0307410_11011308 | 3300031852 | Unclassified | 717 |
| 400 | Ga0307406_10151165 | 3300031901 | Bacteria | 1656 |
| 401 | Ga0307406_10276666 | 3300031901 | Bacteria | 1278 |
| 402 | Ga0307406_11322488 | 3300031901 | Bacteria | 630 |
| 403 | Ga0307406_11540489 | 3300031901 | Bacteria | 586 |
| 404 | Ga0307407_10078127 | 3300031903 | Bacteria | 1993 |
| 405 | Ga0307407_10175649 | 3300031903 | Bacteria | 1415 |
| 406 | Ga0307412_10103127 | 3300031911 | Bacteria | 2021 |
| 407 | Ga0307412_10426248 | 3300031911 | Bacteria | 1086 |
| 408 | Ga0307409_100032336 | 3300031995 | Bacteria | 3792 |
| 409 | Ga0307409_101264665 | 3300031995 | Bacteria | 762 |
| 410 | Ga0307409_102601389 | 3300031995 | Unclassified | 534 |
| 411 | Ga0307416_100069826 | 3300032002 | Bacteria | 2909 |
| 412 | Ga0307416_100211933 | 3300032002 | Bacteria | 1849 |
| 413 | Ga0307416_100327542 | 3300032002 | Unclassified | 1538 |
| 414 | Ga0307416_100416907 | 3300032002 | Bacteria | 1385 |
| 415 | Ga0307416_101290997 | 3300032002 | Unclassified | 836 |
| 416 | Ga0307414_10025995 | 3300032004 | Bacteria | 3761 |
| 417 | Ga0307414_10082808 | 3300032004 | Unclassified | 2354 |
| 418 | Ga0307411_10010772 | 3300032005 | Bacteria | 4893 |
| 419 | Ga0307411_10013670 | 3300032005 | Bacteria | 4488 |
| 420 | Ga0307411_10136484 | 3300032005 | Unclassified | 1802 |
| 421 | Ga0307411_10245120 | 3300032005 | Bacteria | 1405 |
| 422 | Ga0307415_100090510 | 3300032126 | Bacteria | 2213 |
| 423 | Ga0307415_100631337 | 3300032126 | Unclassified | 958 |
| 424 | Ga0307415_101514866 | 3300032126 | Bacteria | 642 |
| 425 | Ga0307415_102298409 | 3300032126 | Bacteria | 529 |
| 426 | Ga0307510_10136350 | 3300033180 | Unclassified | 2111 |
| 427 | Ga0307510_10269164 | 3300033180 | Bacteria | 1181 |
| 428 | Ga0373934_0011032 | 3300035086 | Bacteria | 3399 |
| 429 | Ga0373923_0122549 | 3300035111 | Bacteria | 1163 |
| 430 | Ga0373932_0121324 | 3300035112 | Bacteria | 872 |
| 431 | Ga0373939_0304031 | 3300035114 | Unclassified | 637 |
| 432 | Ga0373953_0001379 | 3300035117 | Bacteria | 6984 |
| 433 | Ga0373954_0000313 | 3300035118 | Bacteria | 17689 |
| 434 | Ga0373957_0002825 | 3300035120 | Bacteria | 5013 |
| 435 | Ga0373955_0000495 | 3300035172 | Bacteria | 16716 |
| 436 | Ga0373933_0003323 | 3300035724 | Bacteria | 8978 |
| 437 | Ga0373937_0001044 | 3300036401 | Bacteria | 23401 |
| 438 | Ga0395899_0002950 | 3300037312 | Bacteria | 13635 |
| 439 | Ga0395899_0643597 | 3300037312 | Bacteria | 671 |
| 440 | Ga0395900_0100094 | 3300037418 | Bacteria | 2977 |
| 441 | Ga0395898_0028340 | 3300037466 | Bacteria | 5613 |
| 442 | Ga0395898_0054854 | 3300037466 | Bacteria | 3888 |
| 443 | Ga0395905_0552121 | 3300037471 | Bacteria | 1053 |
| 444 | Ga0395901_0002816 | 3300038443 | Bacteria | 17562 |
| 445 | Ga0395901_0004332 | 3300038443 | Bacteria | 14320 |
| 446 | Ga0395901_0213460 | 3300038443 | Bacteria | 2019 |
| 447 | Ga0395901_1592169 | 3300038443 | Unclassified | 607 |
| 448 | Ga0439439_0065005 | 3300041406 | Bacteria | 973 |
| 449 | Ga0439461_0065414 | 3300041410 | Unclassified | 833 |
| 450 | Ga0439461_0079844 | 3300041410 | Bacteria | 770 |
| 451 | Ga0451787_178779 | 3300041441 | Unclassified | 541 |
| 452 | Ga0451789_0529924 | 3300041443 | Unclassified | 525 |
| 453 | Ga0451793_0317576 | 3300041452 | Bacteria | 886 |
| 454 | Ga0451798_0756100 | 3300041458 | Unclassified | 1939 |
| 455 | Ga0451807_0049124 | 3300041486 | Unclassified | 978 |
| 456 | Ga0451853_2821110 | 3300041512 | Bacteria | 887 |
| 457 | Ga0439431_0106524 | 3300041997 | Unclassified | 774 |
| 458 | Ga0439433_0017664 | 3300041999 | Bacteria | 1585 |
| 459 | Ga0439441_016970 | 3300042001 | Unclassified | 1303 |
| 460 | Ga0439442_050322 | 3300042002 | Bacteria | 879 |
| 461 | Ga0439443_006736 | 3300042003 | Bacteria | 1579 |
| 462 | Ga0450911_036276 | 3300042115 | Bacteria | 639 |
| 463 | Ga0450922_041753 | 3300042124 | Unclassified | 520 |
| 464 | Ga0450923_007548 | 3300042125 | Bacteria | 1844 |
| 465 | Ga0450895_007079 | 3300042132 | Bacteria | 925 |
| 466 | Ga0450896_004133 | 3300042133 | Bacteria | 1959 |
| 467 | Ga0439446_0058145 | 3300042156 | Unclassified | 1165 |
| 468 | Ga0439458_0235844 | 3300042157 | Unclassified | 506 |
| 469 | Ga0439434_0019414 | 3300042435 | Bacteria | 2038 |
| 470 | Ga0439434_0023489 | 3300042435 | Bacteria | 1857 |
| 471 | Ga0439435_0001054 | 3300042436 | Bacteria | 4865 |
| 472 | Ga0439444_0024881 | 3300042437 | Bacteria | 1085 |
| 473 | Ga0439460_0077928 | 3300042461 | Bacteria | 1036 |
| 474 | Ga0439440_0110970 | 3300042993 | Bacteria | 755 |
| 475 | Ga0466957_0318426 | 3300044842 | Unclassified | 1049 |
| 476 | Ga0466960_0532951 | 3300044901 | Unclassified | 691 |
| 477 | Ga0466960_0742290 | 3300044901 | Unclassified | 591 |
| 478 | Ga0451576_1700425 | 3300045051 | Unclassified | 653 |
| 479 | Ga0495617_172051 | 3300046452 | Unclassified | 684 |
| 480 | Ga0495592_0005825 | 3300046454 | Bacteria | 9139 |
| 481 | Ga0495629_0100613 | 3300046459 | Bacteria | 2017 |
| 482 | Ga0495638_0162233 | 3300046460 | Bacteria | 1289 |
| 483 | Ga0495651_0001257 | 3300046462 | Bacteria | 19640 |
| 484 | Ga0495653_0000881 | 3300046463 | Bacteria | 23166 |
| 485 | Ga0495585_0287373 | 3300046492 | Bacteria | 811 |
| 486 | Ga0495608_0000687 | 3300046511 | Bacteria | 23407 |
| 487 | Ga0495618_0382736 | 3300046514 | Bacteria | 863 |
| 488 | Ga0495628_0107721 | 3300046516 | Unclassified | 2145 |
| 489 | Ga0495632_0113801 | 3300046519 | Unclassified | 1269 |
| 490 | Ga0495648_0436445 | 3300046524 | Bacteria | 576 |
| 491 | Ga0495652_0004854 | 3300046529 | Bacteria | 12771 |
| 492 | Ga0495640_0180023 | 3300046533 | Bacteria | 1347 |
| 493 | Ga0495587_0000799 | 3300046536 | Bacteria | 20999 |
| 494 | Ga0495645_0123207 | 3300046543 | Bacteria | 1823 |
| 495 | Ga0495667_0001241 | 3300046559 | Bacteria | 16709 |
| 496 | Ga0495656_0253082 | 3300046615 | Bacteria | 890 |
| 497 | Ga0495634_0059065 | 3300046642 | Bacteria | 2555 |
| 498 | Ga0495635_0001738 | 3300046663 | Bacteria | 14661 |
| 499 | Ga0495661_0214614 | 3300046665 | Bacteria | 1000 |
| 500 | Ga0495657_0001772 | 3300046675 | Bacteria | 18460 |
| 501 | Ga0495599_0000559 | 3300046678 | Bacteria | 21250 |
| 502 | Ga0495623_0021090 | 3300046679 | Bacteria | 4209 |
| 503 | Ga0495646_0100308 | 3300046680 | Bacteria | 1661 |
| 504 | Ga0495613_0677674 | 3300046689 | Bacteria | 680 |
| 505 | Ga0495671_0024903 | 3300046692 | Bacteria | 3114 |
| 506 | Ga0495600_0000253 | 3300046809 | Bacteria | 29204 |
| 507 | Ga0495604_0001029 | 3300047317 | Bacteria | 23248 |
| 508 | Ga0495674_0028383 | 3300047319 | Bacteria | 5102 |
| 509 | Ga0495680_0001875 | 3300047322 | Bacteria | 22125 |
| 510 | Ga0495675_0000610 | 3300047444 | Bacteria | 23039 |
| 511 | Ga0495684_0001161 | 3300047471 | Bacteria | 21170 |
| 512 | Ga0495593_0005318 | 3300047673 | Bacteria | 7609 |
| 513 | Ga0495602_0009531 | 3300048088 | Bacteria | 10091 |
| 514 | Ga0496100_0831928 | 3300048903 | Unclassified | 724 |
| 515 | Ga0496104_0014095 | 3300048907 | Bacteria | 7216 |
| 516 | Ga0496105_0193278 | 3300048908 | Bacteria | 1663 |
| 517 | Ga0496110_0583995 | 3300048913 | Bacteria | 1014 |
| 518 | Ga0496111_0212404 | 3300048914 | Bacteria | 1437 |
| 519 | Ga0496124_0076789 | 3300048927 | Bacteria | 2756 |
| 520 | Ga0501310_011971 | 3300049130 | Unclassified | 989 |
| 521 | Ga0495682_0288058 | 3300049460 | Bacteria | 580 |
| 522 | Ga0501294_001163 | 3300049517 | Bacteria | 2739 |
| 523 | Ga0501294_007365 | 3300049517 | Bacteria | 1062 |
| 524 | Ga0501296_058241 | 3300049519 | Bacteria | 579 |
| 525 | Ga0501297_013151 | 3300049520 | Bacteria | 969 |
| 526 | Ga0501297_067949 | 3300049520 | Unclassified | 557 |
| 527 | Ga0501298_019896 | 3300049521 | Bacteria | 1246 |
| 528 | Ga0501298_037230 | 3300049521 | Unclassified | 976 |
| 529 | Ga0501300_001721 | 3300049523 | Bacteria | 3281 |
| 530 | Ga0501302_017427 | 3300049525 | Bacteria | 591 |
| 531 | Ga0501303_008507 | 3300049526 | Bacteria | 933 |
| 532 | Ga0501315_024542 | 3300049531 | Unclassified | 834 |
| 533 | Ga0501031_0318872 | 3300049568 | Unclassified | 1007 |
| 534 | Ga0501031_0645411 | 3300049568 | Bacteria | 680 |
| 535 | Ga0501031_1108401 | 3300049568 | Bacteria | 505 |
| 536 | Ga0501032_0006405 | 3300049569 | Bacteria | 8664 |
| 537 | Ga0501032_0126398 | 3300049569 | Bacteria | 1689 |
| 538 | Ga0501032_0135183 | 3300049569 | Bacteria | 1625 |
| 539 | Ga0501032_0779513 | 3300049569 | Unclassified | 604 |
| 540 | Ga0501034_0000135 | 3300049571 | Bacteria | 137151 |
| 541 | Ga0501034_0021435 | 3300049571 | Bacteria | 6587 |
| 542 | Ga0501034_0027030 | 3300049571 | Bacteria | 5837 |
| 543 | Ga0501034_0107456 | 3300049571 | Bacteria | 2782 |
| 544 | Ga0501034_0355484 | 3300049571 | Unclassified | 1393 |
| 545 | Ga0501034_0862247 | 3300049571 | Unclassified | 795 |
| 546 | Ga0501034_0984384 | 3300049571 | Bacteria | 728 |
| 547 | Ga0501034_1001188 | 3300049571 | Unclassified | 720 |
| 548 | Ga0501034_1389820 | 3300049571 | Unclassified | 577 |
| 549 | Ga0501036_0005221 | 3300049572 | Bacteria | 10503 |
| 550 | Ga0501036_0024356 | 3300049572 | Bacteria | 5102 |
| 551 | Ga0501036_0668607 | 3300049572 | Unclassified | 859 |
| 552 | Ga0501037_0003668 | 3300049573 | Bacteria | 11144 |
| 553 | Ga0501037_0116032 | 3300049573 | Bacteria | 1927 |
| 554 | Ga0501037_0291148 | 3300049573 | Bacteria | 1136 |
| 555 | Ga0501037_0440131 | 3300049573 | Bacteria | 890 |
| 556 | Ga0501037_0463122 | 3300049573 | Unclassified | 864 |
| 557 | Ga0501038_0476178 | 3300049574 | Unclassified | 957 |
| 558 | Ga0501039_0000180 | 3300049575 | Bacteria | 45008 |
| 559 | Ga0501039_0234692 | 3300049575 | Bacteria | 1442 |
| 560 | Ga0501040_0076541 | 3300049576 | Bacteria | 2314 |
| 561 | Ga0501040_0101741 | 3300049576 | Bacteria | 2005 |
| 562 | Ga0501040_0129578 | 3300049576 | Unclassified | 1773 |
| 563 | Ga0501042_0171797 | 3300049578 | Bacteria | 1564 |
| 564 | Ga0501043_0554549 | 3300049579 | Unclassified | 853 |
| 565 | Ga0501043_0582437 | 3300049579 | Bacteria | 828 |
| 566 | Ga0501043_1147235 | 3300049579 | Unclassified | 547 |
| 567 | Ga0501046_0003402 | 3300049580 | Bacteria | 14604 |
| 568 | Ga0501046_0163883 | 3300049580 | Bacteria | 1671 |
| 569 | Ga0501046_0214584 | 3300049580 | Bacteria | 1427 |
| 570 | Ga0501046_0235713 | 3300049580 | Bacteria | 1351 |
| 571 | Ga0501046_0970177 | 3300049580 | Unclassified | 591 |
| 572 | Ga0501047_0000897 | 3300049581 | Bacteria | 30435 |
| 573 | Ga0501047_0008106 | 3300049581 | Bacteria | 9913 |
| 574 | Ga0501047_0017104 | 3300049581 | Bacteria | 6935 |
| 575 | Ga0501047_0023931 | 3300049581 | Bacteria | 5864 |
| 576 | Ga0501047_0082177 | 3300049581 | Bacteria | 3097 |
| 577 | Ga0501047_0619504 | 3300049581 | Bacteria | 903 |
| 578 | Ga0501047_0705539 | 3300049581 | Bacteria | 826 |
| 579 | Ga0501047_0974235 | 3300049581 | Bacteria | 661 |
| 580 | Ga0501048_0227897 | 3300049582 | Bacteria | 1322 |
| 581 | Ga0501048_0238380 | 3300049582 | Unclassified | 1291 |
| 582 | Ga0501048_0620884 | 3300049582 | Bacteria | 776 |
| 583 | Ga0501067_0004604 | 3300049583 | Bacteria | 7634 |
| 584 | Ga0501068_0304788 | 3300049584 | Bacteria | 1020 |
| 585 | Ga0501068_0923605 | 3300049584 | Unclassified | 574 |
| 586 | Ga0501068_0985588 | 3300049584 | Unclassified | 556 |
| 587 | Ga0501069_0029067 | 3300049585 | Bacteria | 3033 |
| 588 | Ga0501069_0045771 | 3300049585 | Bacteria | 2425 |
| 589 | Ga0501070_0002980 | 3300049586 | Bacteria | 14744 |
| 590 | Ga0501070_0025565 | 3300049586 | Bacteria | 4952 |
| 591 | Ga0501070_0065076 | 3300049586 | Bacteria | 3019 |
| 592 | Ga0501070_0326194 | 3300049586 | Bacteria | 1248 |
| 593 | Ga0501070_0395470 | 3300049586 | Bacteria | 1118 |
| 594 | Ga0501071_0018219 | 3300049587 | Bacteria | 4858 |
| 595 | Ga0501071_0119043 | 3300049587 | Bacteria | 1957 |
| 596 | Ga0501072_0067808 | 3300049588 | Bacteria | 2816 |
| 597 | Ga0501072_0335667 | 3300049588 | Bacteria | 1201 |
| 598 | Ga0501072_1453544 | 3300049588 | Unclassified | 530 |
| 599 | Ga0501073_0009593 | 3300049589 | Bacteria | 7138 |
| 600 | Ga0501073_0023910 | 3300049589 | Bacteria | 4387 |
| 601 | Ga0501073_0082204 | 3300049589 | Bacteria | 2240 |
| 602 | Ga0501073_0097705 | 3300049589 | Bacteria | 2040 |
| 603 | Ga0501073_0327854 | 3300049589 | Bacteria | 1057 |
| 604 | Ga0501073_0458538 | 3300049589 | Unclassified | 881 |
| 605 | Ga0501073_1118494 | 3300049589 | Unclassified | 541 |
| 606 | Ga0501074_0007311 | 3300049590 | Bacteria | 7984 |
| 607 | Ga0501074_0063957 | 3300049590 | Bacteria | 2649 |
| 608 | Ga0501074_1091405 | 3300049590 | Unclassified | 560 |
| 609 | Ga0501075_0053722 | 3300049591 | Bacteria | 3030 |
| 610 | Ga0501075_0456132 | 3300049591 | Bacteria | 975 |
| 611 | Ga0501076_0011401 | 3300049592 | Bacteria | 6618 |
| 612 | Ga0501076_0462194 | 3300049592 | Bacteria | 1045 |
| 613 | Ga0501076_0891341 | 3300049592 | Bacteria | 733 |
| 614 | Ga0501077_0041159 | 3300049593 | Bacteria | 2942 |
| 615 | Ga0501077_0331648 | 3300049593 | Bacteria | 970 |
| 616 | Ga0501077_0711360 | 3300049593 | Unclassified | 646 |
| 617 | Ga0501077_0990637 | 3300049593 | Unclassified | 541 |
| 618 | Ga0501206_036028 | 3300049653 | Unclassified | 750 |
| 619 | Ga0501206_048665 | 3300049653 | Bacteria | 670 |
| 620 | Ga0501207_004182 | 3300049654 | Bacteria | 1954 |
| 621 | Ga0501210_001617 | 3300049657 | Bacteria | 1312 |
| 622 | Ga0501211_000217 | 3300049658 | Bacteria | 4959 |
| 623 | Ga0501222_003244 | 3300049662 | Bacteria | 2233 |
| 624 | Ga0501222_006973 | 3300049662 | Bacteria | 1514 |
| 625 | Ga0501223_014718 | 3300049663 | Bacteria | 1551 |
| 626 | Ga0501223_047419 | 3300049663 | Bacteria | 833 |
| 627 | Ga0501227_002884 | 3300049665 | Bacteria | 3773 |
| 628 | Ga0501233_003766 | 3300049668 | Bacteria | 2744 |
| 629 | Ga0501235_006211 | 3300049669 | Bacteria | 2602 |
| 630 | Ga0501236_015234 | 3300049670 | Unclassified | 1074 |
| 631 | Ga0501242_060384 | 3300049674 | Bacteria | 575 |
| 632 | Ga0501243_089665 | 3300049675 | Bacteria | 609 |
| 633 | Ga0501247_027834 | 3300049677 | Bacteria | 760 |
| 634 | Ga0501251_015400 | 3300049681 | Bacteria | 961 |
| 635 | Ga0501252_008463 | 3300049682 | Bacteria | 1182 |
| 636 | Ga0501253_008143 | 3300049683 | Bacteria | 1496 |
| 637 | Ga0501253_054206 | 3300049683 | Unclassified | 848 |
| 638 | Ga0501255_000809 | 3300049684 | Bacteria | 2303 |
| 639 | Ga0501257_028296 | 3300049686 | Unclassified | 1344 |
| 640 | Ga0501257_174427 | 3300049686 | Bacteria | 605 |
| 641 | Ga0501258_004012 | 3300049687 | Bacteria | 1375 |
| 642 | Ga0501259_046328 | 3300049688 | Unclassified | 871 |
| 643 | Ga0501221_000226 | 3300049704 | Bacteria | 8090 |
| 644 | Ga0501225_0118543 | 3300049705 | Unclassified | 785 |
| 645 | Ga0501229_002173 | 3300049706 | Bacteria | 2303 |
| 646 | Ga0501079_0006178 | 3300049741 | Bacteria | 8985 |
| 647 | Ga0501079_0072081 | 3300049741 | Bacteria | 2669 |
| 648 | Ga0501079_0217344 | 3300049741 | Bacteria | 1493 |
| 649 | Ga0501079_0263166 | 3300049741 | Bacteria | 1348 |
| 650 | Ga0501080_0000298 | 3300049742 | Bacteria | 37784 |
| 651 | Ga0501080_0017691 | 3300049742 | Bacteria | 6594 |
| 652 | Ga0501080_0027130 | 3300049742 | Bacteria | 5326 |
| 653 | Ga0501080_0077838 | 3300049742 | Bacteria | 3085 |
| 654 | Ga0501080_0182396 | 3300049742 | Bacteria | 1931 |
| 655 | Ga0501080_0197177 | 3300049742 | Bacteria | 1849 |
| 656 | Ga0501080_0378407 | 3300049742 | Unclassified | 1276 |
| 657 | Ga0501080_0383668 | 3300049742 | Bacteria | 1266 |
| 658 | Ga0501080_0467694 | 3300049742 | Unclassified | 1129 |
| 659 | Ga0501080_1167768 | 3300049742 | Unclassified | 663 |
| 660 | Ga0501081_0046548 | 3300049743 | Bacteria | 2982 |
| 661 | Ga0501081_0052097 | 3300049743 | Bacteria | 2823 |
| 662 | Ga0501081_0370996 | 3300049743 | Bacteria | 1057 |
| 663 | Ga0501081_1273014 | 3300049743 | Unclassified | 557 |
| 664 | Ga0501083_0111702 | 3300049744 | Bacteria | 1796 |
| 665 | Ga0501083_0398809 | 3300049744 | Unclassified | 895 |
| 666 | Ga0501232_001758 | 3300049757 | Bacteria | 1781 |
| 667 | Ga0501262_005214 | 3300049759 | Bacteria | 1530 |
| 668 | Ga0501262_014117 | 3300049759 | Unclassified | 1037 |
| 669 | Ga0501265_004898 | 3300049762 | Bacteria | 1537 |
| 670 | Ga0501265_019968 | 3300049762 | Bacteria | 898 |
| 671 | Ga0501267_005752 | 3300049764 | Bacteria | 1178 |
| 672 | Ga0501268_073517 | 3300049765 | Unclassified | 695 |
| 673 | Ga0501270_050502 | 3300049767 | Bacteria | 752 |
| 674 | Ga0501272_006284 | 3300049769 | Bacteria | 1268 |
| 675 | Ga0501272_038274 | 3300049769 | Unclassified | 632 |
| 676 | Ga0501273_032887 | 3300049770 | Unclassified | 744 |
| 677 | Ga0501274_036899 | 3300049771 | Unclassified | 573 |
| 678 | Ga0501282_024536 | 3300049778 | Unclassified | 672 |
| 679 | Ga0501283_012928 | 3300049779 | Bacteria | 1260 |
| 680 | Ga0501283_098284 | 3300049779 | Unclassified | 567 |
| 681 | Ga0501035_0000056 | 3300049822 | Bacteria | 137385 |
| 682 | Ga0501035_0000282 | 3300049822 | Bacteria | 60259 |
| 683 | Ga0501035_0006294 | 3300049822 | Bacteria | 11163 |
| 684 | Ga0501035_0006746 | 3300049822 | Bacteria | 10735 |
| 685 | Ga0501044_0000536 | 3300049823 | Bacteria | 46054 |
| 686 | Ga0501044_0011806 | 3300049823 | Bacteria | 9463 |
| 687 | Ga0501044_0039275 | 3300049823 | Bacteria | 4938 |
| 688 | Ga0501044_0089593 | 3300049823 | Bacteria | 3105 |
| 689 | Ga0501044_1414806 | 3300049823 | Unclassified | 561 |
| 690 | Ga0501045_0005467 | 3300049824 | Bacteria | 8794 |
| 691 | Ga0501045_0659797 | 3300049824 | Unclassified | 773 |
| 692 | Ga0501226_014596 | 3300049853 | Bacteria | 867 |
| 693 | nmdc:mga03683_352107_c1 | 3300050489 | Unclassified | 697 |
| 694 | nmdc:mga0qj67_108492_c1 | 3300050509 | Unclassified | 2240 |
| 695 | nmdc:mga08y16_1371723_c1 | 3300050511 | Unclassified | 671 |
| 696 | nmdc:mga08y16_9336_c1 | 3300050511 | Bacteria | 10287 |
| 697 | nmdc:mga0rr50_1780915_c1 | 3300050513 | Unclassified | 518 |
| 698 | nmdc:mga0sz30_77694_c1 | 3300050516 | Bacteria | 1434 |
| 699 | Ga0495601_0084566 | 3300053077 | Bacteria | 2038 |
| 700 | Ga0495595_0001458 | 3300053084 | Bacteria | 9234 |
| 701 | Ga0495619_0000685 | 3300053085 | Bacteria | 22151 |
| 702 | Ga0500644_0055826 | 3300053088 | Bacteria | 1372 |
| 703 | Ga0500646_0026524 | 3300053090 | Bacteria | 1571 |
| 704 | Ga0500583_0161346 | 3300053092 | Unclassified | 1116 |
| 705 | Ga0500583_0287338 | 3300053092 | Unclassified | 806 |
| 706 | Ga0500651_0417854 | 3300053093 | Bacteria | 751 |
| 707 | Ga0500650_0123477 | 3300053098 | Bacteria | 1206 |
| 708 | Ga0500562_172481 | 3300053108 | Unclassified | 588 |
| 709 | Ga0500595_001067 | 3300053119 | Bacteria | 15236 |
| 710 | Ga0500614_216726 | 3300053123 | Unclassified | 593 |
| 711 | Ga0500642_0000738 | 3300053130 | Bacteria | 9649 |
| 712 | Ga0500658_0008532 | 3300053134 | Bacteria | 3784 |
| 713 | Ga0500658_0109577 | 3300053134 | Unclassified | 1214 |
| 714 | Ga0500568_0046479 | 3300053139 | Bacteria | 1722 |
| 715 | Ga0500577_0127182 | 3300053142 | Bacteria | 1065 |
| 716 | Ga0500588_0018850 | 3300053146 | Bacteria | 1825 |
| 717 | Ga0500604_0004159 | 3300053151 | Bacteria | 3859 |
| 718 | Ga0500604_0020715 | 3300053151 | Bacteria | 1853 |
| 719 | Ga0500611_033113 | 3300053727 | Bacteria | 1085 |
| 720 | Ga0500611_161832 | 3300053727 | Unclassified | 619 |
| 721 | Ga0500609_000975 | 3300053731 | Bacteria | 4297 |
| 722 | Ga0500656_026355 | 3300053732 | Unclassified | 751 |
| 723 | Ga0500599_008793 | 3300053736 | Bacteria | 1316 |
| 724 | Ga0500587_004650 | 3300053739 | Bacteria | 1876 |
| 725 | Ga0501084_0000206 | 3300054114 | Bacteria | 45694 |
| 726 | Ga0501084_0001708 | 3300054114 | Bacteria | 17419 |
| 727 | Ga0501084_0090756 | 3300054114 | Bacteria | 2565 |
| 728 | Ga0501084_1041794 | 3300054114 | Bacteria | 687 |
| 729 | Ga0590071_008554 | 3300059421 | Bacteria | 2406 |
| 730 | Ga0590074_024903 | 3300059423 | Bacteria | 1042 |
| 731 | Ga0590075_004438 | 3300059424 | Bacteria | 3320 |
| 732 | Ga0590077_046200 | 3300059426 | Bacteria | 973 |
| 733 | Ga0501082_0007428 | 3300060353 | Bacteria | 9456 |
| 734 | Ga0501082_0011459 | 3300060353 | Bacteria | 7632 |
| 735 | Ga0501082_0060553 | 3300060353 | Bacteria | 3259 |
| 736 | Ga0501082_0147165 | 3300060353 | Bacteria | 2045 |
| 737 | Ga0501082_0161541 | 3300060353 | Bacteria | 1947 |
| 738 | Ga0501082_0486732 | 3300060353 | Bacteria | 1078 |
| 739 | Ga0501082_0685151 | 3300060353 | Bacteria | 897 |
| 740 | Ga0530510_0392280 | 3300061734 | Bacteria | 1045 |
| 741 | Ga0530510_0718054 | 3300061734 | Bacteria | 762 |
| 742 | Ga0530510_1595916 | 3300061734 | Unclassified | 501 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026121 | Ga0207683_11310176 | Ga0207683_113101762 | 72 |
| 2 | 3300042157 | Ga0439458_0235844 | Ga0439458_0235844_235_474 | 79 |
| 3 | 3300049130 | Ga0501310_011971 | Ga0501310_011971_193_432 | 79 |
| 4 | 3300005344 | Ga0070661_100972063 | Ga0070661_1009720632 | 80 |
| 5 | iso_pu_bacteria | 2738541300 | 2738845094 | 81 |
| 6 | iso_pu_bacteria | 2738543018 | 2739274679 | 81 |
| 7 | iso_pu_bacteria | 2738543030 | 2739343723 | 81 |
| 8 | iso_pu_bacteria | 2643221654 | 2644304246 | 82 |
| 9 | 3300005336 | Ga0070680_100062558 | Ga0070680_1000625583 | 83 |
| 10 | 3300005347 | Ga0070668_101475367 | Ga0070668_1014753672 | 83 |
| 11 | 3300005530 | Ga0070679_100270413 | Ga0070679_1002704132 | 83 |
| 12 | 3300005577 | Ga0068857_100569882 | Ga0068857_1005698822 | 83 |
| 13 | 3300005577 | Ga0068857_101459701 | Ga0068857_1014597012 | 83 |
| 14 | 3300005617 | Ga0068859_101097950 | Ga0068859_1010979502 | 83 |
| 15 | 3300005843 | Ga0068860_100685311 | Ga0068860_1006853112 | 83 |
| 16 | 3300005844 | Ga0068862_100096066 | Ga0068862_1000960664 | 83 |
| 17 | 3300005844 | Ga0068862_101609208 | Ga0068862_1016092082 | 83 |
| 18 | 3300006237 | Ga0097621_102140767 | Ga0097621_1021407671 | 83 |
| 19 | 3300006931 | Ga0097620_101098023 | Ga0097620_1010980232 | 83 |
| 20 | 3300013100 | Ga0157373_10803377 | Ga0157373_108033772 | 83 |
| 21 | 3300013104 | Ga0157370_10190335 | Ga0157370_101903352 | 83 |
| 22 | 3300013104 | Ga0157370_11284657 | Ga0157370_112846572 | 83 |
| 23 | 3300020077 | Ga0206351_10618919 | Ga0206351_106189192 | 83 |
| 24 | 3300025912 | Ga0207707_11144795 | Ga0207707_111447952 | 83 |
| 25 | 3300025917 | Ga0207660_10309861 | Ga0207660_103098612 | 83 |
| 26 | 3300025942 | Ga0207689_10287369 | Ga0207689_102873693 | 83 |
| 27 | 3300025986 | Ga0207658_10287086 | Ga0207658_102870863 | 83 |
| 28 | 3300026116 | Ga0207674_10420784 | Ga0207674_104207843 | 83 |
| 29 | 3300028380 | Ga0268265_10528540 | Ga0268265_105285403 | 83 |
| 30 | 3300028380 | Ga0268265_10884014 | Ga0268265_108840143 | 83 |
| 31 | 3300028381 | Ga0268264_10684069 | Ga0268264_106840693 | 83 |
| 32 | 3300041443 | Ga0451789_0529924 | Ga0451789_0529924_74_328 | 83 |
| 33 | 3300041486 | Ga0451807_0049124 | Ga0451807_0049124_403_657 | 83 |
| 34 | 3300005456 | Ga0070678_101308697 | Ga0070678_1013086971 | 84 |
| 35 | 3300005983 | Ga0081540_1002217 | Ga0081540_10022174 | 84 |
| 36 | 3300006237 | Ga0097621_100118877 | Ga0097621_1001188773 | 84 |
| 37 | 3300006358 | Ga0068871_100148925 | Ga0068871_1001489253 | 84 |
| 38 | 3300007076 | Ga0075435_100833329 | Ga0075435_1008333292 | 84 |
| 39 | 3300009174 | Ga0105241_10579751 | Ga0105241_105797512 | 84 |
| 40 | 3300009545 | Ga0105237_11963860 | Ga0105237_119638602 | 84 |
| 41 | 3300009988 | Ga0105035_102226 | Ga0105035_1022263 | 84 |
| 42 | 3300013100 | Ga0157373_10693148 | Ga0157373_106931482 | 84 |
| 43 | 3300025911 | Ga0207654_10072421 | Ga0207654_100724212 | 84 |
| 44 | 3300026121 | Ga0207683_11176807 | Ga0207683_111768072 | 84 |
| 45 | 3300031824 | Ga0307413_11116710 | Ga0307413_111167102 | 84 |
| 46 | 3300031852 | Ga0307410_10749946 | Ga0307410_107499462 | 84 |
| 47 | 3300045051 | Ga0451576_1700425 | Ga0451576_1700425_55_312 | 84 |
| 48 | 3300048903 | Ga0496100_0831928 | Ga0496100_0831928_375_632 | 84 |
| 49 | 3300049571 | Ga0501034_0984384 | Ga0501034_0984384_390_644 | 84 |
| 50 | 3300049571 | Ga0501034_1001188 | Ga0501034_1001188_59_316 | 84 |
| 51 | 3300049573 | Ga0501037_0291148 | Ga0501037_0291148_806_1060 | 84 |
| 52 | 3300049575 | Ga0501039_0234692 | Ga0501039_0234692_958_1212 | 84 |
| 53 | 3300049580 | Ga0501046_0214584 | Ga0501046_0214584_830_1084 | 84 |
| 54 | 3300049582 | Ga0501048_0620884 | Ga0501048_0620884_297_551 | 84 |
| 55 | 3300049587 | Ga0501071_0018219 | Ga0501071_0018219_3631_3885 | 84 |
| 56 | 3300049588 | Ga0501072_0067808 | Ga0501072_0067808_814_1068 | 84 |
| 57 | 3300049590 | Ga0501074_0063957 | Ga0501074_0063957_760_1014 | 84 |
| 58 | 3300049591 | Ga0501075_0053722 | Ga0501075_0053722_313_567 | 84 |
| 59 | 3300049592 | Ga0501076_0011401 | Ga0501076_0011401_2147_2401 | 84 |
| 60 | 3300049593 | Ga0501077_0041159 | Ga0501077_0041159_2063_2317 | 84 |
| 61 | 3300049741 | Ga0501079_0072081 | Ga0501079_0072081_1432_1686 | 84 |
| 62 | 3300049742 | Ga0501080_0077838 | Ga0501080_0077838_1634_1888 | 84 |
| 63 | 3300049743 | Ga0501081_0052097 | Ga0501081_0052097_393_647 | 84 |
| 64 | 3300050513 | nmdc:mga0rr50_1780915_c1 | nmdc:mga0rr50_1780915_c1_35_292 | 84 |
| 65 | 3300054114 | Ga0501084_0000206 | Ga0501084_0000206_6713_6970 | 84 |
| 66 | 3300054114 | Ga0501084_0001708 | Ga0501084_0001708_1595_1849 | 84 |
| 67 | 3300060353 | Ga0501082_0011459 | Ga0501082_0011459_866_1120 | 84 |
| 68 | 3300061734 | Ga0530510_0392280 | Ga0530510_0392280_752_1006 | 84 |
| 69 | 3300003320 | rootH2_10181915 | rootH2_101819153 | 85 |
| 70 | 3300003323 | rootH1_10007381 | rootH1_100073813 | 85 |
| 71 | 3300005327 | Ga0070658_10019362 | Ga0070658_100193625 | 85 |
| 72 | 3300005327 | Ga0070658_10292388 | Ga0070658_102923882 | 85 |
| 73 | 3300005327 | Ga0070658_11632665 | Ga0070658_116326652 | 85 |
| 74 | 3300005328 | Ga0070676_10795725 | Ga0070676_107957252 | 85 |
| 75 | 3300005329 | Ga0070683_100140667 | Ga0070683_1001406672 | 85 |
| 76 | 3300005329 | Ga0070683_100842435 | Ga0070683_1008424352 | 85 |
| 77 | 3300005329 | Ga0070683_101494679 | Ga0070683_1014946792 | 85 |
| 78 | 3300005330 | Ga0070690_100089951 | Ga0070690_1000899513 | 85 |
| 79 | 3300005331 | Ga0070670_100067057 | Ga0070670_1000670573 | 85 |
| 80 | 3300005334 | Ga0068869_100079823 | Ga0068869_1000798233 | 85 |
| 81 | 3300005335 | Ga0070666_10007725 | Ga0070666_100077253 | 85 |
| 82 | 3300005335 | Ga0070666_10017120 | Ga0070666_100171204 | 85 |
| 83 | 3300005335 | Ga0070666_10597381 | Ga0070666_105973813 | 85 |
| 84 | 3300005335 | Ga0070666_10862654 | Ga0070666_108626542 | 85 |
| 85 | 3300005336 | Ga0070680_100174647 | Ga0070680_1001746473 | 85 |
| 86 | 3300005336 | Ga0070680_100773526 | Ga0070680_1007735262 | 85 |
| 87 | 3300005337 | Ga0070682_101572835 | Ga0070682_1015728351 | 85 |
| 88 | 3300005338 | Ga0068868_100043411 | Ga0068868_1000434114 | 85 |
| 89 | 3300005338 | Ga0068868_100825859 | Ga0068868_1008258592 | 85 |
| 90 | 3300005339 | Ga0070660_100001736 | Ga0070660_10000173610 | 85 |
| 91 | 3300005339 | Ga0070660_100039372 | Ga0070660_1000393725 | 85 |
| 92 | 3300005339 | Ga0070660_100081917 | Ga0070660_1000819173 | 85 |
| 93 | 3300005339 | Ga0070660_100368369 | Ga0070660_1003683693 | 85 |
| 94 | 3300005340 | Ga0070689_100750536 | Ga0070689_1007505361 | 85 |
| 95 | 3300005340 | Ga0070689_101795334 | Ga0070689_1017953341 | 85 |
| 96 | 3300005341 | Ga0070691_10062657 | Ga0070691_100626571 | 85 |
| 97 | 3300005344 | Ga0070661_100123254 | Ga0070661_1001232543 | 85 |
| 98 | 3300005344 | Ga0070661_100557396 | Ga0070661_1005573962 | 85 |
| 99 | 3300005344 | Ga0070661_100825401 | Ga0070661_1008254011 | 85 |
| 100 | 3300005355 | Ga0070671_100055483 | Ga0070671_1000554833 | 85 |
| 101 | 3300005355 | Ga0070671_100811193 | Ga0070671_1008111932 | 85 |
| 102 | 3300005356 | Ga0070674_101173629 | Ga0070674_1011736292 | 85 |
| 103 | 3300005366 | Ga0070659_101324417 | Ga0070659_1013244172 | 85 |
| 104 | 3300005367 | Ga0070667_100029754 | Ga0070667_1000297544 | 85 |
| 105 | 3300005367 | Ga0070667_100778743 | Ga0070667_1007787432 | 85 |
| 106 | 3300005367 | Ga0070667_101393311 | Ga0070667_1013933112 | 85 |
| 107 | 3300005436 | Ga0070713_101145166 | Ga0070713_1011451662 | 85 |
| 108 | 3300005440 | Ga0070705_100086660 | Ga0070705_1000866601 | 85 |
| 109 | 3300005456 | Ga0070678_100006697 | Ga0070678_1000066975 | 85 |
| 110 | 3300005456 | Ga0070678_100033835 | Ga0070678_1000338353 | 85 |
| 111 | 3300005456 | Ga0070678_100739389 | Ga0070678_1007393892 | 85 |
| 112 | 3300005457 | Ga0070662_100273139 | Ga0070662_1002731393 | 85 |
| 113 | 3300005457 | Ga0070662_100316616 | Ga0070662_1003166163 | 85 |
| 114 | 3300005458 | Ga0070681_10499994 | Ga0070681_104999942 | 85 |
| 115 | 3300005458 | Ga0070681_10638407 | Ga0070681_106384073 | 85 |
| 116 | 3300005458 | Ga0070681_11392370 | Ga0070681_113923702 | 85 |
| 117 | 3300005458 | Ga0070681_11537185 | Ga0070681_115371852 | 85 |
| 118 | 3300005458 | Ga0070681_11578690 | Ga0070681_115786901 | 85 |
| 119 | 3300005459 | Ga0068867_100490310 | Ga0068867_1004903102 | 85 |
| 120 | 3300005466 | Ga0070685_11380750 | Ga0070685_113807501 | 85 |
| 121 | 3300005530 | Ga0070679_100029565 | Ga0070679_1000295657 | 85 |
| 122 | 3300005530 | Ga0070679_100447828 | Ga0070679_1004478283 | 85 |
| 123 | 3300005535 | Ga0070684_100043554 | Ga0070684_1000435544 | 85 |
| 124 | 3300005535 | Ga0070684_100936329 | Ga0070684_1009363292 | 85 |
| 125 | 3300005539 | Ga0068853_100112537 | Ga0068853_1001125372 | 85 |
| 126 | 3300005539 | Ga0068853_100134907 | Ga0068853_1001349073 | 85 |
| 127 | 3300005539 | Ga0068853_100559273 | Ga0068853_1005592731 | 85 |
| 128 | 3300005539 | Ga0068853_100679470 | Ga0068853_1006794702 | 85 |
| 129 | 3300005543 | Ga0070672_102054673 | Ga0070672_1020546732 | 85 |
| 130 | 3300005547 | Ga0070693_100215621 | Ga0070693_1002156212 | 85 |
| 131 | 3300005548 | Ga0070665_100018314 | Ga0070665_1000183144 | 85 |
| 132 | 3300005548 | Ga0070665_100029825 | Ga0070665_1000298257 | 85 |
| 133 | 3300005548 | Ga0070665_100034575 | Ga0070665_1000345755 | 85 |
| 134 | 3300005548 | Ga0070665_100045787 | Ga0070665_1000457875 | 85 |
| 135 | 3300005548 | Ga0070665_100262334 | Ga0070665_1002623342 | 85 |
| 136 | 3300005563 | Ga0068855_100053704 | Ga0068855_1000537044 | 85 |
| 137 | 3300005563 | Ga0068855_100072858 | Ga0068855_1000728583 | 85 |
| 138 | 3300005563 | Ga0068855_101852321 | Ga0068855_1018523212 | 85 |
| 139 | 3300005564 | Ga0070664_100012736 | Ga0070664_1000127367 | 85 |
| 140 | 3300005564 | Ga0070664_101636175 | Ga0070664_1016361752 | 85 |
| 141 | 3300005577 | Ga0068857_101924981 | Ga0068857_1019249812 | 85 |
| 142 | 3300005578 | Ga0068854_100169036 | Ga0068854_1001690363 | 85 |
| 143 | 3300005578 | Ga0068854_101418124 | Ga0068854_1014181242 | 85 |
| 144 | 3300005614 | Ga0068856_100081788 | Ga0068856_1000817882 | 85 |
| 145 | 3300005614 | Ga0068856_100263569 | Ga0068856_1002635694 | 85 |
| 146 | 3300005614 | Ga0068856_100577830 | Ga0068856_1005778303 | 85 |
| 147 | 3300005615 | Ga0070702_100082386 | Ga0070702_1000823861 | 85 |
| 148 | 3300005615 | Ga0070702_100536523 | Ga0070702_1005365232 | 85 |
| 149 | 3300005616 | Ga0068852_100002916 | Ga0068852_10000291614 | 85 |
| 150 | 3300005616 | Ga0068852_100328381 | Ga0068852_1003283813 | 85 |
| 151 | 3300005617 | Ga0068859_100737747 | Ga0068859_1007377472 | 85 |
| 152 | 3300005618 | Ga0068864_100872173 | Ga0068864_1008721732 | 85 |
| 153 | 3300005618 | Ga0068864_101134080 | Ga0068864_1011340802 | 85 |
| 154 | 3300005718 | Ga0068866_10799303 | Ga0068866_107993032 | 85 |
| 155 | 3300005719 | Ga0068861_100084560 | Ga0068861_1000845602 | 85 |
| 156 | 3300005719 | Ga0068861_100515744 | Ga0068861_1005157443 | 85 |
| 157 | 3300005719 | Ga0068861_100522092 | Ga0068861_1005220921 | 85 |
| 158 | 3300005834 | Ga0068851_10008911 | Ga0068851_100089113 | 85 |
| 159 | 3300005834 | Ga0068851_10245111 | Ga0068851_102451112 | 85 |
| 160 | 3300005834 | Ga0068851_10850221 | Ga0068851_108502211 | 85 |
| 161 | 3300005841 | Ga0068863_100144307 | Ga0068863_1001443073 | 85 |
| 162 | 3300005841 | Ga0068863_102329101 | Ga0068863_1023291011 | 85 |
| 163 | 3300005842 | Ga0068858_100025035 | Ga0068858_1000250356 | 85 |
| 164 | 3300005842 | Ga0068858_101157146 | Ga0068858_1011571462 | 85 |
| 165 | 3300005842 | Ga0068858_101399049 | Ga0068858_1013990493 | 85 |
| 166 | 3300005843 | Ga0068860_100053160 | Ga0068860_1000531603 | 85 |
| 167 | 3300005843 | Ga0068860_100298956 | Ga0068860_1002989563 | 85 |
| 168 | 3300005937 | Ga0081455_10382330 | Ga0081455_103823302 | 85 |
| 169 | 3300005937 | Ga0081455_11019343 | Ga0081455_110193432 | 85 |
| 170 | 3300005981 | Ga0081538_10005274 | Ga0081538_100052744 | 85 |
| 171 | 3300006038 | Ga0075365_11129296 | Ga0075365_111292961 | 85 |
| 172 | 3300006175 | Ga0070712_100672001 | Ga0070712_1006720012 | 85 |
| 173 | 3300006175 | Ga0070712_101883440 | Ga0070712_1018834402 | 85 |
| 174 | 3300006177 | Ga0075362_10330953 | Ga0075362_103309532 | 85 |
| 175 | 3300006195 | Ga0075366_10560371 | Ga0075366_105603712 | 85 |
| 176 | 3300006237 | Ga0097621_100023872 | Ga0097621_1000238726 | 85 |
| 177 | 3300006237 | Ga0097621_100048974 | Ga0097621_1000489745 | 85 |
| 178 | 3300006237 | Ga0097621_100091415 | Ga0097621_1000914153 | 85 |
| 179 | 3300006237 | Ga0097621_100399683 | Ga0097621_1003996832 | 85 |
| 180 | 3300006237 | Ga0097621_101434075 | Ga0097621_1014340752 | 85 |
| 181 | 3300006237 | Ga0097621_101592159 | Ga0097621_1015921592 | 85 |
| 182 | 3300006353 | Ga0075370_10293515 | Ga0075370_102935152 | 85 |
| 183 | 3300006358 | Ga0068871_100428289 | Ga0068871_1004282892 | 85 |
| 184 | 3300006358 | Ga0068871_100984462 | Ga0068871_1009844623 | 85 |
| 185 | 3300006880 | Ga0075429_101605024 | Ga0075429_1016050242 | 85 |
| 186 | 3300006881 | Ga0068865_100173560 | Ga0068865_1001735603 | 85 |
| 187 | 3300006881 | Ga0068865_100236578 | Ga0068865_1002365783 | 85 |
| 188 | 3300006931 | Ga0097620_100737680 | Ga0097620_1007376802 | 85 |
| 189 | 3300009093 | Ga0105240_10020426 | Ga0105240_100204265 | 85 |
| 190 | 3300009093 | Ga0105240_10022197 | Ga0105240_100221973 | 85 |
| 191 | 3300009093 | Ga0105240_10027089 | Ga0105240_100270893 | 85 |
| 192 | 3300009093 | Ga0105240_10173560 | Ga0105240_101735603 | 85 |
| 193 | 3300009093 | Ga0105240_10355467 | Ga0105240_103554673 | 85 |
| 194 | 3300009093 | Ga0105240_10682076 | Ga0105240_106820762 | 85 |
| 195 | 3300009093 | Ga0105240_11144763 | Ga0105240_111447632 | 85 |
| 196 | 3300009093 | Ga0105240_11636357 | Ga0105240_116363572 | 85 |
| 197 | 3300009093 | Ga0105240_12717551 | Ga0105240_127175512 | 85 |
| 198 | 3300009094 | Ga0111539_10888675 | Ga0111539_108886752 | 85 |
| 199 | 3300009098 | Ga0105245_10006411 | Ga0105245_100064119 | 85 |
| 200 | 3300009101 | Ga0105247_10333254 | Ga0105247_103332542 | 85 |
| 201 | 3300009101 | Ga0105247_10735464 | Ga0105247_107354641 | 85 |
| 202 | 3300009174 | Ga0105241_10012157 | Ga0105241_100121572 | 85 |
| 203 | 3300009174 | Ga0105241_10027763 | Ga0105241_100277633 | 85 |
| 204 | 3300009174 | Ga0105241_10038341 | Ga0105241_100383413 | 85 |
| 205 | 3300009174 | Ga0105241_10598501 | Ga0105241_105985013 | 85 |
| 206 | 3300009174 | Ga0105241_11936616 | Ga0105241_119366162 | 85 |
| 207 | 3300009174 | Ga0105241_12031721 | Ga0105241_120317211 | 85 |
| 208 | 3300009176 | Ga0105242_10017569 | Ga0105242_100175694 | 85 |
| 209 | 3300009176 | Ga0105242_10635384 | Ga0105242_106353842 | 85 |
| 210 | 3300009176 | Ga0105242_10937666 | Ga0105242_109376663 | 85 |
| 211 | 3300009176 | Ga0105242_11444559 | Ga0105242_114445592 | 85 |
| 212 | 3300009177 | Ga0105248_10080635 | Ga0105248_100806355 | 85 |
| 213 | 3300009177 | Ga0105248_10085443 | Ga0105248_100854433 | 85 |
| 214 | 3300009177 | Ga0105248_10976933 | Ga0105248_109769333 | 85 |
| 215 | 3300009177 | Ga0105248_11784842 | Ga0105248_117848423 | 85 |
| 216 | 3300009545 | Ga0105237_10066984 | Ga0105237_100669844 | 85 |
| 217 | 3300009545 | Ga0105237_10097544 | Ga0105237_100975443 | 85 |
| 218 | 3300009545 | Ga0105237_10575949 | Ga0105237_105759493 | 85 |
| 219 | 3300009545 | Ga0105237_10789494 | Ga0105237_107894942 | 85 |
| 220 | 3300009545 | Ga0105237_11030562 | Ga0105237_110305623 | 85 |
| 221 | 3300009551 | Ga0105238_10030103 | Ga0105238_100301037 | 85 |
| 222 | 3300009551 | Ga0105238_10056714 | Ga0105238_100567144 | 85 |
| 223 | 3300009551 | Ga0105238_10165875 | Ga0105238_101658753 | 85 |
| 224 | 3300009551 | Ga0105238_10292394 | Ga0105238_102923943 | 85 |
| 225 | 3300009551 | Ga0105238_10461865 | Ga0105238_104618652 | 85 |
| 226 | 3300009551 | Ga0105238_10623108 | Ga0105238_106231082 | 85 |
| 227 | 3300009553 | Ga0105249_10034353 | Ga0105249_100343532 | 85 |
| 228 | 3300009553 | Ga0105249_10603195 | Ga0105249_106031953 | 85 |
| 229 | 3300009553 | Ga0105249_10800348 | Ga0105249_108003483 | 85 |
| 230 | 3300009553 | Ga0105249_11758797 | Ga0105249_117587972 | 85 |
| 231 | 3300009984 | Ga0105029_121233 | Ga0105029_1212331 | 85 |
| 232 | 3300010375 | Ga0105239_10138614 | Ga0105239_101386143 | 85 |
| 233 | 3300010375 | Ga0105239_10346115 | Ga0105239_103461153 | 85 |
| 234 | 3300010375 | Ga0105239_10464766 | Ga0105239_104647663 | 85 |
| 235 | 3300010375 | Ga0105239_11503569 | Ga0105239_115035692 | 85 |
| 236 | 3300011119 | Ga0105246_10045637 | Ga0105246_100456373 | 85 |
| 237 | 3300011119 | Ga0105246_10247119 | Ga0105246_102471193 | 85 |
| 238 | 3300013100 | Ga0157373_10880697 | Ga0157373_108806972 | 85 |
| 239 | 3300013102 | Ga0157371_11558776 | Ga0157371_115587762 | 85 |
| 240 | 3300013104 | Ga0157370_10017357 | Ga0157370_100173577 | 85 |
| 241 | 3300013104 | Ga0157370_10378103 | Ga0157370_103781033 | 85 |
| 242 | 3300013105 | Ga0157369_10086109 | Ga0157369_100861094 | 85 |
| 243 | 3300013105 | Ga0157369_12522948 | Ga0157369_125229482 | 85 |
| 244 | 3300013296 | Ga0157374_10007748 | Ga0157374_100077484 | 85 |
| 245 | 3300013296 | Ga0157374_10104852 | Ga0157374_101048525 | 85 |
| 246 | 3300013296 | Ga0157374_10204016 | Ga0157374_102040163 | 85 |
| 247 | 3300013296 | Ga0157374_10770833 | Ga0157374_107708332 | 85 |
| 248 | 3300013297 | Ga0157378_10045609 | Ga0157378_100456093 | 85 |
| 249 | 3300013297 | Ga0157378_10079286 | Ga0157378_100792863 | 85 |
| 250 | 3300013297 | Ga0157378_10288068 | Ga0157378_102880683 | 85 |
| 251 | 3300013306 | Ga0163162_10021649 | Ga0163162_100216493 | 85 |
| 252 | 3300013306 | Ga0163162_10226760 | Ga0163162_102267603 | 85 |
| 253 | 3300013306 | Ga0163162_12505640 | Ga0163162_125056402 | 85 |
| 254 | 3300013307 | Ga0157372_10051159 | Ga0157372_100511593 | 85 |
| 255 | 3300013307 | Ga0157372_10100764 | Ga0157372_101007644 | 85 |
| 256 | 3300013308 | Ga0157375_10420552 | Ga0157375_104205522 | 85 |
| 257 | 3300013308 | Ga0157375_11611667 | Ga0157375_116116672 | 85 |
| 258 | 3300014325 | Ga0163163_10701991 | Ga0163163_107019913 | 85 |
| 259 | 3300014325 | Ga0163163_13044929 | Ga0163163_130449292 | 85 |
| 260 | 3300014968 | Ga0157379_10349708 | Ga0157379_103497082 | 85 |
| 261 | 3300014968 | Ga0157379_11613423 | Ga0157379_116134232 | 85 |
| 262 | 3300014969 | Ga0157376_11127613 | Ga0157376_111276132 | 85 |
| 263 | 3300014969 | Ga0157376_11680520 | Ga0157376_116805202 | 85 |
| 264 | 3300014969 | Ga0157376_12375424 | Ga0157376_123754241 | 85 |
| 265 | 3300025321 | Ga0207656_10746750 | Ga0207656_107467501 | 85 |
| 266 | 3300025900 | Ga0207710_10268156 | Ga0207710_102681562 | 85 |
| 267 | 3300025903 | Ga0207680_10510499 | Ga0207680_105104992 | 85 |
| 268 | 3300025903 | Ga0207680_10575682 | Ga0207680_105756821 | 85 |
| 269 | 3300025903 | Ga0207680_10741393 | Ga0207680_107413932 | 85 |
| 270 | 3300025904 | Ga0207647_10245426 | Ga0207647_102454262 | 85 |
| 271 | 3300025907 | Ga0207645_10671479 | Ga0207645_106714792 | 85 |
| 272 | 3300025909 | Ga0207705_10011204 | Ga0207705_100112046 | 85 |
| 273 | 3300025909 | Ga0207705_10014846 | Ga0207705_100148467 | 85 |
| 274 | 3300025909 | Ga0207705_10379860 | Ga0207705_103798602 | 85 |
| 275 | 3300025909 | Ga0207705_10460770 | Ga0207705_104607703 | 85 |
| 276 | 3300025909 | Ga0207705_10518958 | Ga0207705_105189581 | 85 |
| 277 | 3300025909 | Ga0207705_11232334 | Ga0207705_112323342 | 85 |
| 278 | 3300025909 | Ga0207705_11475587 | Ga0207705_114755872 | 85 |
| 279 | 3300025911 | Ga0207654_10062683 | Ga0207654_100626832 | 85 |
| 280 | 3300025911 | Ga0207654_10120282 | Ga0207654_101202823 | 85 |
| 281 | 3300025911 | Ga0207654_10665831 | Ga0207654_106658312 | 85 |
| 282 | 3300025912 | Ga0207707_10218818 | Ga0207707_102188183 | 85 |
| 283 | 3300025912 | Ga0207707_10561573 | Ga0207707_105615732 | 85 |
| 284 | 3300025913 | Ga0207695_10005068 | Ga0207695_1000506810 | 85 |
| 285 | 3300025913 | Ga0207695_10053953 | Ga0207695_100539534 | 85 |
| 286 | 3300025913 | Ga0207695_10069109 | Ga0207695_100691093 | 85 |
| 287 | 3300025913 | Ga0207695_10248597 | Ga0207695_102485972 | 85 |
| 288 | 3300025913 | Ga0207695_10404824 | Ga0207695_104048243 | 85 |
| 289 | 3300025913 | Ga0207695_10642287 | Ga0207695_106422872 | 85 |
| 290 | 3300025913 | Ga0207695_11567841 | Ga0207695_115678412 | 85 |
| 291 | 3300025914 | Ga0207671_10133411 | Ga0207671_101334114 | 85 |
| 292 | 3300025914 | Ga0207671_10345845 | Ga0207671_103458452 | 85 |
| 293 | 3300025914 | Ga0207671_10512537 | Ga0207671_105125372 | 85 |
| 294 | 3300025914 | Ga0207671_10526506 | Ga0207671_105265063 | 85 |
| 295 | 3300025915 | Ga0207693_10655188 | Ga0207693_106551882 | 85 |
| 296 | 3300025917 | Ga0207660_10112270 | Ga0207660_101122703 | 85 |
| 297 | 3300025917 | Ga0207660_10275511 | Ga0207660_102755112 | 85 |
| 298 | 3300025917 | Ga0207660_10353014 | Ga0207660_103530141 | 85 |
| 299 | 3300025917 | Ga0207660_11154599 | Ga0207660_111545992 | 85 |
| 300 | 3300025919 | Ga0207657_10003976 | Ga0207657_100039766 | 85 |
| 301 | 3300025919 | Ga0207657_10022961 | Ga0207657_100229617 | 85 |
| 302 | 3300025919 | Ga0207657_10302214 | Ga0207657_103022143 | 85 |
| 303 | 3300025920 | Ga0207649_10079732 | Ga0207649_100797323 | 85 |
| 304 | 3300025920 | Ga0207649_10181066 | Ga0207649_101810662 | 85 |
| 305 | 3300025920 | Ga0207649_11575989 | Ga0207649_115759892 | 85 |
| 306 | 3300025921 | Ga0207652_10065966 | Ga0207652_100659663 | 85 |
| 307 | 3300025921 | Ga0207652_10073311 | Ga0207652_100733113 | 85 |
| 308 | 3300025921 | Ga0207652_10274157 | Ga0207652_102741572 | 85 |
| 309 | 3300025921 | Ga0207652_10327649 | Ga0207652_103276493 | 85 |
| 310 | 3300025924 | Ga0207694_10030274 | Ga0207694_100302747 | 85 |
| 311 | 3300025924 | Ga0207694_10034379 | Ga0207694_100343793 | 85 |
| 312 | 3300025924 | Ga0207694_10320774 | Ga0207694_103207743 | 85 |
| 313 | 3300025924 | Ga0207694_11036567 | Ga0207694_110365672 | 85 |
| 314 | 3300025925 | Ga0207650_10254409 | Ga0207650_102544092 | 85 |
| 315 | 3300025925 | Ga0207650_10466932 | Ga0207650_104669323 | 85 |
| 316 | 3300025927 | Ga0207687_10232982 | Ga0207687_102329823 | 85 |
| 317 | 3300025927 | Ga0207687_11339678 | Ga0207687_113396782 | 85 |
| 318 | 3300025929 | Ga0207664_11955335 | Ga0207664_119553352 | 85 |
| 319 | 3300025931 | Ga0207644_10568380 | Ga0207644_105683802 | 85 |
| 320 | 3300025931 | Ga0207644_10899564 | Ga0207644_108995641 | 85 |
| 321 | 3300025933 | Ga0207706_10201290 | Ga0207706_102012903 | 85 |
| 322 | 3300025933 | Ga0207706_10477081 | Ga0207706_104770813 | 85 |
| 323 | 3300025934 | Ga0207686_10015197 | Ga0207686_100151973 | 85 |
| 324 | 3300025934 | Ga0207686_10226218 | Ga0207686_102262183 | 85 |
| 325 | 3300025934 | Ga0207686_11521884 | Ga0207686_115218842 | 85 |
| 326 | 3300025934 | Ga0207686_11683192 | Ga0207686_116831922 | 85 |
| 327 | 3300025937 | Ga0207669_11301755 | Ga0207669_113017552 | 85 |
| 328 | 3300025938 | Ga0207704_10153680 | Ga0207704_101536802 | 85 |
| 329 | 3300025938 | Ga0207704_10198599 | Ga0207704_101985993 | 85 |
| 330 | 3300025939 | Ga0207665_10105297 | Ga0207665_101052973 | 85 |
| 331 | 3300025940 | Ga0207691_11674814 | Ga0207691_116748142 | 85 |
| 332 | 3300025941 | Ga0207711_10029833 | Ga0207711_100298337 | 85 |
| 333 | 3300025941 | Ga0207711_10221420 | Ga0207711_102214204 | 85 |
| 334 | 3300025941 | Ga0207711_10666514 | Ga0207711_106665143 | 85 |
| 335 | 3300025942 | Ga0207689_10062635 | Ga0207689_100626353 | 85 |
| 336 | 3300025942 | Ga0207689_10064251 | Ga0207689_100642513 | 85 |
| 337 | 3300025944 | Ga0207661_10112973 | Ga0207661_101129733 | 85 |
| 338 | 3300025944 | Ga0207661_10287893 | Ga0207661_102878932 | 85 |
| 339 | 3300025945 | Ga0207679_10426687 | Ga0207679_104266872 | 85 |
| 340 | 3300025949 | Ga0207667_10006875 | Ga0207667_100068757 | 85 |
| 341 | 3300025949 | Ga0207667_11618516 | Ga0207667_116185162 | 85 |
| 342 | 3300025961 | Ga0207712_11057512 | Ga0207712_110575122 | 85 |
| 343 | 3300025981 | Ga0207640_10262359 | Ga0207640_102623592 | 85 |
| 344 | 3300025986 | Ga0207658_10379976 | Ga0207658_103799762 | 85 |
| 345 | 3300025986 | Ga0207658_12084861 | Ga0207658_120848612 | 85 |
| 346 | 3300025986 | Ga0207658_12172721 | Ga0207658_121727212 | 85 |
| 347 | 3300026023 | Ga0207677_10063109 | Ga0207677_100631093 | 85 |
| 348 | 3300026023 | Ga0207677_10268905 | Ga0207677_102689053 | 85 |
| 349 | 3300026023 | Ga0207677_10543356 | Ga0207677_105433561 | 85 |
| 350 | 3300026023 | Ga0207677_10700317 | Ga0207677_107003172 | 85 |
| 351 | 3300026035 | Ga0207703_10926979 | Ga0207703_109269792 | 85 |
| 352 | 3300026035 | Ga0207703_11516497 | Ga0207703_115164972 | 85 |
| 353 | 3300026035 | Ga0207703_11752130 | Ga0207703_117521302 | 85 |
| 354 | 3300026041 | Ga0207639_10071232 | Ga0207639_100712323 | 85 |
| 355 | 3300026041 | Ga0207639_11624439 | Ga0207639_116244392 | 85 |
| 356 | 3300026078 | Ga0207702_10011606 | Ga0207702_100116062 | 85 |
| 357 | 3300026078 | Ga0207702_10061064 | Ga0207702_100610642 | 85 |
| 358 | 3300026078 | Ga0207702_10313340 | Ga0207702_103133403 | 85 |
| 359 | 3300026078 | Ga0207702_11311975 | Ga0207702_113119753 | 85 |
| 360 | 3300026088 | Ga0207641_10743950 | Ga0207641_107439501 | 85 |
| 361 | 3300026088 | Ga0207641_10838505 | Ga0207641_108385052 | 85 |
| 362 | 3300026089 | Ga0207648_10673513 | Ga0207648_106735132 | 85 |
| 363 | 3300026089 | Ga0207648_11964412 | Ga0207648_119644122 | 85 |
| 364 | 3300026095 | Ga0207676_10800802 | Ga0207676_108008022 | 85 |
| 365 | 3300026095 | Ga0207676_11672544 | Ga0207676_116725442 | 85 |
| 366 | 3300026118 | Ga0207675_100528643 | Ga0207675_1005286433 | 85 |
| 367 | 3300026118 | Ga0207675_100724078 | Ga0207675_1007240782 | 85 |
| 368 | 3300026121 | Ga0207683_10029354 | Ga0207683_100293544 | 85 |
| 369 | 3300026121 | Ga0207683_10128529 | Ga0207683_101285293 | 85 |
| 370 | 3300026142 | Ga0207698_10143101 | Ga0207698_101431013 | 85 |
| 371 | 3300026142 | Ga0207698_10582236 | Ga0207698_105822362 | 85 |
| 372 | 3300027617 | Ga0210002_1023723 | Ga0210002_10237232 | 85 |
| 373 | 3300027682 | Ga0209971_1038461 | Ga0209971_10384612 | 85 |
| 374 | 3300027876 | Ga0209974_10176473 | Ga0209974_101764732 | 85 |
| 375 | 3300028379 | Ga0268266_10066516 | Ga0268266_100665165 | 85 |
| 376 | 3300028379 | Ga0268266_10118596 | Ga0268266_101185963 | 85 |
| 377 | 3300028379 | Ga0268266_10131310 | Ga0268266_101313103 | 85 |
| 378 | 3300028379 | Ga0268266_10135479 | Ga0268266_101354794 | 85 |
| 379 | 3300028379 | Ga0268266_10347409 | Ga0268266_103474093 | 85 |
| 380 | 3300028379 | Ga0268266_10551151 | Ga0268266_105511512 | 85 |
| 381 | 3300028380 | Ga0268265_12074366 | Ga0268265_120743662 | 85 |
| 382 | 3300028381 | Ga0268264_10048640 | Ga0268264_100486404 | 85 |
| 383 | 3300028381 | Ga0268264_10283735 | Ga0268264_102837353 | 85 |
| 384 | 3300031548 | Ga0307408_100035242 | Ga0307408_1000352423 | 85 |
| 385 | 3300031548 | Ga0307408_100105857 | Ga0307408_1001058572 | 85 |
| 386 | 3300031731 | Ga0307405_10545051 | Ga0307405_105450513 | 85 |
| 387 | 3300031824 | Ga0307413_10089355 | Ga0307413_100893552 | 85 |
| 388 | 3300031824 | Ga0307413_11508145 | Ga0307413_115081452 | 85 |
| 389 | 3300031852 | Ga0307410_10053704 | Ga0307410_100537043 | 85 |
| 390 | 3300031852 | Ga0307410_10073014 | Ga0307410_100730143 | 85 |
| 391 | 3300031852 | Ga0307410_11011308 | Ga0307410_110113081 | 85 |
| 392 | 3300031901 | Ga0307406_10151165 | Ga0307406_101511653 | 85 |
| 393 | 3300031901 | Ga0307406_10276666 | Ga0307406_102766662 | 85 |
| 394 | 3300031901 | Ga0307406_11322488 | Ga0307406_113224882 | 85 |
| 395 | 3300031903 | Ga0307407_10078127 | Ga0307407_100781273 | 85 |
| 396 | 3300031903 | Ga0307407_10175649 | Ga0307407_101756492 | 85 |
| 397 | 3300031911 | Ga0307412_10103127 | Ga0307412_101031274 | 85 |
| 398 | 3300031911 | Ga0307412_10426248 | Ga0307412_104262483 | 85 |
| 399 | 3300031995 | Ga0307409_100032336 | Ga0307409_1000323363 | 85 |
| 400 | 3300031995 | Ga0307409_101264665 | Ga0307409_1012646651 | 85 |
| 401 | 3300031995 | Ga0307409_102601389 | Ga0307409_1026013892 | 85 |
| 402 | 3300032002 | Ga0307416_100069826 | Ga0307416_1000698262 | 85 |
| 403 | 3300032002 | Ga0307416_100211933 | Ga0307416_1002119333 | 85 |
| 404 | 3300032002 | Ga0307416_100327542 | Ga0307416_1003275423 | 85 |
| 405 | 3300032002 | Ga0307416_100416907 | Ga0307416_1004169072 | 85 |
| 406 | 3300032002 | Ga0307416_101290997 | Ga0307416_1012909972 | 85 |
| 407 | 3300032004 | Ga0307414_10082808 | Ga0307414_100828082 | 85 |
| 408 | 3300032005 | Ga0307411_10010772 | Ga0307411_100107722 | 85 |
| 409 | 3300032005 | Ga0307411_10136484 | Ga0307411_101364843 | 85 |
| 410 | 3300032005 | Ga0307411_10245120 | Ga0307411_102451202 | 85 |
| 411 | 3300032126 | Ga0307415_100090510 | Ga0307415_1000905103 | 85 |
| 412 | 3300032126 | Ga0307415_100631337 | Ga0307415_1006313372 | 85 |
| 413 | 3300033180 | Ga0307510_10136350 | Ga0307510_101363504 | 85 |
| 414 | 3300035086 | Ga0373934_0011032 | Ga0373934_0011032_2665_2922 | 85 |
| 415 | 3300035111 | Ga0373923_0122549 | Ga0373923_0122549_555_812 | 85 |
| 416 | 3300035112 | Ga0373932_0121324 | Ga0373932_0121324_562_819 | 85 |
| 417 | 3300035114 | Ga0373939_0304031 | Ga0373939_0304031_15_272 | 85 |
| 418 | 3300035117 | Ga0373953_0001379 | Ga0373953_0001379_5282_5539 | 85 |
| 419 | 3300035118 | Ga0373954_0000313 | Ga0373954_0000313_12066_12323 | 85 |
| 420 | 3300035120 | Ga0373957_0002825 | Ga0373957_0002825_1247_1504 | 85 |
| 421 | 3300035172 | Ga0373955_0000495 | Ga0373955_0000495_10800_11057 | 85 |
| 422 | 3300035724 | Ga0373933_0003323 | Ga0373933_0003323_550_807 | 85 |
| 423 | 3300036401 | Ga0373937_0001044 | Ga0373937_0001044_12364_12621 | 85 |
| 424 | 3300037312 | Ga0395899_0002950 | Ga0395899_0002950_1792_2049 | 85 |
| 425 | 3300037418 | Ga0395900_0100094 | Ga0395900_0100094_703_960 | 85 |
| 426 | 3300037466 | Ga0395898_0054854 | Ga0395898_0054854_1146_1403 | 85 |
| 427 | 3300038443 | Ga0395901_0004332 | Ga0395901_0004332_186_443 | 85 |
| 428 | 3300038443 | Ga0395901_0213460 | Ga0395901_0213460_748_1005 | 85 |
| 429 | 3300038443 | Ga0395901_1592169 | Ga0395901_1592169_181_438 | 85 |
| 430 | 3300041406 | Ga0439439_0065005 | Ga0439439_0065005_228_488 | 85 |
| 431 | 3300041410 | Ga0439461_0065414 | Ga0439461_0065414_359_619 | 85 |
| 432 | 3300041458 | Ga0451798_0756100 | Ga0451798_0756100_21_278 | 85 |
| 433 | 3300041997 | Ga0439431_0106524 | Ga0439431_0106524_412_672 | 85 |
| 434 | 3300041999 | Ga0439433_0017664 | Ga0439433_0017664_1061_1321 | 85 |
| 435 | 3300042001 | Ga0439441_016970 | Ga0439441_016970_275_535 | 85 |
| 436 | 3300042002 | Ga0439442_050322 | Ga0439442_050322_144_404 | 85 |
| 437 | 3300042003 | Ga0439443_006736 | Ga0439443_006736_99_359 | 85 |
| 438 | 3300042124 | Ga0450922_041753 | Ga0450922_041753_58_318 | 85 |
| 439 | 3300042125 | Ga0450923_007548 | Ga0450923_007548_654_914 | 85 |
| 440 | 3300042132 | Ga0450895_007079 | Ga0450895_007079_129_389 | 85 |
| 441 | 3300042133 | Ga0450896_004133 | Ga0450896_004133_1040_1300 | 85 |
| 442 | 3300042156 | Ga0439446_0058145 | Ga0439446_0058145_267_527 | 85 |
| 443 | 3300042435 | Ga0439434_0019414 | Ga0439434_0019414_1037_1297 | 85 |
| 444 | 3300042435 | Ga0439434_0023489 | Ga0439434_0023489_157_417 | 85 |
| 445 | 3300042436 | Ga0439435_0001054 | Ga0439435_0001054_516_776 | 85 |
| 446 | 3300042437 | Ga0439444_0024881 | Ga0439444_0024881_722_982 | 85 |
| 447 | 3300042461 | Ga0439460_0077928 | Ga0439460_0077928_359_619 | 85 |
| 448 | 3300042993 | Ga0439440_0110970 | Ga0439440_0110970_390_650 | 85 |
| 449 | 3300044842 | Ga0466957_0318426 | Ga0466957_0318426_540_797 | 85 |
| 450 | 3300044901 | Ga0466960_0742290 | Ga0466960_0742290_303_560 | 85 |
| 451 | 3300046452 | Ga0495617_172051 | Ga0495617_172051_14_271 | 85 |
| 452 | 3300046454 | Ga0495592_0005825 | Ga0495592_0005825_4948_5205 | 85 |
| 453 | 3300046459 | Ga0495629_0100613 | Ga0495629_0100613_605_862 | 85 |
| 454 | 3300046462 | Ga0495651_0001257 | Ga0495651_0001257_12131_12388 | 85 |
| 455 | 3300046463 | Ga0495653_0000881 | Ga0495653_0000881_12081_12338 | 85 |
| 456 | 3300046492 | Ga0495585_0287373 | Ga0495585_0287373_113_373 | 85 |
| 457 | 3300046511 | Ga0495608_0000687 | Ga0495608_0000687_11030_11287 | 85 |
| 458 | 3300046514 | Ga0495618_0382736 | Ga0495618_0382736_11_298 | 85 |
| 459 | 3300046516 | Ga0495628_0107721 | Ga0495628_0107721_417_674 | 85 |
| 460 | 3300046519 | Ga0495632_0113801 | Ga0495632_0113801_89_355 | 85 |
| 461 | 3300046524 | Ga0495648_0436445 | Ga0495648_0436445_236_496 | 85 |
| 462 | 3300046529 | Ga0495652_0004854 | Ga0495652_0004854_428_685 | 85 |
| 463 | 3300046533 | Ga0495640_0180023 | Ga0495640_0180023_682_939 | 85 |
| 464 | 3300046536 | Ga0495587_0000799 | Ga0495587_0000799_9151_9408 | 85 |
| 465 | 3300046543 | Ga0495645_0123207 | Ga0495645_0123207_835_1092 | 85 |
| 466 | 3300046559 | Ga0495667_0001241 | Ga0495667_0001241_7253_7510 | 85 |
| 467 | 3300046615 | Ga0495656_0253082 | Ga0495656_0253082_372_629 | 85 |
| 468 | 3300046642 | Ga0495634_0059065 | Ga0495634_0059065_1273_1530 | 85 |
| 469 | 3300046663 | Ga0495635_0001738 | Ga0495635_0001738_7557_7814 | 85 |
| 470 | 3300046665 | Ga0495661_0214614 | Ga0495661_0214614_191_451 | 85 |
| 471 | 3300046675 | Ga0495657_0001772 | Ga0495657_0001772_10805_11062 | 85 |
| 472 | 3300046678 | Ga0495599_0000559 | Ga0495599_0000559_12292_12549 | 85 |
| 473 | 3300046679 | Ga0495623_0021090 | Ga0495623_0021090_3661_3918 | 85 |
| 474 | 3300046680 | Ga0495646_0100308 | Ga0495646_0100308_639_896 | 85 |
| 475 | 3300046689 | Ga0495613_0677674 | Ga0495613_0677674_43_330 | 85 |
| 476 | 3300046692 | Ga0495671_0024903 | Ga0495671_0024903_908_1168 | 85 |
| 477 | 3300046809 | Ga0495600_0000253 | Ga0495600_0000253_16817_17074 | 85 |
| 478 | 3300047317 | Ga0495604_0001029 | Ga0495604_0001029_12236_12493 | 85 |
| 479 | 3300047319 | Ga0495674_0028383 | Ga0495674_0028383_3310_3567 | 85 |
| 480 | 3300047322 | Ga0495680_0001875 | Ga0495680_0001875_17004_17261 | 85 |
| 481 | 3300047444 | Ga0495675_0000610 | Ga0495675_0000610_12010_12267 | 85 |
| 482 | 3300047471 | Ga0495684_0001161 | Ga0495684_0001161_12121_12378 | 85 |
| 483 | 3300047673 | Ga0495593_0005318 | Ga0495593_0005318_7257_7544 | 85 |
| 484 | 3300048088 | Ga0495602_0009531 | Ga0495602_0009531_9279_9536 | 85 |
| 485 | 3300048907 | Ga0496104_0014095 | Ga0496104_0014095_3114_3371 | 85 |
| 486 | 3300048908 | Ga0496105_0193278 | Ga0496105_0193278_1178_1435 | 85 |
| 487 | 3300048913 | Ga0496110_0583995 | Ga0496110_0583995_377_634 | 85 |
| 488 | 3300048914 | Ga0496111_0212404 | Ga0496111_0212404_659_916 | 85 |
| 489 | 3300049460 | Ga0495682_0288058 | Ga0495682_0288058_279_539 | 85 |
| 490 | 3300049568 | Ga0501031_0318872 | Ga0501031_0318872_22_282 | 85 |
| 491 | 3300049568 | Ga0501031_0645411 | Ga0501031_0645411_157_417 | 85 |
| 492 | 3300049568 | Ga0501031_1108401 | Ga0501031_1108401_201_461 | 85 |
| 493 | 3300049569 | Ga0501032_0135183 | Ga0501032_0135183_1238_1498 | 85 |
| 494 | 3300049569 | Ga0501032_0779513 | Ga0501032_0779513_59_319 | 85 |
| 495 | 3300049571 | Ga0501034_0021435 | Ga0501034_0021435_4469_4729 | 85 |
| 496 | 3300049571 | Ga0501034_0027030 | Ga0501034_0027030_5114_5374 | 85 |
| 497 | 3300049571 | Ga0501034_0355484 | Ga0501034_0355484_600_857 | 85 |
| 498 | 3300049572 | Ga0501036_0024356 | Ga0501036_0024356_1689_1949 | 85 |
| 499 | 3300049572 | Ga0501036_0668607 | Ga0501036_0668607_330_587 | 85 |
| 500 | 3300049573 | Ga0501037_0116032 | Ga0501037_0116032_291_551 | 85 |
| 501 | 3300049576 | Ga0501040_0076541 | Ga0501040_0076541_1479_1739 | 85 |
| 502 | 3300049576 | Ga0501040_0129578 | Ga0501040_0129578_515_772 | 85 |
| 503 | 3300049578 | Ga0501042_0171797 | Ga0501042_0171797_1234_1494 | 85 |
| 504 | 3300049579 | Ga0501043_1147235 | Ga0501043_1147235_85_345 | 85 |
| 505 | 3300049580 | Ga0501046_0163883 | Ga0501046_0163883_169_426 | 85 |
| 506 | 3300049580 | Ga0501046_0235713 | Ga0501046_0235713_418_678 | 85 |
| 507 | 3300049580 | Ga0501046_0970177 | Ga0501046_0970177_210_467 | 85 |
| 508 | 3300049581 | Ga0501047_0008106 | Ga0501047_0008106_2550_2810 | 85 |
| 509 | 3300049581 | Ga0501047_0023931 | Ga0501047_0023931_4574_4834 | 85 |
| 510 | 3300049581 | Ga0501047_0082177 | Ga0501047_0082177_1695_1958 | 85 |
| 511 | 3300049581 | Ga0501047_0705539 | Ga0501047_0705539_265_525 | 85 |
| 512 | 3300049581 | Ga0501047_0974235 | Ga0501047_0974235_214_474 | 85 |
| 513 | 3300049582 | Ga0501048_0227897 | Ga0501048_0227897_999_1259 | 85 |
| 514 | 3300049582 | Ga0501048_0238380 | Ga0501048_0238380_778_1035 | 85 |
| 515 | 3300049583 | Ga0501067_0004604 | Ga0501067_0004604_5241_5501 | 85 |
| 516 | 3300049585 | Ga0501069_0029067 | Ga0501069_0029067_192_452 | 85 |
| 517 | 3300049586 | Ga0501070_0025565 | Ga0501070_0025565_4168_4428 | 85 |
| 518 | 3300049586 | Ga0501070_0395470 | Ga0501070_0395470_457_717 | 85 |
| 519 | 3300049587 | Ga0501071_0119043 | Ga0501071_0119043_812_1072 | 85 |
| 520 | 3300049588 | Ga0501072_1453544 | Ga0501072_1453544_162_419 | 85 |
| 521 | 3300049589 | Ga0501073_0009593 | Ga0501073_0009593_887_1147 | 85 |
| 522 | 3300049589 | Ga0501073_0458538 | Ga0501073_0458538_477_737 | 85 |
| 523 | 3300049589 | Ga0501073_1118494 | Ga0501073_1118494_97_354 | 85 |
| 524 | 3300049590 | Ga0501074_0007311 | Ga0501074_0007311_1793_2053 | 85 |
| 525 | 3300049591 | Ga0501075_0456132 | Ga0501075_0456132_669_926 | 85 |
| 526 | 3300049592 | Ga0501076_0462194 | Ga0501076_0462194_117_374 | 85 |
| 527 | 3300049592 | Ga0501076_0891341 | Ga0501076_0891341_375_632 | 85 |
| 528 | 3300049593 | Ga0501077_0331648 | Ga0501077_0331648_499_759 | 85 |
| 529 | 3300049593 | Ga0501077_0711360 | Ga0501077_0711360_206_463 | 85 |
| 530 | 3300049686 | Ga0501257_028296 | Ga0501257_028296_545_802 | 85 |
| 531 | 3300049688 | Ga0501259_046328 | Ga0501259_046328_347_604 | 85 |
| 532 | 3300049705 | Ga0501225_0118543 | Ga0501225_0118543_20_277 | 85 |
| 533 | 3300049741 | Ga0501079_0006178 | Ga0501079_0006178_5838_6098 | 85 |
| 534 | 3300049741 | Ga0501079_0217344 | Ga0501079_0217344_179_439 | 85 |
| 535 | 3300049742 | Ga0501080_0017691 | Ga0501080_0017691_6120_6380 | 85 |
| 536 | 3300049742 | Ga0501080_0383668 | Ga0501080_0383668_798_1058 | 85 |
| 537 | 3300049742 | Ga0501080_1167768 | Ga0501080_1167768_169_429 | 85 |
| 538 | 3300049743 | Ga0501081_0046548 | Ga0501081_0046548_1687_1947 | 85 |
| 539 | 3300049743 | Ga0501081_0370996 | Ga0501081_0370996_684_941 | 85 |
| 540 | 3300049743 | Ga0501081_1273014 | Ga0501081_1273014_103_360 | 85 |
| 541 | 3300049822 | Ga0501035_0000282 | Ga0501035_0000282_4754_5014 | 85 |
| 542 | 3300049822 | Ga0501035_0006294 | Ga0501035_0006294_2935_3195 | 85 |
| 543 | 3300049822 | Ga0501035_0006746 | Ga0501035_0006746_9960_10220 | 85 |
| 544 | 3300049823 | Ga0501044_0011806 | Ga0501044_0011806_7104_7364 | 85 |
| 545 | 3300049824 | Ga0501045_0659797 | Ga0501045_0659797_389_646 | 85 |
| 546 | 3300050489 | nmdc:mga03683_352107_c1 | nmdc:mga03683_352107_c1_74_331 | 85 |
| 547 | 3300050511 | nmdc:mga08y16_1371723_c1 | nmdc:mga08y16_1371723_c1_369_629 | 85 |
| 548 | 3300053077 | Ga0495601_0084566 | Ga0495601_0084566_1583_1870 | 85 |
| 549 | 3300053084 | Ga0495595_0001458 | Ga0495595_0001458_550_807 | 85 |
| 550 | 3300053085 | Ga0495619_0000685 | Ga0495619_0000685_17020_17277 | 85 |
| 551 | 3300053092 | Ga0500583_0161346 | Ga0500583_0161346_560_826 | 85 |
| 552 | 3300053092 | Ga0500583_0287338 | Ga0500583_0287338_200_466 | 85 |
| 553 | 3300053108 | Ga0500562_172481 | Ga0500562_172481_143_409 | 85 |
| 554 | 3300053119 | Ga0500595_001067 | Ga0500595_001067_10731_10997 | 85 |
| 555 | 3300053134 | Ga0500658_0109577 | Ga0500658_0109577_114_380 | 85 |
| 556 | 3300053727 | Ga0500611_161832 | Ga0500611_161832_330_596 | 85 |
| 557 | 3300054114 | Ga0501084_1041794 | Ga0501084_1041794_239_496 | 85 |
| 558 | 3300059421 | Ga0590071_008554 | Ga0590071_008554_1723_1980 | 85 |
| 559 | 3300059423 | Ga0590074_024903 | Ga0590074_024903_340_597 | 85 |
| 560 | 3300059424 | Ga0590075_004438 | Ga0590075_004438_1442_1699 | 85 |
| 561 | 3300059426 | Ga0590077_046200 | Ga0590077_046200_53_310 | 85 |
| 562 | 3300060353 | Ga0501082_0147165 | Ga0501082_0147165_898_1158 | 85 |
| 563 | 3300060353 | Ga0501082_0161541 | Ga0501082_0161541_74_331 | 85 |
| 564 | 3300060353 | Ga0501082_0486732 | Ga0501082_0486732_781_1041 | 85 |
| 565 | 3300060353 | Ga0501082_0685151 | Ga0501082_0685151_321_578 | 85 |
| 566 | 3300061734 | Ga0530510_0718054 | Ga0530510_0718054_91_348 | 85 |
| 567 | 3300061734 | Ga0530510_1595916 | Ga0530510_1595916_134_394 | 85 |
| 568 | 3300003316 | rootH1_10118784 | rootH1_101187842 | 86 |
| 569 | 3300003320 | rootH2_10030263 | rootH2_100302638 | 86 |
| 570 | 3300003320 | rootH2_10131974 | rootH2_101319741 | 86 |
| 571 | 3300003320 | rootH2_10320555 | rootH2_103205553 | 86 |
| 572 | 3300003322 | rootL2_10180144 | rootL2_101801443 | 86 |
| 573 | 3300003322 | rootL2_10211209 | rootL2_102112092 | 86 |
| 574 | 3300003323 | rootH1_10052430 | rootH1_100524302 | 86 |
| 575 | 3300003323 | rootH1_10225615 | rootH1_102256152 | 86 |
| 576 | 3300005337 | Ga0070682_100001461 | Ga0070682_1000014617 | 86 |
| 577 | 3300005339 | Ga0070660_101393993 | Ga0070660_1013939931 | 86 |
| 578 | 3300005345 | Ga0070692_10246111 | Ga0070692_102461112 | 86 |
| 579 | 3300005440 | Ga0070705_101908757 | Ga0070705_1019087571 | 86 |
| 580 | 3300005457 | Ga0070662_100004066 | Ga0070662_1000040666 | 86 |
| 581 | 3300005544 | Ga0070686_101371161 | Ga0070686_1013711612 | 86 |
| 582 | 3300005840 | Ga0068870_10008064 | Ga0068870_100080645 | 86 |
| 583 | 3300005844 | Ga0068862_100033951 | Ga0068862_1000339516 | 86 |
| 584 | 3300005937 | Ga0081455_10257287 | Ga0081455_102572872 | 86 |
| 585 | 3300006844 | Ga0075428_100007347 | Ga0075428_1000073476 | 86 |
| 586 | 3300006846 | Ga0075430_100117524 | Ga0075430_1001175243 | 86 |
| 587 | 3300006880 | Ga0075429_100035604 | Ga0075429_1000356044 | 86 |
| 588 | 3300009094 | Ga0111539_10013189 | Ga0111539_100131896 | 86 |
| 589 | 3300025297 | Ga0209758_1000028 | Ga0209758_1000028230 | 86 |
| 590 | 3300025297 | Ga0209758_1131233 | Ga0209758_11312332 | 86 |
| 591 | 3300025298 | Ga0209050_1002767 | Ga0209050_100276714 | 86 |
| 592 | 3300025302 | Ga0207426_1086508 | Ga0207426_10865082 | 86 |
| 593 | 3300025303 | Ga0209051_1025241 | Ga0209051_10252414 | 86 |
| 594 | 3300025304 | Ga0209257_1000574 | Ga0209257_100057419 | 86 |
| 595 | 3300025908 | Ga0207643_10011617 | Ga0207643_100116175 | 86 |
| 596 | 3300025919 | Ga0207657_11488404 | Ga0207657_114884041 | 86 |
| 597 | 3300025929 | Ga0207664_10000078 | Ga0207664_100000785 | 86 |
| 598 | 3300025933 | Ga0207706_10062067 | Ga0207706_100620674 | 86 |
| 599 | 3300026023 | Ga0207677_10000004 | Ga0207677_1000000481 | 86 |
| 600 | 3300027907 | Ga0207428_10158239 | Ga0207428_101582393 | 86 |
| 601 | 3300028380 | Ga0268265_10002160 | Ga0268265_1000216015 | 86 |
| 602 | 3300031548 | Ga0307408_100129213 | Ga0307408_1001292132 | 86 |
| 603 | 3300031548 | Ga0307408_100310301 | Ga0307408_1003103013 | 86 |
| 604 | 3300031548 | Ga0307408_100925653 | Ga0307408_1009256533 | 86 |
| 605 | 3300031901 | Ga0307406_11540489 | Ga0307406_115404892 | 86 |
| 606 | 3300032004 | Ga0307414_10025995 | Ga0307414_100259955 | 86 |
| 607 | 3300032005 | Ga0307411_10013670 | Ga0307411_100136708 | 86 |
| 608 | 3300032126 | Ga0307415_101514866 | Ga0307415_1015148662 | 86 |
| 609 | 3300032126 | Ga0307415_102298409 | Ga0307415_1022984092 | 86 |
| 610 | 3300033180 | Ga0307510_10269164 | Ga0307510_102691643 | 86 |
| 611 | 3300037312 | Ga0395899_0643597 | Ga0395899_0643597_360_620 | 86 |
| 612 | 3300037466 | Ga0395898_0028340 | Ga0395898_0028340_350_610 | 86 |
| 613 | 3300037471 | Ga0395905_0552121 | Ga0395905_0552121_285_545 | 86 |
| 614 | 3300038443 | Ga0395901_0002816 | Ga0395901_0002816_16998_17258 | 86 |
| 615 | 3300041410 | Ga0439461_0079844 | Ga0439461_0079844_182_442 | 86 |
| 616 | 3300041441 | Ga0451787_178779 | Ga0451787_178779_73_339 | 86 |
| 617 | 3300041452 | Ga0451793_0317576 | Ga0451793_0317576_322_588 | 86 |
| 618 | 3300041512 | Ga0451853_2821110 | Ga0451853_2821110_360_620 | 86 |
| 619 | 3300042115 | Ga0450911_036276 | Ga0450911_036276_133_393 | 86 |
| 620 | 3300044901 | Ga0466960_0532951 | Ga0466960_0532951_366_626 | 86 |
| 621 | 3300046460 | Ga0495638_0162233 | Ga0495638_0162233_456_716 | 86 |
| 622 | 3300048927 | Ga0496124_0076789 | Ga0496124_0076789_1125_1391 | 86 |
| 623 | 3300049517 | Ga0501294_001163 | Ga0501294_001163_1922_2182 | 86 |
| 624 | 3300049517 | Ga0501294_007365 | Ga0501294_007365_336_596 | 86 |
| 625 | 3300049519 | Ga0501296_058241 | Ga0501296_058241_225_485 | 86 |
| 626 | 3300049520 | Ga0501297_013151 | Ga0501297_013151_134_394 | 86 |
| 627 | 3300049520 | Ga0501297_067949 | Ga0501297_067949_244_504 | 86 |
| 628 | 3300049521 | Ga0501298_019896 | Ga0501298_019896_786_1046 | 86 |
| 629 | 3300049521 | Ga0501298_037230 | Ga0501298_037230_462_722 | 86 |
| 630 | 3300049523 | Ga0501300_001721 | Ga0501300_001721_1797_2057 | 86 |
| 631 | 3300049525 | Ga0501302_017427 | Ga0501302_017427_203_463 | 86 |
| 632 | 3300049526 | Ga0501303_008507 | Ga0501303_008507_408_668 | 86 |
| 633 | 3300049531 | Ga0501315_024542 | Ga0501315_024542_474_734 | 86 |
| 634 | 3300049569 | Ga0501032_0006405 | Ga0501032_0006405_847_1110 | 86 |
| 635 | 3300049569 | Ga0501032_0126398 | Ga0501032_0126398_126_386 | 86 |
| 636 | 3300049571 | Ga0501034_0000135 | Ga0501034_0000135_24274_24537 | 86 |
| 637 | 3300049571 | Ga0501034_0107456 | Ga0501034_0107456_2122_2382 | 86 |
| 638 | 3300049571 | Ga0501034_0862247 | Ga0501034_0862247_180_443 | 86 |
| 639 | 3300049571 | Ga0501034_1389820 | Ga0501034_1389820_92_352 | 86 |
| 640 | 3300049572 | Ga0501036_0005221 | Ga0501036_0005221_5152_5415 | 86 |
| 641 | 3300049573 | Ga0501037_0003668 | Ga0501037_0003668_10193_10456 | 86 |
| 642 | 3300049573 | Ga0501037_0440131 | Ga0501037_0440131_217_480 | 86 |
| 643 | 3300049573 | Ga0501037_0463122 | Ga0501037_0463122_285_545 | 86 |
| 644 | 3300049574 | Ga0501038_0476178 | Ga0501038_0476178_243_503 | 86 |
| 645 | 3300049575 | Ga0501039_0000180 | Ga0501039_0000180_712_975 | 86 |
| 646 | 3300049576 | Ga0501040_0101741 | Ga0501040_0101741_1658_1921 | 86 |
| 647 | 3300049579 | Ga0501043_0554549 | Ga0501043_0554549_39_302 | 86 |
| 648 | 3300049579 | Ga0501043_0582437 | Ga0501043_0582437_336_596 | 86 |
| 649 | 3300049580 | Ga0501046_0003402 | Ga0501046_0003402_7808_8071 | 86 |
| 650 | 3300049581 | Ga0501047_0000897 | Ga0501047_0000897_6407_6670 | 86 |
| 651 | 3300049581 | Ga0501047_0017104 | Ga0501047_0017104_4671_4934 | 86 |
| 652 | 3300049581 | Ga0501047_0619504 | Ga0501047_0619504_21_284 | 86 |
| 653 | 3300049584 | Ga0501068_0304788 | Ga0501068_0304788_92_352 | 86 |
| 654 | 3300049584 | Ga0501068_0923605 | Ga0501068_0923605_46_309 | 86 |
| 655 | 3300049584 | Ga0501068_0985588 | Ga0501068_0985588_69_329 | 86 |
| 656 | 3300049585 | Ga0501069_0045771 | Ga0501069_0045771_1045_1308 | 86 |
| 657 | 3300049586 | Ga0501070_0002980 | Ga0501070_0002980_9504_9767 | 86 |
| 658 | 3300049586 | Ga0501070_0065076 | Ga0501070_0065076_2335_2595 | 86 |
| 659 | 3300049586 | Ga0501070_0326194 | Ga0501070_0326194_315_575 | 86 |
| 660 | 3300049588 | Ga0501072_0335667 | Ga0501072_0335667_528_788 | 86 |
| 661 | 3300049589 | Ga0501073_0023910 | Ga0501073_0023910_1173_1433 | 86 |
| 662 | 3300049589 | Ga0501073_0082204 | Ga0501073_0082204_932_1195 | 86 |
| 663 | 3300049589 | Ga0501073_0097705 | Ga0501073_0097705_1522_1785 | 86 |
| 664 | 3300049589 | Ga0501073_0327854 | Ga0501073_0327854_182_442 | 86 |
| 665 | 3300049590 | Ga0501074_1091405 | Ga0501074_1091405_104_367 | 86 |
| 666 | 3300049593 | Ga0501077_0990637 | Ga0501077_0990637_115_378 | 86 |
| 667 | 3300049653 | Ga0501206_036028 | Ga0501206_036028_178_438 | 86 |
| 668 | 3300049653 | Ga0501206_048665 | Ga0501206_048665_210_470 | 86 |
| 669 | 3300049654 | Ga0501207_004182 | Ga0501207_004182_836_1096 | 86 |
| 670 | 3300049657 | Ga0501210_001617 | Ga0501210_001617_725_985 | 86 |
| 671 | 3300049658 | Ga0501211_000217 | Ga0501211_000217_2447_2707 | 86 |
| 672 | 3300049662 | Ga0501222_003244 | Ga0501222_003244_1689_1949 | 86 |
| 673 | 3300049662 | Ga0501222_006973 | Ga0501222_006973_366_629 | 86 |
| 674 | 3300049663 | Ga0501223_014718 | Ga0501223_014718_336_596 | 86 |
| 675 | 3300049663 | Ga0501223_047419 | Ga0501223_047419_52_312 | 86 |
| 676 | 3300049665 | Ga0501227_002884 | Ga0501227_002884_1050_1310 | 86 |
| 677 | 3300049668 | Ga0501233_003766 | Ga0501233_003766_2284_2544 | 86 |
| 678 | 3300049669 | Ga0501235_006211 | Ga0501235_006211_1466_1726 | 86 |
| 679 | 3300049670 | Ga0501236_015234 | Ga0501236_015234_298_558 | 86 |
| 680 | 3300049674 | Ga0501242_060384 | Ga0501242_060384_230_490 | 86 |
| 681 | 3300049675 | Ga0501243_089665 | Ga0501243_089665_187_447 | 86 |
| 682 | 3300049677 | Ga0501247_027834 | Ga0501247_027834_196_456 | 86 |
| 683 | 3300049681 | Ga0501251_015400 | Ga0501251_015400_499_759 | 86 |
| 684 | 3300049682 | Ga0501252_008463 | Ga0501252_008463_394_654 | 86 |
| 685 | 3300049683 | Ga0501253_008143 | Ga0501253_008143_670_930 | 86 |
| 686 | 3300049683 | Ga0501253_054206 | Ga0501253_054206_199_459 | 86 |
| 687 | 3300049684 | Ga0501255_000809 | Ga0501255_000809_1608_1868 | 86 |
| 688 | 3300049686 | Ga0501257_174427 | Ga0501257_174427_236_496 | 86 |
| 689 | 3300049687 | Ga0501258_004012 | Ga0501258_004012_632_892 | 86 |
| 690 | 3300049704 | Ga0501221_000226 | Ga0501221_000226_4682_4942 | 86 |
| 691 | 3300049706 | Ga0501229_002173 | Ga0501229_002173_1900_2160 | 86 |
| 692 | 3300049741 | Ga0501079_0263166 | Ga0501079_0263166_133_396 | 86 |
| 693 | 3300049742 | Ga0501080_0000298 | Ga0501080_0000298_12986_13249 | 86 |
| 694 | 3300049742 | Ga0501080_0027130 | Ga0501080_0027130_4457_4720 | 86 |
| 695 | 3300049742 | Ga0501080_0182396 | Ga0501080_0182396_1275_1535 | 86 |
| 696 | 3300049742 | Ga0501080_0197177 | Ga0501080_0197177_852_1112 | 86 |
| 697 | 3300049742 | Ga0501080_0378407 | Ga0501080_0378407_544_807 | 86 |
| 698 | 3300049742 | Ga0501080_0467694 | Ga0501080_0467694_587_847 | 86 |
| 699 | 3300049744 | Ga0501083_0111702 | Ga0501083_0111702_1261_1524 | 86 |
| 700 | 3300049744 | Ga0501083_0398809 | Ga0501083_0398809_157_417 | 86 |
| 701 | 3300049757 | Ga0501232_001758 | Ga0501232_001758_392_652 | 86 |
| 702 | 3300049759 | Ga0501262_005214 | Ga0501262_005214_393_653 | 86 |
| 703 | 3300049759 | Ga0501262_014117 | Ga0501262_014117_617_877 | 86 |
| 704 | 3300049762 | Ga0501265_004898 | Ga0501265_004898_572_832 | 86 |
| 705 | 3300049762 | Ga0501265_019968 | Ga0501265_019968_395_655 | 86 |
| 706 | 3300049764 | Ga0501267_005752 | Ga0501267_005752_678_938 | 86 |
| 707 | 3300049765 | Ga0501268_073517 | Ga0501268_073517_307_567 | 86 |
| 708 | 3300049767 | Ga0501270_050502 | Ga0501270_050502_388_648 | 86 |
| 709 | 3300049769 | Ga0501272_006284 | Ga0501272_006284_531_791 | 86 |
| 710 | 3300049769 | Ga0501272_038274 | Ga0501272_038274_201_461 | 86 |
| 711 | 3300049770 | Ga0501273_032887 | Ga0501273_032887_323_583 | 86 |
| 712 | 3300049771 | Ga0501274_036899 | Ga0501274_036899_244_504 | 86 |
| 713 | 3300049778 | Ga0501282_024536 | Ga0501282_024536_308_568 | 86 |
| 714 | 3300049779 | Ga0501283_012928 | Ga0501283_012928_611_871 | 86 |
| 715 | 3300049779 | Ga0501283_098284 | Ga0501283_098284_202_462 | 86 |
| 716 | 3300049822 | Ga0501035_0000056 | Ga0501035_0000056_24111_24374 | 86 |
| 717 | 3300049823 | Ga0501044_0000536 | Ga0501044_0000536_21967_22230 | 86 |
| 718 | 3300049823 | Ga0501044_0039275 | Ga0501044_0039275_13_273 | 86 |
| 719 | 3300049823 | Ga0501044_0089593 | Ga0501044_0089593_1403_1663 | 86 |
| 720 | 3300049823 | Ga0501044_1414806 | Ga0501044_1414806_97_360 | 86 |
| 721 | 3300049824 | Ga0501045_0005467 | Ga0501045_0005467_6571_6834 | 86 |
| 722 | 3300049853 | Ga0501226_014596 | Ga0501226_014596_202_462 | 86 |
| 723 | 3300050509 | nmdc:mga0qj67_108492_c1 | nmdc:mga0qj67_108492_c1_692_958 | 86 |
| 724 | 3300050511 | nmdc:mga08y16_9336_c1 | nmdc:mga08y16_9336_c1_5384_5650 | 86 |
| 725 | 3300050516 | nmdc:mga0sz30_77694_c1 | nmdc:mga0sz30_77694_c1_431_691 | 86 |
| 726 | 3300053088 | Ga0500644_0055826 | Ga0500644_0055826_636_896 | 86 |
| 727 | 3300053090 | Ga0500646_0026524 | Ga0500646_0026524_818_1078 | 86 |
| 728 | 3300053093 | Ga0500651_0417854 | Ga0500651_0417854_118_378 | 86 |
| 729 | 3300053098 | Ga0500650_0123477 | Ga0500650_0123477_465_725 | 86 |
| 730 | 3300053123 | Ga0500614_216726 | Ga0500614_216726_163_423 | 86 |
| 731 | 3300053130 | Ga0500642_0000738 | Ga0500642_0000738_7981_8241 | 86 |
| 732 | 3300053134 | Ga0500658_0008532 | Ga0500658_0008532_1075_1335 | 86 |
| 733 | 3300053139 | Ga0500568_0046479 | Ga0500568_0046479_953_1213 | 86 |
| 734 | 3300053142 | Ga0500577_0127182 | Ga0500577_0127182_359_619 | 86 |
| 735 | 3300053146 | Ga0500588_0018850 | Ga0500588_0018850_456_716 | 86 |
| 736 | 3300053151 | Ga0500604_0004159 | Ga0500604_0004159_902_1165 | 86 |
| 737 | 3300053151 | Ga0500604_0020715 | Ga0500604_0020715_1051_1311 | 86 |
| 738 | 3300053727 | Ga0500611_033113 | Ga0500611_033113_192_452 | 86 |
| 739 | 3300053731 | Ga0500609_000975 | Ga0500609_000975_1553_1813 | 86 |
| 740 | 3300053732 | Ga0500656_026355 | Ga0500656_026355_471_731 | 86 |
| 741 | 3300053736 | Ga0500599_008793 | Ga0500599_008793_156_416 | 86 |
| 742 | 3300053739 | Ga0500587_004650 | Ga0500587_004650_667_927 | 86 |
| 743 | 3300054114 | Ga0501084_0090756 | Ga0501084_0090756_1629_1892 | 86 |
| 744 | 3300060353 | Ga0501082_0007428 | Ga0501082_0007428_438_701 | 86 |
| 745 | 3300060353 | Ga0501082_0060553 | Ga0501082_0060553_1738_2001 | 86 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar