F478792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 745 | 393 | 734 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10367633|Ga0114129_103676333 |
| Length | 261 |
| Sequence | MAHGARKLTRMRPLKSRPAGRRRGRARGVPTQPIELYYWPTPNGQKVSIMLEECGLPYRVIAVNIARGEQFKPAFLKISPNNRIPAIVDPHGPGGRPIAVFESGAILQYLGRKTGQFYPAGERARVEVDQWLFWQMANLGPKAGEANHFRRYATAANQQYAVERFGNELNRLFGVMNKRLKDRAFLAGRYSIADMACVGWIRLFERQGRELDGFPHLKRWLKRVRARPAVRRGMGIRIEEASRVDVRDPTVRAVLFGQRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 5 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 6 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 7 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 8 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 9 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 10 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 11 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 12 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 14 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 16 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 17 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 20 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 26 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 29 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 30 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 31 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 32 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 33 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 34 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 232 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 243 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 263 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 270 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 271 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 274 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 275 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 283 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 284 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 0.13 |
| Isolates | 1.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.21 |
| Nodule | 0.81 |
| Rhizoplane | 6.85 |
| Rhizosphere | 89.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214756334 | 2209111006 | Bacteria | 3097 |
| 2 | ARcpr5oldR_c000183 | 3300000041 | Bacteria | 10873 |
| 3 | ARSoilYngRDRAFT_c00120 | 3300000042 | Bacteria | 13387 |
| 4 | ARcpr5yngRDRAFT_c000195 | 3300000043 | Bacteria | 9370 |
| 5 | ARSoilOldRDRAFT_c000093 | 3300000044 | Bacteria | 16766 |
| 6 | ARCol0oldRDRAFT_c01241 | 3300000045 | Bacteria | 1815 |
| 7 | ARCol0yngRDRAFT_1000124 | 3300000652 | Bacteria | 13864 |
| 8 | JGI24736J21556_1023741 | 3300001904 | Bacteria | 957 |
| 9 | JGI24746J21847_1000166 | 3300001977 | Bacteria | 8589 |
| 10 | JGI24747J21853_1000502 | 3300001978 | Bacteria | 2469 |
| 11 | JGI24740J21852_10013161 | 3300001979 | Bacteria | 3096 |
| 12 | JGI24739J22299_10000057 | 3300001989 | Bacteria | 31581 |
| 13 | JGI24737J22298_10000391 | 3300001990 | Bacteria | 14950 |
| 14 | JGI24737J22298_10001583 | 3300001990 | Bacteria | 8090 |
| 15 | JGI24750J21931_1000122 | 3300002070 | Bacteria | 12437 |
| 16 | JGI24745J21846_1000432 | 3300002073 | Bacteria | 3722 |
| 17 | JGI24748J21848_1008199 | 3300002074 | Bacteria | 1227 |
| 18 | JGI24738J21930_10000767 | 3300002075 | Bacteria | 9204 |
| 19 | JGI24749J21850_1000951 | 3300002076 | Bacteria | 4128 |
| 20 | JGI24035J26624_1000228 | 3300002126 | Bacteria | 5149 |
| 21 | JGI24033J26618_1000617 | 3300002155 | Bacteria | 3419 |
| 22 | JGI24034J26672_10000108 | 3300002239 | Bacteria | 13522 |
| 23 | JGI24742J22300_10000111 | 3300002244 | Bacteria | 11743 |
| 24 | JGI24751J29686_10013943 | 3300002459 | Bacteria | 1659 |
| 25 | JGI25151J46595_10000086 | 3300003187 | Bacteria | 126250 |
| 26 | JGI25153J46596_10006736 | 3300003215 | Bacteria | 5763 |
| 27 | Ga0055526_1000371 | 3300003771 | Bacteria | 36363 |
| 28 | Ga0065717_1003053 | 3300005276 | Bacteria | 1448 |
| 29 | Ga0065704_10107468 | 3300005289 | Bacteria | 2055 |
| 30 | Ga0065712_10072616 | 3300005290 | Bacteria | 4681 |
| 31 | Ga0065712_10103628 | 3300005290 | Bacteria | 1980 |
| 32 | Ga0065715_10002625 | 3300005293 | Bacteria | 8315 |
| 33 | Ga0065715_10090398 | 3300005293 | Bacteria | 7088 |
| 34 | Ga0065715_10327286 | 3300005293 | Bacteria | 990 |
| 35 | Ga0065707_10135694 | 3300005295 | Bacteria | 1845 |
| 36 | Ga0065707_10231548 | 3300005295 | Bacteria | 1187 |
| 37 | Ga0070658_10038385 | 3300005327 | Bacteria | 3862 |
| 38 | Ga0070658_10088474 | 3300005327 | Bacteria | 2550 |
| 39 | Ga0070658_10153929 | 3300005327 | Bacteria | 1926 |
| 40 | Ga0070676_10000170 | 3300005328 | Bacteria | 26484 |
| 41 | Ga0070683_100003392 | 3300005329 | Bacteria | 12912 |
| 42 | Ga0070690_100013276 | 3300005330 | Bacteria | 4865 |
| 43 | Ga0070670_100021304 | 3300005331 | Bacteria | 5576 |
| 44 | Ga0070670_100214100 | 3300005331 | Bacteria | 1675 |
| 45 | Ga0070677_10000320 | 3300005333 | Bacteria | 16762 |
| 46 | Ga0068869_100000181 | 3300005334 | Bacteria | 32256 |
| 47 | Ga0068869_100538273 | 3300005334 | Bacteria | 979 |
| 48 | Ga0070680_100002750 | 3300005336 | Bacteria | 13050 |
| 49 | Ga0070680_100044489 | 3300005336 | Bacteria | 3607 |
| 50 | Ga0070680_100123385 | 3300005336 | Bacteria | 2163 |
| 51 | Ga0070682_100000903 | 3300005337 | Bacteria | 17347 |
| 52 | Ga0070682_100270343 | 3300005337 | Bacteria | 1234 |
| 53 | Ga0068868_100000590 | 3300005338 | Bacteria | 24437 |
| 54 | Ga0070660_100007288 | 3300005339 | Bacteria | 7706 |
| 55 | Ga0070660_100043246 | 3300005339 | Bacteria | 3442 |
| 56 | Ga0070660_100095703 | 3300005339 | Bacteria | 2347 |
| 57 | Ga0070660_100145147 | 3300005339 | Bacteria | 1906 |
| 58 | Ga0070689_100001256 | 3300005340 | Bacteria | 16143 |
| 59 | Ga0070689_100015933 | 3300005340 | Bacteria | 5493 |
| 60 | Ga0070689_100174164 | 3300005340 | Bacteria | 1744 |
| 61 | Ga0070691_10000085 | 3300005341 | Bacteria | 26262 |
| 62 | Ga0070691_10052867 | 3300005341 | Bacteria | 1942 |
| 63 | Ga0070687_100000037 | 3300005343 | Bacteria | 42337 |
| 64 | Ga0070687_100009985 | 3300005343 | Bacteria | 4085 |
| 65 | Ga0070661_100014737 | 3300005344 | Bacteria | 5513 |
| 66 | Ga0070692_10000038 | 3300005345 | Bacteria | 25433 |
| 67 | Ga0070668_100012587 | 3300005347 | Bacteria | 6299 |
| 68 | Ga0070669_100015059 | 3300005353 | Bacteria | 5513 |
| 69 | Ga0070669_100344318 | 3300005353 | Bacteria | 1209 |
| 70 | Ga0070675_100013975 | 3300005354 | Bacteria | 6320 |
| 71 | Ga0070671_100010890 | 3300005355 | Bacteria | 7303 |
| 72 | Ga0070674_100000195 | 3300005356 | Bacteria | 29060 |
| 73 | Ga0070674_100063853 | 3300005356 | Bacteria | 2579 |
| 74 | Ga0070674_100106305 | 3300005356 | Bacteria | 2053 |
| 75 | Ga0070673_100000191 | 3300005364 | Bacteria | 30135 |
| 76 | Ga0070688_100006371 | 3300005365 | Bacteria | 6307 |
| 77 | Ga0070688_100008846 | 3300005365 | Bacteria | 5481 |
| 78 | Ga0070688_100026022 | 3300005365 | Bacteria | 3471 |
| 79 | Ga0070659_100001504 | 3300005366 | Bacteria | 16803 |
| 80 | Ga0070667_100015512 | 3300005367 | Bacteria | 6299 |
| 81 | Ga0070667_100330758 | 3300005367 | Bacteria | 1376 |
| 82 | Ga0070709_10129111 | 3300005434 | Bacteria | 1723 |
| 83 | Ga0070709_10199095 | 3300005434 | Bacteria | 1417 |
| 84 | Ga0070709_10268758 | 3300005434 | Bacteria | 1235 |
| 85 | Ga0070709_10334425 | 3300005434 | Bacteria | 1115 |
| 86 | Ga0070714_100090919 | 3300005435 | Bacteria | 2674 |
| 87 | Ga0070714_100410973 | 3300005435 | Bacteria | 1281 |
| 88 | Ga0070714_100976386 | 3300005435 | Bacteria | 824 |
| 89 | Ga0070713_100030801 | 3300005436 | Bacteria | 4266 |
| 90 | Ga0070701_10032655 | 3300005438 | Bacteria | 2594 |
| 91 | Ga0070711_100098293 | 3300005439 | Bacteria | 2125 |
| 92 | Ga0070711_100387541 | 3300005439 | Bacteria | 1131 |
| 93 | Ga0070700_100009799 | 3300005441 | Bacteria | 5269 |
| 94 | Ga0070700_100028282 | 3300005441 | Bacteria | 3332 |
| 95 | Ga0070694_100019235 | 3300005444 | Bacteria | 4342 |
| 96 | Ga0070694_100526283 | 3300005444 | Bacteria | 944 |
| 97 | Ga0070663_100005367 | 3300005455 | Bacteria | 7611 |
| 98 | Ga0070663_100082466 | 3300005455 | Bacteria | 2365 |
| 99 | Ga0070663_100148508 | 3300005455 | Bacteria | 1795 |
| 100 | Ga0070663_100581151 | 3300005455 | Bacteria | 940 |
| 101 | Ga0070678_100010208 | 3300005456 | Bacteria | 5725 |
| 102 | Ga0070678_100379491 | 3300005456 | Bacteria | 1223 |
| 103 | Ga0070662_100001810 | 3300005457 | Bacteria | 13141 |
| 104 | Ga0070662_100014550 | 3300005457 | Bacteria | 5260 |
| 105 | Ga0070662_100531376 | 3300005457 | Bacteria | 984 |
| 106 | Ga0070681_10002441 | 3300005458 | Bacteria | 17015 |
| 107 | Ga0070681_10007687 | 3300005458 | Bacteria | 10539 |
| 108 | Ga0070681_10022976 | 3300005458 | Bacteria | 6267 |
| 109 | Ga0068867_100000082 | 3300005459 | Bacteria | 59236 |
| 110 | Ga0070685_10006868 | 3300005466 | Bacteria | 5808 |
| 111 | Ga0070685_10022949 | 3300005466 | Bacteria | 3409 |
| 112 | Ga0074259_10441056 | 3300005507 | Bacteria | 991 |
| 113 | Ga0070679_100006190 | 3300005530 | Bacteria | 11142 |
| 114 | Ga0070679_100059858 | 3300005530 | Bacteria | 3795 |
| 115 | Ga0070679_100092831 | 3300005530 | Bacteria | 3005 |
| 116 | Ga0070684_100001355 | 3300005535 | Bacteria | 17557 |
| 117 | Ga0070697_100046445 | 3300005536 | Bacteria | 3520 |
| 118 | Ga0070697_100287956 | 3300005536 | Bacteria | 1410 |
| 119 | Ga0068853_100020240 | 3300005539 | Bacteria | 5532 |
| 120 | Ga0070672_100001052 | 3300005543 | Bacteria | 16850 |
| 121 | Ga0070672_100083939 | 3300005543 | Bacteria | 2557 |
| 122 | Ga0070686_100005857 | 3300005544 | Bacteria | 6810 |
| 123 | Ga0070686_100038034 | 3300005544 | Bacteria | 2989 |
| 124 | Ga0070686_100079120 | 3300005544 | Bacteria | 2173 |
| 125 | Ga0070695_100024055 | 3300005545 | Bacteria | 3750 |
| 126 | Ga0070695_100028142 | 3300005545 | Bacteria | 3486 |
| 127 | Ga0070695_100319416 | 3300005545 | Bacteria | 1154 |
| 128 | Ga0070696_100019040 | 3300005546 | Bacteria | 4647 |
| 129 | Ga0070696_100019906 | 3300005546 | Bacteria | 4549 |
| 130 | Ga0070696_100055263 | 3300005546 | Bacteria | 2768 |
| 131 | Ga0070693_100006925 | 3300005547 | Bacteria | 5513 |
| 132 | Ga0070693_100009627 | 3300005547 | Bacteria | 4810 |
| 133 | Ga0070693_100043952 | 3300005547 | Bacteria | 2525 |
| 134 | Ga0070665_100035064 | 3300005548 | Bacteria | 5046 |
| 135 | Ga0070704_100002284 | 3300005549 | Bacteria | 10707 |
| 136 | Ga0070704_100008914 | 3300005549 | Bacteria | 6042 |
| 137 | Ga0068855_100066014 | 3300005563 | Bacteria | 4218 |
| 138 | Ga0068855_100176270 | 3300005563 | Bacteria | 2419 |
| 139 | Ga0068855_100356364 | 3300005563 | Bacteria | 1610 |
| 140 | Ga0070664_100015140 | 3300005564 | Bacteria | 6299 |
| 141 | Ga0070664_100417004 | 3300005564 | Bacteria | 1229 |
| 142 | Ga0068857_100001561 | 3300005577 | Bacteria | 18370 |
| 143 | Ga0068854_100000140 | 3300005578 | Bacteria | 50187 |
| 144 | Ga0068854_100126224 | 3300005578 | Bacteria | 1949 |
| 145 | Ga0068856_100014995 | 3300005614 | Bacteria | 7486 |
| 146 | Ga0070702_100000796 | 3300005615 | Bacteria | 12029 |
| 147 | Ga0070702_100171461 | 3300005615 | Bacteria | 1412 |
| 148 | Ga0070702_100460682 | 3300005615 | Bacteria | 924 |
| 149 | Ga0068852_100009442 | 3300005616 | Bacteria | 7245 |
| 150 | Ga0068852_100563421 | 3300005616 | Bacteria | 1141 |
| 151 | Ga0068859_100029961 | 3300005617 | Bacteria | 5459 |
| 152 | Ga0068864_100002090 | 3300005618 | Bacteria | 16498 |
| 153 | Ga0068861_100062512 | 3300005719 | Bacteria | 2860 |
| 154 | Ga0068870_10000063 | 3300005840 | Bacteria | 33368 |
| 155 | Ga0068863_100026081 | 3300005841 | Bacteria | 5577 |
| 156 | Ga0068863_100474921 | 3300005841 | Bacteria | 1229 |
| 157 | Ga0068858_100025376 | 3300005842 | Bacteria | 5514 |
| 158 | Ga0068858_100042274 | 3300005842 | Bacteria | 4225 |
| 159 | Ga0068860_100003358 | 3300005843 | Bacteria | 16477 |
| 160 | Ga0068862_100001746 | 3300005844 | Bacteria | 19666 |
| 161 | Ga0081455_10000028 | 3300005937 | Bacteria | 155778 |
| 162 | Ga0081455_10009936 | 3300005937 | Bacteria | 9733 |
| 163 | Ga0081455_10177700 | 3300005937 | Bacteria | 1615 |
| 164 | Ga0075363_100148315 | 3300006048 | Bacteria | 1323 |
| 165 | Ga0075363_100148335 | 3300006048 | Bacteria | 1323 |
| 166 | Ga0075432_10074372 | 3300006058 | Bacteria | 1224 |
| 167 | Ga0070716_100176439 | 3300006173 | Bacteria | 1399 |
| 168 | Ga0070712_100004132 | 3300006175 | Bacteria | 8923 |
| 169 | Ga0075427_10008231 | 3300006194 | Bacteria | 1543 |
| 170 | Ga0097621_100000083 | 3300006237 | Bacteria | 50576 |
| 171 | Ga0097621_100136443 | 3300006237 | Bacteria | 2093 |
| 172 | Ga0068871_100000067 | 3300006358 | Bacteria | 57681 |
| 173 | Ga0068871_100097761 | 3300006358 | Bacteria | 2455 |
| 174 | Ga0075430_100031292 | 3300006846 | Bacteria | 4516 |
| 175 | Ga0075430_100120670 | 3300006846 | Bacteria | 2185 |
| 176 | Ga0075430_100423031 | 3300006846 | Bacteria | 1099 |
| 177 | Ga0075431_100252555 | 3300006847 | Bacteria | 1791 |
| 178 | Ga0075433_10001386 | 3300006852 | Bacteria | 17846 |
| 179 | Ga0075433_10018647 | 3300006852 | Bacteria | 5771 |
| 180 | Ga0075433_10068230 | 3300006852 | Bacteria | 3122 |
| 181 | Ga0075434_100001186 | 3300006871 | Bacteria | 21600 |
| 182 | Ga0075434_100006580 | 3300006871 | Bacteria | 10659 |
| 183 | Ga0075434_100131989 | 3300006871 | Bacteria | 2517 |
| 184 | Ga0075429_100038699 | 3300006880 | Bacteria | 4152 |
| 185 | Ga0075429_100535484 | 3300006880 | Bacteria | 1026 |
| 186 | Ga0068865_100000244 | 3300006881 | Bacteria | 30343 |
| 187 | Ga0068865_100414752 | 3300006881 | Bacteria | 1106 |
| 188 | Ga0075436_100255479 | 3300006914 | Bacteria | 1249 |
| 189 | Ga0097620_100029962 | 3300006931 | Bacteria | 5459 |
| 190 | Ga0075435_100017607 | 3300007076 | Bacteria | 5413 |
| 191 | Ga0075435_100109445 | 3300007076 | Bacteria | 2297 |
| 192 | Ga0075435_100167915 | 3300007076 | Bacteria | 1851 |
| 193 | Ga0075435_100472532 | 3300007076 | Bacteria | 1082 |
| 194 | Ga0105240_10027953 | 3300009093 | Bacteria | 7377 |
| 195 | Ga0105240_10109579 | 3300009093 | Bacteria | 3343 |
| 196 | Ga0111539_10032831 | 3300009094 | Bacteria | 6303 |
| 197 | Ga0111539_10091401 | 3300009094 | Bacteria | 3576 |
| 198 | Ga0111539_10207974 | 3300009094 | Bacteria | 2280 |
| 199 | Ga0111539_10301194 | 3300009094 | Bacteria | 1866 |
| 200 | Ga0105245_10000762 | 3300009098 | Bacteria | 29109 |
| 201 | Ga0105245_10204325 | 3300009098 | Bacteria | 1898 |
| 202 | Ga0105247_10164326 | 3300009101 | Bacteria | 1472 |
| 203 | Ga0105247_10178452 | 3300009101 | Bacteria | 1416 |
| 204 | Ga0114129_10072717 | 3300009147 | Bacteria | 4793 |
| 205 | Ga0114129_10263683 | 3300009147 | Bacteria | 2308 |
| 206 | Ga0114129_10367633 | 3300009147 | Bacteria | 1902 |
| 207 | Ga0105243_10016647 | 3300009148 | Bacteria | 5560 |
| 208 | Ga0105243_10039120 | 3300009148 | Bacteria | 3696 |
| 209 | Ga0105243_10087167 | 3300009148 | Bacteria | 2562 |
| 210 | Ga0105243_10124097 | 3300009148 | Bacteria | 2182 |
| 211 | Ga0105243_10343414 | 3300009148 | Bacteria | 1368 |
| 212 | Ga0105241_10000900 | 3300009174 | Bacteria | 22448 |
| 213 | Ga0105241_10086615 | 3300009174 | Bacteria | 2464 |
| 214 | Ga0105241_10247267 | 3300009174 | Bacteria | 1510 |
| 215 | Ga0105242_10000036 | 3300009176 | Bacteria | 91470 |
| 216 | Ga0105242_10177227 | 3300009176 | Bacteria | 1878 |
| 217 | Ga0105248_10034721 | 3300009177 | Bacteria | 5642 |
| 218 | Ga0105248_10050918 | 3300009177 | Bacteria | 4647 |
| 219 | Ga0105248_10392904 | 3300009177 | Bacteria | 1562 |
| 220 | Ga0105237_10029241 | 3300009545 | Bacteria | 5605 |
| 221 | Ga0105238_10037849 | 3300009551 | Bacteria | 4902 |
| 222 | Ga0105238_10101122 | 3300009551 | Bacteria | 2866 |
| 223 | Ga0105238_10138983 | 3300009551 | Bacteria | 2406 |
| 224 | Ga0105249_10001033 | 3300009553 | Bacteria | 24619 |
| 225 | Ga0105249_10065149 | 3300009553 | Bacteria | 3351 |
| 226 | Ga0105239_10035447 | 3300010375 | Bacteria | 5479 |
| 227 | Ga0105239_10042248 | 3300010375 | Bacteria | 4996 |
| 228 | Ga0157339_1000936 | 3300012505 | Bacteria | 1642 |
| 229 | Ga0157373_10432321 | 3300013100 | Bacteria | 946 |
| 230 | Ga0157371_10037194 | 3300013102 | Bacteria | 3485 |
| 231 | Ga0157371_10075390 | 3300013102 | Bacteria | 2389 |
| 232 | Ga0157369_10102581 | 3300013105 | Bacteria | 3048 |
| 233 | Ga0157369_10207590 | 3300013105 | Bacteria | 2054 |
| 234 | Ga0157374_10009715 | 3300013296 | Bacteria | 8260 |
| 235 | Ga0157378_10002181 | 3300013297 | Bacteria | 17356 |
| 236 | Ga0157378_10066591 | 3300013297 | Bacteria | 3226 |
| 237 | Ga0157378_10644994 | 3300013297 | Bacteria | 1074 |
| 238 | Ga0163162_10011076 | 3300013306 | Bacteria | 8786 |
| 239 | Ga0163162_10021532 | 3300013306 | Bacteria | 6350 |
| 240 | Ga0157372_10039877 | 3300013307 | Bacteria | 5185 |
| 241 | Ga0157372_10543544 | 3300013307 | Bacteria | 1354 |
| 242 | Ga0157372_10725265 | 3300013307 | Bacteria | 1156 |
| 243 | Ga0157375_10003806 | 3300013308 | Bacteria | 13080 |
| 244 | Ga0157375_10188167 | 3300013308 | Bacteria | 2219 |
| 245 | Ga0163163_10016530 | 3300014325 | Bacteria | 6861 |
| 246 | Ga0163163_10088960 | 3300014325 | Bacteria | 3100 |
| 247 | Ga0163163_10284043 | 3300014325 | Bacteria | 1707 |
| 248 | Ga0163163_11022761 | 3300014325 | Bacteria | 890 |
| 249 | Ga0157380_10001301 | 3300014326 | Bacteria | 16225 |
| 250 | Ga0157380_10097749 | 3300014326 | Bacteria | 2437 |
| 251 | Ga0157377_10000124 | 3300014745 | Bacteria | 49953 |
| 252 | Ga0157379_10000275 | 3300014968 | Bacteria | 40524 |
| 253 | Ga0157379_10377201 | 3300014968 | Bacteria | 1301 |
| 254 | Ga0157376_10000115 | 3300014969 | Bacteria | 57170 |
| 255 | Ga0163161_10010835 | 3300017792 | Bacteria | 6320 |
| 256 | Ga0163161_10175659 | 3300017792 | Bacteria | 1640 |
| 257 | Ga0163161_10298124 | 3300017792 | Bacteria | 1269 |
| 258 | Ga0213876_10060758 | 3300021384 | Bacteria | 1994 |
| 259 | Ga0207666_1000050 | 3300025271 | Bacteria | 22802 |
| 260 | Ga0207666_1000394 | 3300025271 | Bacteria | 5755 |
| 261 | Ga0207673_1000083 | 3300025290 | Bacteria | 8317 |
| 262 | Ga0209758_1009129 | 3300025297 | Bacteria | 6244 |
| 263 | Ga0207697_10000039 | 3300025315 | Bacteria | 49235 |
| 264 | Ga0207697_10044924 | 3300025315 | Bacteria | 1818 |
| 265 | Ga0207682_10000121 | 3300025893 | Bacteria | 35950 |
| 266 | Ga0207692_10116613 | 3300025898 | Bacteria | 1489 |
| 267 | Ga0207692_10173098 | 3300025898 | Bacteria | 1252 |
| 268 | Ga0207642_10001013 | 3300025899 | Bacteria | 8804 |
| 269 | Ga0207710_10104614 | 3300025900 | Bacteria | 1339 |
| 270 | Ga0207710_10206923 | 3300025900 | Bacteria | 971 |
| 271 | Ga0207710_10213179 | 3300025900 | Bacteria | 957 |
| 272 | Ga0207688_10000073 | 3300025901 | Bacteria | 37681 |
| 273 | Ga0207688_10001691 | 3300025901 | Bacteria | 11690 |
| 274 | Ga0207688_10041092 | 3300025901 | Bacteria | 2571 |
| 275 | Ga0207680_10062152 | 3300025903 | Bacteria | 2280 |
| 276 | Ga0207647_10013109 | 3300025904 | Bacteria | 5759 |
| 277 | Ga0207647_10023727 | 3300025904 | Bacteria | 4053 |
| 278 | Ga0207699_10147743 | 3300025906 | Bacteria | 1552 |
| 279 | Ga0207645_10000114 | 3300025907 | Bacteria | 60880 |
| 280 | Ga0207645_10080713 | 3300025907 | Bacteria | 2085 |
| 281 | Ga0207643_10000134 | 3300025908 | Bacteria | 50474 |
| 282 | Ga0207705_10076166 | 3300025909 | Bacteria | 2438 |
| 283 | Ga0207705_10107127 | 3300025909 | Bacteria | 2062 |
| 284 | Ga0207654_10000527 | 3300025911 | Bacteria | 21845 |
| 285 | Ga0207707_10017884 | 3300025912 | Bacteria | 6180 |
| 286 | Ga0207707_10072873 | 3300025912 | Bacteria | 2994 |
| 287 | Ga0207707_10149287 | 3300025912 | Bacteria | 2044 |
| 288 | Ga0207707_10165869 | 3300025912 | Bacteria | 1930 |
| 289 | Ga0207695_10079997 | 3300025913 | Bacteria | 3311 |
| 290 | Ga0207671_10015778 | 3300025914 | Bacteria | 5898 |
| 291 | Ga0207671_10077531 | 3300025914 | Bacteria | 2488 |
| 292 | Ga0207693_10002351 | 3300025915 | Bacteria | 16428 |
| 293 | Ga0207693_10149824 | 3300025915 | Bacteria | 1835 |
| 294 | Ga0207693_10236824 | 3300025915 | Bacteria | 1433 |
| 295 | Ga0207693_10396546 | 3300025915 | Bacteria | 1079 |
| 296 | Ga0207663_10288072 | 3300025916 | Bacteria | 1222 |
| 297 | Ga0207660_10000034 | 3300025917 | Bacteria | 65783 |
| 298 | Ga0207660_10101409 | 3300025917 | Bacteria | 2150 |
| 299 | Ga0207660_10413467 | 3300025917 | Bacteria | 1087 |
| 300 | Ga0207662_10008712 | 3300025918 | Bacteria | 5564 |
| 301 | Ga0207657_10005404 | 3300025919 | Bacteria | 13354 |
| 302 | Ga0207657_10014984 | 3300025919 | Bacteria | 7531 |
| 303 | Ga0207657_10037686 | 3300025919 | Bacteria | 4313 |
| 304 | Ga0207657_10148869 | 3300025919 | Bacteria | 1908 |
| 305 | Ga0207649_10000142 | 3300025920 | Bacteria | 60023 |
| 306 | Ga0207652_10002021 | 3300025921 | Bacteria | 17491 |
| 307 | Ga0207652_10028137 | 3300025921 | Bacteria | 4688 |
| 308 | Ga0207652_10084695 | 3300025921 | Bacteria | 2778 |
| 309 | Ga0207652_10196609 | 3300025921 | Bacteria | 1814 |
| 310 | Ga0207652_10210104 | 3300025921 | Bacteria | 1752 |
| 311 | Ga0207681_10000065 | 3300025923 | Bacteria | 98832 |
| 312 | Ga0207694_10061870 | 3300025924 | Bacteria | 2914 |
| 313 | Ga0207694_10176142 | 3300025924 | Bacteria | 1733 |
| 314 | Ga0207650_10013410 | 3300025925 | Bacteria | 5674 |
| 315 | Ga0207659_10000078 | 3300025926 | Bacteria | 61403 |
| 316 | Ga0207687_10007258 | 3300025927 | Bacteria | 7308 |
| 317 | Ga0207687_10055950 | 3300025927 | Bacteria | 2766 |
| 318 | Ga0207644_10023497 | 3300025931 | Bacteria | 4223 |
| 319 | Ga0207690_10000200 | 3300025932 | Bacteria | 46868 |
| 320 | Ga0207690_10469920 | 3300025932 | Bacteria | 1013 |
| 321 | Ga0207706_10023274 | 3300025933 | Bacteria | 5564 |
| 322 | Ga0207706_10264061 | 3300025933 | Bacteria | 1503 |
| 323 | Ga0207706_10541153 | 3300025933 | Bacteria | 1003 |
| 324 | Ga0207686_10007002 | 3300025934 | Bacteria | 6068 |
| 325 | Ga0207709_10000183 | 3300025935 | Bacteria | 83374 |
| 326 | Ga0207709_10178892 | 3300025935 | Bacteria | 1496 |
| 327 | Ga0207670_10006498 | 3300025936 | Bacteria | 6487 |
| 328 | Ga0207670_10486686 | 3300025936 | Bacteria | 1000 |
| 329 | Ga0207669_10000248 | 3300025937 | Bacteria | 24525 |
| 330 | Ga0207669_10185446 | 3300025937 | Bacteria | 1496 |
| 331 | Ga0207669_10194135 | 3300025937 | Bacteria | 1467 |
| 332 | Ga0207704_10000719 | 3300025938 | Bacteria | 14567 |
| 333 | Ga0207704_10061999 | 3300025938 | Bacteria | 2323 |
| 334 | Ga0207704_10288214 | 3300025938 | Bacteria | 1251 |
| 335 | Ga0207665_10110238 | 3300025939 | Bacteria | 1933 |
| 336 | Ga0207665_10226841 | 3300025939 | Bacteria | 1371 |
| 337 | Ga0207691_10000990 | 3300025940 | Bacteria | 28262 |
| 338 | Ga0207691_10162026 | 3300025940 | Bacteria | 1962 |
| 339 | Ga0207711_10031108 | 3300025941 | Bacteria | 4504 |
| 340 | Ga0207711_10117161 | 3300025941 | Bacteria | 2375 |
| 341 | Ga0207689_10000144 | 3300025942 | Bacteria | 61402 |
| 342 | Ga0207689_10070952 | 3300025942 | Bacteria | 2861 |
| 343 | Ga0207689_10164753 | 3300025942 | Bacteria | 1827 |
| 344 | Ga0207661_10001264 | 3300025944 | Bacteria | 16911 |
| 345 | Ga0207661_10169458 | 3300025944 | Bacteria | 1900 |
| 346 | Ga0207661_10269667 | 3300025944 | Bacteria | 1519 |
| 347 | Ga0207679_10000064 | 3300025945 | Bacteria | 98118 |
| 348 | Ga0207679_10188373 | 3300025945 | Bacteria | 1713 |
| 349 | Ga0207667_10140537 | 3300025949 | Bacteria | 2486 |
| 350 | Ga0207667_10271242 | 3300025949 | Bacteria | 1735 |
| 351 | Ga0207667_10275509 | 3300025949 | Bacteria | 1720 |
| 352 | Ga0207651_10000420 | 3300025960 | Bacteria | 18070 |
| 353 | Ga0207651_10234872 | 3300025960 | Bacteria | 1491 |
| 354 | Ga0207712_10001661 | 3300025961 | Bacteria | 14931 |
| 355 | Ga0207712_10105751 | 3300025961 | Bacteria | 2101 |
| 356 | Ga0207712_10136291 | 3300025961 | Bacteria | 1878 |
| 357 | Ga0207668_10193755 | 3300025972 | Bacteria | 1613 |
| 358 | Ga0207668_10362044 | 3300025972 | Bacteria | 1216 |
| 359 | Ga0207640_10004058 | 3300025981 | Bacteria | 7911 |
| 360 | Ga0207658_10022503 | 3300025986 | Bacteria | 4389 |
| 361 | Ga0207677_10008968 | 3300026023 | Bacteria | 5611 |
| 362 | Ga0207703_10010897 | 3300026035 | Bacteria | 7087 |
| 363 | Ga0207703_10380122 | 3300026035 | Bacteria | 1306 |
| 364 | Ga0207703_10668501 | 3300026035 | Bacteria | 986 |
| 365 | Ga0207639_10379319 | 3300026041 | Bacteria | 1269 |
| 366 | Ga0207678_10003913 | 3300026067 | Bacteria | 13396 |
| 367 | Ga0207678_10028306 | 3300026067 | Bacteria | 4893 |
| 368 | Ga0207678_10043085 | 3300026067 | Bacteria | 3907 |
| 369 | Ga0207678_10067329 | 3300026067 | Bacteria | 3074 |
| 370 | Ga0207708_10016908 | 3300026075 | Bacteria | 5492 |
| 371 | Ga0207708_10029616 | 3300026075 | Bacteria | 4150 |
| 372 | Ga0207708_10161778 | 3300026075 | Bacteria | 1768 |
| 373 | Ga0207702_10032108 | 3300026078 | Bacteria | 4381 |
| 374 | Ga0207702_10122792 | 3300026078 | Bacteria | 2327 |
| 375 | Ga0207702_10795749 | 3300026078 | Bacteria | 934 |
| 376 | Ga0207641_10001821 | 3300026088 | Bacteria | 20519 |
| 377 | Ga0207648_10023701 | 3300026089 | Bacteria | 5492 |
| 378 | Ga0207648_10491555 | 3300026089 | Bacteria | 1122 |
| 379 | Ga0207676_10000079 | 3300026095 | Bacteria | 94811 |
| 380 | Ga0207676_10162583 | 3300026095 | Bacteria | 1936 |
| 381 | Ga0207674_10000323 | 3300026116 | Bacteria | 61026 |
| 382 | Ga0207675_100000270 | 3300026118 | Bacteria | 49235 |
| 383 | Ga0207675_100048918 | 3300026118 | Bacteria | 3947 |
| 384 | Ga0207683_10000037 | 3300026121 | Bacteria | 100920 |
| 385 | Ga0207683_10012300 | 3300026121 | Bacteria | 7305 |
| 386 | Ga0207698_10001179 | 3300026142 | Bacteria | 15239 |
| 387 | Ga0209973_1001076 | 3300027252 | Bacteria | 2280 |
| 388 | Ga0209982_1014937 | 3300027552 | Bacteria | 1175 |
| 389 | Ga0210002_1000055 | 3300027617 | Bacteria | 17399 |
| 390 | Ga0209971_1012497 | 3300027682 | Bacteria | 2009 |
| 391 | Ga0209966_1010800 | 3300027695 | Bacteria | 1655 |
| 392 | Ga0209998_10003279 | 3300027717 | Bacteria | 3562 |
| 393 | Ga0209998_10006433 | 3300027717 | Bacteria | 2439 |
| 394 | Ga0209974_10001624 | 3300027876 | Bacteria | 8137 |
| 395 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 396 | Ga0207428_10000947 | 3300027907 | Bacteria | 32277 |
| 397 | Ga0207428_10135243 | 3300027907 | Bacteria | 1885 |
| 398 | Ga0207428_10169255 | 3300027907 | Bacteria | 1655 |
| 399 | Ga0268266_10050353 | 3300028379 | Bacteria | 3574 |
| 400 | Ga0268265_10001593 | 3300028380 | Bacteria | 18775 |
| 401 | Ga0268265_10163574 | 3300028380 | Bacteria | 1894 |
| 402 | Ga0268265_10459201 | 3300028380 | Bacteria | 1191 |
| 403 | Ga0268264_10002487 | 3300028381 | Bacteria | 16198 |
| 404 | Ga0268264_10185461 | 3300028381 | Bacteria | 1893 |
| 405 | Ga0265338_10034833 | 3300028800 | Bacteria | 4854 |
| 406 | Ga0265338_10075788 | 3300028800 | Bacteria | 2853 |
| 407 | Ga0265324_10073106 | 3300029957 | Bacteria | 1168 |
| 408 | Ga0265330_10119049 | 3300031235 | Bacteria | 1125 |
| 409 | Ga0265325_10000104 | 3300031241 | Bacteria | 59692 |
| 410 | Ga0265325_10012604 | 3300031241 | Bacteria | 4830 |
| 411 | Ga0265329_10042660 | 3300031242 | Bacteria | 1452 |
| 412 | Ga0265339_10001035 | 3300031249 | Bacteria | 21200 |
| 413 | Ga0265339_10150744 | 3300031249 | Bacteria | 1176 |
| 414 | Ga0265339_10171751 | 3300031249 | Bacteria | 1084 |
| 415 | Ga0265331_10074499 | 3300031250 | Bacteria | 1584 |
| 416 | Ga0265313_10000825 | 3300031595 | Bacteria | 31303 |
| 417 | Ga0265313_10009755 | 3300031595 | Bacteria | 6187 |
| 418 | Ga0265313_10033183 | 3300031595 | Bacteria | 2627 |
| 419 | Ga0265313_10057445 | 3300031595 | Bacteria | 1837 |
| 420 | Ga0316575_10021842 | 3300031665 | Bacteria | 2467 |
| 421 | Ga0265314_10039560 | 3300031711 | Bacteria | 3394 |
| 422 | Ga0265342_10000807 | 3300031712 | Bacteria | 31481 |
| 423 | Ga0265342_10004144 | 3300031712 | Bacteria | 11539 |
| 424 | Ga0265342_10185477 | 3300031712 | Bacteria | 1137 |
| 425 | Ga0265342_10236214 | 3300031712 | Bacteria | 980 |
| 426 | Ga0307416_100578520 | 3300032002 | Bacteria | 1200 |
| 427 | Ga0307414_10315019 | 3300032004 | Bacteria | 1329 |
| 428 | Ga0307411_10064652 | 3300032005 | Bacteria | 2450 |
| 429 | Ga0316583_10029508 | 3300032133 | Bacteria | 1955 |
| 430 | Ga0373930_0002122 | 3300034816 | Unclassified | 3039 |
| 431 | Ga0373930_0041699 | 3300034816 | Bacteria | 980 |
| 432 | Ga0373948_0015571 | 3300034817 | Bacteria | 1397 |
| 433 | Ga0373948_0017194 | 3300034817 | Bacteria | 1345 |
| 434 | Ga0373938_0000060 | 3300034957 | Bacteria | 13928 |
| 435 | Ga0373926_0052232 | 3300035083 | Bacteria | 1477 |
| 436 | Ga0373928_0002099 | 3300035084 | Bacteria | 3891 |
| 437 | Ga0373928_0002309 | 3300035084 | Bacteria | 3704 |
| 438 | Ga0373929_0016449 | 3300035085 | Bacteria | 1449 |
| 439 | Ga0373940_0012286 | 3300035088 | Bacteria | 2049 |
| 440 | Ga0373940_0027836 | 3300035088 | Bacteria | 1488 |
| 441 | Ga0373944_0090275 | 3300035089 | Bacteria | 1023 |
| 442 | Ga0373949_0006592 | 3300035090 | Bacteria | 2552 |
| 443 | Ga0373949_0024510 | 3300035090 | Bacteria | 1403 |
| 444 | Ga0373949_0074800 | 3300035090 | Bacteria | 893 |
| 445 | Ga0373951_0017842 | 3300035091 | Bacteria | 1608 |
| 446 | Ga0373951_0064848 | 3300035091 | Bacteria | 920 |
| 447 | Ga0373952_0003451 | 3300035092 | Bacteria | 2852 |
| 448 | Ga0373952_0003689 | 3300035092 | Bacteria | 2765 |
| 449 | Ga0373952_0032655 | 3300035092 | Bacteria | 1164 |
| 450 | Ga0373923_0046600 | 3300035111 | Bacteria | 1804 |
| 451 | Ga0373923_0136853 | 3300035111 | Bacteria | 1105 |
| 452 | Ga0373932_0002546 | 3300035112 | Bacteria | 4567 |
| 453 | Ga0373932_0003334 | 3300035112 | Bacteria | 3874 |
| 454 | Ga0373936_0074531 | 3300035113 | Bacteria | 1404 |
| 455 | Ga0373939_0000354 | 3300035114 | Bacteria | 11613 |
| 456 | Ga0373939_0003245 | 3300035114 | Bacteria | 3810 |
| 457 | Ga0373939_0005961 | 3300035114 | Bacteria | 2919 |
| 458 | Ga0373941_0000729 | 3300035115 | Bacteria | 6757 |
| 459 | Ga0373941_0018605 | 3300035115 | Bacteria | 1921 |
| 460 | Ga0373945_0024660 | 3300035116 | Bacteria | 2085 |
| 461 | Ga0373945_0130469 | 3300035116 | Bacteria | 1006 |
| 462 | Ga0373954_0003357 | 3300035118 | Bacteria | 6778 |
| 463 | Ga0373956_0032682 | 3300035119 | Bacteria | 2284 |
| 464 | Ga0373957_0048971 | 3300035120 | Bacteria | 1612 |
| 465 | Ga0373960_0000114 | 3300035121 | Bacteria | 12986 |
| 466 | Ga0373960_0010353 | 3300035121 | Bacteria | 2276 |
| 467 | Ga0373943_0025585 | 3300035170 | Bacteria | 2759 |
| 468 | Ga0373946_0021196 | 3300035171 | Bacteria | 2518 |
| 469 | Ga0373946_0129034 | 3300035171 | Bacteria | 1161 |
| 470 | Ga0373955_0096661 | 3300035172 | Bacteria | 1690 |
| 471 | Ga0373942_0030402 | 3300035207 | Bacteria | 1423 |
| 472 | Ga0373961_0007426 | 3300035241 | Bacteria | 2650 |
| 473 | Ga0373961_0039634 | 3300035241 | Bacteria | 1354 |
| 474 | Ga0373961_0095828 | 3300035241 | Bacteria | 954 |
| 475 | Ga0373962_0001858 | 3300035242 | Bacteria | 5032 |
| 476 | Ga0373962_0010726 | 3300035242 | Bacteria | 2289 |
| 477 | Ga0373962_0021825 | 3300035242 | Bacteria | 1692 |
| 478 | Ga0373924_0052097 | 3300035410 | Bacteria | 1698 |
| 479 | Ga0373931_0005088 | 3300035691 | Bacteria | 6050 |
| 480 | Ga0373931_0005770 | 3300035691 | Bacteria | 5752 |
| 481 | Ga0373931_0011401 | 3300035691 | Bacteria | 4294 |
| 482 | Ga0373931_0067706 | 3300035691 | Bacteria | 1941 |
| 483 | Ga0373931_0171890 | 3300035691 | Bacteria | 1277 |
| 484 | Ga0373935_0039868 | 3300035692 | Bacteria | 2945 |
| 485 | Ga0373935_0115969 | 3300035692 | Bacteria | 1783 |
| 486 | Ga0373935_0225194 | 3300035692 | Bacteria | 1304 |
| 487 | Ga0373935_0229770 | 3300035692 | Bacteria | 1291 |
| 488 | Ga0373935_0233538 | 3300035692 | Bacteria | 1281 |
| 489 | Ga0373927_0033962 | 3300035695 | Bacteria | 3319 |
| 490 | Ga0373927_0185762 | 3300035695 | Bacteria | 1363 |
| 491 | Ga0373933_0456464 | 3300035724 | Bacteria | 836 |
| 492 | Ga0373947_0017482 | 3300035725 | Bacteria | 4125 |
| 493 | Ga0373937_0110446 | 3300036401 | Bacteria | 2557 |
| 494 | Ga0373937_0232459 | 3300036401 | Bacteria | 1736 |
| 495 | Ga0373937_0354592 | 3300036401 | Bacteria | 1390 |
| 496 | Ga0373925_0332372 | 3300037068 | Bacteria | 1231 |
| 497 | Ga0395899_0002674 | 3300037312 | Bacteria | 14372 |
| 498 | Ga0395900_0003303 | 3300037418 | Bacteria | 17453 |
| 499 | Ga0395898_0006986 | 3300037466 | Bacteria | 12000 |
| 500 | Ga0395898_0008249 | 3300037466 | Bacteria | 11015 |
| 501 | Ga0395901_0245506 | 3300038443 | Bacteria | 1866 |
| 502 | Ga0436365_0070766 | 3300039437 | Bacteria | 22318 |
| 503 | Ga0436365_0379418 | 3300039437 | Bacteria | 3311 |
| 504 | Ga0436363_0417802 | 3300039450 | Bacteria | 2105 |
| 505 | Ga0439455_0031484 | 3300042012 | Bacteria | 1321 |
| 506 | Ga0439464_0056907 | 3300042439 | Bacteria | 1139 |
| 507 | Ga0466961_0131588 | 3300044693 | Bacteria | 1568 |
| 508 | Ga0466963_0237663 | 3300044694 | Bacteria | 1277 |
| 509 | Ga0466957_0081528 | 3300044842 | Bacteria | 2015 |
| 510 | Ga0466960_0127631 | 3300044901 | Bacteria | 1339 |
| 511 | Ga0466967_0030498 | 3300045976 | Bacteria | 4526 |
| 512 | Ga0466967_0182759 | 3300045976 | Bacteria | 1979 |
| 513 | Ga0466967_0357229 | 3300045976 | Bacteria | 1415 |
| 514 | Ga0495592_0056089 | 3300046454 | Bacteria | 2912 |
| 515 | Ga0495592_0103108 | 3300046454 | Bacteria | 2030 |
| 516 | Ga0495603_0049063 | 3300046455 | Bacteria | 2513 |
| 517 | Ga0495629_0001773 | 3300046459 | Bacteria | 16935 |
| 518 | Ga0495641_0077498 | 3300046461 | Bacteria | 1490 |
| 519 | Ga0495641_0091317 | 3300046461 | Bacteria | 1360 |
| 520 | Ga0495651_0008470 | 3300046462 | Bacteria | 7880 |
| 521 | Ga0495653_0044857 | 3300046463 | Bacteria | 3430 |
| 522 | Ga0495653_0049099 | 3300046463 | Bacteria | 3253 |
| 523 | Ga0495653_0073549 | 3300046463 | Bacteria | 2550 |
| 524 | Ga0495653_0245034 | 3300046463 | Bacteria | 1192 |
| 525 | Ga0495580_0082718 | 3300046472 | Bacteria | 2237 |
| 526 | Ga0495580_0185405 | 3300046472 | Bacteria | 1436 |
| 527 | Ga0495580_0300229 | 3300046472 | Bacteria | 1094 |
| 528 | Ga0495639_0010519 | 3300046475 | Bacteria | 3984 |
| 529 | Ga0495639_0058195 | 3300046475 | Bacteria | 1767 |
| 530 | Ga0495662_0000862 | 3300046476 | Bacteria | 14797 |
| 531 | Ga0495662_0006475 | 3300046476 | Bacteria | 5849 |
| 532 | Ga0495662_0104251 | 3300046476 | Bacteria | 1387 |
| 533 | Ga0495664_0003765 | 3300046477 | Bacteria | 8279 |
| 534 | Ga0495585_0015702 | 3300046492 | Bacteria | 4397 |
| 535 | Ga0495594_0025402 | 3300046499 | Bacteria | 3184 |
| 536 | Ga0495607_0028101 | 3300046501 | Bacteria | 3473 |
| 537 | Ga0495608_0057938 | 3300046511 | Bacteria | 2555 |
| 538 | Ga0495618_0140557 | 3300046514 | Bacteria | 1544 |
| 539 | Ga0495628_0049236 | 3300046516 | Bacteria | 3337 |
| 540 | Ga0495628_0344817 | 3300046516 | Bacteria | 1096 |
| 541 | Ga0495630_0300509 | 3300046517 | Bacteria | 1226 |
| 542 | Ga0495644_0001471 | 3300046523 | Bacteria | 9606 |
| 543 | Ga0495666_0076114 | 3300046526 | Bacteria | 1591 |
| 544 | Ga0495652_0021427 | 3300046529 | Bacteria | 5746 |
| 545 | Ga0495652_0045513 | 3300046529 | Bacteria | 3771 |
| 546 | Ga0495652_0139129 | 3300046529 | Bacteria | 1911 |
| 547 | Ga0495665_0075844 | 3300046531 | Bacteria | 1770 |
| 548 | Ga0495640_0072445 | 3300046533 | Bacteria | 2309 |
| 549 | Ga0495640_0096683 | 3300046533 | Bacteria | 1943 |
| 550 | Ga0495587_0069138 | 3300046536 | Bacteria | 2056 |
| 551 | Ga0495587_0093676 | 3300046536 | Bacteria | 1734 |
| 552 | Ga0495609_0119402 | 3300046538 | Bacteria | 1134 |
| 553 | Ga0495621_0056368 | 3300046539 | Bacteria | 1417 |
| 554 | Ga0495645_0031035 | 3300046543 | Bacteria | 3892 |
| 555 | Ga0495645_0149353 | 3300046543 | Bacteria | 1625 |
| 556 | Ga0495645_0157530 | 3300046543 | Bacteria | 1572 |
| 557 | Ga0495645_0302413 | 3300046543 | Bacteria | 1044 |
| 558 | Ga0495633_0005211 | 3300046558 | Bacteria | 8021 |
| 559 | Ga0495667_0042465 | 3300046559 | Bacteria | 3015 |
| 560 | Ga0495667_0132750 | 3300046559 | Bacteria | 1606 |
| 561 | Ga0495656_0007359 | 3300046615 | Bacteria | 3887 |
| 562 | Ga0495634_0009441 | 3300046642 | Bacteria | 7195 |
| 563 | Ga0495634_0094322 | 3300046642 | Bacteria | 1939 |
| 564 | Ga0495611_0125324 | 3300046648 | Bacteria | 1198 |
| 565 | Ga0495635_0012909 | 3300046663 | Bacteria | 5849 |
| 566 | Ga0495635_0021945 | 3300046663 | Bacteria | 4449 |
| 567 | Ga0495635_0118712 | 3300046663 | Bacteria | 1804 |
| 568 | Ga0495635_0364867 | 3300046663 | Bacteria | 962 |
| 569 | Ga0495588_0152784 | 3300046674 | Bacteria | 1220 |
| 570 | Ga0495646_0009338 | 3300046680 | Bacteria | 6223 |
| 571 | Ga0495647_0040938 | 3300046681 | Bacteria | 1762 |
| 572 | Ga0495647_0056768 | 3300046681 | Bacteria | 1535 |
| 573 | Ga0495658_0005766 | 3300046683 | Bacteria | 6082 |
| 574 | Ga0495669_0002627 | 3300046684 | Bacteria | 7347 |
| 575 | Ga0495613_0010751 | 3300046689 | Bacteria | 6788 |
| 576 | Ga0495613_0423506 | 3300046689 | Bacteria | 905 |
| 577 | Ga0495624_0022669 | 3300046690 | Bacteria | 4146 |
| 578 | Ga0495624_0092800 | 3300046690 | Bacteria | 1861 |
| 579 | Ga0495670_0002981 | 3300046691 | Bacteria | 8344 |
| 580 | Ga0495581_0071081 | 3300047315 | Bacteria | 2014 |
| 581 | Ga0495581_0174252 | 3300047315 | Bacteria | 1258 |
| 582 | Ga0495604_0105375 | 3300047317 | Bacteria | 2064 |
| 583 | Ga0495604_0260266 | 3300047317 | Bacteria | 1179 |
| 584 | Ga0495604_0311425 | 3300047317 | Bacteria | 1055 |
| 585 | Ga0495674_0013643 | 3300047319 | Bacteria | 7633 |
| 586 | Ga0495674_0099852 | 3300047319 | Bacteria | 2470 |
| 587 | Ga0495676_0093487 | 3300047321 | Bacteria | 2242 |
| 588 | Ga0495676_0207648 | 3300047321 | Bacteria | 1357 |
| 589 | Ga0495676_0251510 | 3300047321 | Bacteria | 1205 |
| 590 | Ga0495680_0149439 | 3300047322 | Bacteria | 1704 |
| 591 | Ga0495680_0202209 | 3300047322 | Bacteria | 1424 |
| 592 | Ga0495677_0069897 | 3300047445 | Bacteria | 1308 |
| 593 | Ga0495684_0002658 | 3300047471 | Bacteria | 14168 |
| 594 | Ga0495684_0018177 | 3300047471 | Bacteria | 5417 |
| 595 | Ga0495593_0014389 | 3300047673 | Bacteria | 4499 |
| 596 | Ga0495593_0400814 | 3300047673 | Bacteria | 686 |
| 597 | Ga0495602_0153107 | 3300048088 | Bacteria | 1809 |
| 598 | Ga0495614_0140945 | 3300048089 | Bacteria | 1071 |
| 599 | Ga0496100_0005485 | 3300048903 | Bacteria | 6837 |
| 600 | Ga0496101_0185246 | 3300048904 | Bacteria | 1604 |
| 601 | Ga0496102_0000857 | 3300048905 | Bacteria | 29213 |
| 602 | Ga0496102_0416944 | 3300048905 | Bacteria | 1261 |
| 603 | Ga0496103_0001402 | 3300048906 | Bacteria | 16210 |
| 604 | Ga0496103_0099258 | 3300048906 | Bacteria | 1842 |
| 605 | Ga0496103_0169505 | 3300048906 | Bacteria | 1401 |
| 606 | Ga0496104_0003432 | 3300048907 | Bacteria | 13669 |
| 607 | Ga0496104_0009004 | 3300048907 | Bacteria | 8877 |
| 608 | Ga0496104_0075925 | 3300048907 | Bacteria | 3200 |
| 609 | Ga0496104_0191154 | 3300048907 | Bacteria | 1958 |
| 610 | Ga0496104_0242307 | 3300048907 | Bacteria | 1715 |
| 611 | Ga0496104_0541858 | 3300048907 | Bacteria | 1074 |
| 612 | Ga0496105_0025746 | 3300048908 | Bacteria | 4793 |
| 613 | Ga0496105_0251297 | 3300048908 | Bacteria | 1432 |
| 614 | Ga0496105_0285638 | 3300048908 | Bacteria | 1329 |
| 615 | Ga0496105_0468577 | 3300048908 | Bacteria | 992 |
| 616 | Ga0496106_0026946 | 3300048909 | Bacteria | 4280 |
| 617 | Ga0496106_0039849 | 3300048909 | Bacteria | 3518 |
| 618 | Ga0496106_0129103 | 3300048909 | Bacteria | 1981 |
| 619 | Ga0496107_0035893 | 3300048910 | Bacteria | 3555 |
| 620 | Ga0496107_0081619 | 3300048910 | Bacteria | 2358 |
| 621 | Ga0496107_0323170 | 3300048910 | Bacteria | 1148 |
| 622 | Ga0496108_0003866 | 3300048911 | Bacteria | 12025 |
| 623 | Ga0496109_0005368 | 3300048912 | Bacteria | 10715 |
| 624 | Ga0496109_0029090 | 3300048912 | Bacteria | 4946 |
| 625 | Ga0496109_0143389 | 3300048912 | Bacteria | 2234 |
| 626 | Ga0496110_0012589 | 3300048913 | Bacteria | 6957 |
| 627 | Ga0496110_0056112 | 3300048913 | Bacteria | 3466 |
| 628 | Ga0496110_0184148 | 3300048913 | Bacteria | 1896 |
| 629 | Ga0496110_0204685 | 3300048913 | Bacteria | 1793 |
| 630 | Ga0496110_0230537 | 3300048913 | Bacteria | 1684 |
| 631 | Ga0496110_0330239 | 3300048913 | Bacteria | 1389 |
| 632 | Ga0496111_0046069 | 3300048914 | Bacteria | 3139 |
| 633 | Ga0496111_0053597 | 3300048914 | Bacteria | 2914 |
| 634 | Ga0496111_0152709 | 3300048914 | Bacteria | 1713 |
| 635 | Ga0496111_0235983 | 3300048914 | Bacteria | 1358 |
| 636 | Ga0496112_0004182 | 3300048915 | Bacteria | 12158 |
| 637 | Ga0496112_0138306 | 3300048915 | Bacteria | 2405 |
| 638 | Ga0496112_0227365 | 3300048915 | Bacteria | 1821 |
| 639 | Ga0496112_0487329 | 3300048915 | Bacteria | 1169 |
| 640 | Ga0496112_0505139 | 3300048915 | Bacteria | 1144 |
| 641 | Ga0496113_0018247 | 3300048916 | Bacteria | 4885 |
| 642 | Ga0496113_0052028 | 3300048916 | Bacteria | 3057 |
| 643 | Ga0496113_0319161 | 3300048916 | Bacteria | 1245 |
| 644 | Ga0496114_0001715 | 3300048917 | Bacteria | 16640 |
| 645 | Ga0496114_0738561 | 3300048917 | Bacteria | 861 |
| 646 | Ga0496115_0003668 | 3300048918 | Bacteria | 11050 |
| 647 | Ga0496115_0005508 | 3300048918 | Bacteria | 9214 |
| 648 | Ga0496115_0051574 | 3300048918 | Bacteria | 3298 |
| 649 | Ga0496115_0440846 | 3300048918 | Bacteria | 1053 |
| 650 | Ga0496126_0187964 | 3300048929 | Bacteria | 1751 |
| 651 | Ga0501318_013502 | 3300049534 | Bacteria | 951 |
| 652 | Ga0501031_0053884 | 3300049568 | Bacteria | 2622 |
| 653 | Ga0501032_0295081 | 3300049569 | Bacteria | 1048 |
| 654 | Ga0501034_0005441 | 3300049571 | Bacteria | 13914 |
| 655 | Ga0501034_0022069 | 3300049571 | Bacteria | 6486 |
| 656 | Ga0501034_0104559 | 3300049571 | Bacteria | 2825 |
| 657 | Ga0501034_0451479 | 3300049571 | Bacteria | 1203 |
| 658 | Ga0501037_0023203 | 3300049573 | Bacteria | 4588 |
| 659 | Ga0501037_0073718 | 3300049573 | Bacteria | 2482 |
| 660 | Ga0501038_0101979 | 3300049574 | Bacteria | 2389 |
| 661 | Ga0501038_0150082 | 3300049574 | Bacteria | 1901 |
| 662 | Ga0501038_0372742 | 3300049574 | Bacteria | 1108 |
| 663 | Ga0501043_0051671 | 3300049579 | Bacteria | 3229 |
| 664 | Ga0501047_0000218 | 3300049581 | Bacteria | 68952 |
| 665 | Ga0501047_0007054 | 3300049581 | Bacteria | 10551 |
| 666 | Ga0501047_0452222 | 3300049581 | Bacteria | 1114 |
| 667 | Ga0501048_0000762 | 3300049582 | Bacteria | 23616 |
| 668 | Ga0501067_0099398 | 3300049583 | Bacteria | 1616 |
| 669 | Ga0501069_0109809 | 3300049585 | Bacteria | 1570 |
| 670 | Ga0501070_0011908 | 3300049586 | Bacteria | 7346 |
| 671 | Ga0501070_0064609 | 3300049586 | Bacteria | 3030 |
| 672 | Ga0501070_0565039 | 3300049586 | Bacteria | 909 |
| 673 | Ga0501073_0016647 | 3300049589 | Bacteria | 5327 |
| 674 | Ga0501073_0072277 | 3300049589 | Bacteria | 2402 |
| 675 | Ga0501074_0203616 | 3300049590 | Bacteria | 1410 |
| 676 | Ga0501079_0195819 | 3300049741 | Bacteria | 1578 |
| 677 | Ga0501079_0327996 | 3300049741 | Bacteria | 1199 |
| 678 | Ga0501080_0000489 | 3300049742 | Bacteria | 30879 |
| 679 | Ga0501080_0174437 | 3300049742 | Bacteria | 1981 |
| 680 | Ga0501083_0035521 | 3300049744 | Bacteria | 3404 |
| 681 | Ga0501083_0073874 | 3300049744 | Bacteria | 2266 |
| 682 | Ga0501035_0294672 | 3300049822 | Bacteria | 1368 |
| 683 | Ga0501044_0000822 | 3300049823 | Bacteria | 37410 |
| 684 | Ga0501044_0000931 | 3300049823 | Bacteria | 35180 |
| 685 | Ga0501044_0028137 | 3300049823 | Bacteria | 5933 |
| 686 | Ga0501044_0054761 | 3300049823 | Bacteria | 4099 |
| 687 | nmdc:mga06z11_86137_c1 | 3300050494 | Bacteria | 1696 |
| 688 | nmdc:mga07m45_82627_c1 | 3300050496 | Bacteria | 1835 |
| 689 | nmdc:mga05p37_238950_c1 | 3300050507 | Bacteria | 2186 |
| 690 | nmdc:mga05p37_415996_c1 | 3300050507 | Bacteria | 1566 |
| 691 | nmdc:mga09592_224785_c1 | 3300050508 | Bacteria | 1626 |
| 692 | nmdc:mga09592_487620_c1 | 3300050508 | Bacteria | 1062 |
| 693 | nmdc:mga0qj67_11473_c1 | 3300050509 | Bacteria | 6641 |
| 694 | nmdc:mga0qj67_274379_c1 | 3300050509 | Bacteria | 904 |
| 695 | nmdc:mga0qj67_98625_c1 | 3300050509 | Bacteria | 2354 |
| 696 | nmdc:mga06r32_112677_c1 | 3300050510 | Bacteria | 2677 |
| 697 | nmdc:mga06r32_117970_c1 | 3300050510 | Bacteria | 2616 |
| 698 | nmdc:mga06r32_65348_c1 | 3300050510 | Bacteria | 3509 |
| 699 | nmdc:mga08y16_137324_c1 | 3300050511 | Bacteria | 2542 |
| 700 | nmdc:mga08y16_248815_c1 | 3300050511 | Bacteria | 1837 |
| 701 | nmdc:mga0n895_1013778_c1 | 3300050512 | Bacteria | 811 |
| 702 | nmdc:mga0n895_145344_c1 | 3300050512 | Bacteria | 2401 |
| 703 | nmdc:mga0n895_216859_c1 | 3300050512 | Bacteria | 1943 |
| 704 | nmdc:mga0n895_292442_c1 | 3300050512 | Bacteria | 1651 |
| 705 | nmdc:mga0n895_6097_c1 | 3300050512 | Bacteria | 10177 |
| 706 | nmdc:mga0n895_6117_c1 | 3300050512 | Bacteria | 10162 |
| 707 | nmdc:mga0n895_902858_c1 | 3300050512 | Bacteria | 869 |
| 708 | nmdc:mga0rr50_108460_c1 | 3300050513 | Bacteria | 2193 |
| 709 | nmdc:mga0rr50_296815_c1 | 3300050513 | Bacteria | 1351 |
| 710 | nmdc:mga0rr50_479651_c1 | 3300050513 | Bacteria | 1056 |
| 711 | nmdc:mga0rr50_482060_c1 | 3300050513 | Bacteria | 1053 |
| 712 | nmdc:mga0rr50_7816_c1 | 3300050513 | Bacteria | 6628 |
| 713 | nmdc:mga08x19_275320_c1 | 3300050514 | Bacteria | 1165 |
| 714 | nmdc:mga08x19_354033_c1 | 3300050514 | Bacteria | 1025 |
| 715 | nmdc:mga0a205_18984_c1 | 3300050515 | Bacteria | 6478 |
| 716 | nmdc:mga0a205_386734_c1 | 3300050515 | Bacteria | 1264 |
| 717 | nmdc:mga0a205_8435_c1 | 3300050515 | Bacteria | 9377 |
| 718 | Ga0495601_0005540 | 3300053077 | Bacteria | 7366 |
| 719 | Ga0495601_0005957 | 3300053077 | Bacteria | 7113 |
| 720 | Ga0495601_0012093 | 3300053077 | Bacteria | 5173 |
| 721 | Ga0495601_0098247 | 3300053077 | Bacteria | 1889 |
| 722 | Ga0495601_0098855 | 3300053077 | Bacteria | 1883 |
| 723 | Ga0495601_0134512 | 3300053077 | Bacteria | 1611 |
| 724 | Ga0495612_0004268 | 3300053078 | Bacteria | 5937 |
| 725 | Ga0495612_0026304 | 3300053078 | Bacteria | 2338 |
| 726 | Ga0495612_0066058 | 3300053078 | Bacteria | 1503 |
| 727 | Ga0495595_0003051 | 3300053084 | Bacteria | 6620 |
| 728 | Ga0495595_0038503 | 3300053084 | Bacteria | 2178 |
| 729 | Ga0495619_0000043 | 3300053085 | Bacteria | 109865 |
| 730 | Ga0495619_0003707 | 3300053085 | Bacteria | 9849 |
| 731 | Ga0495619_0007997 | 3300053085 | Bacteria | 6693 |
| 732 | Ga0495619_0010056 | 3300053085 | Bacteria | 5954 |
| 733 | Ga0495619_0072311 | 3300053085 | Bacteria | 2309 |
| 734 | Ga0500616_0171940 | 3300053153 | Bacteria | 983 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100976386 | Ga0070714_1009763861 | 211 |
| 2 | 3300025915 | Ga0207693_10149824 | Ga0207693_101498242 | 211 |
| 3 | 3300047673 | Ga0495593_0400814 | Ga0495593_0400814_34_669 | 211 |
| 4 | 3300005353 | Ga0070669_100344318 | Ga0070669_1003443182 | 228 |
| 5 | iso_pu_bacteria | 2513237087 | 2513591060 | 230 |
| 6 | iso_pu_bacteria | 8045864390 | 8045867754 | 230 |
| 7 | iso_pu_bacteria | 2508501114 | 2509078414 | 231 |
| 8 | iso_pu_bacteria | 2773857925 | 2774872609 | 231 |
| 9 | iso_pu_bacteria | 2775506901 | 2776259625 | 231 |
| 10 | iso_pu_bacteria | 2835312727 | 2835315454 | 231 |
| 11 | iso_pu_bacteria | 2841911363 | 2841911909 | 231 |
| 12 | iso_pu_bacteria | 2841917233 | 2841921362 | 231 |
| 13 | iso_pu_bacteria | 2882456835 | 2882458206 | 231 |
| 14 | iso_pu_bacteria | 2884298095 | 2884299824 | 231 |
| 15 | iso_pu_bacteria | 2894232714 | 2894239667 | 231 |
| 16 | 3300005616 | Ga0068852_100563421 | Ga0068852_1005634212 | 232 |
| 17 | 3300017792 | Ga0163161_10298124 | Ga0163161_102981241 | 232 |
| 18 | 3300025912 | Ga0207707_10149287 | Ga0207707_101492873 | 232 |
| 19 | 3300035241 | Ga0373961_0095828 | Ga0373961_0095828_90_800 | 232 |
| 20 | 3300005434 | Ga0070709_10334425 | Ga0070709_103344251 | 233 |
| 21 | 3300005457 | Ga0070662_100531376 | Ga0070662_1005313761 | 233 |
| 22 | 3300005544 | Ga0070686_100038034 | Ga0070686_1000380343 | 233 |
| 23 | 3300005937 | Ga0081455_10000028 | Ga0081455_1000002855 | 233 |
| 24 | 3300006846 | Ga0075430_100120670 | Ga0075430_1001206703 | 233 |
| 25 | 3300006846 | Ga0075430_100423031 | Ga0075430_1004230311 | 233 |
| 26 | 3300006847 | Ga0075431_100252555 | Ga0075431_1002525552 | 233 |
| 27 | 3300006852 | Ga0075433_10001386 | Ga0075433_100013863 | 233 |
| 28 | 3300006852 | Ga0075433_10068230 | Ga0075433_100682303 | 233 |
| 29 | 3300006871 | Ga0075434_100001186 | Ga0075434_10000118610 | 233 |
| 30 | 3300006880 | Ga0075429_100038699 | Ga0075429_1000386994 | 233 |
| 31 | 3300006880 | Ga0075429_100535484 | Ga0075429_1005354842 | 233 |
| 32 | 3300007076 | Ga0075435_100017607 | Ga0075435_1000176073 | 233 |
| 33 | 3300009098 | Ga0105245_10204325 | Ga0105245_102043252 | 233 |
| 34 | 3300014325 | Ga0163163_10284043 | Ga0163163_102840432 | 233 |
| 35 | 3300025900 | Ga0207710_10206923 | Ga0207710_102069231 | 233 |
| 36 | 3300025933 | Ga0207706_10541153 | Ga0207706_105411531 | 233 |
| 37 | 3300025936 | Ga0207670_10006498 | Ga0207670_100064983 | 233 |
| 38 | 3300025936 | Ga0207670_10486686 | Ga0207670_104866861 | 233 |
| 39 | 3300027907 | Ga0207428_10135243 | Ga0207428_101352432 | 233 |
| 40 | 3300034816 | Ga0373930_0041699 | Ga0373930_0041699_180_884 | 233 |
| 41 | 3300034817 | Ga0373948_0017194 | Ga0373948_0017194_608_1312 | 233 |
| 42 | 3300035114 | Ga0373939_0003245 | Ga0373939_0003245_1966_2670 | 233 |
| 43 | 3300035121 | Ga0373960_0010353 | Ga0373960_0010353_1168_1872 | 233 |
| 44 | 3300035241 | Ga0373961_0039634 | Ga0373961_0039634_425_1129 | 233 |
| 45 | 3300035242 | Ga0373962_0021825 | Ga0373962_0021825_206_910 | 233 |
| 46 | 3300035691 | Ga0373931_0005770 | Ga0373931_0005770_1042_1746 | 233 |
| 47 | 3300048907 | Ga0496104_0003432 | Ga0496104_0003432_3692_4396 | 233 |
| 48 | 3300048908 | Ga0496105_0285638 | Ga0496105_0285638_112_816 | 233 |
| 49 | 3300048909 | Ga0496106_0039849 | Ga0496106_0039849_2735_3439 | 233 |
| 50 | 3300048912 | Ga0496109_0143389 | Ga0496109_0143389_408_1112 | 233 |
| 51 | 3300048913 | Ga0496110_0012589 | Ga0496110_0012589_278_982 | 233 |
| 52 | 3300048914 | Ga0496111_0046069 | Ga0496111_0046069_1332_2036 | 233 |
| 53 | 3300048914 | Ga0496111_0152709 | Ga0496111_0152709_187_891 | 233 |
| 54 | 3300048915 | Ga0496112_0227365 | Ga0496112_0227365_565_1269 | 233 |
| 55 | 3300048915 | Ga0496112_0487329 | Ga0496112_0487329_205_909 | 233 |
| 56 | 3300048918 | Ga0496115_0005508 | Ga0496115_0005508_4548_5252 | 233 |
| 57 | 3300049571 | Ga0501034_0022069 | Ga0501034_0022069_4663_5370 | 233 |
| 58 | 3300050508 | nmdc:mga09592_224785_c1 | nmdc:mga09592_224785_c1_127_831 | 233 |
| 59 | 3300050508 | nmdc:mga09592_487620_c1 | nmdc:mga09592_487620_c1_153_857 | 233 |
| 60 | 3300050509 | nmdc:mga0qj67_11473_c1 | nmdc:mga0qj67_11473_c1_427_1131 | 233 |
| 61 | 3300050509 | nmdc:mga0qj67_274379_c1 | nmdc:mga0qj67_274379_c1_94_798 | 233 |
| 62 | 3300050510 | nmdc:mga06r32_112677_c1 | nmdc:mga06r32_112677_c1_1159_1863 | 233 |
| 63 | 3300050510 | nmdc:mga06r32_117970_c1 | nmdc:mga06r32_117970_c1_785_1489 | 233 |
| 64 | 3300050510 | nmdc:mga06r32_65348_c1 | nmdc:mga06r32_65348_c1_1174_1878 | 233 |
| 65 | 3300050512 | nmdc:mga0n895_1013778_c1 | nmdc:mga0n895_1013778_c1_14_718 | 233 |
| 66 | 3300050512 | nmdc:mga0n895_6117_c1 | nmdc:mga0n895_6117_c1_7453_8157 | 233 |
| 67 | 3300050515 | nmdc:mga0a205_8435_c1 | nmdc:mga0a205_8435_c1_1006_1710 | 233 |
| 68 | 3300003187 | JGI25151J46595_10000086 | JGI25151J46595_1000008696 | 234 |
| 69 | 3300003215 | JGI25153J46596_10006736 | JGI25153J46596_100067365 | 234 |
| 70 | 3300003771 | Ga0055526_1000371 | Ga0055526_100037120 | 234 |
| 71 | 3300005455 | Ga0070663_100581151 | Ga0070663_1005811512 | 234 |
| 72 | 3300006048 | Ga0075363_100148335 | Ga0075363_1001483352 | 234 |
| 73 | 3300006058 | Ga0075432_10074372 | Ga0075432_100743722 | 234 |
| 74 | 3300007076 | Ga0075435_100167915 | Ga0075435_1001679152 | 234 |
| 75 | 3300009148 | Ga0105243_10343414 | Ga0105243_103434141 | 234 |
| 76 | 3300014326 | Ga0157380_10097749 | Ga0157380_100977493 | 234 |
| 77 | 3300025297 | Ga0209758_1009129 | Ga0209758_10091293 | 234 |
| 78 | 3300025901 | Ga0207688_10041092 | Ga0207688_100410924 | 234 |
| 79 | 3300025949 | Ga0207667_10275509 | Ga0207667_102755093 | 234 |
| 80 | 3300025972 | Ga0207668_10193755 | Ga0207668_101937552 | 234 |
| 81 | 3300026078 | Ga0207702_10122792 | Ga0207702_101227922 | 234 |
| 82 | 3300032004 | Ga0307414_10315019 | Ga0307414_103150192 | 234 |
| 83 | 3300032005 | Ga0307411_10064652 | Ga0307411_100646521 | 234 |
| 84 | 3300048917 | Ga0496114_0738561 | Ga0496114_0738561_46_753 | 234 |
| 85 | 3300049534 | Ga0501318_013502 | Ga0501318_013502_36_743 | 234 |
| 86 | 3300050494 | nmdc:mga06z11_86137_c1 | nmdc:mga06z11_86137_c1_431_1195 | 234 |
| 87 | 3300050512 | nmdc:mga0n895_145344_c1 | nmdc:mga0n895_145344_c1_842_1549 | 234 |
| 88 | 3300050513 | nmdc:mga0rr50_7816_c1 | nmdc:mga0rr50_7816_c1_5401_6108 | 234 |
| 89 | 3300053153 | Ga0500616_0171940 | Ga0500616_0171940_95_838 | 234 |
| 90 | 3300005456 | Ga0070678_100379491 | Ga0070678_1003794911 | 235 |
| 91 | 3300009176 | Ga0105242_10177227 | Ga0105242_101772271 | 235 |
| 92 | 3300026095 | Ga0207676_10162583 | Ga0207676_101625832 | 235 |
| 93 | 3300035691 | Ga0373931_0067706 | Ga0373931_0067706_987_1742 | 235 |
| 94 | 3300048905 | Ga0496102_0416944 | Ga0496102_0416944_473_1228 | 235 |
| 95 | 3300048906 | Ga0496103_0099258 | Ga0496103_0099258_1046_1801 | 235 |
| 96 | 3300048907 | Ga0496104_0191154 | Ga0496104_0191154_73_828 | 235 |
| 97 | 3300048908 | Ga0496105_0025746 | Ga0496105_0025746_229_984 | 235 |
| 98 | 3300048909 | Ga0496106_0129103 | Ga0496106_0129103_236_991 | 235 |
| 99 | 3300048910 | Ga0496107_0323170 | Ga0496107_0323170_64_819 | 235 |
| 100 | 3300048913 | Ga0496110_0056112 | Ga0496110_0056112_1357_2112 | 235 |
| 101 | 3300048916 | Ga0496113_0319161 | Ga0496113_0319161_174_929 | 235 |
| 102 | 3300048918 | Ga0496115_0051574 | Ga0496115_0051574_1447_2202 | 235 |
| 103 | 3300050513 | nmdc:mga0rr50_482060_c1 | nmdc:mga0rr50_482060_c1_218_973 | 235 |
| 104 | 3300053077 | Ga0495601_0134512 | Ga0495601_0134512_632_1387 | 235 |
| 105 | 3300032002 | Ga0307416_100578520 | Ga0307416_1005785202 | 236 |
| 106 | 3300035114 | Ga0373939_0005961 | Ga0373939_0005961_465_1238 | 236 |
| 107 | 3300005564 | Ga0070664_100417004 | Ga0070664_1004170041 | 237 |
| 108 | 3300005937 | Ga0081455_10009936 | Ga0081455_1000993610 | 237 |
| 109 | 3300006846 | Ga0075430_100031292 | Ga0075430_1000312923 | 237 |
| 110 | 3300006852 | Ga0075433_10018647 | Ga0075433_100186472 | 237 |
| 111 | 3300006914 | Ga0075436_100255479 | Ga0075436_1002554791 | 237 |
| 112 | 3300009147 | Ga0114129_10072717 | Ga0114129_100727173 | 237 |
| 113 | 3300027907 | Ga0207428_10000216 | Ga0207428_100002165 | 237 |
| 114 | 3300037312 | Ga0395899_0002674 | Ga0395899_0002674_5708_6487 | 237 |
| 115 | 3300037418 | Ga0395900_0003303 | Ga0395900_0003303_16058_16837 | 237 |
| 116 | 3300037466 | Ga0395898_0006986 | Ga0395898_0006986_9980_10759 | 237 |
| 117 | 3300038443 | Ga0395901_0245506 | Ga0395901_0245506_693_1472 | 237 |
| 118 | 3300039437 | Ga0436365_0070766 | Ga0436365_0070766_19618_20364 | 237 |
| 119 | 3300044842 | Ga0466957_0081528 | Ga0466957_0081528_141_908 | 237 |
| 120 | 3300045976 | Ga0466967_0182759 | Ga0466967_0182759_1201_1968 | 237 |
| 121 | 3300048929 | Ga0496126_0187964 | Ga0496126_0187964_120_974 | 237 |
| 122 | 3300049571 | Ga0501034_0104559 | Ga0501034_0104559_1666_2409 | 237 |
| 123 | 3300049822 | Ga0501035_0294672 | Ga0501035_0294672_65_883 | 237 |
| 124 | 3300049823 | Ga0501044_0000822 | Ga0501044_0000822_33117_33860 | 237 |
| 125 | 3300050507 | nmdc:mga05p37_238950_c1 | nmdc:mga05p37_238950_c1_1255_2043 | 237 |
| 126 | 3300050507 | nmdc:mga05p37_415996_c1 | nmdc:mga05p37_415996_c1_712_1500 | 237 |
| 127 | 3300050509 | nmdc:mga0qj67_98625_c1 | nmdc:mga0qj67_98625_c1_443_1231 | 237 |
| 128 | 3300050513 | nmdc:mga0rr50_108460_c1 | nmdc:mga0rr50_108460_c1_299_1087 | 237 |
| 129 | 3300050514 | nmdc:mga08x19_275320_c1 | nmdc:mga08x19_275320_c1_352_1140 | 237 |
| 130 | 3300050515 | nmdc:mga0a205_18984_c1 | nmdc:mga0a205_18984_c1_5608_6396 | 237 |
| 131 | 3300050515 | nmdc:mga0a205_386734_c1 | nmdc:mga0a205_386734_c1_90_878 | 237 |
| 132 | 3300005327 | Ga0070658_10038385 | Ga0070658_100383856 | 238 |
| 133 | 3300005336 | Ga0070680_100123385 | Ga0070680_1001233854 | 238 |
| 134 | 3300005435 | Ga0070714_100410973 | Ga0070714_1004109731 | 238 |
| 135 | 3300005563 | Ga0068855_100356364 | Ga0068855_1003563643 | 238 |
| 136 | 3300006194 | Ga0075427_10008231 | Ga0075427_100082312 | 238 |
| 137 | 3300009094 | Ga0111539_10301194 | Ga0111539_103011942 | 238 |
| 138 | 3300025909 | Ga0207705_10107127 | Ga0207705_101071272 | 238 |
| 139 | 3300025919 | Ga0207657_10148869 | Ga0207657_101488692 | 238 |
| 140 | 3300025921 | Ga0207652_10210104 | Ga0207652_102101042 | 238 |
| 141 | 3300025932 | Ga0207690_10469920 | Ga0207690_104699201 | 238 |
| 142 | 3300025949 | Ga0207667_10140537 | Ga0207667_101405372 | 238 |
| 143 | 3300026078 | Ga0207702_10795749 | Ga0207702_107957491 | 238 |
| 144 | 3300028800 | Ga0265338_10034833 | Ga0265338_100348334 | 238 |
| 145 | 3300031235 | Ga0265330_10119049 | Ga0265330_101190492 | 238 |
| 146 | 3300031241 | Ga0265325_10012604 | Ga0265325_100126044 | 238 |
| 147 | 3300031249 | Ga0265339_10150744 | Ga0265339_101507442 | 238 |
| 148 | 3300031249 | Ga0265339_10171751 | Ga0265339_101717512 | 238 |
| 149 | 3300031595 | Ga0265313_10033183 | Ga0265313_100331832 | 238 |
| 150 | 3300031665 | Ga0316575_10021842 | Ga0316575_100218424 | 238 |
| 151 | 3300031712 | Ga0265342_10000807 | Ga0265342_1000080713 | 238 |
| 152 | 3300031712 | Ga0265342_10004144 | Ga0265342_1000414411 | 238 |
| 153 | 3300048907 | Ga0496104_0009004 | Ga0496104_0009004_466_1239 | 238 |
| 154 | 3300048918 | Ga0496115_0440846 | Ga0496115_0440846_91_864 | 238 |
| 155 | 3300049581 | Ga0501047_0007054 | Ga0501047_0007054_7011_7814 | 238 |
| 156 | 3300005295 | Ga0065707_10231548 | Ga0065707_102315481 | 239 |
| 157 | 3300005339 | Ga0070660_100145147 | Ga0070660_1001451471 | 239 |
| 158 | 3300005367 | Ga0070667_100330758 | Ga0070667_1003307582 | 239 |
| 159 | 3300005434 | Ga0070709_10268758 | Ga0070709_102687581 | 239 |
| 160 | 3300005435 | Ga0070714_100090919 | Ga0070714_1000909192 | 239 |
| 161 | 3300006173 | Ga0070716_100176439 | Ga0070716_1001764392 | 239 |
| 162 | 3300006871 | Ga0075434_100131989 | Ga0075434_1001319892 | 239 |
| 163 | 3300007076 | Ga0075435_100109445 | Ga0075435_1001094453 | 239 |
| 164 | 3300007076 | Ga0075435_100472532 | Ga0075435_1004725321 | 239 |
| 165 | 3300014325 | Ga0163163_11022761 | Ga0163163_110227611 | 239 |
| 166 | 3300025898 | Ga0207692_10173098 | Ga0207692_101730982 | 239 |
| 167 | 3300025914 | Ga0207671_10077531 | Ga0207671_100775312 | 239 |
| 168 | 3300025972 | Ga0207668_10362044 | Ga0207668_103620442 | 239 |
| 169 | 3300035090 | Ga0373949_0024510 | Ga0373949_0024510_410_1186 | 239 |
| 170 | 3300035119 | Ga0373956_0032682 | Ga0373956_0032682_1025_1810 | 239 |
| 171 | 3300035170 | Ga0373943_0025585 | Ga0373943_0025585_619_1395 | 239 |
| 172 | 3300035172 | Ga0373955_0096661 | Ga0373955_0096661_895_1680 | 239 |
| 173 | 3300035691 | Ga0373931_0171890 | Ga0373931_0171890_391_1167 | 239 |
| 174 | 3300035692 | Ga0373935_0229770 | Ga0373935_0229770_427_1203 | 239 |
| 175 | 3300035695 | Ga0373927_0033962 | Ga0373927_0033962_1739_2515 | 239 |
| 176 | 3300035725 | Ga0373947_0017482 | Ga0373947_0017482_1866_2642 | 239 |
| 177 | 3300036401 | Ga0373937_0232459 | Ga0373937_0232459_565_1350 | 239 |
| 178 | 3300044901 | Ga0466960_0127631 | Ga0466960_0127631_552_1328 | 239 |
| 179 | 3300046454 | Ga0495592_0103108 | Ga0495592_0103108_593_1378 | 239 |
| 180 | 3300046455 | Ga0495603_0049063 | Ga0495603_0049063_431_1207 | 239 |
| 181 | 3300046459 | Ga0495629_0001773 | Ga0495629_0001773_4235_5011 | 239 |
| 182 | 3300046463 | Ga0495653_0245034 | Ga0495653_0245034_391_1176 | 239 |
| 183 | 3300046511 | Ga0495608_0057938 | Ga0495608_0057938_1231_2016 | 239 |
| 184 | 3300046529 | Ga0495652_0045513 | Ga0495652_0045513_549_1334 | 239 |
| 185 | 3300046533 | Ga0495640_0096683 | Ga0495640_0096683_556_1341 | 239 |
| 186 | 3300046536 | Ga0495587_0093676 | Ga0495587_0093676_405_1190 | 239 |
| 187 | 3300046543 | Ga0495645_0031035 | Ga0495645_0031035_562_1347 | 239 |
| 188 | 3300046559 | Ga0495667_0132750 | Ga0495667_0132750_566_1351 | 239 |
| 189 | 3300046663 | Ga0495635_0364867 | Ga0495635_0364867_35_820 | 239 |
| 190 | 3300046674 | Ga0495588_0152784 | Ga0495588_0152784_402_1178 | 239 |
| 191 | 3300046683 | Ga0495658_0005766 | Ga0495658_0005766_430_1206 | 239 |
| 192 | 3300046689 | Ga0495613_0010751 | Ga0495613_0010751_890_1666 | 239 |
| 193 | 3300047317 | Ga0495604_0105375 | Ga0495604_0105375_708_1493 | 239 |
| 194 | 3300047322 | Ga0495680_0149439 | Ga0495680_0149439_273_1058 | 239 |
| 195 | 3300047673 | Ga0495593_0014389 | Ga0495593_0014389_552_1328 | 239 |
| 196 | 3300048088 | Ga0495602_0153107 | Ga0495602_0153107_520_1305 | 239 |
| 197 | 3300048907 | Ga0496104_0242307 | Ga0496104_0242307_912_1688 | 239 |
| 198 | 3300048908 | Ga0496105_0468577 | Ga0496105_0468577_71_847 | 239 |
| 199 | 3300050513 | nmdc:mga0rr50_296815_c1 | nmdc:mga0rr50_296815_c1_547_1323 | 239 |
| 200 | 3300053077 | Ga0495601_0005540 | Ga0495601_0005540_348_1133 | 239 |
| 201 | 3300053084 | Ga0495595_0038503 | Ga0495595_0038503_883_1668 | 239 |
| 202 | 3300053085 | Ga0495619_0007997 | Ga0495619_0007997_591_1376 | 239 |
| 203 | 3300053085 | Ga0495619_0010056 | Ga0495619_0010056_4458_5234 | 239 |
| 204 | 3300005327 | Ga0070658_10088474 | Ga0070658_100884742 | 240 |
| 205 | 3300005334 | Ga0068869_100538273 | Ga0068869_1005382731 | 240 |
| 206 | 3300005336 | Ga0070680_100044489 | Ga0070680_1000444896 | 240 |
| 207 | 3300005339 | Ga0070660_100095703 | Ga0070660_1000957033 | 240 |
| 208 | 3300005439 | Ga0070711_100387541 | Ga0070711_1003875411 | 240 |
| 209 | 3300005444 | Ga0070694_100526283 | Ga0070694_1005262831 | 240 |
| 210 | 3300005455 | Ga0070663_100148508 | Ga0070663_1001485081 | 240 |
| 211 | 3300005530 | Ga0070679_100092831 | Ga0070679_1000928315 | 240 |
| 212 | 3300005536 | Ga0070697_100287956 | Ga0070697_1002879561 | 240 |
| 213 | 3300005545 | Ga0070695_100319416 | Ga0070695_1003194161 | 240 |
| 214 | 3300005546 | Ga0070696_100019906 | Ga0070696_1000199065 | 240 |
| 215 | 3300005547 | Ga0070693_100009627 | Ga0070693_1000096274 | 240 |
| 216 | 3300005578 | Ga0068854_100126224 | Ga0068854_1001262242 | 240 |
| 217 | 3300006881 | Ga0068865_100414752 | Ga0068865_1004147521 | 240 |
| 218 | 3300009093 | Ga0105240_10109579 | Ga0105240_101095795 | 240 |
| 219 | 3300009147 | Ga0114129_10367633 | Ga0114129_103676333 | 240 |
| 220 | 3300009148 | Ga0105243_10087167 | Ga0105243_100871672 | 240 |
| 221 | 3300013102 | Ga0157371_10037194 | Ga0157371_100371943 | 240 |
| 222 | 3300013105 | Ga0157369_10102581 | Ga0157369_101025814 | 240 |
| 223 | 3300013297 | Ga0157378_10644994 | Ga0157378_106449941 | 240 |
| 224 | 3300021384 | Ga0213876_10060758 | Ga0213876_100607582 | 240 |
| 225 | 3300025900 | Ga0207710_10213179 | Ga0207710_102131791 | 240 |
| 226 | 3300025907 | Ga0207645_10080713 | Ga0207645_100807134 | 240 |
| 227 | 3300025912 | Ga0207707_10072873 | Ga0207707_100728732 | 240 |
| 228 | 3300025913 | Ga0207695_10079997 | Ga0207695_100799972 | 240 |
| 229 | 3300025916 | Ga0207663_10288072 | Ga0207663_102880722 | 240 |
| 230 | 3300025917 | Ga0207660_10413467 | Ga0207660_104134671 | 240 |
| 231 | 3300025919 | Ga0207657_10037686 | Ga0207657_100376864 | 240 |
| 232 | 3300025921 | Ga0207652_10028137 | Ga0207652_100281372 | 240 |
| 233 | 3300025935 | Ga0207709_10178892 | Ga0207709_101788922 | 240 |
| 234 | 3300025938 | Ga0207704_10288214 | Ga0207704_102882141 | 240 |
| 235 | 3300025939 | Ga0207665_10226841 | Ga0207665_102268411 | 240 |
| 236 | 3300026067 | Ga0207678_10067329 | Ga0207678_100673294 | 240 |
| 237 | 3300026089 | Ga0207648_10491555 | Ga0207648_104915551 | 240 |
| 238 | 3300035083 | Ga0373926_0052232 | Ga0373926_0052232_517_1278 | 240 |
| 239 | 3300035090 | Ga0373949_0074800 | Ga0373949_0074800_63_851 | 240 |
| 240 | 3300035111 | Ga0373923_0136853 | Ga0373923_0136853_10_771 | 240 |
| 241 | 3300035116 | Ga0373945_0130469 | Ga0373945_0130469_57_818 | 240 |
| 242 | 3300035120 | Ga0373957_0048971 | Ga0373957_0048971_249_1019 | 240 |
| 243 | 3300035171 | Ga0373946_0021196 | Ga0373946_0021196_911_1672 | 240 |
| 244 | 3300035692 | Ga0373935_0115969 | Ga0373935_0115969_57_818 | 240 |
| 245 | 3300037068 | Ga0373925_0332372 | Ga0373925_0332372_191_952 | 240 |
| 246 | 3300039437 | Ga0436365_0379418 | Ga0436365_0379418_1225_2007 | 240 |
| 247 | 3300039450 | Ga0436363_0417802 | Ga0436363_0417802_994_1776 | 240 |
| 248 | 3300046463 | Ga0495653_0073549 | Ga0495653_0073549_410_1171 | 240 |
| 249 | 3300046472 | Ga0495580_0300229 | Ga0495580_0300229_320_1078 | 240 |
| 250 | 3300046475 | Ga0495639_0058195 | Ga0495639_0058195_36_797 | 240 |
| 251 | 3300046476 | Ga0495662_0000862 | Ga0495662_0000862_7589_8350 | 240 |
| 252 | 3300046477 | Ga0495664_0003765 | Ga0495664_0003765_6441_7202 | 240 |
| 253 | 3300046516 | Ga0495628_0344817 | Ga0495628_0344817_259_1020 | 240 |
| 254 | 3300046517 | Ga0495630_0300509 | Ga0495630_0300509_262_1023 | 240 |
| 255 | 3300046526 | Ga0495666_0076114 | Ga0495666_0076114_79_840 | 240 |
| 256 | 3300046529 | Ga0495652_0021427 | Ga0495652_0021427_3531_4292 | 240 |
| 257 | 3300046543 | Ga0495645_0157530 | Ga0495645_0157530_279_1037 | 240 |
| 258 | 3300046642 | Ga0495634_0009441 | Ga0495634_0009441_5771_6532 | 240 |
| 259 | 3300046663 | Ga0495635_0012909 | Ga0495635_0012909_647_1408 | 240 |
| 260 | 3300046681 | Ga0495647_0056768 | Ga0495647_0056768_559_1347 | 240 |
| 261 | 3300046690 | Ga0495624_0022669 | Ga0495624_0022669_2285_3046 | 240 |
| 262 | 3300047315 | Ga0495581_0174252 | Ga0495581_0174252_70_831 | 240 |
| 263 | 3300047319 | Ga0495674_0013643 | Ga0495674_0013643_4187_4948 | 240 |
| 264 | 3300047321 | Ga0495676_0207648 | Ga0495676_0207648_104_865 | 240 |
| 265 | 3300047471 | Ga0495684_0018177 | Ga0495684_0018177_2416_3177 | 240 |
| 266 | 3300048906 | Ga0496103_0169505 | Ga0496103_0169505_208_996 | 240 |
| 267 | 3300048907 | Ga0496104_0541858 | Ga0496104_0541858_127_903 | 240 |
| 268 | 3300050496 | nmdc:mga07m45_82627_c1 | nmdc:mga07m45_82627_c1_57_836 | 240 |
| 269 | 3300050512 | nmdc:mga0n895_292442_c1 | nmdc:mga0n895_292442_c1_679_1467 | 240 |
| 270 | 3300050514 | nmdc:mga08x19_354033_c1 | nmdc:mga08x19_354033_c1_82_870 | 240 |
| 271 | 3300053077 | Ga0495601_0098247 | Ga0495601_0098247_410_1171 | 240 |
| 272 | 3300053078 | Ga0495612_0004268 | Ga0495612_0004268_3755_4516 | 240 |
| 273 | 3300053085 | Ga0495619_0003707 | Ga0495619_0003707_3784_4545 | 240 |
| 274 | 3300025906 | Ga0207699_10147743 | Ga0207699_101477433 | 241 |
| 275 | 3300031241 | Ga0265325_10000104 | Ga0265325_1000010432 | 241 |
| 276 | 3300031712 | Ga0265342_10236214 | Ga0265342_102362142 | 241 |
| 277 | 3300049568 | Ga0501031_0053884 | Ga0501031_0053884_469_1233 | 241 |
| 278 | 3300049571 | Ga0501034_0451479 | Ga0501034_0451479_157_948 | 241 |
| 279 | 3300049573 | Ga0501037_0073718 | Ga0501037_0073718_1185_1949 | 241 |
| 280 | 3300049574 | Ga0501038_0150082 | Ga0501038_0150082_800_1591 | 241 |
| 281 | 3300049585 | Ga0501069_0109809 | Ga0501069_0109809_511_1287 | 241 |
| 282 | 3300049586 | Ga0501070_0565039 | Ga0501070_0565039_56_832 | 241 |
| 283 | 3300049589 | Ga0501073_0016647 | Ga0501073_0016647_3139_3903 | 241 |
| 284 | 3300049589 | Ga0501073_0072277 | Ga0501073_0072277_136_912 | 241 |
| 285 | 3300049742 | Ga0501080_0174437 | Ga0501080_0174437_1170_1946 | 241 |
| 286 | 3300049744 | Ga0501083_0035521 | Ga0501083_0035521_1209_1973 | 241 |
| 287 | 3300049823 | Ga0501044_0054761 | Ga0501044_0054761_120_884 | 241 |
| 288 | 3300005331 | Ga0070670_100214100 | Ga0070670_1002141002 | 242 |
| 289 | 3300005340 | Ga0070689_100174164 | Ga0070689_1001741643 | 242 |
| 290 | 3300005356 | Ga0070674_100063853 | Ga0070674_1000638534 | 242 |
| 291 | 3300005365 | Ga0070688_100026022 | Ga0070688_1000260224 | 242 |
| 292 | 3300005434 | Ga0070709_10199095 | Ga0070709_101990951 | 242 |
| 293 | 3300005466 | Ga0070685_10022949 | Ga0070685_100229493 | 242 |
| 294 | 3300005547 | Ga0070693_100043952 | Ga0070693_1000439522 | 242 |
| 295 | 3300005615 | Ga0070702_100460682 | Ga0070702_1004606821 | 242 |
| 296 | 3300005937 | Ga0081455_10177700 | Ga0081455_101777002 | 242 |
| 297 | 3300006237 | Ga0097621_100136443 | Ga0097621_1001364432 | 242 |
| 298 | 3300006358 | Ga0068871_100097761 | Ga0068871_1000977612 | 242 |
| 299 | 3300009101 | Ga0105247_10164326 | Ga0105247_101643262 | 242 |
| 300 | 3300009148 | Ga0105243_10039120 | Ga0105243_100391203 | 242 |
| 301 | 3300009174 | Ga0105241_10086615 | Ga0105241_100866153 | 242 |
| 302 | 3300009177 | Ga0105248_10392904 | Ga0105248_103929042 | 242 |
| 303 | 3300009551 | Ga0105238_10138983 | Ga0105238_101389832 | 242 |
| 304 | 3300013297 | Ga0157378_10066591 | Ga0157378_100665913 | 242 |
| 305 | 3300013307 | Ga0157372_10725265 | Ga0157372_107252651 | 242 |
| 306 | 3300017792 | Ga0163161_10175659 | Ga0163161_101756592 | 242 |
| 307 | 3300025898 | Ga0207692_10116613 | Ga0207692_101166132 | 242 |
| 308 | 3300025903 | Ga0207680_10062152 | Ga0207680_100621522 | 242 |
| 309 | 3300025927 | Ga0207687_10055950 | Ga0207687_100559503 | 242 |
| 310 | 3300025937 | Ga0207669_10185446 | Ga0207669_101854462 | 242 |
| 311 | 3300025938 | Ga0207704_10061999 | Ga0207704_100619994 | 242 |
| 312 | 3300025939 | Ga0207665_10110238 | Ga0207665_101102382 | 242 |
| 313 | 3300025941 | Ga0207711_10117161 | Ga0207711_101171614 | 242 |
| 314 | 3300025942 | Ga0207689_10070952 | Ga0207689_100709523 | 242 |
| 315 | 3300025944 | Ga0207661_10269667 | Ga0207661_102696672 | 242 |
| 316 | 3300025961 | Ga0207712_10105751 | Ga0207712_101057513 | 242 |
| 317 | 3300026035 | Ga0207703_10380122 | Ga0207703_103801222 | 242 |
| 318 | 3300026067 | Ga0207678_10028306 | Ga0207678_100283063 | 242 |
| 319 | 3300026075 | Ga0207708_10161778 | Ga0207708_101617782 | 242 |
| 320 | 3300026121 | Ga0207683_10012300 | Ga0207683_100123003 | 242 |
| 321 | 3300028380 | Ga0268265_10163574 | Ga0268265_101635742 | 242 |
| 322 | 3300029957 | Ga0265324_10073106 | Ga0265324_100731062 | 242 |
| 323 | 3300031242 | Ga0265329_10042660 | Ga0265329_100426603 | 242 |
| 324 | 3300031249 | Ga0265339_10001035 | Ga0265339_1000103515 | 242 |
| 325 | 3300031595 | Ga0265313_10000825 | Ga0265313_1000082525 | 242 |
| 326 | 3300031712 | Ga0265342_10185477 | Ga0265342_101854772 | 242 |
| 327 | 3300035111 | Ga0373923_0046600 | Ga0373923_0046600_366_1139 | 242 |
| 328 | 3300035113 | Ga0373936_0074531 | Ga0373936_0074531_274_1047 | 242 |
| 329 | 3300035116 | Ga0373945_0024660 | Ga0373945_0024660_140_913 | 242 |
| 330 | 3300035118 | Ga0373954_0003357 | Ga0373954_0003357_169_942 | 242 |
| 331 | 3300035171 | Ga0373946_0129034 | Ga0373946_0129034_283_1056 | 242 |
| 332 | 3300035207 | Ga0373942_0030402 | Ga0373942_0030402_148_924 | 242 |
| 333 | 3300035410 | Ga0373924_0052097 | Ga0373924_0052097_410_1183 | 242 |
| 334 | 3300035692 | Ga0373935_0039868 | Ga0373935_0039868_612_1385 | 242 |
| 335 | 3300044694 | Ga0466963_0237663 | Ga0466963_0237663_31_807 | 242 |
| 336 | 3300046454 | Ga0495592_0056089 | Ga0495592_0056089_1752_2525 | 242 |
| 337 | 3300046461 | Ga0495641_0091317 | Ga0495641_0091317_240_1013 | 242 |
| 338 | 3300046472 | Ga0495580_0082718 | Ga0495580_0082718_312_1085 | 242 |
| 339 | 3300046476 | Ga0495662_0006475 | Ga0495662_0006475_511_1284 | 242 |
| 340 | 3300046492 | Ga0495585_0015702 | Ga0495585_0015702_1515_2288 | 242 |
| 341 | 3300046499 | Ga0495594_0025402 | Ga0495594_0025402_758_1531 | 242 |
| 342 | 3300046501 | Ga0495607_0028101 | Ga0495607_0028101_202_975 | 242 |
| 343 | 3300046514 | Ga0495618_0140557 | Ga0495618_0140557_122_895 | 242 |
| 344 | 3300046523 | Ga0495644_0001471 | Ga0495644_0001471_5347_6120 | 242 |
| 345 | 3300046531 | Ga0495665_0075844 | Ga0495665_0075844_618_1391 | 242 |
| 346 | 3300046536 | Ga0495587_0069138 | Ga0495587_0069138_459_1232 | 242 |
| 347 | 3300046538 | Ga0495609_0119402 | Ga0495609_0119402_184_957 | 242 |
| 348 | 3300046539 | Ga0495621_0056368 | Ga0495621_0056368_141_914 | 242 |
| 349 | 3300046558 | Ga0495633_0005211 | Ga0495633_0005211_1740_2513 | 242 |
| 350 | 3300046559 | Ga0495667_0042465 | Ga0495667_0042465_1206_1979 | 242 |
| 351 | 3300046615 | Ga0495656_0007359 | Ga0495656_0007359_198_971 | 242 |
| 352 | 3300046642 | Ga0495634_0094322 | Ga0495634_0094322_707_1480 | 242 |
| 353 | 3300046648 | Ga0495611_0125324 | Ga0495611_0125324_296_1069 | 242 |
| 354 | 3300046681 | Ga0495647_0040938 | Ga0495647_0040938_176_949 | 242 |
| 355 | 3300046690 | Ga0495624_0092800 | Ga0495624_0092800_324_1097 | 242 |
| 356 | 3300046691 | Ga0495670_0002981 | Ga0495670_0002981_4247_5020 | 242 |
| 357 | 3300047317 | Ga0495604_0260266 | Ga0495604_0260266_101_874 | 242 |
| 358 | 3300047319 | Ga0495674_0099852 | Ga0495674_0099852_59_832 | 242 |
| 359 | 3300047321 | Ga0495676_0093487 | Ga0495676_0093487_1150_1923 | 242 |
| 360 | 3300048089 | Ga0495614_0140945 | Ga0495614_0140945_138_911 | 242 |
| 361 | 3300048904 | Ga0496101_0185246 | Ga0496101_0185246_650_1426 | 242 |
| 362 | 3300048913 | Ga0496110_0204685 | Ga0496110_0204685_854_1630 | 242 |
| 363 | 3300048914 | Ga0496111_0053597 | Ga0496111_0053597_1057_1833 | 242 |
| 364 | 3300048915 | Ga0496112_0138306 | Ga0496112_0138306_98_874 | 242 |
| 365 | 3300005327 | Ga0070658_10153929 | Ga0070658_101539294 | 243 |
| 366 | 3300005339 | Ga0070660_100043246 | Ga0070660_1000432463 | 243 |
| 367 | 3300005439 | Ga0070711_100098293 | Ga0070711_1000982932 | 243 |
| 368 | 3300005458 | Ga0070681_10007687 | Ga0070681_100076875 | 243 |
| 369 | 3300005530 | Ga0070679_100006190 | Ga0070679_1000061907 | 243 |
| 370 | 3300005563 | Ga0068855_100176270 | Ga0068855_1001762703 | 243 |
| 371 | 3300006175 | Ga0070712_100004132 | Ga0070712_1000041327 | 243 |
| 372 | 3300009147 | Ga0114129_10263683 | Ga0114129_102636833 | 243 |
| 373 | 3300009551 | Ga0105238_10037849 | Ga0105238_100378496 | 243 |
| 374 | 3300013105 | Ga0157369_10207590 | Ga0157369_102075904 | 243 |
| 375 | 3300013307 | Ga0157372_10543544 | Ga0157372_105435442 | 243 |
| 376 | 3300014968 | Ga0157379_10377201 | Ga0157379_103772012 | 243 |
| 377 | 3300025909 | Ga0207705_10076166 | Ga0207705_100761664 | 243 |
| 378 | 3300025915 | Ga0207693_10002351 | Ga0207693_1000235115 | 243 |
| 379 | 3300025915 | Ga0207693_10236824 | Ga0207693_102368242 | 243 |
| 380 | 3300025921 | Ga0207652_10084695 | Ga0207652_100846953 | 243 |
| 381 | 3300025924 | Ga0207694_10176142 | Ga0207694_101761423 | 243 |
| 382 | 3300025949 | Ga0207667_10271242 | Ga0207667_102712423 | 243 |
| 383 | 3300031711 | Ga0265314_10039560 | Ga0265314_100395604 | 243 |
| 384 | 3300032133 | Ga0316583_10029508 | Ga0316583_100295082 | 243 |
| 385 | 3300035089 | Ga0373944_0090275 | Ga0373944_0090275_13_816 | 243 |
| 386 | 3300035695 | Ga0373927_0185762 | Ga0373927_0185762_180_983 | 243 |
| 387 | 3300042012 | Ga0439455_0031484 | Ga0439455_0031484_405_1205 | 243 |
| 388 | 3300044693 | Ga0466961_0131588 | Ga0466961_0131588_377_1153 | 243 |
| 389 | 3300045976 | Ga0466967_0357229 | Ga0466967_0357229_44_820 | 243 |
| 390 | 3300046461 | Ga0495641_0077498 | Ga0495641_0077498_594_1397 | 243 |
| 391 | 3300046472 | Ga0495580_0185405 | Ga0495580_0185405_15_818 | 243 |
| 392 | 3300046529 | Ga0495652_0139129 | Ga0495652_0139129_708_1511 | 243 |
| 393 | 3300046533 | Ga0495640_0072445 | Ga0495640_0072445_600_1403 | 243 |
| 394 | 3300046543 | Ga0495645_0302413 | Ga0495645_0302413_153_956 | 243 |
| 395 | 3300049569 | Ga0501032_0295081 | Ga0501032_0295081_17_781 | 243 |
| 396 | 3300049571 | Ga0501034_0005441 | Ga0501034_0005441_11756_12520 | 243 |
| 397 | 3300049573 | Ga0501037_0023203 | Ga0501037_0023203_777_1541 | 243 |
| 398 | 3300049574 | Ga0501038_0101979 | Ga0501038_0101979_879_1649 | 243 |
| 399 | 3300049574 | Ga0501038_0372742 | Ga0501038_0372742_255_1019 | 243 |
| 400 | 3300049579 | Ga0501043_0051671 | Ga0501043_0051671_318_1082 | 243 |
| 401 | 3300049581 | Ga0501047_0000218 | Ga0501047_0000218_28603_29367 | 243 |
| 402 | 3300049582 | Ga0501048_0000762 | Ga0501048_0000762_21392_22156 | 243 |
| 403 | 3300049583 | Ga0501067_0099398 | Ga0501067_0099398_664_1428 | 243 |
| 404 | 3300049586 | Ga0501070_0011908 | Ga0501070_0011908_5356_6120 | 243 |
| 405 | 3300049590 | Ga0501074_0203616 | Ga0501074_0203616_215_979 | 243 |
| 406 | 3300049742 | Ga0501080_0000489 | Ga0501080_0000489_28706_29470 | 243 |
| 407 | 3300049744 | Ga0501083_0073874 | Ga0501083_0073874_42_806 | 243 |
| 408 | 3300049823 | Ga0501044_0000931 | Ga0501044_0000931_25315_26079 | 243 |
| 409 | 3300049823 | Ga0501044_0028137 | Ga0501044_0028137_2529_3332 | 243 |
| 410 | 3300053077 | Ga0495601_0098855 | Ga0495601_0098855_905_1708 | 243 |
| 411 | 3300053085 | Ga0495619_0072311 | Ga0495619_0072311_596_1399 | 243 |
| 412 | 3300001904 | JGI24736J21556_1023741 | JGI24736J21556_10237411 | 244 |
| 413 | 3300001977 | JGI24746J21847_1000166 | JGI24746J21847_10001664 | 244 |
| 414 | 3300001978 | JGI24747J21853_1000502 | JGI24747J21853_10005022 | 244 |
| 415 | 3300001979 | JGI24740J21852_10013161 | JGI24740J21852_100131613 | 244 |
| 416 | 3300001989 | JGI24739J22299_10000057 | JGI24739J22299_1000005724 | 244 |
| 417 | 3300001990 | JGI24737J22298_10000391 | JGI24737J22298_100003918 | 244 |
| 418 | 3300002070 | JGI24750J21931_1000122 | JGI24750J21931_100012211 | 244 |
| 419 | 3300002073 | JGI24745J21846_1000432 | JGI24745J21846_10004322 | 244 |
| 420 | 3300002074 | JGI24748J21848_1008199 | JGI24748J21848_10081991 | 244 |
| 421 | 3300002075 | JGI24738J21930_10000767 | JGI24738J21930_100007677 | 244 |
| 422 | 3300002076 | JGI24749J21850_1000951 | JGI24749J21850_10009513 | 244 |
| 423 | 3300002126 | JGI24035J26624_1000228 | JGI24035J26624_10002283 | 244 |
| 424 | 3300002155 | JGI24033J26618_1000617 | JGI24033J26618_10006173 | 244 |
| 425 | 3300002239 | JGI24034J26672_10000108 | JGI24034J26672_100001088 | 244 |
| 426 | 3300002244 | JGI24742J22300_10000111 | JGI24742J22300_1000011112 | 244 |
| 427 | 3300002459 | JGI24751J29686_10013943 | JGI24751J29686_100139432 | 244 |
| 428 | 3300005290 | Ga0065712_10072616 | Ga0065712_100726162 | 244 |
| 429 | 3300005293 | Ga0065715_10090398 | Ga0065715_100903984 | 244 |
| 430 | 3300005328 | Ga0070676_10000170 | Ga0070676_1000017026 | 244 |
| 431 | 3300005329 | Ga0070683_100003392 | Ga0070683_10000339211 | 244 |
| 432 | 3300005330 | Ga0070690_100013276 | Ga0070690_1000132767 | 244 |
| 433 | 3300005331 | Ga0070670_100021304 | Ga0070670_1000213048 | 244 |
| 434 | 3300005333 | Ga0070677_10000320 | Ga0070677_1000032017 | 244 |
| 435 | 3300005334 | Ga0068869_100000181 | Ga0068869_10000018118 | 244 |
| 436 | 3300005336 | Ga0070680_100002750 | Ga0070680_10000275011 | 244 |
| 437 | 3300005337 | Ga0070682_100000903 | Ga0070682_10000090316 | 244 |
| 438 | 3300005337 | Ga0070682_100270343 | Ga0070682_1002703431 | 244 |
| 439 | 3300005338 | Ga0068868_100000590 | Ga0068868_10000059014 | 244 |
| 440 | 3300005339 | Ga0070660_100007288 | Ga0070660_1000072887 | 244 |
| 441 | 3300005340 | Ga0070689_100015933 | Ga0070689_1000159337 | 244 |
| 442 | 3300005341 | Ga0070691_10000085 | Ga0070691_100000859 | 244 |
| 443 | 3300005343 | Ga0070687_100000037 | Ga0070687_10000003734 | 244 |
| 444 | 3300005344 | Ga0070661_100014737 | Ga0070661_1000147377 | 244 |
| 445 | 3300005345 | Ga0070692_10000038 | Ga0070692_1000003815 | 244 |
| 446 | 3300005347 | Ga0070668_100012587 | Ga0070668_1000125877 | 244 |
| 447 | 3300005353 | Ga0070669_100015059 | Ga0070669_1000150597 | 244 |
| 448 | 3300005354 | Ga0070675_100013975 | Ga0070675_1000139753 | 244 |
| 449 | 3300005355 | Ga0070671_100010890 | Ga0070671_1000108908 | 244 |
| 450 | 3300005356 | Ga0070674_100000195 | Ga0070674_10000019529 | 244 |
| 451 | 3300005364 | Ga0070673_100000191 | Ga0070673_1000001918 | 244 |
| 452 | 3300005365 | Ga0070688_100008846 | Ga0070688_1000088462 | 244 |
| 453 | 3300005366 | Ga0070659_100001504 | Ga0070659_1000015046 | 244 |
| 454 | 3300005367 | Ga0070667_100015512 | Ga0070667_1000155127 | 244 |
| 455 | 3300005434 | Ga0070709_10129111 | Ga0070709_101291112 | 244 |
| 456 | 3300005436 | Ga0070713_100030801 | Ga0070713_1000308013 | 244 |
| 457 | 3300005441 | Ga0070700_100009799 | Ga0070700_1000097997 | 244 |
| 458 | 3300005455 | Ga0070663_100005367 | Ga0070663_1000053677 | 244 |
| 459 | 3300005456 | Ga0070678_100010208 | Ga0070678_1000102086 | 244 |
| 460 | 3300005457 | Ga0070662_100014550 | Ga0070662_1000145502 | 244 |
| 461 | 3300005458 | Ga0070681_10002441 | Ga0070681_100024417 | 244 |
| 462 | 3300005459 | Ga0068867_100000082 | Ga0068867_10000008258 | 244 |
| 463 | 3300005535 | Ga0070684_100001355 | Ga0070684_10000135513 | 244 |
| 464 | 3300005536 | Ga0070697_100046445 | Ga0070697_1000464452 | 244 |
| 465 | 3300005539 | Ga0068853_100020240 | Ga0068853_1000202402 | 244 |
| 466 | 3300005543 | Ga0070672_100001052 | Ga0070672_10000105213 | 244 |
| 467 | 3300005544 | Ga0070686_100005857 | Ga0070686_1000058573 | 244 |
| 468 | 3300005545 | Ga0070695_100024055 | Ga0070695_1000240552 | 244 |
| 469 | 3300005546 | Ga0070696_100019040 | Ga0070696_1000190406 | 244 |
| 470 | 3300005547 | Ga0070693_100006925 | Ga0070693_1000069257 | 244 |
| 471 | 3300005548 | Ga0070665_100035064 | Ga0070665_1000350646 | 244 |
| 472 | 3300005549 | Ga0070704_100002284 | Ga0070704_10000228410 | 244 |
| 473 | 3300005563 | Ga0068855_100066014 | Ga0068855_1000660143 | 244 |
| 474 | 3300005564 | Ga0070664_100015140 | Ga0070664_1000151403 | 244 |
| 475 | 3300005577 | Ga0068857_100001561 | Ga0068857_10000156111 | 244 |
| 476 | 3300005578 | Ga0068854_100000140 | Ga0068854_1000001403 | 244 |
| 477 | 3300005614 | Ga0068856_100014995 | Ga0068856_1000149958 | 244 |
| 478 | 3300005615 | Ga0070702_100000796 | Ga0070702_1000007968 | 244 |
| 479 | 3300005615 | Ga0070702_100171461 | Ga0070702_1001714612 | 244 |
| 480 | 3300005616 | Ga0068852_100009442 | Ga0068852_1000094428 | 244 |
| 481 | 3300005617 | Ga0068859_100029961 | Ga0068859_1000299617 | 244 |
| 482 | 3300005618 | Ga0068864_100002090 | Ga0068864_1000020908 | 244 |
| 483 | 3300005840 | Ga0068870_10000063 | Ga0068870_1000006334 | 244 |
| 484 | 3300005841 | Ga0068863_100026081 | Ga0068863_1000260813 | 244 |
| 485 | 3300005842 | Ga0068858_100025376 | Ga0068858_1000253767 | 244 |
| 486 | 3300005843 | Ga0068860_100003358 | Ga0068860_1000033587 | 244 |
| 487 | 3300005844 | Ga0068862_100001746 | Ga0068862_10000174616 | 244 |
| 488 | 3300006048 | Ga0075363_100148315 | Ga0075363_1001483153 | 244 |
| 489 | 3300006237 | Ga0097621_100000083 | Ga0097621_1000000833 | 244 |
| 490 | 3300006358 | Ga0068871_100000067 | Ga0068871_1000000673 | 244 |
| 491 | 3300006871 | Ga0075434_100006580 | Ga0075434_1000065805 | 244 |
| 492 | 3300006881 | Ga0068865_100000244 | Ga0068865_10000024430 | 244 |
| 493 | 3300006931 | Ga0097620_100029962 | Ga0097620_1000299623 | 244 |
| 494 | 3300009093 | Ga0105240_10027953 | Ga0105240_100279533 | 244 |
| 495 | 3300009094 | Ga0111539_10032831 | Ga0111539_100328317 | 244 |
| 496 | 3300009094 | Ga0111539_10091401 | Ga0111539_100914012 | 244 |
| 497 | 3300009098 | Ga0105245_10000762 | Ga0105245_100007623 | 244 |
| 498 | 3300009101 | Ga0105247_10178452 | Ga0105247_101784521 | 244 |
| 499 | 3300009148 | Ga0105243_10016647 | Ga0105243_100166472 | 244 |
| 500 | 3300009174 | Ga0105241_10000900 | Ga0105241_1000090022 | 244 |
| 501 | 3300009176 | Ga0105242_10000036 | Ga0105242_1000003693 | 244 |
| 502 | 3300009177 | Ga0105248_10050918 | Ga0105248_100509182 | 244 |
| 503 | 3300009545 | Ga0105237_10029241 | Ga0105237_100292417 | 244 |
| 504 | 3300009551 | Ga0105238_10101122 | Ga0105238_101011223 | 244 |
| 505 | 3300009553 | Ga0105249_10001033 | Ga0105249_100010337 | 244 |
| 506 | 3300010375 | Ga0105239_10042248 | Ga0105239_100422481 | 244 |
| 507 | 3300013102 | Ga0157371_10075390 | Ga0157371_100753903 | 244 |
| 508 | 3300013296 | Ga0157374_10009715 | Ga0157374_100097153 | 244 |
| 509 | 3300013297 | Ga0157378_10002181 | Ga0157378_1000218114 | 244 |
| 510 | 3300013306 | Ga0163162_10021532 | Ga0163162_100215328 | 244 |
| 511 | 3300013307 | Ga0157372_10039877 | Ga0157372_100398772 | 244 |
| 512 | 3300013308 | Ga0157375_10003806 | Ga0157375_100038068 | 244 |
| 513 | 3300014325 | Ga0163163_10088960 | Ga0163163_100889603 | 244 |
| 514 | 3300014326 | Ga0157380_10001301 | Ga0157380_100013017 | 244 |
| 515 | 3300014745 | Ga0157377_10000124 | Ga0157377_100001242 | 244 |
| 516 | 3300014968 | Ga0157379_10000275 | Ga0157379_1000027526 | 244 |
| 517 | 3300014969 | Ga0157376_10000115 | Ga0157376_1000011548 | 244 |
| 518 | 3300017792 | Ga0163161_10010835 | Ga0163161_100108357 | 244 |
| 519 | 3300025271 | Ga0207666_1000050 | Ga0207666_10000505 | 244 |
| 520 | 3300025290 | Ga0207673_1000083 | Ga0207673_10000834 | 244 |
| 521 | 3300025315 | Ga0207697_10000039 | Ga0207697_100000392 | 244 |
| 522 | 3300025893 | Ga0207682_10000121 | Ga0207682_1000012135 | 244 |
| 523 | 3300025899 | Ga0207642_10001013 | Ga0207642_100010138 | 244 |
| 524 | 3300025900 | Ga0207710_10104614 | Ga0207710_101046141 | 244 |
| 525 | 3300025901 | Ga0207688_10000073 | Ga0207688_1000007337 | 244 |
| 526 | 3300025904 | Ga0207647_10013109 | Ga0207647_100131098 | 244 |
| 527 | 3300025907 | Ga0207645_10000114 | Ga0207645_1000011449 | 244 |
| 528 | 3300025908 | Ga0207643_10000134 | Ga0207643_100001345 | 244 |
| 529 | 3300025911 | Ga0207654_10000527 | Ga0207654_1000052721 | 244 |
| 530 | 3300025912 | Ga0207707_10017884 | Ga0207707_100178848 | 244 |
| 531 | 3300025914 | Ga0207671_10015778 | Ga0207671_100157782 | 244 |
| 532 | 3300025917 | Ga0207660_10000034 | Ga0207660_1000003456 | 244 |
| 533 | 3300025918 | Ga0207662_10008712 | Ga0207662_100087128 | 244 |
| 534 | 3300025919 | Ga0207657_10005404 | Ga0207657_100054047 | 244 |
| 535 | 3300025920 | Ga0207649_10000142 | Ga0207649_1000014245 | 244 |
| 536 | 3300025921 | Ga0207652_10002021 | Ga0207652_1000202117 | 244 |
| 537 | 3300025923 | Ga0207681_10000065 | Ga0207681_100000659 | 244 |
| 538 | 3300025924 | Ga0207694_10061870 | Ga0207694_100618703 | 244 |
| 539 | 3300025925 | Ga0207650_10013410 | Ga0207650_100134108 | 244 |
| 540 | 3300025926 | Ga0207659_10000078 | Ga0207659_1000007815 | 244 |
| 541 | 3300025927 | Ga0207687_10007258 | Ga0207687_100072582 | 244 |
| 542 | 3300025931 | Ga0207644_10023497 | Ga0207644_100234976 | 244 |
| 543 | 3300025932 | Ga0207690_10000200 | Ga0207690_1000020045 | 244 |
| 544 | 3300025933 | Ga0207706_10023274 | Ga0207706_100232748 | 244 |
| 545 | 3300025934 | Ga0207686_10007002 | Ga0207686_100070023 | 244 |
| 546 | 3300025935 | Ga0207709_10000183 | Ga0207709_1000018376 | 244 |
| 547 | 3300025937 | Ga0207669_10000248 | Ga0207669_100002482 | 244 |
| 548 | 3300025938 | Ga0207704_10000719 | Ga0207704_1000071912 | 244 |
| 549 | 3300025940 | Ga0207691_10000990 | Ga0207691_100009902 | 244 |
| 550 | 3300025941 | Ga0207711_10031108 | Ga0207711_100311085 | 244 |
| 551 | 3300025942 | Ga0207689_10000144 | Ga0207689_100001445 | 244 |
| 552 | 3300025944 | Ga0207661_10001264 | Ga0207661_1000126415 | 244 |
| 553 | 3300025945 | Ga0207679_10000064 | Ga0207679_1000006491 | 244 |
| 554 | 3300025960 | Ga0207651_10000420 | Ga0207651_100004208 | 244 |
| 555 | 3300025961 | Ga0207712_10001661 | Ga0207712_100016613 | 244 |
| 556 | 3300025981 | Ga0207640_10004058 | Ga0207640_100040589 | 244 |
| 557 | 3300025986 | Ga0207658_10022503 | Ga0207658_100225032 | 244 |
| 558 | 3300026023 | Ga0207677_10008968 | Ga0207677_100089688 | 244 |
| 559 | 3300026035 | Ga0207703_10010897 | Ga0207703_100108975 | 244 |
| 560 | 3300026041 | Ga0207639_10379319 | Ga0207639_103793192 | 244 |
| 561 | 3300026067 | Ga0207678_10003913 | Ga0207678_1000391311 | 244 |
| 562 | 3300026075 | Ga0207708_10016908 | Ga0207708_100169087 | 244 |
| 563 | 3300026078 | Ga0207702_10032108 | Ga0207702_100321086 | 244 |
| 564 | 3300026088 | Ga0207641_10001821 | Ga0207641_1000182111 | 244 |
| 565 | 3300026089 | Ga0207648_10023701 | Ga0207648_100237017 | 244 |
| 566 | 3300026095 | Ga0207676_10000079 | Ga0207676_1000007985 | 244 |
| 567 | 3300026116 | Ga0207674_10000323 | Ga0207674_1000032349 | 244 |
| 568 | 3300026118 | Ga0207675_100000270 | Ga0207675_1000002702 | 244 |
| 569 | 3300026121 | Ga0207683_10000037 | Ga0207683_1000003715 | 244 |
| 570 | 3300026142 | Ga0207698_10001179 | Ga0207698_1000117913 | 244 |
| 571 | 3300027252 | Ga0209973_1001076 | Ga0209973_10010763 | 244 |
| 572 | 3300027617 | Ga0210002_1000055 | Ga0210002_10000552 | 244 |
| 573 | 3300027717 | Ga0209998_10003279 | Ga0209998_100032793 | 244 |
| 574 | 3300027876 | Ga0209974_10001624 | Ga0209974_100016248 | 244 |
| 575 | 3300027907 | Ga0207428_10000947 | Ga0207428_1000094729 | 244 |
| 576 | 3300028379 | Ga0268266_10050353 | Ga0268266_100503532 | 244 |
| 577 | 3300028380 | Ga0268265_10001593 | Ga0268265_1000159315 | 244 |
| 578 | 3300028381 | Ga0268264_10002487 | Ga0268264_1000248715 | 244 |
| 579 | 3300031595 | Ga0265313_10057445 | Ga0265313_100574452 | 244 |
| 580 | 3300034816 | Ga0373930_0002122 | Ga0373930_0002122_329_1129 | 244 |
| 581 | 3300034957 | Ga0373938_0000060 | Ga0373938_0000060_4029_4829 | 244 |
| 582 | 3300035084 | Ga0373928_0002099 | Ga0373928_0002099_696_1496 | 244 |
| 583 | 3300035088 | Ga0373940_0027836 | Ga0373940_0027836_313_1113 | 244 |
| 584 | 3300035090 | Ga0373949_0006592 | Ga0373949_0006592_1470_2270 | 244 |
| 585 | 3300035091 | Ga0373951_0017842 | Ga0373951_0017842_327_1127 | 244 |
| 586 | 3300035092 | Ga0373952_0003451 | Ga0373952_0003451_1803_2603 | 244 |
| 587 | 3300035092 | Ga0373952_0032655 | Ga0373952_0032655_70_861 | 244 |
| 588 | 3300035112 | Ga0373932_0002546 | Ga0373932_0002546_1564_2364 | 244 |
| 589 | 3300035115 | Ga0373941_0018605 | Ga0373941_0018605_1000_1800 | 244 |
| 590 | 3300035241 | Ga0373961_0007426 | Ga0373961_0007426_278_1078 | 244 |
| 591 | 3300035242 | Ga0373962_0001858 | Ga0373962_0001858_2196_2996 | 244 |
| 592 | 3300035691 | Ga0373931_0005088 | Ga0373931_0005088_1229_2029 | 244 |
| 593 | 3300035692 | Ga0373935_0225194 | Ga0373935_0225194_504_1289 | 244 |
| 594 | 3300035692 | Ga0373935_0233538 | Ga0373935_0233538_269_1072 | 244 |
| 595 | 3300036401 | Ga0373937_0110446 | Ga0373937_0110446_742_1518 | 244 |
| 596 | 3300042439 | Ga0439464_0056907 | Ga0439464_0056907_282_1082 | 244 |
| 597 | 3300046462 | Ga0495651_0008470 | Ga0495651_0008470_503_1276 | 244 |
| 598 | 3300046463 | Ga0495653_0044857 | Ga0495653_0044857_2310_3086 | 244 |
| 599 | 3300046463 | Ga0495653_0049099 | Ga0495653_0049099_2197_2970 | 244 |
| 600 | 3300046475 | Ga0495639_0010519 | Ga0495639_0010519_2923_3696 | 244 |
| 601 | 3300046516 | Ga0495628_0049236 | Ga0495628_0049236_1389_2162 | 244 |
| 602 | 3300046543 | Ga0495645_0149353 | Ga0495645_0149353_818_1591 | 244 |
| 603 | 3300046663 | Ga0495635_0021945 | Ga0495635_0021945_765_1538 | 244 |
| 604 | 3300046663 | Ga0495635_0118712 | Ga0495635_0118712_985_1761 | 244 |
| 605 | 3300046680 | Ga0495646_0009338 | Ga0495646_0009338_88_861 | 244 |
| 606 | 3300046684 | Ga0495669_0002627 | Ga0495669_0002627_1061_1861 | 244 |
| 607 | 3300046689 | Ga0495613_0423506 | Ga0495613_0423506_85_858 | 244 |
| 608 | 3300047315 | Ga0495581_0071081 | Ga0495581_0071081_644_1447 | 244 |
| 609 | 3300047317 | Ga0495604_0311425 | Ga0495604_0311425_160_936 | 244 |
| 610 | 3300047321 | Ga0495676_0251510 | Ga0495676_0251510_212_1015 | 244 |
| 611 | 3300047322 | Ga0495680_0202209 | Ga0495680_0202209_404_1177 | 244 |
| 612 | 3300047445 | Ga0495677_0069897 | Ga0495677_0069897_362_1162 | 244 |
| 613 | 3300047471 | Ga0495684_0002658 | Ga0495684_0002658_1721_2494 | 244 |
| 614 | 3300048903 | Ga0496100_0005485 | Ga0496100_0005485_5851_6651 | 244 |
| 615 | 3300048905 | Ga0496102_0000857 | Ga0496102_0000857_8306_9106 | 244 |
| 616 | 3300048906 | Ga0496103_0001402 | Ga0496103_0001402_3315_4115 | 244 |
| 617 | 3300048907 | Ga0496104_0075925 | Ga0496104_0075925_940_1740 | 244 |
| 618 | 3300048911 | Ga0496108_0003866 | Ga0496108_0003866_5901_6701 | 244 |
| 619 | 3300048912 | Ga0496109_0005368 | Ga0496109_0005368_6987_7787 | 244 |
| 620 | 3300048913 | Ga0496110_0184148 | Ga0496110_0184148_706_1506 | 244 |
| 621 | 3300048916 | Ga0496113_0018247 | Ga0496113_0018247_4089_4871 | 244 |
| 622 | 3300048917 | Ga0496114_0001715 | Ga0496114_0001715_1057_1857 | 244 |
| 623 | 3300048918 | Ga0496115_0003668 | Ga0496115_0003668_4555_5355 | 244 |
| 624 | 3300049741 | Ga0501079_0195819 | Ga0501079_0195819_146_946 | 244 |
| 625 | 3300050511 | nmdc:mga08y16_137324_c1 | nmdc:mga08y16_137324_c1_307_1128 | 244 |
| 626 | 3300050512 | nmdc:mga0n895_6097_c1 | nmdc:mga0n895_6097_c1_5136_5936 | 244 |
| 627 | 3300053077 | Ga0495601_0005957 | Ga0495601_0005957_6268_7044 | 244 |
| 628 | 3300053077 | Ga0495601_0012093 | Ga0495601_0012093_749_1522 | 244 |
| 629 | 3300053078 | Ga0495612_0026304 | Ga0495612_0026304_366_1139 | 244 |
| 630 | 3300053078 | Ga0495612_0066058 | Ga0495612_0066058_649_1425 | 244 |
| 631 | 3300053084 | Ga0495595_0003051 | Ga0495595_0003051_5691_6464 | 244 |
| 632 | 3300053085 | Ga0495619_0000043 | Ga0495619_0000043_102200_102976 | 244 |
| 633 | 2209111006 | 2214756334 | 2213770201 | 245 |
| 634 | 3300000041 | ARcpr5oldR_c000183 | ARcpr5oldR_0001839 | 245 |
| 635 | 3300000042 | ARSoilYngRDRAFT_c00120 | ARSoilYngRDRAFT_001207 | 245 |
| 636 | 3300000043 | ARcpr5yngRDRAFT_c000195 | ARcpr5yngRDRAFT_0001953 | 245 |
| 637 | 3300000044 | ARSoilOldRDRAFT_c000093 | ARSoilOldRDRAFT_00009311 | 245 |
| 638 | 3300000045 | ARCol0oldRDRAFT_c01241 | ARCol0oldRDRAFT_012412 | 245 |
| 639 | 3300000652 | ARCol0yngRDRAFT_1000124 | ARCol0yngRDRAFT_100012410 | 245 |
| 640 | 3300001990 | JGI24737J22298_10001583 | JGI24737J22298_100015839 | 245 |
| 641 | 3300005276 | Ga0065717_1003053 | Ga0065717_10030531 | 245 |
| 642 | 3300005289 | Ga0065704_10107468 | Ga0065704_101074683 | 245 |
| 643 | 3300005290 | Ga0065712_10103628 | Ga0065712_101036282 | 245 |
| 644 | 3300005293 | Ga0065715_10002625 | Ga0065715_100026259 | 245 |
| 645 | 3300005293 | Ga0065715_10327286 | Ga0065715_103272861 | 245 |
| 646 | 3300005295 | Ga0065707_10135694 | Ga0065707_101356943 | 245 |
| 647 | 3300005340 | Ga0070689_100001256 | Ga0070689_1000012563 | 245 |
| 648 | 3300005341 | Ga0070691_10052867 | Ga0070691_100528672 | 245 |
| 649 | 3300005343 | Ga0070687_100009985 | Ga0070687_1000099852 | 245 |
| 650 | 3300005356 | Ga0070674_100106305 | Ga0070674_1001063053 | 245 |
| 651 | 3300005365 | Ga0070688_100006371 | Ga0070688_1000063713 | 245 |
| 652 | 3300005438 | Ga0070701_10032655 | Ga0070701_100326552 | 245 |
| 653 | 3300005441 | Ga0070700_100028282 | Ga0070700_1000282823 | 245 |
| 654 | 3300005444 | Ga0070694_100019235 | Ga0070694_1000192352 | 245 |
| 655 | 3300005455 | Ga0070663_100082466 | Ga0070663_1000824663 | 245 |
| 656 | 3300005457 | Ga0070662_100001810 | Ga0070662_10000181014 | 245 |
| 657 | 3300005458 | Ga0070681_10022976 | Ga0070681_100229765 | 245 |
| 658 | 3300005466 | Ga0070685_10006868 | Ga0070685_100068684 | 245 |
| 659 | 3300005507 | Ga0074259_10441056 | Ga0074259_104410561 | 245 |
| 660 | 3300005530 | Ga0070679_100059858 | Ga0070679_1000598582 | 245 |
| 661 | 3300005543 | Ga0070672_100083939 | Ga0070672_1000839393 | 245 |
| 662 | 3300005544 | Ga0070686_100079120 | Ga0070686_1000791202 | 245 |
| 663 | 3300005545 | Ga0070695_100028142 | Ga0070695_1000281423 | 245 |
| 664 | 3300005546 | Ga0070696_100055263 | Ga0070696_1000552633 | 245 |
| 665 | 3300005549 | Ga0070704_100008914 | Ga0070704_1000089143 | 245 |
| 666 | 3300005719 | Ga0068861_100062512 | Ga0068861_1000625123 | 245 |
| 667 | 3300005841 | Ga0068863_100474921 | Ga0068863_1004749212 | 245 |
| 668 | 3300005842 | Ga0068858_100042274 | Ga0068858_1000422744 | 245 |
| 669 | 3300009094 | Ga0111539_10207974 | Ga0111539_102079742 | 245 |
| 670 | 3300009148 | Ga0105243_10124097 | Ga0105243_101240972 | 245 |
| 671 | 3300009174 | Ga0105241_10247267 | Ga0105241_102472672 | 245 |
| 672 | 3300009177 | Ga0105248_10034721 | Ga0105248_100347211 | 245 |
| 673 | 3300009553 | Ga0105249_10065149 | Ga0105249_100651492 | 245 |
| 674 | 3300010375 | Ga0105239_10035447 | Ga0105239_100354472 | 245 |
| 675 | 3300012505 | Ga0157339_1000936 | Ga0157339_10009362 | 245 |
| 676 | 3300013100 | Ga0157373_10432321 | Ga0157373_104323211 | 245 |
| 677 | 3300013306 | Ga0163162_10011076 | Ga0163162_100110762 | 245 |
| 678 | 3300013308 | Ga0157375_10188167 | Ga0157375_101881673 | 245 |
| 679 | 3300014325 | Ga0163163_10016530 | Ga0163163_100165307 | 245 |
| 680 | 3300025271 | Ga0207666_1000394 | Ga0207666_10003946 | 245 |
| 681 | 3300025315 | Ga0207697_10044924 | Ga0207697_100449241 | 245 |
| 682 | 3300025901 | Ga0207688_10001691 | Ga0207688_100016913 | 245 |
| 683 | 3300025904 | Ga0207647_10023727 | Ga0207647_100237272 | 245 |
| 684 | 3300025912 | Ga0207707_10165869 | Ga0207707_101658692 | 245 |
| 685 | 3300025915 | Ga0207693_10396546 | Ga0207693_103965461 | 245 |
| 686 | 3300025917 | Ga0207660_10101409 | Ga0207660_101014091 | 245 |
| 687 | 3300025919 | Ga0207657_10014984 | Ga0207657_100149842 | 245 |
| 688 | 3300025921 | Ga0207652_10196609 | Ga0207652_101966092 | 245 |
| 689 | 3300025933 | Ga0207706_10264061 | Ga0207706_102640612 | 245 |
| 690 | 3300025937 | Ga0207669_10194135 | Ga0207669_101941351 | 245 |
| 691 | 3300025940 | Ga0207691_10162026 | Ga0207691_101620262 | 245 |
| 692 | 3300025942 | Ga0207689_10164753 | Ga0207689_101647533 | 245 |
| 693 | 3300025944 | Ga0207661_10169458 | Ga0207661_101694582 | 245 |
| 694 | 3300025945 | Ga0207679_10188373 | Ga0207679_101883732 | 245 |
| 695 | 3300025960 | Ga0207651_10234872 | Ga0207651_102348721 | 245 |
| 696 | 3300025961 | Ga0207712_10136291 | Ga0207712_101362912 | 245 |
| 697 | 3300026035 | Ga0207703_10668501 | Ga0207703_106685011 | 245 |
| 698 | 3300026067 | Ga0207678_10043085 | Ga0207678_100430852 | 245 |
| 699 | 3300026075 | Ga0207708_10029616 | Ga0207708_100296162 | 245 |
| 700 | 3300026118 | Ga0207675_100048918 | Ga0207675_1000489182 | 245 |
| 701 | 3300027552 | Ga0209982_1014937 | Ga0209982_10149371 | 245 |
| 702 | 3300027682 | Ga0209971_1012497 | Ga0209971_10124972 | 245 |
| 703 | 3300027695 | Ga0209966_1010800 | Ga0209966_10108002 | 245 |
| 704 | 3300027717 | Ga0209998_10006433 | Ga0209998_100064332 | 245 |
| 705 | 3300027907 | Ga0207428_10169255 | Ga0207428_101692553 | 245 |
| 706 | 3300028380 | Ga0268265_10459201 | Ga0268265_104592011 | 245 |
| 707 | 3300028381 | Ga0268264_10185461 | Ga0268264_101854611 | 245 |
| 708 | 3300028800 | Ga0265338_10075788 | Ga0265338_100757882 | 245 |
| 709 | 3300031250 | Ga0265331_10074499 | Ga0265331_100744993 | 245 |
| 710 | 3300031595 | Ga0265313_10009755 | Ga0265313_100097559 | 245 |
| 711 | 3300034817 | Ga0373948_0015571 | Ga0373948_0015571_545_1366 | 245 |
| 712 | 3300035084 | Ga0373928_0002309 | Ga0373928_0002309_2395_3216 | 245 |
| 713 | 3300035085 | Ga0373929_0016449 | Ga0373929_0016449_17_838 | 245 |
| 714 | 3300035088 | Ga0373940_0012286 | Ga0373940_0012286_1038_1859 | 245 |
| 715 | 3300035091 | Ga0373951_0064848 | Ga0373951_0064848_77_898 | 245 |
| 716 | 3300035092 | Ga0373952_0003689 | Ga0373952_0003689_1913_2734 | 245 |
| 717 | 3300035112 | Ga0373932_0003334 | Ga0373932_0003334_2564_3385 | 245 |
| 718 | 3300035114 | Ga0373939_0000354 | Ga0373939_0000354_4347_5168 | 245 |
| 719 | 3300035115 | Ga0373941_0000729 | Ga0373941_0000729_543_1364 | 245 |
| 720 | 3300035121 | Ga0373960_0000114 | Ga0373960_0000114_9230_10051 | 245 |
| 721 | 3300035242 | Ga0373962_0010726 | Ga0373962_0010726_19_840 | 245 |
| 722 | 3300035691 | Ga0373931_0011401 | Ga0373931_0011401_542_1363 | 245 |
| 723 | 3300035724 | Ga0373933_0456464 | Ga0373933_0456464_10_795 | 245 |
| 724 | 3300036401 | Ga0373937_0354592 | Ga0373937_0354592_379_1164 | 245 |
| 725 | 3300037466 | Ga0395898_0008249 | Ga0395898_0008249_2461_3240 | 245 |
| 726 | 3300045976 | Ga0466967_0030498 | Ga0466967_0030498_1027_1797 | 245 |
| 727 | 3300046476 | Ga0495662_0104251 | Ga0495662_0104251_22_810 | 245 |
| 728 | 3300048908 | Ga0496105_0251297 | Ga0496105_0251297_93_914 | 245 |
| 729 | 3300048909 | Ga0496106_0026946 | Ga0496106_0026946_512_1333 | 245 |
| 730 | 3300048910 | Ga0496107_0035893 | Ga0496107_0035893_2523_3344 | 245 |
| 731 | 3300048910 | Ga0496107_0081619 | Ga0496107_0081619_428_1222 | 245 |
| 732 | 3300048912 | Ga0496109_0029090 | Ga0496109_0029090_3605_4399 | 245 |
| 733 | 3300048913 | Ga0496110_0230537 | Ga0496110_0230537_528_1349 | 245 |
| 734 | 3300048913 | Ga0496110_0330239 | Ga0496110_0330239_532_1326 | 245 |
| 735 | 3300048914 | Ga0496111_0235983 | Ga0496111_0235983_501_1322 | 245 |
| 736 | 3300048915 | Ga0496112_0004182 | Ga0496112_0004182_2384_3178 | 245 |
| 737 | 3300048915 | Ga0496112_0505139 | Ga0496112_0505139_309_1130 | 245 |
| 738 | 3300048916 | Ga0496113_0052028 | Ga0496113_0052028_380_1174 | 245 |
| 739 | 3300049581 | Ga0501047_0452222 | Ga0501047_0452222_228_1001 | 245 |
| 740 | 3300049586 | Ga0501070_0064609 | Ga0501070_0064609_2002_2844 | 245 |
| 741 | 3300049741 | Ga0501079_0327996 | Ga0501079_0327996_327_1169 | 245 |
| 742 | 3300050511 | nmdc:mga08y16_248815_c1 | nmdc:mga08y16_248815_c1_272_1045 | 245 |
| 743 | 3300050512 | nmdc:mga0n895_216859_c1 | nmdc:mga0n895_216859_c1_852_1634 | 245 |
| 744 | 3300050512 | nmdc:mga0n895_902858_c1 | nmdc:mga0n895_902858_c1_32_853 | 245 |
| 745 | 3300050513 | nmdc:mga0rr50_479651_c1 | nmdc:mga0rr50_479651_c1_196_978 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ecj-assembly1.cif.gz_B | crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione | 0.9669 | 17 | 218 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9641 | 17 | 216 |
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9635 | 17 | 217 |
| 6tah-assembly1.cif.gz_CAA | crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione | 0.959 | 15 | 218 |
| 4l8e-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit | 0.9549 | 18 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ecjB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9733 | 102 | 209 | 1.20.1050.10 |
| 4l8eA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9718 | 18 | 100 | 3.40.30.10 |
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9706 | 17 | 98 | 3.40.30.10 |
| af_P77526_87_192_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9706 | 102 | 204 | 1.20.1050.10 |
| 4f0bB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9652 | 104 | 209 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523FIZ1-F1-model_v4 | Glutathione S-transferase family protein | 0.9965 | 17 | 87 |
GO:0016740
|
| AF-A0A348G006-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9883 | 14 | 224 |
|
| AF-A0A5M6HID1-F1-model_v4 | Glutathione S-transferase family protein | 0.9874 | 14 | 224 |
GO:0016740
|
| AF-A0A833LL52-F1-model_v4 | Glutathione S-transferase family protein | 0.9862 | 13 | 218 |
GO:0016740
|
| AF-A0A383DJX2-F1-model_v4 | GST N-terminal domain-containing protein | 0.9841 | 17 | 115 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar