F478792

General Info

Members Datasets Scaffolds Average Seq Length
745 393 734 245

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10367633|Ga0114129_103676333
Length 261
Sequence MAHGARKLTRMRPLKSRPAGRRRGRARGVPTQPIELYYWPTPNGQKVSIMLEECGLPYRVIAVNIARGEQFKPAFLKISPNNRIPAIVDPHGPGGRPIAVFESGAILQYLGRKTGQFYPAGERARVEVDQWLFWQMANLGPKAGEANHFRRYATAANQQYAVERFGNELNRLFGVMNKRLKDRAFLAGRYSIADMACVGWIRLFERQGRELDGFPHLKRWLKRVRARPAVRRGMGIRIEEASRVDVRDPTVRAVLFGQRAR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2773857925 Microvirga vignae BR3299 Isolate Unclassified
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
7 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
8 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
9 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
10 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
11 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
12 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
13 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
14 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
15 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
16 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
17 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
20 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
29 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
30 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
31 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
32 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
33 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
230 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
243 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
244 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
245 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
253 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
263 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
264 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
265 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
268 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
269 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
270 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
284 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
317 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
320 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
321 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
375 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.13
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0.81
Rhizoplane 6.85
Rhizosphere 89.93
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214756334 2209111006 Bacteria 3097
2 ARcpr5oldR_c000183 3300000041 Bacteria 10873
3 ARSoilYngRDRAFT_c00120 3300000042 Bacteria 13387
4 ARcpr5yngRDRAFT_c000195 3300000043 Bacteria 9370
5 ARSoilOldRDRAFT_c000093 3300000044 Bacteria 16766
6 ARCol0oldRDRAFT_c01241 3300000045 Bacteria 1815
7 ARCol0yngRDRAFT_1000124 3300000652 Bacteria 13864
8 JGI24736J21556_1023741 3300001904 Bacteria 957
9 JGI24746J21847_1000166 3300001977 Bacteria 8589
10 JGI24747J21853_1000502 3300001978 Bacteria 2469
11 JGI24740J21852_10013161 3300001979 Bacteria 3096
12 JGI24739J22299_10000057 3300001989 Bacteria 31581
13 JGI24737J22298_10000391 3300001990 Bacteria 14950
14 JGI24737J22298_10001583 3300001990 Bacteria 8090
15 JGI24750J21931_1000122 3300002070 Bacteria 12437
16 JGI24745J21846_1000432 3300002073 Bacteria 3722
17 JGI24748J21848_1008199 3300002074 Bacteria 1227
18 JGI24738J21930_10000767 3300002075 Bacteria 9204
19 JGI24749J21850_1000951 3300002076 Bacteria 4128
20 JGI24035J26624_1000228 3300002126 Bacteria 5149
21 JGI24033J26618_1000617 3300002155 Bacteria 3419
22 JGI24034J26672_10000108 3300002239 Bacteria 13522
23 JGI24742J22300_10000111 3300002244 Bacteria 11743
24 JGI24751J29686_10013943 3300002459 Bacteria 1659
25 JGI25151J46595_10000086 3300003187 Bacteria 126250
26 JGI25153J46596_10006736 3300003215 Bacteria 5763
27 Ga0055526_1000371 3300003771 Bacteria 36363
28 Ga0065717_1003053 3300005276 Bacteria 1448
29 Ga0065704_10107468 3300005289 Bacteria 2055
30 Ga0065712_10072616 3300005290 Bacteria 4681
31 Ga0065712_10103628 3300005290 Bacteria 1980
32 Ga0065715_10002625 3300005293 Bacteria 8315
33 Ga0065715_10090398 3300005293 Bacteria 7088
34 Ga0065715_10327286 3300005293 Bacteria 990
35 Ga0065707_10135694 3300005295 Bacteria 1845
36 Ga0065707_10231548 3300005295 Bacteria 1187
37 Ga0070658_10038385 3300005327 Bacteria 3862
38 Ga0070658_10088474 3300005327 Bacteria 2550
39 Ga0070658_10153929 3300005327 Bacteria 1926
40 Ga0070676_10000170 3300005328 Bacteria 26484
41 Ga0070683_100003392 3300005329 Bacteria 12912
42 Ga0070690_100013276 3300005330 Bacteria 4865
43 Ga0070670_100021304 3300005331 Bacteria 5576
44 Ga0070670_100214100 3300005331 Bacteria 1675
45 Ga0070677_10000320 3300005333 Bacteria 16762
46 Ga0068869_100000181 3300005334 Bacteria 32256
47 Ga0068869_100538273 3300005334 Bacteria 979
48 Ga0070680_100002750 3300005336 Bacteria 13050
49 Ga0070680_100044489 3300005336 Bacteria 3607
50 Ga0070680_100123385 3300005336 Bacteria 2163
51 Ga0070682_100000903 3300005337 Bacteria 17347
52 Ga0070682_100270343 3300005337 Bacteria 1234
53 Ga0068868_100000590 3300005338 Bacteria 24437
54 Ga0070660_100007288 3300005339 Bacteria 7706
55 Ga0070660_100043246 3300005339 Bacteria 3442
56 Ga0070660_100095703 3300005339 Bacteria 2347
57 Ga0070660_100145147 3300005339 Bacteria 1906
58 Ga0070689_100001256 3300005340 Bacteria 16143
59 Ga0070689_100015933 3300005340 Bacteria 5493
60 Ga0070689_100174164 3300005340 Bacteria 1744
61 Ga0070691_10000085 3300005341 Bacteria 26262
62 Ga0070691_10052867 3300005341 Bacteria 1942
63 Ga0070687_100000037 3300005343 Bacteria 42337
64 Ga0070687_100009985 3300005343 Bacteria 4085
65 Ga0070661_100014737 3300005344 Bacteria 5513
66 Ga0070692_10000038 3300005345 Bacteria 25433
67 Ga0070668_100012587 3300005347 Bacteria 6299
68 Ga0070669_100015059 3300005353 Bacteria 5513
69 Ga0070669_100344318 3300005353 Bacteria 1209
70 Ga0070675_100013975 3300005354 Bacteria 6320
71 Ga0070671_100010890 3300005355 Bacteria 7303
72 Ga0070674_100000195 3300005356 Bacteria 29060
73 Ga0070674_100063853 3300005356 Bacteria 2579
74 Ga0070674_100106305 3300005356 Bacteria 2053
75 Ga0070673_100000191 3300005364 Bacteria 30135
76 Ga0070688_100006371 3300005365 Bacteria 6307
77 Ga0070688_100008846 3300005365 Bacteria 5481
78 Ga0070688_100026022 3300005365 Bacteria 3471
79 Ga0070659_100001504 3300005366 Bacteria 16803
80 Ga0070667_100015512 3300005367 Bacteria 6299
81 Ga0070667_100330758 3300005367 Bacteria 1376
82 Ga0070709_10129111 3300005434 Bacteria 1723
83 Ga0070709_10199095 3300005434 Bacteria 1417
84 Ga0070709_10268758 3300005434 Bacteria 1235
85 Ga0070709_10334425 3300005434 Bacteria 1115
86 Ga0070714_100090919 3300005435 Bacteria 2674
87 Ga0070714_100410973 3300005435 Bacteria 1281
88 Ga0070714_100976386 3300005435 Bacteria 824
89 Ga0070713_100030801 3300005436 Bacteria 4266
90 Ga0070701_10032655 3300005438 Bacteria 2594
91 Ga0070711_100098293 3300005439 Bacteria 2125
92 Ga0070711_100387541 3300005439 Bacteria 1131
93 Ga0070700_100009799 3300005441 Bacteria 5269
94 Ga0070700_100028282 3300005441 Bacteria 3332
95 Ga0070694_100019235 3300005444 Bacteria 4342
96 Ga0070694_100526283 3300005444 Bacteria 944
97 Ga0070663_100005367 3300005455 Bacteria 7611
98 Ga0070663_100082466 3300005455 Bacteria 2365
99 Ga0070663_100148508 3300005455 Bacteria 1795
100 Ga0070663_100581151 3300005455 Bacteria 940
101 Ga0070678_100010208 3300005456 Bacteria 5725
102 Ga0070678_100379491 3300005456 Bacteria 1223
103 Ga0070662_100001810 3300005457 Bacteria 13141
104 Ga0070662_100014550 3300005457 Bacteria 5260
105 Ga0070662_100531376 3300005457 Bacteria 984
106 Ga0070681_10002441 3300005458 Bacteria 17015
107 Ga0070681_10007687 3300005458 Bacteria 10539
108 Ga0070681_10022976 3300005458 Bacteria 6267
109 Ga0068867_100000082 3300005459 Bacteria 59236
110 Ga0070685_10006868 3300005466 Bacteria 5808
111 Ga0070685_10022949 3300005466 Bacteria 3409
112 Ga0074259_10441056 3300005507 Bacteria 991
113 Ga0070679_100006190 3300005530 Bacteria 11142
114 Ga0070679_100059858 3300005530 Bacteria 3795
115 Ga0070679_100092831 3300005530 Bacteria 3005
116 Ga0070684_100001355 3300005535 Bacteria 17557
117 Ga0070697_100046445 3300005536 Bacteria 3520
118 Ga0070697_100287956 3300005536 Bacteria 1410
119 Ga0068853_100020240 3300005539 Bacteria 5532
120 Ga0070672_100001052 3300005543 Bacteria 16850
121 Ga0070672_100083939 3300005543 Bacteria 2557
122 Ga0070686_100005857 3300005544 Bacteria 6810
123 Ga0070686_100038034 3300005544 Bacteria 2989
124 Ga0070686_100079120 3300005544 Bacteria 2173
125 Ga0070695_100024055 3300005545 Bacteria 3750
126 Ga0070695_100028142 3300005545 Bacteria 3486
127 Ga0070695_100319416 3300005545 Bacteria 1154
128 Ga0070696_100019040 3300005546 Bacteria 4647
129 Ga0070696_100019906 3300005546 Bacteria 4549
130 Ga0070696_100055263 3300005546 Bacteria 2768
131 Ga0070693_100006925 3300005547 Bacteria 5513
132 Ga0070693_100009627 3300005547 Bacteria 4810
133 Ga0070693_100043952 3300005547 Bacteria 2525
134 Ga0070665_100035064 3300005548 Bacteria 5046
135 Ga0070704_100002284 3300005549 Bacteria 10707
136 Ga0070704_100008914 3300005549 Bacteria 6042
137 Ga0068855_100066014 3300005563 Bacteria 4218
138 Ga0068855_100176270 3300005563 Bacteria 2419
139 Ga0068855_100356364 3300005563 Bacteria 1610
140 Ga0070664_100015140 3300005564 Bacteria 6299
141 Ga0070664_100417004 3300005564 Bacteria 1229
142 Ga0068857_100001561 3300005577 Bacteria 18370
143 Ga0068854_100000140 3300005578 Bacteria 50187
144 Ga0068854_100126224 3300005578 Bacteria 1949
145 Ga0068856_100014995 3300005614 Bacteria 7486
146 Ga0070702_100000796 3300005615 Bacteria 12029
147 Ga0070702_100171461 3300005615 Bacteria 1412
148 Ga0070702_100460682 3300005615 Bacteria 924
149 Ga0068852_100009442 3300005616 Bacteria 7245
150 Ga0068852_100563421 3300005616 Bacteria 1141
151 Ga0068859_100029961 3300005617 Bacteria 5459
152 Ga0068864_100002090 3300005618 Bacteria 16498
153 Ga0068861_100062512 3300005719 Bacteria 2860
154 Ga0068870_10000063 3300005840 Bacteria 33368
155 Ga0068863_100026081 3300005841 Bacteria 5577
156 Ga0068863_100474921 3300005841 Bacteria 1229
157 Ga0068858_100025376 3300005842 Bacteria 5514
158 Ga0068858_100042274 3300005842 Bacteria 4225
159 Ga0068860_100003358 3300005843 Bacteria 16477
160 Ga0068862_100001746 3300005844 Bacteria 19666
161 Ga0081455_10000028 3300005937 Bacteria 155778
162 Ga0081455_10009936 3300005937 Bacteria 9733
163 Ga0081455_10177700 3300005937 Bacteria 1615
164 Ga0075363_100148315 3300006048 Bacteria 1323
165 Ga0075363_100148335 3300006048 Bacteria 1323
166 Ga0075432_10074372 3300006058 Bacteria 1224
167 Ga0070716_100176439 3300006173 Bacteria 1399
168 Ga0070712_100004132 3300006175 Bacteria 8923
169 Ga0075427_10008231 3300006194 Bacteria 1543
170 Ga0097621_100000083 3300006237 Bacteria 50576
171 Ga0097621_100136443 3300006237 Bacteria 2093
172 Ga0068871_100000067 3300006358 Bacteria 57681
173 Ga0068871_100097761 3300006358 Bacteria 2455
174 Ga0075430_100031292 3300006846 Bacteria 4516
175 Ga0075430_100120670 3300006846 Bacteria 2185
176 Ga0075430_100423031 3300006846 Bacteria 1099
177 Ga0075431_100252555 3300006847 Bacteria 1791
178 Ga0075433_10001386 3300006852 Bacteria 17846
179 Ga0075433_10018647 3300006852 Bacteria 5771
180 Ga0075433_10068230 3300006852 Bacteria 3122
181 Ga0075434_100001186 3300006871 Bacteria 21600
182 Ga0075434_100006580 3300006871 Bacteria 10659
183 Ga0075434_100131989 3300006871 Bacteria 2517
184 Ga0075429_100038699 3300006880 Bacteria 4152
185 Ga0075429_100535484 3300006880 Bacteria 1026
186 Ga0068865_100000244 3300006881 Bacteria 30343
187 Ga0068865_100414752 3300006881 Bacteria 1106
188 Ga0075436_100255479 3300006914 Bacteria 1249
189 Ga0097620_100029962 3300006931 Bacteria 5459
190 Ga0075435_100017607 3300007076 Bacteria 5413
191 Ga0075435_100109445 3300007076 Bacteria 2297
192 Ga0075435_100167915 3300007076 Bacteria 1851
193 Ga0075435_100472532 3300007076 Bacteria 1082
194 Ga0105240_10027953 3300009093 Bacteria 7377
195 Ga0105240_10109579 3300009093 Bacteria 3343
196 Ga0111539_10032831 3300009094 Bacteria 6303
197 Ga0111539_10091401 3300009094 Bacteria 3576
198 Ga0111539_10207974 3300009094 Bacteria 2280
199 Ga0111539_10301194 3300009094 Bacteria 1866
200 Ga0105245_10000762 3300009098 Bacteria 29109
201 Ga0105245_10204325 3300009098 Bacteria 1898
202 Ga0105247_10164326 3300009101 Bacteria 1472
203 Ga0105247_10178452 3300009101 Bacteria 1416
204 Ga0114129_10072717 3300009147 Bacteria 4793
205 Ga0114129_10263683 3300009147 Bacteria 2308
206 Ga0114129_10367633 3300009147 Bacteria 1902
207 Ga0105243_10016647 3300009148 Bacteria 5560
208 Ga0105243_10039120 3300009148 Bacteria 3696
209 Ga0105243_10087167 3300009148 Bacteria 2562
210 Ga0105243_10124097 3300009148 Bacteria 2182
211 Ga0105243_10343414 3300009148 Bacteria 1368
212 Ga0105241_10000900 3300009174 Bacteria 22448
213 Ga0105241_10086615 3300009174 Bacteria 2464
214 Ga0105241_10247267 3300009174 Bacteria 1510
215 Ga0105242_10000036 3300009176 Bacteria 91470
216 Ga0105242_10177227 3300009176 Bacteria 1878
217 Ga0105248_10034721 3300009177 Bacteria 5642
218 Ga0105248_10050918 3300009177 Bacteria 4647
219 Ga0105248_10392904 3300009177 Bacteria 1562
220 Ga0105237_10029241 3300009545 Bacteria 5605
221 Ga0105238_10037849 3300009551 Bacteria 4902
222 Ga0105238_10101122 3300009551 Bacteria 2866
223 Ga0105238_10138983 3300009551 Bacteria 2406
224 Ga0105249_10001033 3300009553 Bacteria 24619
225 Ga0105249_10065149 3300009553 Bacteria 3351
226 Ga0105239_10035447 3300010375 Bacteria 5479
227 Ga0105239_10042248 3300010375 Bacteria 4996
228 Ga0157339_1000936 3300012505 Bacteria 1642
229 Ga0157373_10432321 3300013100 Bacteria 946
230 Ga0157371_10037194 3300013102 Bacteria 3485
231 Ga0157371_10075390 3300013102 Bacteria 2389
232 Ga0157369_10102581 3300013105 Bacteria 3048
233 Ga0157369_10207590 3300013105 Bacteria 2054
234 Ga0157374_10009715 3300013296 Bacteria 8260
235 Ga0157378_10002181 3300013297 Bacteria 17356
236 Ga0157378_10066591 3300013297 Bacteria 3226
237 Ga0157378_10644994 3300013297 Bacteria 1074
238 Ga0163162_10011076 3300013306 Bacteria 8786
239 Ga0163162_10021532 3300013306 Bacteria 6350
240 Ga0157372_10039877 3300013307 Bacteria 5185
241 Ga0157372_10543544 3300013307 Bacteria 1354
242 Ga0157372_10725265 3300013307 Bacteria 1156
243 Ga0157375_10003806 3300013308 Bacteria 13080
244 Ga0157375_10188167 3300013308 Bacteria 2219
245 Ga0163163_10016530 3300014325 Bacteria 6861
246 Ga0163163_10088960 3300014325 Bacteria 3100
247 Ga0163163_10284043 3300014325 Bacteria 1707
248 Ga0163163_11022761 3300014325 Bacteria 890
249 Ga0157380_10001301 3300014326 Bacteria 16225
250 Ga0157380_10097749 3300014326 Bacteria 2437
251 Ga0157377_10000124 3300014745 Bacteria 49953
252 Ga0157379_10000275 3300014968 Bacteria 40524
253 Ga0157379_10377201 3300014968 Bacteria 1301
254 Ga0157376_10000115 3300014969 Bacteria 57170
255 Ga0163161_10010835 3300017792 Bacteria 6320
256 Ga0163161_10175659 3300017792 Bacteria 1640
257 Ga0163161_10298124 3300017792 Bacteria 1269
258 Ga0213876_10060758 3300021384 Bacteria 1994
259 Ga0207666_1000050 3300025271 Bacteria 22802
260 Ga0207666_1000394 3300025271 Bacteria 5755
261 Ga0207673_1000083 3300025290 Bacteria 8317
262 Ga0209758_1009129 3300025297 Bacteria 6244
263 Ga0207697_10000039 3300025315 Bacteria 49235
264 Ga0207697_10044924 3300025315 Bacteria 1818
265 Ga0207682_10000121 3300025893 Bacteria 35950
266 Ga0207692_10116613 3300025898 Bacteria 1489
267 Ga0207692_10173098 3300025898 Bacteria 1252
268 Ga0207642_10001013 3300025899 Bacteria 8804
269 Ga0207710_10104614 3300025900 Bacteria 1339
270 Ga0207710_10206923 3300025900 Bacteria 971
271 Ga0207710_10213179 3300025900 Bacteria 957
272 Ga0207688_10000073 3300025901 Bacteria 37681
273 Ga0207688_10001691 3300025901 Bacteria 11690
274 Ga0207688_10041092 3300025901 Bacteria 2571
275 Ga0207680_10062152 3300025903 Bacteria 2280
276 Ga0207647_10013109 3300025904 Bacteria 5759
277 Ga0207647_10023727 3300025904 Bacteria 4053
278 Ga0207699_10147743 3300025906 Bacteria 1552
279 Ga0207645_10000114 3300025907 Bacteria 60880
280 Ga0207645_10080713 3300025907 Bacteria 2085
281 Ga0207643_10000134 3300025908 Bacteria 50474
282 Ga0207705_10076166 3300025909 Bacteria 2438
283 Ga0207705_10107127 3300025909 Bacteria 2062
284 Ga0207654_10000527 3300025911 Bacteria 21845
285 Ga0207707_10017884 3300025912 Bacteria 6180
286 Ga0207707_10072873 3300025912 Bacteria 2994
287 Ga0207707_10149287 3300025912 Bacteria 2044
288 Ga0207707_10165869 3300025912 Bacteria 1930
289 Ga0207695_10079997 3300025913 Bacteria 3311
290 Ga0207671_10015778 3300025914 Bacteria 5898
291 Ga0207671_10077531 3300025914 Bacteria 2488
292 Ga0207693_10002351 3300025915 Bacteria 16428
293 Ga0207693_10149824 3300025915 Bacteria 1835
294 Ga0207693_10236824 3300025915 Bacteria 1433
295 Ga0207693_10396546 3300025915 Bacteria 1079
296 Ga0207663_10288072 3300025916 Bacteria 1222
297 Ga0207660_10000034 3300025917 Bacteria 65783
298 Ga0207660_10101409 3300025917 Bacteria 2150
299 Ga0207660_10413467 3300025917 Bacteria 1087
300 Ga0207662_10008712 3300025918 Bacteria 5564
301 Ga0207657_10005404 3300025919 Bacteria 13354
302 Ga0207657_10014984 3300025919 Bacteria 7531
303 Ga0207657_10037686 3300025919 Bacteria 4313
304 Ga0207657_10148869 3300025919 Bacteria 1908
305 Ga0207649_10000142 3300025920 Bacteria 60023
306 Ga0207652_10002021 3300025921 Bacteria 17491
307 Ga0207652_10028137 3300025921 Bacteria 4688
308 Ga0207652_10084695 3300025921 Bacteria 2778
309 Ga0207652_10196609 3300025921 Bacteria 1814
310 Ga0207652_10210104 3300025921 Bacteria 1752
311 Ga0207681_10000065 3300025923 Bacteria 98832
312 Ga0207694_10061870 3300025924 Bacteria 2914
313 Ga0207694_10176142 3300025924 Bacteria 1733
314 Ga0207650_10013410 3300025925 Bacteria 5674
315 Ga0207659_10000078 3300025926 Bacteria 61403
316 Ga0207687_10007258 3300025927 Bacteria 7308
317 Ga0207687_10055950 3300025927 Bacteria 2766
318 Ga0207644_10023497 3300025931 Bacteria 4223
319 Ga0207690_10000200 3300025932 Bacteria 46868
320 Ga0207690_10469920 3300025932 Bacteria 1013
321 Ga0207706_10023274 3300025933 Bacteria 5564
322 Ga0207706_10264061 3300025933 Bacteria 1503
323 Ga0207706_10541153 3300025933 Bacteria 1003
324 Ga0207686_10007002 3300025934 Bacteria 6068
325 Ga0207709_10000183 3300025935 Bacteria 83374
326 Ga0207709_10178892 3300025935 Bacteria 1496
327 Ga0207670_10006498 3300025936 Bacteria 6487
328 Ga0207670_10486686 3300025936 Bacteria 1000
329 Ga0207669_10000248 3300025937 Bacteria 24525
330 Ga0207669_10185446 3300025937 Bacteria 1496
331 Ga0207669_10194135 3300025937 Bacteria 1467
332 Ga0207704_10000719 3300025938 Bacteria 14567
333 Ga0207704_10061999 3300025938 Bacteria 2323
334 Ga0207704_10288214 3300025938 Bacteria 1251
335 Ga0207665_10110238 3300025939 Bacteria 1933
336 Ga0207665_10226841 3300025939 Bacteria 1371
337 Ga0207691_10000990 3300025940 Bacteria 28262
338 Ga0207691_10162026 3300025940 Bacteria 1962
339 Ga0207711_10031108 3300025941 Bacteria 4504
340 Ga0207711_10117161 3300025941 Bacteria 2375
341 Ga0207689_10000144 3300025942 Bacteria 61402
342 Ga0207689_10070952 3300025942 Bacteria 2861
343 Ga0207689_10164753 3300025942 Bacteria 1827
344 Ga0207661_10001264 3300025944 Bacteria 16911
345 Ga0207661_10169458 3300025944 Bacteria 1900
346 Ga0207661_10269667 3300025944 Bacteria 1519
347 Ga0207679_10000064 3300025945 Bacteria 98118
348 Ga0207679_10188373 3300025945 Bacteria 1713
349 Ga0207667_10140537 3300025949 Bacteria 2486
350 Ga0207667_10271242 3300025949 Bacteria 1735
351 Ga0207667_10275509 3300025949 Bacteria 1720
352 Ga0207651_10000420 3300025960 Bacteria 18070
353 Ga0207651_10234872 3300025960 Bacteria 1491
354 Ga0207712_10001661 3300025961 Bacteria 14931
355 Ga0207712_10105751 3300025961 Bacteria 2101
356 Ga0207712_10136291 3300025961 Bacteria 1878
357 Ga0207668_10193755 3300025972 Bacteria 1613
358 Ga0207668_10362044 3300025972 Bacteria 1216
359 Ga0207640_10004058 3300025981 Bacteria 7911
360 Ga0207658_10022503 3300025986 Bacteria 4389
361 Ga0207677_10008968 3300026023 Bacteria 5611
362 Ga0207703_10010897 3300026035 Bacteria 7087
363 Ga0207703_10380122 3300026035 Bacteria 1306
364 Ga0207703_10668501 3300026035 Bacteria 986
365 Ga0207639_10379319 3300026041 Bacteria 1269
366 Ga0207678_10003913 3300026067 Bacteria 13396
367 Ga0207678_10028306 3300026067 Bacteria 4893
368 Ga0207678_10043085 3300026067 Bacteria 3907
369 Ga0207678_10067329 3300026067 Bacteria 3074
370 Ga0207708_10016908 3300026075 Bacteria 5492
371 Ga0207708_10029616 3300026075 Bacteria 4150
372 Ga0207708_10161778 3300026075 Bacteria 1768
373 Ga0207702_10032108 3300026078 Bacteria 4381
374 Ga0207702_10122792 3300026078 Bacteria 2327
375 Ga0207702_10795749 3300026078 Bacteria 934
376 Ga0207641_10001821 3300026088 Bacteria 20519
377 Ga0207648_10023701 3300026089 Bacteria 5492
378 Ga0207648_10491555 3300026089 Bacteria 1122
379 Ga0207676_10000079 3300026095 Bacteria 94811
380 Ga0207676_10162583 3300026095 Bacteria 1936
381 Ga0207674_10000323 3300026116 Bacteria 61026
382 Ga0207675_100000270 3300026118 Bacteria 49235
383 Ga0207675_100048918 3300026118 Bacteria 3947
384 Ga0207683_10000037 3300026121 Bacteria 100920
385 Ga0207683_10012300 3300026121 Bacteria 7305
386 Ga0207698_10001179 3300026142 Bacteria 15239
387 Ga0209973_1001076 3300027252 Bacteria 2280
388 Ga0209982_1014937 3300027552 Bacteria 1175
389 Ga0210002_1000055 3300027617 Bacteria 17399
390 Ga0209971_1012497 3300027682 Bacteria 2009
391 Ga0209966_1010800 3300027695 Bacteria 1655
392 Ga0209998_10003279 3300027717 Bacteria 3562
393 Ga0209998_10006433 3300027717 Bacteria 2439
394 Ga0209974_10001624 3300027876 Bacteria 8137
395 Ga0207428_10000216 3300027907 Bacteria 79777
396 Ga0207428_10000947 3300027907 Bacteria 32277
397 Ga0207428_10135243 3300027907 Bacteria 1885
398 Ga0207428_10169255 3300027907 Bacteria 1655
399 Ga0268266_10050353 3300028379 Bacteria 3574
400 Ga0268265_10001593 3300028380 Bacteria 18775
401 Ga0268265_10163574 3300028380 Bacteria 1894
402 Ga0268265_10459201 3300028380 Bacteria 1191
403 Ga0268264_10002487 3300028381 Bacteria 16198
404 Ga0268264_10185461 3300028381 Bacteria 1893
405 Ga0265338_10034833 3300028800 Bacteria 4854
406 Ga0265338_10075788 3300028800 Bacteria 2853
407 Ga0265324_10073106 3300029957 Bacteria 1168
408 Ga0265330_10119049 3300031235 Bacteria 1125
409 Ga0265325_10000104 3300031241 Bacteria 59692
410 Ga0265325_10012604 3300031241 Bacteria 4830
411 Ga0265329_10042660 3300031242 Bacteria 1452
412 Ga0265339_10001035 3300031249 Bacteria 21200
413 Ga0265339_10150744 3300031249 Bacteria 1176
414 Ga0265339_10171751 3300031249 Bacteria 1084
415 Ga0265331_10074499 3300031250 Bacteria 1584
416 Ga0265313_10000825 3300031595 Bacteria 31303
417 Ga0265313_10009755 3300031595 Bacteria 6187
418 Ga0265313_10033183 3300031595 Bacteria 2627
419 Ga0265313_10057445 3300031595 Bacteria 1837
420 Ga0316575_10021842 3300031665 Bacteria 2467
421 Ga0265314_10039560 3300031711 Bacteria 3394
422 Ga0265342_10000807 3300031712 Bacteria 31481
423 Ga0265342_10004144 3300031712 Bacteria 11539
424 Ga0265342_10185477 3300031712 Bacteria 1137
425 Ga0265342_10236214 3300031712 Bacteria 980
426 Ga0307416_100578520 3300032002 Bacteria 1200
427 Ga0307414_10315019 3300032004 Bacteria 1329
428 Ga0307411_10064652 3300032005 Bacteria 2450
429 Ga0316583_10029508 3300032133 Bacteria 1955
430 Ga0373930_0002122 3300034816 Unclassified 3039
431 Ga0373930_0041699 3300034816 Bacteria 980
432 Ga0373948_0015571 3300034817 Bacteria 1397
433 Ga0373948_0017194 3300034817 Bacteria 1345
434 Ga0373938_0000060 3300034957 Bacteria 13928
435 Ga0373926_0052232 3300035083 Bacteria 1477
436 Ga0373928_0002099 3300035084 Bacteria 3891
437 Ga0373928_0002309 3300035084 Bacteria 3704
438 Ga0373929_0016449 3300035085 Bacteria 1449
439 Ga0373940_0012286 3300035088 Bacteria 2049
440 Ga0373940_0027836 3300035088 Bacteria 1488
441 Ga0373944_0090275 3300035089 Bacteria 1023
442 Ga0373949_0006592 3300035090 Bacteria 2552
443 Ga0373949_0024510 3300035090 Bacteria 1403
444 Ga0373949_0074800 3300035090 Bacteria 893
445 Ga0373951_0017842 3300035091 Bacteria 1608
446 Ga0373951_0064848 3300035091 Bacteria 920
447 Ga0373952_0003451 3300035092 Bacteria 2852
448 Ga0373952_0003689 3300035092 Bacteria 2765
449 Ga0373952_0032655 3300035092 Bacteria 1164
450 Ga0373923_0046600 3300035111 Bacteria 1804
451 Ga0373923_0136853 3300035111 Bacteria 1105
452 Ga0373932_0002546 3300035112 Bacteria 4567
453 Ga0373932_0003334 3300035112 Bacteria 3874
454 Ga0373936_0074531 3300035113 Bacteria 1404
455 Ga0373939_0000354 3300035114 Bacteria 11613
456 Ga0373939_0003245 3300035114 Bacteria 3810
457 Ga0373939_0005961 3300035114 Bacteria 2919
458 Ga0373941_0000729 3300035115 Bacteria 6757
459 Ga0373941_0018605 3300035115 Bacteria 1921
460 Ga0373945_0024660 3300035116 Bacteria 2085
461 Ga0373945_0130469 3300035116 Bacteria 1006
462 Ga0373954_0003357 3300035118 Bacteria 6778
463 Ga0373956_0032682 3300035119 Bacteria 2284
464 Ga0373957_0048971 3300035120 Bacteria 1612
465 Ga0373960_0000114 3300035121 Bacteria 12986
466 Ga0373960_0010353 3300035121 Bacteria 2276
467 Ga0373943_0025585 3300035170 Bacteria 2759
468 Ga0373946_0021196 3300035171 Bacteria 2518
469 Ga0373946_0129034 3300035171 Bacteria 1161
470 Ga0373955_0096661 3300035172 Bacteria 1690
471 Ga0373942_0030402 3300035207 Bacteria 1423
472 Ga0373961_0007426 3300035241 Bacteria 2650
473 Ga0373961_0039634 3300035241 Bacteria 1354
474 Ga0373961_0095828 3300035241 Bacteria 954
475 Ga0373962_0001858 3300035242 Bacteria 5032
476 Ga0373962_0010726 3300035242 Bacteria 2289
477 Ga0373962_0021825 3300035242 Bacteria 1692
478 Ga0373924_0052097 3300035410 Bacteria 1698
479 Ga0373931_0005088 3300035691 Bacteria 6050
480 Ga0373931_0005770 3300035691 Bacteria 5752
481 Ga0373931_0011401 3300035691 Bacteria 4294
482 Ga0373931_0067706 3300035691 Bacteria 1941
483 Ga0373931_0171890 3300035691 Bacteria 1277
484 Ga0373935_0039868 3300035692 Bacteria 2945
485 Ga0373935_0115969 3300035692 Bacteria 1783
486 Ga0373935_0225194 3300035692 Bacteria 1304
487 Ga0373935_0229770 3300035692 Bacteria 1291
488 Ga0373935_0233538 3300035692 Bacteria 1281
489 Ga0373927_0033962 3300035695 Bacteria 3319
490 Ga0373927_0185762 3300035695 Bacteria 1363
491 Ga0373933_0456464 3300035724 Bacteria 836
492 Ga0373947_0017482 3300035725 Bacteria 4125
493 Ga0373937_0110446 3300036401 Bacteria 2557
494 Ga0373937_0232459 3300036401 Bacteria 1736
495 Ga0373937_0354592 3300036401 Bacteria 1390
496 Ga0373925_0332372 3300037068 Bacteria 1231
497 Ga0395899_0002674 3300037312 Bacteria 14372
498 Ga0395900_0003303 3300037418 Bacteria 17453
499 Ga0395898_0006986 3300037466 Bacteria 12000
500 Ga0395898_0008249 3300037466 Bacteria 11015
501 Ga0395901_0245506 3300038443 Bacteria 1866
502 Ga0436365_0070766 3300039437 Bacteria 22318
503 Ga0436365_0379418 3300039437 Bacteria 3311
504 Ga0436363_0417802 3300039450 Bacteria 2105
505 Ga0439455_0031484 3300042012 Bacteria 1321
506 Ga0439464_0056907 3300042439 Bacteria 1139
507 Ga0466961_0131588 3300044693 Bacteria 1568
508 Ga0466963_0237663 3300044694 Bacteria 1277
509 Ga0466957_0081528 3300044842 Bacteria 2015
510 Ga0466960_0127631 3300044901 Bacteria 1339
511 Ga0466967_0030498 3300045976 Bacteria 4526
512 Ga0466967_0182759 3300045976 Bacteria 1979
513 Ga0466967_0357229 3300045976 Bacteria 1415
514 Ga0495592_0056089 3300046454 Bacteria 2912
515 Ga0495592_0103108 3300046454 Bacteria 2030
516 Ga0495603_0049063 3300046455 Bacteria 2513
517 Ga0495629_0001773 3300046459 Bacteria 16935
518 Ga0495641_0077498 3300046461 Bacteria 1490
519 Ga0495641_0091317 3300046461 Bacteria 1360
520 Ga0495651_0008470 3300046462 Bacteria 7880
521 Ga0495653_0044857 3300046463 Bacteria 3430
522 Ga0495653_0049099 3300046463 Bacteria 3253
523 Ga0495653_0073549 3300046463 Bacteria 2550
524 Ga0495653_0245034 3300046463 Bacteria 1192
525 Ga0495580_0082718 3300046472 Bacteria 2237
526 Ga0495580_0185405 3300046472 Bacteria 1436
527 Ga0495580_0300229 3300046472 Bacteria 1094
528 Ga0495639_0010519 3300046475 Bacteria 3984
529 Ga0495639_0058195 3300046475 Bacteria 1767
530 Ga0495662_0000862 3300046476 Bacteria 14797
531 Ga0495662_0006475 3300046476 Bacteria 5849
532 Ga0495662_0104251 3300046476 Bacteria 1387
533 Ga0495664_0003765 3300046477 Bacteria 8279
534 Ga0495585_0015702 3300046492 Bacteria 4397
535 Ga0495594_0025402 3300046499 Bacteria 3184
536 Ga0495607_0028101 3300046501 Bacteria 3473
537 Ga0495608_0057938 3300046511 Bacteria 2555
538 Ga0495618_0140557 3300046514 Bacteria 1544
539 Ga0495628_0049236 3300046516 Bacteria 3337
540 Ga0495628_0344817 3300046516 Bacteria 1096
541 Ga0495630_0300509 3300046517 Bacteria 1226
542 Ga0495644_0001471 3300046523 Bacteria 9606
543 Ga0495666_0076114 3300046526 Bacteria 1591
544 Ga0495652_0021427 3300046529 Bacteria 5746
545 Ga0495652_0045513 3300046529 Bacteria 3771
546 Ga0495652_0139129 3300046529 Bacteria 1911
547 Ga0495665_0075844 3300046531 Bacteria 1770
548 Ga0495640_0072445 3300046533 Bacteria 2309
549 Ga0495640_0096683 3300046533 Bacteria 1943
550 Ga0495587_0069138 3300046536 Bacteria 2056
551 Ga0495587_0093676 3300046536 Bacteria 1734
552 Ga0495609_0119402 3300046538 Bacteria 1134
553 Ga0495621_0056368 3300046539 Bacteria 1417
554 Ga0495645_0031035 3300046543 Bacteria 3892
555 Ga0495645_0149353 3300046543 Bacteria 1625
556 Ga0495645_0157530 3300046543 Bacteria 1572
557 Ga0495645_0302413 3300046543 Bacteria 1044
558 Ga0495633_0005211 3300046558 Bacteria 8021
559 Ga0495667_0042465 3300046559 Bacteria 3015
560 Ga0495667_0132750 3300046559 Bacteria 1606
561 Ga0495656_0007359 3300046615 Bacteria 3887
562 Ga0495634_0009441 3300046642 Bacteria 7195
563 Ga0495634_0094322 3300046642 Bacteria 1939
564 Ga0495611_0125324 3300046648 Bacteria 1198
565 Ga0495635_0012909 3300046663 Bacteria 5849
566 Ga0495635_0021945 3300046663 Bacteria 4449
567 Ga0495635_0118712 3300046663 Bacteria 1804
568 Ga0495635_0364867 3300046663 Bacteria 962
569 Ga0495588_0152784 3300046674 Bacteria 1220
570 Ga0495646_0009338 3300046680 Bacteria 6223
571 Ga0495647_0040938 3300046681 Bacteria 1762
572 Ga0495647_0056768 3300046681 Bacteria 1535
573 Ga0495658_0005766 3300046683 Bacteria 6082
574 Ga0495669_0002627 3300046684 Bacteria 7347
575 Ga0495613_0010751 3300046689 Bacteria 6788
576 Ga0495613_0423506 3300046689 Bacteria 905
577 Ga0495624_0022669 3300046690 Bacteria 4146
578 Ga0495624_0092800 3300046690 Bacteria 1861
579 Ga0495670_0002981 3300046691 Bacteria 8344
580 Ga0495581_0071081 3300047315 Bacteria 2014
581 Ga0495581_0174252 3300047315 Bacteria 1258
582 Ga0495604_0105375 3300047317 Bacteria 2064
583 Ga0495604_0260266 3300047317 Bacteria 1179
584 Ga0495604_0311425 3300047317 Bacteria 1055
585 Ga0495674_0013643 3300047319 Bacteria 7633
586 Ga0495674_0099852 3300047319 Bacteria 2470
587 Ga0495676_0093487 3300047321 Bacteria 2242
588 Ga0495676_0207648 3300047321 Bacteria 1357
589 Ga0495676_0251510 3300047321 Bacteria 1205
590 Ga0495680_0149439 3300047322 Bacteria 1704
591 Ga0495680_0202209 3300047322 Bacteria 1424
592 Ga0495677_0069897 3300047445 Bacteria 1308
593 Ga0495684_0002658 3300047471 Bacteria 14168
594 Ga0495684_0018177 3300047471 Bacteria 5417
595 Ga0495593_0014389 3300047673 Bacteria 4499
596 Ga0495593_0400814 3300047673 Bacteria 686
597 Ga0495602_0153107 3300048088 Bacteria 1809
598 Ga0495614_0140945 3300048089 Bacteria 1071
599 Ga0496100_0005485 3300048903 Bacteria 6837
600 Ga0496101_0185246 3300048904 Bacteria 1604
601 Ga0496102_0000857 3300048905 Bacteria 29213
602 Ga0496102_0416944 3300048905 Bacteria 1261
603 Ga0496103_0001402 3300048906 Bacteria 16210
604 Ga0496103_0099258 3300048906 Bacteria 1842
605 Ga0496103_0169505 3300048906 Bacteria 1401
606 Ga0496104_0003432 3300048907 Bacteria 13669
607 Ga0496104_0009004 3300048907 Bacteria 8877
608 Ga0496104_0075925 3300048907 Bacteria 3200
609 Ga0496104_0191154 3300048907 Bacteria 1958
610 Ga0496104_0242307 3300048907 Bacteria 1715
611 Ga0496104_0541858 3300048907 Bacteria 1074
612 Ga0496105_0025746 3300048908 Bacteria 4793
613 Ga0496105_0251297 3300048908 Bacteria 1432
614 Ga0496105_0285638 3300048908 Bacteria 1329
615 Ga0496105_0468577 3300048908 Bacteria 992
616 Ga0496106_0026946 3300048909 Bacteria 4280
617 Ga0496106_0039849 3300048909 Bacteria 3518
618 Ga0496106_0129103 3300048909 Bacteria 1981
619 Ga0496107_0035893 3300048910 Bacteria 3555
620 Ga0496107_0081619 3300048910 Bacteria 2358
621 Ga0496107_0323170 3300048910 Bacteria 1148
622 Ga0496108_0003866 3300048911 Bacteria 12025
623 Ga0496109_0005368 3300048912 Bacteria 10715
624 Ga0496109_0029090 3300048912 Bacteria 4946
625 Ga0496109_0143389 3300048912 Bacteria 2234
626 Ga0496110_0012589 3300048913 Bacteria 6957
627 Ga0496110_0056112 3300048913 Bacteria 3466
628 Ga0496110_0184148 3300048913 Bacteria 1896
629 Ga0496110_0204685 3300048913 Bacteria 1793
630 Ga0496110_0230537 3300048913 Bacteria 1684
631 Ga0496110_0330239 3300048913 Bacteria 1389
632 Ga0496111_0046069 3300048914 Bacteria 3139
633 Ga0496111_0053597 3300048914 Bacteria 2914
634 Ga0496111_0152709 3300048914 Bacteria 1713
635 Ga0496111_0235983 3300048914 Bacteria 1358
636 Ga0496112_0004182 3300048915 Bacteria 12158
637 Ga0496112_0138306 3300048915 Bacteria 2405
638 Ga0496112_0227365 3300048915 Bacteria 1821
639 Ga0496112_0487329 3300048915 Bacteria 1169
640 Ga0496112_0505139 3300048915 Bacteria 1144
641 Ga0496113_0018247 3300048916 Bacteria 4885
642 Ga0496113_0052028 3300048916 Bacteria 3057
643 Ga0496113_0319161 3300048916 Bacteria 1245
644 Ga0496114_0001715 3300048917 Bacteria 16640
645 Ga0496114_0738561 3300048917 Bacteria 861
646 Ga0496115_0003668 3300048918 Bacteria 11050
647 Ga0496115_0005508 3300048918 Bacteria 9214
648 Ga0496115_0051574 3300048918 Bacteria 3298
649 Ga0496115_0440846 3300048918 Bacteria 1053
650 Ga0496126_0187964 3300048929 Bacteria 1751
651 Ga0501318_013502 3300049534 Bacteria 951
652 Ga0501031_0053884 3300049568 Bacteria 2622
653 Ga0501032_0295081 3300049569 Bacteria 1048
654 Ga0501034_0005441 3300049571 Bacteria 13914
655 Ga0501034_0022069 3300049571 Bacteria 6486
656 Ga0501034_0104559 3300049571 Bacteria 2825
657 Ga0501034_0451479 3300049571 Bacteria 1203
658 Ga0501037_0023203 3300049573 Bacteria 4588
659 Ga0501037_0073718 3300049573 Bacteria 2482
660 Ga0501038_0101979 3300049574 Bacteria 2389
661 Ga0501038_0150082 3300049574 Bacteria 1901
662 Ga0501038_0372742 3300049574 Bacteria 1108
663 Ga0501043_0051671 3300049579 Bacteria 3229
664 Ga0501047_0000218 3300049581 Bacteria 68952
665 Ga0501047_0007054 3300049581 Bacteria 10551
666 Ga0501047_0452222 3300049581 Bacteria 1114
667 Ga0501048_0000762 3300049582 Bacteria 23616
668 Ga0501067_0099398 3300049583 Bacteria 1616
669 Ga0501069_0109809 3300049585 Bacteria 1570
670 Ga0501070_0011908 3300049586 Bacteria 7346
671 Ga0501070_0064609 3300049586 Bacteria 3030
672 Ga0501070_0565039 3300049586 Bacteria 909
673 Ga0501073_0016647 3300049589 Bacteria 5327
674 Ga0501073_0072277 3300049589 Bacteria 2402
675 Ga0501074_0203616 3300049590 Bacteria 1410
676 Ga0501079_0195819 3300049741 Bacteria 1578
677 Ga0501079_0327996 3300049741 Bacteria 1199
678 Ga0501080_0000489 3300049742 Bacteria 30879
679 Ga0501080_0174437 3300049742 Bacteria 1981
680 Ga0501083_0035521 3300049744 Bacteria 3404
681 Ga0501083_0073874 3300049744 Bacteria 2266
682 Ga0501035_0294672 3300049822 Bacteria 1368
683 Ga0501044_0000822 3300049823 Bacteria 37410
684 Ga0501044_0000931 3300049823 Bacteria 35180
685 Ga0501044_0028137 3300049823 Bacteria 5933
686 Ga0501044_0054761 3300049823 Bacteria 4099
687 nmdc:mga06z11_86137_c1 3300050494 Bacteria 1696
688 nmdc:mga07m45_82627_c1 3300050496 Bacteria 1835
689 nmdc:mga05p37_238950_c1 3300050507 Bacteria 2186
690 nmdc:mga05p37_415996_c1 3300050507 Bacteria 1566
691 nmdc:mga09592_224785_c1 3300050508 Bacteria 1626
692 nmdc:mga09592_487620_c1 3300050508 Bacteria 1062
693 nmdc:mga0qj67_11473_c1 3300050509 Bacteria 6641
694 nmdc:mga0qj67_274379_c1 3300050509 Bacteria 904
695 nmdc:mga0qj67_98625_c1 3300050509 Bacteria 2354
696 nmdc:mga06r32_112677_c1 3300050510 Bacteria 2677
697 nmdc:mga06r32_117970_c1 3300050510 Bacteria 2616
698 nmdc:mga06r32_65348_c1 3300050510 Bacteria 3509
699 nmdc:mga08y16_137324_c1 3300050511 Bacteria 2542
700 nmdc:mga08y16_248815_c1 3300050511 Bacteria 1837
701 nmdc:mga0n895_1013778_c1 3300050512 Bacteria 811
702 nmdc:mga0n895_145344_c1 3300050512 Bacteria 2401
703 nmdc:mga0n895_216859_c1 3300050512 Bacteria 1943
704 nmdc:mga0n895_292442_c1 3300050512 Bacteria 1651
705 nmdc:mga0n895_6097_c1 3300050512 Bacteria 10177
706 nmdc:mga0n895_6117_c1 3300050512 Bacteria 10162
707 nmdc:mga0n895_902858_c1 3300050512 Bacteria 869
708 nmdc:mga0rr50_108460_c1 3300050513 Bacteria 2193
709 nmdc:mga0rr50_296815_c1 3300050513 Bacteria 1351
710 nmdc:mga0rr50_479651_c1 3300050513 Bacteria 1056
711 nmdc:mga0rr50_482060_c1 3300050513 Bacteria 1053
712 nmdc:mga0rr50_7816_c1 3300050513 Bacteria 6628
713 nmdc:mga08x19_275320_c1 3300050514 Bacteria 1165
714 nmdc:mga08x19_354033_c1 3300050514 Bacteria 1025
715 nmdc:mga0a205_18984_c1 3300050515 Bacteria 6478
716 nmdc:mga0a205_386734_c1 3300050515 Bacteria 1264
717 nmdc:mga0a205_8435_c1 3300050515 Bacteria 9377
718 Ga0495601_0005540 3300053077 Bacteria 7366
719 Ga0495601_0005957 3300053077 Bacteria 7113
720 Ga0495601_0012093 3300053077 Bacteria 5173
721 Ga0495601_0098247 3300053077 Bacteria 1889
722 Ga0495601_0098855 3300053077 Bacteria 1883
723 Ga0495601_0134512 3300053077 Bacteria 1611
724 Ga0495612_0004268 3300053078 Bacteria 5937
725 Ga0495612_0026304 3300053078 Bacteria 2338
726 Ga0495612_0066058 3300053078 Bacteria 1503
727 Ga0495595_0003051 3300053084 Bacteria 6620
728 Ga0495595_0038503 3300053084 Bacteria 2178
729 Ga0495619_0000043 3300053085 Bacteria 109865
730 Ga0495619_0003707 3300053085 Bacteria 9849
731 Ga0495619_0007997 3300053085 Bacteria 6693
732 Ga0495619_0010056 3300053085 Bacteria 5954
733 Ga0495619_0072311 3300053085 Bacteria 2309
734 Ga0500616_0171940 3300053153 Bacteria 983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100976386 Ga0070714_1009763861 211
2 3300025915 Ga0207693_10149824 Ga0207693_101498242 211
3 3300047673 Ga0495593_0400814 Ga0495593_0400814_34_669 211
4 3300005353 Ga0070669_100344318 Ga0070669_1003443182 228
5 iso_pu_bacteria 2513237087 2513591060 230
6 iso_pu_bacteria 8045864390 8045867754 230
7 iso_pu_bacteria 2508501114 2509078414 231
8 iso_pu_bacteria 2773857925 2774872609 231
9 iso_pu_bacteria 2775506901 2776259625 231
10 iso_pu_bacteria 2835312727 2835315454 231
11 iso_pu_bacteria 2841911363 2841911909 231
12 iso_pu_bacteria 2841917233 2841921362 231
13 iso_pu_bacteria 2882456835 2882458206 231
14 iso_pu_bacteria 2884298095 2884299824 231
15 iso_pu_bacteria 2894232714 2894239667 231
16 3300005616 Ga0068852_100563421 Ga0068852_1005634212 232
17 3300017792 Ga0163161_10298124 Ga0163161_102981241 232
18 3300025912 Ga0207707_10149287 Ga0207707_101492873 232
19 3300035241 Ga0373961_0095828 Ga0373961_0095828_90_800 232
20 3300005434 Ga0070709_10334425 Ga0070709_103344251 233
21 3300005457 Ga0070662_100531376 Ga0070662_1005313761 233
22 3300005544 Ga0070686_100038034 Ga0070686_1000380343 233
23 3300005937 Ga0081455_10000028 Ga0081455_1000002855 233
24 3300006846 Ga0075430_100120670 Ga0075430_1001206703 233
25 3300006846 Ga0075430_100423031 Ga0075430_1004230311 233
26 3300006847 Ga0075431_100252555 Ga0075431_1002525552 233
27 3300006852 Ga0075433_10001386 Ga0075433_100013863 233
28 3300006852 Ga0075433_10068230 Ga0075433_100682303 233
29 3300006871 Ga0075434_100001186 Ga0075434_10000118610 233
30 3300006880 Ga0075429_100038699 Ga0075429_1000386994 233
31 3300006880 Ga0075429_100535484 Ga0075429_1005354842 233
32 3300007076 Ga0075435_100017607 Ga0075435_1000176073 233
33 3300009098 Ga0105245_10204325 Ga0105245_102043252 233
34 3300014325 Ga0163163_10284043 Ga0163163_102840432 233
35 3300025900 Ga0207710_10206923 Ga0207710_102069231 233
36 3300025933 Ga0207706_10541153 Ga0207706_105411531 233
37 3300025936 Ga0207670_10006498 Ga0207670_100064983 233
38 3300025936 Ga0207670_10486686 Ga0207670_104866861 233
39 3300027907 Ga0207428_10135243 Ga0207428_101352432 233
40 3300034816 Ga0373930_0041699 Ga0373930_0041699_180_884 233
41 3300034817 Ga0373948_0017194 Ga0373948_0017194_608_1312 233
42 3300035114 Ga0373939_0003245 Ga0373939_0003245_1966_2670 233
43 3300035121 Ga0373960_0010353 Ga0373960_0010353_1168_1872 233
44 3300035241 Ga0373961_0039634 Ga0373961_0039634_425_1129 233
45 3300035242 Ga0373962_0021825 Ga0373962_0021825_206_910 233
46 3300035691 Ga0373931_0005770 Ga0373931_0005770_1042_1746 233
47 3300048907 Ga0496104_0003432 Ga0496104_0003432_3692_4396 233
48 3300048908 Ga0496105_0285638 Ga0496105_0285638_112_816 233
49 3300048909 Ga0496106_0039849 Ga0496106_0039849_2735_3439 233
50 3300048912 Ga0496109_0143389 Ga0496109_0143389_408_1112 233
51 3300048913 Ga0496110_0012589 Ga0496110_0012589_278_982 233
52 3300048914 Ga0496111_0046069 Ga0496111_0046069_1332_2036 233
53 3300048914 Ga0496111_0152709 Ga0496111_0152709_187_891 233
54 3300048915 Ga0496112_0227365 Ga0496112_0227365_565_1269 233
55 3300048915 Ga0496112_0487329 Ga0496112_0487329_205_909 233
56 3300048918 Ga0496115_0005508 Ga0496115_0005508_4548_5252 233
57 3300049571 Ga0501034_0022069 Ga0501034_0022069_4663_5370 233
58 3300050508 nmdc:mga09592_224785_c1 nmdc:mga09592_224785_c1_127_831 233
59 3300050508 nmdc:mga09592_487620_c1 nmdc:mga09592_487620_c1_153_857 233
60 3300050509 nmdc:mga0qj67_11473_c1 nmdc:mga0qj67_11473_c1_427_1131 233
61 3300050509 nmdc:mga0qj67_274379_c1 nmdc:mga0qj67_274379_c1_94_798 233
62 3300050510 nmdc:mga06r32_112677_c1 nmdc:mga06r32_112677_c1_1159_1863 233
63 3300050510 nmdc:mga06r32_117970_c1 nmdc:mga06r32_117970_c1_785_1489 233
64 3300050510 nmdc:mga06r32_65348_c1 nmdc:mga06r32_65348_c1_1174_1878 233
65 3300050512 nmdc:mga0n895_1013778_c1 nmdc:mga0n895_1013778_c1_14_718 233
66 3300050512 nmdc:mga0n895_6117_c1 nmdc:mga0n895_6117_c1_7453_8157 233
67 3300050515 nmdc:mga0a205_8435_c1 nmdc:mga0a205_8435_c1_1006_1710 233
68 3300003187 JGI25151J46595_10000086 JGI25151J46595_1000008696 234
69 3300003215 JGI25153J46596_10006736 JGI25153J46596_100067365 234
70 3300003771 Ga0055526_1000371 Ga0055526_100037120 234
71 3300005455 Ga0070663_100581151 Ga0070663_1005811512 234
72 3300006048 Ga0075363_100148335 Ga0075363_1001483352 234
73 3300006058 Ga0075432_10074372 Ga0075432_100743722 234
74 3300007076 Ga0075435_100167915 Ga0075435_1001679152 234
75 3300009148 Ga0105243_10343414 Ga0105243_103434141 234
76 3300014326 Ga0157380_10097749 Ga0157380_100977493 234
77 3300025297 Ga0209758_1009129 Ga0209758_10091293 234
78 3300025901 Ga0207688_10041092 Ga0207688_100410924 234
79 3300025949 Ga0207667_10275509 Ga0207667_102755093 234
80 3300025972 Ga0207668_10193755 Ga0207668_101937552 234
81 3300026078 Ga0207702_10122792 Ga0207702_101227922 234
82 3300032004 Ga0307414_10315019 Ga0307414_103150192 234
83 3300032005 Ga0307411_10064652 Ga0307411_100646521 234
84 3300048917 Ga0496114_0738561 Ga0496114_0738561_46_753 234
85 3300049534 Ga0501318_013502 Ga0501318_013502_36_743 234
86 3300050494 nmdc:mga06z11_86137_c1 nmdc:mga06z11_86137_c1_431_1195 234
87 3300050512 nmdc:mga0n895_145344_c1 nmdc:mga0n895_145344_c1_842_1549 234
88 3300050513 nmdc:mga0rr50_7816_c1 nmdc:mga0rr50_7816_c1_5401_6108 234
89 3300053153 Ga0500616_0171940 Ga0500616_0171940_95_838 234
90 3300005456 Ga0070678_100379491 Ga0070678_1003794911 235
91 3300009176 Ga0105242_10177227 Ga0105242_101772271 235
92 3300026095 Ga0207676_10162583 Ga0207676_101625832 235
93 3300035691 Ga0373931_0067706 Ga0373931_0067706_987_1742 235
94 3300048905 Ga0496102_0416944 Ga0496102_0416944_473_1228 235
95 3300048906 Ga0496103_0099258 Ga0496103_0099258_1046_1801 235
96 3300048907 Ga0496104_0191154 Ga0496104_0191154_73_828 235
97 3300048908 Ga0496105_0025746 Ga0496105_0025746_229_984 235
98 3300048909 Ga0496106_0129103 Ga0496106_0129103_236_991 235
99 3300048910 Ga0496107_0323170 Ga0496107_0323170_64_819 235
100 3300048913 Ga0496110_0056112 Ga0496110_0056112_1357_2112 235
101 3300048916 Ga0496113_0319161 Ga0496113_0319161_174_929 235
102 3300048918 Ga0496115_0051574 Ga0496115_0051574_1447_2202 235
103 3300050513 nmdc:mga0rr50_482060_c1 nmdc:mga0rr50_482060_c1_218_973 235
104 3300053077 Ga0495601_0134512 Ga0495601_0134512_632_1387 235
105 3300032002 Ga0307416_100578520 Ga0307416_1005785202 236
106 3300035114 Ga0373939_0005961 Ga0373939_0005961_465_1238 236
107 3300005564 Ga0070664_100417004 Ga0070664_1004170041 237
108 3300005937 Ga0081455_10009936 Ga0081455_1000993610 237
109 3300006846 Ga0075430_100031292 Ga0075430_1000312923 237
110 3300006852 Ga0075433_10018647 Ga0075433_100186472 237
111 3300006914 Ga0075436_100255479 Ga0075436_1002554791 237
112 3300009147 Ga0114129_10072717 Ga0114129_100727173 237
113 3300027907 Ga0207428_10000216 Ga0207428_100002165 237
114 3300037312 Ga0395899_0002674 Ga0395899_0002674_5708_6487 237
115 3300037418 Ga0395900_0003303 Ga0395900_0003303_16058_16837 237
116 3300037466 Ga0395898_0006986 Ga0395898_0006986_9980_10759 237
117 3300038443 Ga0395901_0245506 Ga0395901_0245506_693_1472 237
118 3300039437 Ga0436365_0070766 Ga0436365_0070766_19618_20364 237
119 3300044842 Ga0466957_0081528 Ga0466957_0081528_141_908 237
120 3300045976 Ga0466967_0182759 Ga0466967_0182759_1201_1968 237
121 3300048929 Ga0496126_0187964 Ga0496126_0187964_120_974 237
122 3300049571 Ga0501034_0104559 Ga0501034_0104559_1666_2409 237
123 3300049822 Ga0501035_0294672 Ga0501035_0294672_65_883 237
124 3300049823 Ga0501044_0000822 Ga0501044_0000822_33117_33860 237
125 3300050507 nmdc:mga05p37_238950_c1 nmdc:mga05p37_238950_c1_1255_2043 237
126 3300050507 nmdc:mga05p37_415996_c1 nmdc:mga05p37_415996_c1_712_1500 237
127 3300050509 nmdc:mga0qj67_98625_c1 nmdc:mga0qj67_98625_c1_443_1231 237
128 3300050513 nmdc:mga0rr50_108460_c1 nmdc:mga0rr50_108460_c1_299_1087 237
129 3300050514 nmdc:mga08x19_275320_c1 nmdc:mga08x19_275320_c1_352_1140 237
130 3300050515 nmdc:mga0a205_18984_c1 nmdc:mga0a205_18984_c1_5608_6396 237
131 3300050515 nmdc:mga0a205_386734_c1 nmdc:mga0a205_386734_c1_90_878 237
132 3300005327 Ga0070658_10038385 Ga0070658_100383856 238
133 3300005336 Ga0070680_100123385 Ga0070680_1001233854 238
134 3300005435 Ga0070714_100410973 Ga0070714_1004109731 238
135 3300005563 Ga0068855_100356364 Ga0068855_1003563643 238
136 3300006194 Ga0075427_10008231 Ga0075427_100082312 238
137 3300009094 Ga0111539_10301194 Ga0111539_103011942 238
138 3300025909 Ga0207705_10107127 Ga0207705_101071272 238
139 3300025919 Ga0207657_10148869 Ga0207657_101488692 238
140 3300025921 Ga0207652_10210104 Ga0207652_102101042 238
141 3300025932 Ga0207690_10469920 Ga0207690_104699201 238
142 3300025949 Ga0207667_10140537 Ga0207667_101405372 238
143 3300026078 Ga0207702_10795749 Ga0207702_107957491 238
144 3300028800 Ga0265338_10034833 Ga0265338_100348334 238
145 3300031235 Ga0265330_10119049 Ga0265330_101190492 238
146 3300031241 Ga0265325_10012604 Ga0265325_100126044 238
147 3300031249 Ga0265339_10150744 Ga0265339_101507442 238
148 3300031249 Ga0265339_10171751 Ga0265339_101717512 238
149 3300031595 Ga0265313_10033183 Ga0265313_100331832 238
150 3300031665 Ga0316575_10021842 Ga0316575_100218424 238
151 3300031712 Ga0265342_10000807 Ga0265342_1000080713 238
152 3300031712 Ga0265342_10004144 Ga0265342_1000414411 238
153 3300048907 Ga0496104_0009004 Ga0496104_0009004_466_1239 238
154 3300048918 Ga0496115_0440846 Ga0496115_0440846_91_864 238
155 3300049581 Ga0501047_0007054 Ga0501047_0007054_7011_7814 238
156 3300005295 Ga0065707_10231548 Ga0065707_102315481 239
157 3300005339 Ga0070660_100145147 Ga0070660_1001451471 239
158 3300005367 Ga0070667_100330758 Ga0070667_1003307582 239
159 3300005434 Ga0070709_10268758 Ga0070709_102687581 239
160 3300005435 Ga0070714_100090919 Ga0070714_1000909192 239
161 3300006173 Ga0070716_100176439 Ga0070716_1001764392 239
162 3300006871 Ga0075434_100131989 Ga0075434_1001319892 239
163 3300007076 Ga0075435_100109445 Ga0075435_1001094453 239
164 3300007076 Ga0075435_100472532 Ga0075435_1004725321 239
165 3300014325 Ga0163163_11022761 Ga0163163_110227611 239
166 3300025898 Ga0207692_10173098 Ga0207692_101730982 239
167 3300025914 Ga0207671_10077531 Ga0207671_100775312 239
168 3300025972 Ga0207668_10362044 Ga0207668_103620442 239
169 3300035090 Ga0373949_0024510 Ga0373949_0024510_410_1186 239
170 3300035119 Ga0373956_0032682 Ga0373956_0032682_1025_1810 239
171 3300035170 Ga0373943_0025585 Ga0373943_0025585_619_1395 239
172 3300035172 Ga0373955_0096661 Ga0373955_0096661_895_1680 239
173 3300035691 Ga0373931_0171890 Ga0373931_0171890_391_1167 239
174 3300035692 Ga0373935_0229770 Ga0373935_0229770_427_1203 239
175 3300035695 Ga0373927_0033962 Ga0373927_0033962_1739_2515 239
176 3300035725 Ga0373947_0017482 Ga0373947_0017482_1866_2642 239
177 3300036401 Ga0373937_0232459 Ga0373937_0232459_565_1350 239
178 3300044901 Ga0466960_0127631 Ga0466960_0127631_552_1328 239
179 3300046454 Ga0495592_0103108 Ga0495592_0103108_593_1378 239
180 3300046455 Ga0495603_0049063 Ga0495603_0049063_431_1207 239
181 3300046459 Ga0495629_0001773 Ga0495629_0001773_4235_5011 239
182 3300046463 Ga0495653_0245034 Ga0495653_0245034_391_1176 239
183 3300046511 Ga0495608_0057938 Ga0495608_0057938_1231_2016 239
184 3300046529 Ga0495652_0045513 Ga0495652_0045513_549_1334 239
185 3300046533 Ga0495640_0096683 Ga0495640_0096683_556_1341 239
186 3300046536 Ga0495587_0093676 Ga0495587_0093676_405_1190 239
187 3300046543 Ga0495645_0031035 Ga0495645_0031035_562_1347 239
188 3300046559 Ga0495667_0132750 Ga0495667_0132750_566_1351 239
189 3300046663 Ga0495635_0364867 Ga0495635_0364867_35_820 239
190 3300046674 Ga0495588_0152784 Ga0495588_0152784_402_1178 239
191 3300046683 Ga0495658_0005766 Ga0495658_0005766_430_1206 239
192 3300046689 Ga0495613_0010751 Ga0495613_0010751_890_1666 239
193 3300047317 Ga0495604_0105375 Ga0495604_0105375_708_1493 239
194 3300047322 Ga0495680_0149439 Ga0495680_0149439_273_1058 239
195 3300047673 Ga0495593_0014389 Ga0495593_0014389_552_1328 239
196 3300048088 Ga0495602_0153107 Ga0495602_0153107_520_1305 239
197 3300048907 Ga0496104_0242307 Ga0496104_0242307_912_1688 239
198 3300048908 Ga0496105_0468577 Ga0496105_0468577_71_847 239
199 3300050513 nmdc:mga0rr50_296815_c1 nmdc:mga0rr50_296815_c1_547_1323 239
200 3300053077 Ga0495601_0005540 Ga0495601_0005540_348_1133 239
201 3300053084 Ga0495595_0038503 Ga0495595_0038503_883_1668 239
202 3300053085 Ga0495619_0007997 Ga0495619_0007997_591_1376 239
203 3300053085 Ga0495619_0010056 Ga0495619_0010056_4458_5234 239
204 3300005327 Ga0070658_10088474 Ga0070658_100884742 240
205 3300005334 Ga0068869_100538273 Ga0068869_1005382731 240
206 3300005336 Ga0070680_100044489 Ga0070680_1000444896 240
207 3300005339 Ga0070660_100095703 Ga0070660_1000957033 240
208 3300005439 Ga0070711_100387541 Ga0070711_1003875411 240
209 3300005444 Ga0070694_100526283 Ga0070694_1005262831 240
210 3300005455 Ga0070663_100148508 Ga0070663_1001485081 240
211 3300005530 Ga0070679_100092831 Ga0070679_1000928315 240
212 3300005536 Ga0070697_100287956 Ga0070697_1002879561 240
213 3300005545 Ga0070695_100319416 Ga0070695_1003194161 240
214 3300005546 Ga0070696_100019906 Ga0070696_1000199065 240
215 3300005547 Ga0070693_100009627 Ga0070693_1000096274 240
216 3300005578 Ga0068854_100126224 Ga0068854_1001262242 240
217 3300006881 Ga0068865_100414752 Ga0068865_1004147521 240
218 3300009093 Ga0105240_10109579 Ga0105240_101095795 240
219 3300009147 Ga0114129_10367633 Ga0114129_103676333 240
220 3300009148 Ga0105243_10087167 Ga0105243_100871672 240
221 3300013102 Ga0157371_10037194 Ga0157371_100371943 240
222 3300013105 Ga0157369_10102581 Ga0157369_101025814 240
223 3300013297 Ga0157378_10644994 Ga0157378_106449941 240
224 3300021384 Ga0213876_10060758 Ga0213876_100607582 240
225 3300025900 Ga0207710_10213179 Ga0207710_102131791 240
226 3300025907 Ga0207645_10080713 Ga0207645_100807134 240
227 3300025912 Ga0207707_10072873 Ga0207707_100728732 240
228 3300025913 Ga0207695_10079997 Ga0207695_100799972 240
229 3300025916 Ga0207663_10288072 Ga0207663_102880722 240
230 3300025917 Ga0207660_10413467 Ga0207660_104134671 240
231 3300025919 Ga0207657_10037686 Ga0207657_100376864 240
232 3300025921 Ga0207652_10028137 Ga0207652_100281372 240
233 3300025935 Ga0207709_10178892 Ga0207709_101788922 240
234 3300025938 Ga0207704_10288214 Ga0207704_102882141 240
235 3300025939 Ga0207665_10226841 Ga0207665_102268411 240
236 3300026067 Ga0207678_10067329 Ga0207678_100673294 240
237 3300026089 Ga0207648_10491555 Ga0207648_104915551 240
238 3300035083 Ga0373926_0052232 Ga0373926_0052232_517_1278 240
239 3300035090 Ga0373949_0074800 Ga0373949_0074800_63_851 240
240 3300035111 Ga0373923_0136853 Ga0373923_0136853_10_771 240
241 3300035116 Ga0373945_0130469 Ga0373945_0130469_57_818 240
242 3300035120 Ga0373957_0048971 Ga0373957_0048971_249_1019 240
243 3300035171 Ga0373946_0021196 Ga0373946_0021196_911_1672 240
244 3300035692 Ga0373935_0115969 Ga0373935_0115969_57_818 240
245 3300037068 Ga0373925_0332372 Ga0373925_0332372_191_952 240
246 3300039437 Ga0436365_0379418 Ga0436365_0379418_1225_2007 240
247 3300039450 Ga0436363_0417802 Ga0436363_0417802_994_1776 240
248 3300046463 Ga0495653_0073549 Ga0495653_0073549_410_1171 240
249 3300046472 Ga0495580_0300229 Ga0495580_0300229_320_1078 240
250 3300046475 Ga0495639_0058195 Ga0495639_0058195_36_797 240
251 3300046476 Ga0495662_0000862 Ga0495662_0000862_7589_8350 240
252 3300046477 Ga0495664_0003765 Ga0495664_0003765_6441_7202 240
253 3300046516 Ga0495628_0344817 Ga0495628_0344817_259_1020 240
254 3300046517 Ga0495630_0300509 Ga0495630_0300509_262_1023 240
255 3300046526 Ga0495666_0076114 Ga0495666_0076114_79_840 240
256 3300046529 Ga0495652_0021427 Ga0495652_0021427_3531_4292 240
257 3300046543 Ga0495645_0157530 Ga0495645_0157530_279_1037 240
258 3300046642 Ga0495634_0009441 Ga0495634_0009441_5771_6532 240
259 3300046663 Ga0495635_0012909 Ga0495635_0012909_647_1408 240
260 3300046681 Ga0495647_0056768 Ga0495647_0056768_559_1347 240
261 3300046690 Ga0495624_0022669 Ga0495624_0022669_2285_3046 240
262 3300047315 Ga0495581_0174252 Ga0495581_0174252_70_831 240
263 3300047319 Ga0495674_0013643 Ga0495674_0013643_4187_4948 240
264 3300047321 Ga0495676_0207648 Ga0495676_0207648_104_865 240
265 3300047471 Ga0495684_0018177 Ga0495684_0018177_2416_3177 240
266 3300048906 Ga0496103_0169505 Ga0496103_0169505_208_996 240
267 3300048907 Ga0496104_0541858 Ga0496104_0541858_127_903 240
268 3300050496 nmdc:mga07m45_82627_c1 nmdc:mga07m45_82627_c1_57_836 240
269 3300050512 nmdc:mga0n895_292442_c1 nmdc:mga0n895_292442_c1_679_1467 240
270 3300050514 nmdc:mga08x19_354033_c1 nmdc:mga08x19_354033_c1_82_870 240
271 3300053077 Ga0495601_0098247 Ga0495601_0098247_410_1171 240
272 3300053078 Ga0495612_0004268 Ga0495612_0004268_3755_4516 240
273 3300053085 Ga0495619_0003707 Ga0495619_0003707_3784_4545 240
274 3300025906 Ga0207699_10147743 Ga0207699_101477433 241
275 3300031241 Ga0265325_10000104 Ga0265325_1000010432 241
276 3300031712 Ga0265342_10236214 Ga0265342_102362142 241
277 3300049568 Ga0501031_0053884 Ga0501031_0053884_469_1233 241
278 3300049571 Ga0501034_0451479 Ga0501034_0451479_157_948 241
279 3300049573 Ga0501037_0073718 Ga0501037_0073718_1185_1949 241
280 3300049574 Ga0501038_0150082 Ga0501038_0150082_800_1591 241
281 3300049585 Ga0501069_0109809 Ga0501069_0109809_511_1287 241
282 3300049586 Ga0501070_0565039 Ga0501070_0565039_56_832 241
283 3300049589 Ga0501073_0016647 Ga0501073_0016647_3139_3903 241
284 3300049589 Ga0501073_0072277 Ga0501073_0072277_136_912 241
285 3300049742 Ga0501080_0174437 Ga0501080_0174437_1170_1946 241
286 3300049744 Ga0501083_0035521 Ga0501083_0035521_1209_1973 241
287 3300049823 Ga0501044_0054761 Ga0501044_0054761_120_884 241
288 3300005331 Ga0070670_100214100 Ga0070670_1002141002 242
289 3300005340 Ga0070689_100174164 Ga0070689_1001741643 242
290 3300005356 Ga0070674_100063853 Ga0070674_1000638534 242
291 3300005365 Ga0070688_100026022 Ga0070688_1000260224 242
292 3300005434 Ga0070709_10199095 Ga0070709_101990951 242
293 3300005466 Ga0070685_10022949 Ga0070685_100229493 242
294 3300005547 Ga0070693_100043952 Ga0070693_1000439522 242
295 3300005615 Ga0070702_100460682 Ga0070702_1004606821 242
296 3300005937 Ga0081455_10177700 Ga0081455_101777002 242
297 3300006237 Ga0097621_100136443 Ga0097621_1001364432 242
298 3300006358 Ga0068871_100097761 Ga0068871_1000977612 242
299 3300009101 Ga0105247_10164326 Ga0105247_101643262 242
300 3300009148 Ga0105243_10039120 Ga0105243_100391203 242
301 3300009174 Ga0105241_10086615 Ga0105241_100866153 242
302 3300009177 Ga0105248_10392904 Ga0105248_103929042 242
303 3300009551 Ga0105238_10138983 Ga0105238_101389832 242
304 3300013297 Ga0157378_10066591 Ga0157378_100665913 242
305 3300013307 Ga0157372_10725265 Ga0157372_107252651 242
306 3300017792 Ga0163161_10175659 Ga0163161_101756592 242
307 3300025898 Ga0207692_10116613 Ga0207692_101166132 242
308 3300025903 Ga0207680_10062152 Ga0207680_100621522 242
309 3300025927 Ga0207687_10055950 Ga0207687_100559503 242
310 3300025937 Ga0207669_10185446 Ga0207669_101854462 242
311 3300025938 Ga0207704_10061999 Ga0207704_100619994 242
312 3300025939 Ga0207665_10110238 Ga0207665_101102382 242
313 3300025941 Ga0207711_10117161 Ga0207711_101171614 242
314 3300025942 Ga0207689_10070952 Ga0207689_100709523 242
315 3300025944 Ga0207661_10269667 Ga0207661_102696672 242
316 3300025961 Ga0207712_10105751 Ga0207712_101057513 242
317 3300026035 Ga0207703_10380122 Ga0207703_103801222 242
318 3300026067 Ga0207678_10028306 Ga0207678_100283063 242
319 3300026075 Ga0207708_10161778 Ga0207708_101617782 242
320 3300026121 Ga0207683_10012300 Ga0207683_100123003 242
321 3300028380 Ga0268265_10163574 Ga0268265_101635742 242
322 3300029957 Ga0265324_10073106 Ga0265324_100731062 242
323 3300031242 Ga0265329_10042660 Ga0265329_100426603 242
324 3300031249 Ga0265339_10001035 Ga0265339_1000103515 242
325 3300031595 Ga0265313_10000825 Ga0265313_1000082525 242
326 3300031712 Ga0265342_10185477 Ga0265342_101854772 242
327 3300035111 Ga0373923_0046600 Ga0373923_0046600_366_1139 242
328 3300035113 Ga0373936_0074531 Ga0373936_0074531_274_1047 242
329 3300035116 Ga0373945_0024660 Ga0373945_0024660_140_913 242
330 3300035118 Ga0373954_0003357 Ga0373954_0003357_169_942 242
331 3300035171 Ga0373946_0129034 Ga0373946_0129034_283_1056 242
332 3300035207 Ga0373942_0030402 Ga0373942_0030402_148_924 242
333 3300035410 Ga0373924_0052097 Ga0373924_0052097_410_1183 242
334 3300035692 Ga0373935_0039868 Ga0373935_0039868_612_1385 242
335 3300044694 Ga0466963_0237663 Ga0466963_0237663_31_807 242
336 3300046454 Ga0495592_0056089 Ga0495592_0056089_1752_2525 242
337 3300046461 Ga0495641_0091317 Ga0495641_0091317_240_1013 242
338 3300046472 Ga0495580_0082718 Ga0495580_0082718_312_1085 242
339 3300046476 Ga0495662_0006475 Ga0495662_0006475_511_1284 242
340 3300046492 Ga0495585_0015702 Ga0495585_0015702_1515_2288 242
341 3300046499 Ga0495594_0025402 Ga0495594_0025402_758_1531 242
342 3300046501 Ga0495607_0028101 Ga0495607_0028101_202_975 242
343 3300046514 Ga0495618_0140557 Ga0495618_0140557_122_895 242
344 3300046523 Ga0495644_0001471 Ga0495644_0001471_5347_6120 242
345 3300046531 Ga0495665_0075844 Ga0495665_0075844_618_1391 242
346 3300046536 Ga0495587_0069138 Ga0495587_0069138_459_1232 242
347 3300046538 Ga0495609_0119402 Ga0495609_0119402_184_957 242
348 3300046539 Ga0495621_0056368 Ga0495621_0056368_141_914 242
349 3300046558 Ga0495633_0005211 Ga0495633_0005211_1740_2513 242
350 3300046559 Ga0495667_0042465 Ga0495667_0042465_1206_1979 242
351 3300046615 Ga0495656_0007359 Ga0495656_0007359_198_971 242
352 3300046642 Ga0495634_0094322 Ga0495634_0094322_707_1480 242
353 3300046648 Ga0495611_0125324 Ga0495611_0125324_296_1069 242
354 3300046681 Ga0495647_0040938 Ga0495647_0040938_176_949 242
355 3300046690 Ga0495624_0092800 Ga0495624_0092800_324_1097 242
356 3300046691 Ga0495670_0002981 Ga0495670_0002981_4247_5020 242
357 3300047317 Ga0495604_0260266 Ga0495604_0260266_101_874 242
358 3300047319 Ga0495674_0099852 Ga0495674_0099852_59_832 242
359 3300047321 Ga0495676_0093487 Ga0495676_0093487_1150_1923 242
360 3300048089 Ga0495614_0140945 Ga0495614_0140945_138_911 242
361 3300048904 Ga0496101_0185246 Ga0496101_0185246_650_1426 242
362 3300048913 Ga0496110_0204685 Ga0496110_0204685_854_1630 242
363 3300048914 Ga0496111_0053597 Ga0496111_0053597_1057_1833 242
364 3300048915 Ga0496112_0138306 Ga0496112_0138306_98_874 242
365 3300005327 Ga0070658_10153929 Ga0070658_101539294 243
366 3300005339 Ga0070660_100043246 Ga0070660_1000432463 243
367 3300005439 Ga0070711_100098293 Ga0070711_1000982932 243
368 3300005458 Ga0070681_10007687 Ga0070681_100076875 243
369 3300005530 Ga0070679_100006190 Ga0070679_1000061907 243
370 3300005563 Ga0068855_100176270 Ga0068855_1001762703 243
371 3300006175 Ga0070712_100004132 Ga0070712_1000041327 243
372 3300009147 Ga0114129_10263683 Ga0114129_102636833 243
373 3300009551 Ga0105238_10037849 Ga0105238_100378496 243
374 3300013105 Ga0157369_10207590 Ga0157369_102075904 243
375 3300013307 Ga0157372_10543544 Ga0157372_105435442 243
376 3300014968 Ga0157379_10377201 Ga0157379_103772012 243
377 3300025909 Ga0207705_10076166 Ga0207705_100761664 243
378 3300025915 Ga0207693_10002351 Ga0207693_1000235115 243
379 3300025915 Ga0207693_10236824 Ga0207693_102368242 243
380 3300025921 Ga0207652_10084695 Ga0207652_100846953 243
381 3300025924 Ga0207694_10176142 Ga0207694_101761423 243
382 3300025949 Ga0207667_10271242 Ga0207667_102712423 243
383 3300031711 Ga0265314_10039560 Ga0265314_100395604 243
384 3300032133 Ga0316583_10029508 Ga0316583_100295082 243
385 3300035089 Ga0373944_0090275 Ga0373944_0090275_13_816 243
386 3300035695 Ga0373927_0185762 Ga0373927_0185762_180_983 243
387 3300042012 Ga0439455_0031484 Ga0439455_0031484_405_1205 243
388 3300044693 Ga0466961_0131588 Ga0466961_0131588_377_1153 243
389 3300045976 Ga0466967_0357229 Ga0466967_0357229_44_820 243
390 3300046461 Ga0495641_0077498 Ga0495641_0077498_594_1397 243
391 3300046472 Ga0495580_0185405 Ga0495580_0185405_15_818 243
392 3300046529 Ga0495652_0139129 Ga0495652_0139129_708_1511 243
393 3300046533 Ga0495640_0072445 Ga0495640_0072445_600_1403 243
394 3300046543 Ga0495645_0302413 Ga0495645_0302413_153_956 243
395 3300049569 Ga0501032_0295081 Ga0501032_0295081_17_781 243
396 3300049571 Ga0501034_0005441 Ga0501034_0005441_11756_12520 243
397 3300049573 Ga0501037_0023203 Ga0501037_0023203_777_1541 243
398 3300049574 Ga0501038_0101979 Ga0501038_0101979_879_1649 243
399 3300049574 Ga0501038_0372742 Ga0501038_0372742_255_1019 243
400 3300049579 Ga0501043_0051671 Ga0501043_0051671_318_1082 243
401 3300049581 Ga0501047_0000218 Ga0501047_0000218_28603_29367 243
402 3300049582 Ga0501048_0000762 Ga0501048_0000762_21392_22156 243
403 3300049583 Ga0501067_0099398 Ga0501067_0099398_664_1428 243
404 3300049586 Ga0501070_0011908 Ga0501070_0011908_5356_6120 243
405 3300049590 Ga0501074_0203616 Ga0501074_0203616_215_979 243
406 3300049742 Ga0501080_0000489 Ga0501080_0000489_28706_29470 243
407 3300049744 Ga0501083_0073874 Ga0501083_0073874_42_806 243
408 3300049823 Ga0501044_0000931 Ga0501044_0000931_25315_26079 243
409 3300049823 Ga0501044_0028137 Ga0501044_0028137_2529_3332 243
410 3300053077 Ga0495601_0098855 Ga0495601_0098855_905_1708 243
411 3300053085 Ga0495619_0072311 Ga0495619_0072311_596_1399 243
412 3300001904 JGI24736J21556_1023741 JGI24736J21556_10237411 244
413 3300001977 JGI24746J21847_1000166 JGI24746J21847_10001664 244
414 3300001978 JGI24747J21853_1000502 JGI24747J21853_10005022 244
415 3300001979 JGI24740J21852_10013161 JGI24740J21852_100131613 244
416 3300001989 JGI24739J22299_10000057 JGI24739J22299_1000005724 244
417 3300001990 JGI24737J22298_10000391 JGI24737J22298_100003918 244
418 3300002070 JGI24750J21931_1000122 JGI24750J21931_100012211 244
419 3300002073 JGI24745J21846_1000432 JGI24745J21846_10004322 244
420 3300002074 JGI24748J21848_1008199 JGI24748J21848_10081991 244
421 3300002075 JGI24738J21930_10000767 JGI24738J21930_100007677 244
422 3300002076 JGI24749J21850_1000951 JGI24749J21850_10009513 244
423 3300002126 JGI24035J26624_1000228 JGI24035J26624_10002283 244
424 3300002155 JGI24033J26618_1000617 JGI24033J26618_10006173 244
425 3300002239 JGI24034J26672_10000108 JGI24034J26672_100001088 244
426 3300002244 JGI24742J22300_10000111 JGI24742J22300_1000011112 244
427 3300002459 JGI24751J29686_10013943 JGI24751J29686_100139432 244
428 3300005290 Ga0065712_10072616 Ga0065712_100726162 244
429 3300005293 Ga0065715_10090398 Ga0065715_100903984 244
430 3300005328 Ga0070676_10000170 Ga0070676_1000017026 244
431 3300005329 Ga0070683_100003392 Ga0070683_10000339211 244
432 3300005330 Ga0070690_100013276 Ga0070690_1000132767 244
433 3300005331 Ga0070670_100021304 Ga0070670_1000213048 244
434 3300005333 Ga0070677_10000320 Ga0070677_1000032017 244
435 3300005334 Ga0068869_100000181 Ga0068869_10000018118 244
436 3300005336 Ga0070680_100002750 Ga0070680_10000275011 244
437 3300005337 Ga0070682_100000903 Ga0070682_10000090316 244
438 3300005337 Ga0070682_100270343 Ga0070682_1002703431 244
439 3300005338 Ga0068868_100000590 Ga0068868_10000059014 244
440 3300005339 Ga0070660_100007288 Ga0070660_1000072887 244
441 3300005340 Ga0070689_100015933 Ga0070689_1000159337 244
442 3300005341 Ga0070691_10000085 Ga0070691_100000859 244
443 3300005343 Ga0070687_100000037 Ga0070687_10000003734 244
444 3300005344 Ga0070661_100014737 Ga0070661_1000147377 244
445 3300005345 Ga0070692_10000038 Ga0070692_1000003815 244
446 3300005347 Ga0070668_100012587 Ga0070668_1000125877 244
447 3300005353 Ga0070669_100015059 Ga0070669_1000150597 244
448 3300005354 Ga0070675_100013975 Ga0070675_1000139753 244
449 3300005355 Ga0070671_100010890 Ga0070671_1000108908 244
450 3300005356 Ga0070674_100000195 Ga0070674_10000019529 244
451 3300005364 Ga0070673_100000191 Ga0070673_1000001918 244
452 3300005365 Ga0070688_100008846 Ga0070688_1000088462 244
453 3300005366 Ga0070659_100001504 Ga0070659_1000015046 244
454 3300005367 Ga0070667_100015512 Ga0070667_1000155127 244
455 3300005434 Ga0070709_10129111 Ga0070709_101291112 244
456 3300005436 Ga0070713_100030801 Ga0070713_1000308013 244
457 3300005441 Ga0070700_100009799 Ga0070700_1000097997 244
458 3300005455 Ga0070663_100005367 Ga0070663_1000053677 244
459 3300005456 Ga0070678_100010208 Ga0070678_1000102086 244
460 3300005457 Ga0070662_100014550 Ga0070662_1000145502 244
461 3300005458 Ga0070681_10002441 Ga0070681_100024417 244
462 3300005459 Ga0068867_100000082 Ga0068867_10000008258 244
463 3300005535 Ga0070684_100001355 Ga0070684_10000135513 244
464 3300005536 Ga0070697_100046445 Ga0070697_1000464452 244
465 3300005539 Ga0068853_100020240 Ga0068853_1000202402 244
466 3300005543 Ga0070672_100001052 Ga0070672_10000105213 244
467 3300005544 Ga0070686_100005857 Ga0070686_1000058573 244
468 3300005545 Ga0070695_100024055 Ga0070695_1000240552 244
469 3300005546 Ga0070696_100019040 Ga0070696_1000190406 244
470 3300005547 Ga0070693_100006925 Ga0070693_1000069257 244
471 3300005548 Ga0070665_100035064 Ga0070665_1000350646 244
472 3300005549 Ga0070704_100002284 Ga0070704_10000228410 244
473 3300005563 Ga0068855_100066014 Ga0068855_1000660143 244
474 3300005564 Ga0070664_100015140 Ga0070664_1000151403 244
475 3300005577 Ga0068857_100001561 Ga0068857_10000156111 244
476 3300005578 Ga0068854_100000140 Ga0068854_1000001403 244
477 3300005614 Ga0068856_100014995 Ga0068856_1000149958 244
478 3300005615 Ga0070702_100000796 Ga0070702_1000007968 244
479 3300005615 Ga0070702_100171461 Ga0070702_1001714612 244
480 3300005616 Ga0068852_100009442 Ga0068852_1000094428 244
481 3300005617 Ga0068859_100029961 Ga0068859_1000299617 244
482 3300005618 Ga0068864_100002090 Ga0068864_1000020908 244
483 3300005840 Ga0068870_10000063 Ga0068870_1000006334 244
484 3300005841 Ga0068863_100026081 Ga0068863_1000260813 244
485 3300005842 Ga0068858_100025376 Ga0068858_1000253767 244
486 3300005843 Ga0068860_100003358 Ga0068860_1000033587 244
487 3300005844 Ga0068862_100001746 Ga0068862_10000174616 244
488 3300006048 Ga0075363_100148315 Ga0075363_1001483153 244
489 3300006237 Ga0097621_100000083 Ga0097621_1000000833 244
490 3300006358 Ga0068871_100000067 Ga0068871_1000000673 244
491 3300006871 Ga0075434_100006580 Ga0075434_1000065805 244
492 3300006881 Ga0068865_100000244 Ga0068865_10000024430 244
493 3300006931 Ga0097620_100029962 Ga0097620_1000299623 244
494 3300009093 Ga0105240_10027953 Ga0105240_100279533 244
495 3300009094 Ga0111539_10032831 Ga0111539_100328317 244
496 3300009094 Ga0111539_10091401 Ga0111539_100914012 244
497 3300009098 Ga0105245_10000762 Ga0105245_100007623 244
498 3300009101 Ga0105247_10178452 Ga0105247_101784521 244
499 3300009148 Ga0105243_10016647 Ga0105243_100166472 244
500 3300009174 Ga0105241_10000900 Ga0105241_1000090022 244
501 3300009176 Ga0105242_10000036 Ga0105242_1000003693 244
502 3300009177 Ga0105248_10050918 Ga0105248_100509182 244
503 3300009545 Ga0105237_10029241 Ga0105237_100292417 244
504 3300009551 Ga0105238_10101122 Ga0105238_101011223 244
505 3300009553 Ga0105249_10001033 Ga0105249_100010337 244
506 3300010375 Ga0105239_10042248 Ga0105239_100422481 244
507 3300013102 Ga0157371_10075390 Ga0157371_100753903 244
508 3300013296 Ga0157374_10009715 Ga0157374_100097153 244
509 3300013297 Ga0157378_10002181 Ga0157378_1000218114 244
510 3300013306 Ga0163162_10021532 Ga0163162_100215328 244
511 3300013307 Ga0157372_10039877 Ga0157372_100398772 244
512 3300013308 Ga0157375_10003806 Ga0157375_100038068 244
513 3300014325 Ga0163163_10088960 Ga0163163_100889603 244
514 3300014326 Ga0157380_10001301 Ga0157380_100013017 244
515 3300014745 Ga0157377_10000124 Ga0157377_100001242 244
516 3300014968 Ga0157379_10000275 Ga0157379_1000027526 244
517 3300014969 Ga0157376_10000115 Ga0157376_1000011548 244
518 3300017792 Ga0163161_10010835 Ga0163161_100108357 244
519 3300025271 Ga0207666_1000050 Ga0207666_10000505 244
520 3300025290 Ga0207673_1000083 Ga0207673_10000834 244
521 3300025315 Ga0207697_10000039 Ga0207697_100000392 244
522 3300025893 Ga0207682_10000121 Ga0207682_1000012135 244
523 3300025899 Ga0207642_10001013 Ga0207642_100010138 244
524 3300025900 Ga0207710_10104614 Ga0207710_101046141 244
525 3300025901 Ga0207688_10000073 Ga0207688_1000007337 244
526 3300025904 Ga0207647_10013109 Ga0207647_100131098 244
527 3300025907 Ga0207645_10000114 Ga0207645_1000011449 244
528 3300025908 Ga0207643_10000134 Ga0207643_100001345 244
529 3300025911 Ga0207654_10000527 Ga0207654_1000052721 244
530 3300025912 Ga0207707_10017884 Ga0207707_100178848 244
531 3300025914 Ga0207671_10015778 Ga0207671_100157782 244
532 3300025917 Ga0207660_10000034 Ga0207660_1000003456 244
533 3300025918 Ga0207662_10008712 Ga0207662_100087128 244
534 3300025919 Ga0207657_10005404 Ga0207657_100054047 244
535 3300025920 Ga0207649_10000142 Ga0207649_1000014245 244
536 3300025921 Ga0207652_10002021 Ga0207652_1000202117 244
537 3300025923 Ga0207681_10000065 Ga0207681_100000659 244
538 3300025924 Ga0207694_10061870 Ga0207694_100618703 244
539 3300025925 Ga0207650_10013410 Ga0207650_100134108 244
540 3300025926 Ga0207659_10000078 Ga0207659_1000007815 244
541 3300025927 Ga0207687_10007258 Ga0207687_100072582 244
542 3300025931 Ga0207644_10023497 Ga0207644_100234976 244
543 3300025932 Ga0207690_10000200 Ga0207690_1000020045 244
544 3300025933 Ga0207706_10023274 Ga0207706_100232748 244
545 3300025934 Ga0207686_10007002 Ga0207686_100070023 244
546 3300025935 Ga0207709_10000183 Ga0207709_1000018376 244
547 3300025937 Ga0207669_10000248 Ga0207669_100002482 244
548 3300025938 Ga0207704_10000719 Ga0207704_1000071912 244
549 3300025940 Ga0207691_10000990 Ga0207691_100009902 244
550 3300025941 Ga0207711_10031108 Ga0207711_100311085 244
551 3300025942 Ga0207689_10000144 Ga0207689_100001445 244
552 3300025944 Ga0207661_10001264 Ga0207661_1000126415 244
553 3300025945 Ga0207679_10000064 Ga0207679_1000006491 244
554 3300025960 Ga0207651_10000420 Ga0207651_100004208 244
555 3300025961 Ga0207712_10001661 Ga0207712_100016613 244
556 3300025981 Ga0207640_10004058 Ga0207640_100040589 244
557 3300025986 Ga0207658_10022503 Ga0207658_100225032 244
558 3300026023 Ga0207677_10008968 Ga0207677_100089688 244
559 3300026035 Ga0207703_10010897 Ga0207703_100108975 244
560 3300026041 Ga0207639_10379319 Ga0207639_103793192 244
561 3300026067 Ga0207678_10003913 Ga0207678_1000391311 244
562 3300026075 Ga0207708_10016908 Ga0207708_100169087 244
563 3300026078 Ga0207702_10032108 Ga0207702_100321086 244
564 3300026088 Ga0207641_10001821 Ga0207641_1000182111 244
565 3300026089 Ga0207648_10023701 Ga0207648_100237017 244
566 3300026095 Ga0207676_10000079 Ga0207676_1000007985 244
567 3300026116 Ga0207674_10000323 Ga0207674_1000032349 244
568 3300026118 Ga0207675_100000270 Ga0207675_1000002702 244
569 3300026121 Ga0207683_10000037 Ga0207683_1000003715 244
570 3300026142 Ga0207698_10001179 Ga0207698_1000117913 244
571 3300027252 Ga0209973_1001076 Ga0209973_10010763 244
572 3300027617 Ga0210002_1000055 Ga0210002_10000552 244
573 3300027717 Ga0209998_10003279 Ga0209998_100032793 244
574 3300027876 Ga0209974_10001624 Ga0209974_100016248 244
575 3300027907 Ga0207428_10000947 Ga0207428_1000094729 244
576 3300028379 Ga0268266_10050353 Ga0268266_100503532 244
577 3300028380 Ga0268265_10001593 Ga0268265_1000159315 244
578 3300028381 Ga0268264_10002487 Ga0268264_1000248715 244
579 3300031595 Ga0265313_10057445 Ga0265313_100574452 244
580 3300034816 Ga0373930_0002122 Ga0373930_0002122_329_1129 244
581 3300034957 Ga0373938_0000060 Ga0373938_0000060_4029_4829 244
582 3300035084 Ga0373928_0002099 Ga0373928_0002099_696_1496 244
583 3300035088 Ga0373940_0027836 Ga0373940_0027836_313_1113 244
584 3300035090 Ga0373949_0006592 Ga0373949_0006592_1470_2270 244
585 3300035091 Ga0373951_0017842 Ga0373951_0017842_327_1127 244
586 3300035092 Ga0373952_0003451 Ga0373952_0003451_1803_2603 244
587 3300035092 Ga0373952_0032655 Ga0373952_0032655_70_861 244
588 3300035112 Ga0373932_0002546 Ga0373932_0002546_1564_2364 244
589 3300035115 Ga0373941_0018605 Ga0373941_0018605_1000_1800 244
590 3300035241 Ga0373961_0007426 Ga0373961_0007426_278_1078 244
591 3300035242 Ga0373962_0001858 Ga0373962_0001858_2196_2996 244
592 3300035691 Ga0373931_0005088 Ga0373931_0005088_1229_2029 244
593 3300035692 Ga0373935_0225194 Ga0373935_0225194_504_1289 244
594 3300035692 Ga0373935_0233538 Ga0373935_0233538_269_1072 244
595 3300036401 Ga0373937_0110446 Ga0373937_0110446_742_1518 244
596 3300042439 Ga0439464_0056907 Ga0439464_0056907_282_1082 244
597 3300046462 Ga0495651_0008470 Ga0495651_0008470_503_1276 244
598 3300046463 Ga0495653_0044857 Ga0495653_0044857_2310_3086 244
599 3300046463 Ga0495653_0049099 Ga0495653_0049099_2197_2970 244
600 3300046475 Ga0495639_0010519 Ga0495639_0010519_2923_3696 244
601 3300046516 Ga0495628_0049236 Ga0495628_0049236_1389_2162 244
602 3300046543 Ga0495645_0149353 Ga0495645_0149353_818_1591 244
603 3300046663 Ga0495635_0021945 Ga0495635_0021945_765_1538 244
604 3300046663 Ga0495635_0118712 Ga0495635_0118712_985_1761 244
605 3300046680 Ga0495646_0009338 Ga0495646_0009338_88_861 244
606 3300046684 Ga0495669_0002627 Ga0495669_0002627_1061_1861 244
607 3300046689 Ga0495613_0423506 Ga0495613_0423506_85_858 244
608 3300047315 Ga0495581_0071081 Ga0495581_0071081_644_1447 244
609 3300047317 Ga0495604_0311425 Ga0495604_0311425_160_936 244
610 3300047321 Ga0495676_0251510 Ga0495676_0251510_212_1015 244
611 3300047322 Ga0495680_0202209 Ga0495680_0202209_404_1177 244
612 3300047445 Ga0495677_0069897 Ga0495677_0069897_362_1162 244
613 3300047471 Ga0495684_0002658 Ga0495684_0002658_1721_2494 244
614 3300048903 Ga0496100_0005485 Ga0496100_0005485_5851_6651 244
615 3300048905 Ga0496102_0000857 Ga0496102_0000857_8306_9106 244
616 3300048906 Ga0496103_0001402 Ga0496103_0001402_3315_4115 244
617 3300048907 Ga0496104_0075925 Ga0496104_0075925_940_1740 244
618 3300048911 Ga0496108_0003866 Ga0496108_0003866_5901_6701 244
619 3300048912 Ga0496109_0005368 Ga0496109_0005368_6987_7787 244
620 3300048913 Ga0496110_0184148 Ga0496110_0184148_706_1506 244
621 3300048916 Ga0496113_0018247 Ga0496113_0018247_4089_4871 244
622 3300048917 Ga0496114_0001715 Ga0496114_0001715_1057_1857 244
623 3300048918 Ga0496115_0003668 Ga0496115_0003668_4555_5355 244
624 3300049741 Ga0501079_0195819 Ga0501079_0195819_146_946 244
625 3300050511 nmdc:mga08y16_137324_c1 nmdc:mga08y16_137324_c1_307_1128 244
626 3300050512 nmdc:mga0n895_6097_c1 nmdc:mga0n895_6097_c1_5136_5936 244
627 3300053077 Ga0495601_0005957 Ga0495601_0005957_6268_7044 244
628 3300053077 Ga0495601_0012093 Ga0495601_0012093_749_1522 244
629 3300053078 Ga0495612_0026304 Ga0495612_0026304_366_1139 244
630 3300053078 Ga0495612_0066058 Ga0495612_0066058_649_1425 244
631 3300053084 Ga0495595_0003051 Ga0495595_0003051_5691_6464 244
632 3300053085 Ga0495619_0000043 Ga0495619_0000043_102200_102976 244
633 2209111006 2214756334 2213770201 245
634 3300000041 ARcpr5oldR_c000183 ARcpr5oldR_0001839 245
635 3300000042 ARSoilYngRDRAFT_c00120 ARSoilYngRDRAFT_001207 245
636 3300000043 ARcpr5yngRDRAFT_c000195 ARcpr5yngRDRAFT_0001953 245
637 3300000044 ARSoilOldRDRAFT_c000093 ARSoilOldRDRAFT_00009311 245
638 3300000045 ARCol0oldRDRAFT_c01241 ARCol0oldRDRAFT_012412 245
639 3300000652 ARCol0yngRDRAFT_1000124 ARCol0yngRDRAFT_100012410 245
640 3300001990 JGI24737J22298_10001583 JGI24737J22298_100015839 245
641 3300005276 Ga0065717_1003053 Ga0065717_10030531 245
642 3300005289 Ga0065704_10107468 Ga0065704_101074683 245
643 3300005290 Ga0065712_10103628 Ga0065712_101036282 245
644 3300005293 Ga0065715_10002625 Ga0065715_100026259 245
645 3300005293 Ga0065715_10327286 Ga0065715_103272861 245
646 3300005295 Ga0065707_10135694 Ga0065707_101356943 245
647 3300005340 Ga0070689_100001256 Ga0070689_1000012563 245
648 3300005341 Ga0070691_10052867 Ga0070691_100528672 245
649 3300005343 Ga0070687_100009985 Ga0070687_1000099852 245
650 3300005356 Ga0070674_100106305 Ga0070674_1001063053 245
651 3300005365 Ga0070688_100006371 Ga0070688_1000063713 245
652 3300005438 Ga0070701_10032655 Ga0070701_100326552 245
653 3300005441 Ga0070700_100028282 Ga0070700_1000282823 245
654 3300005444 Ga0070694_100019235 Ga0070694_1000192352 245
655 3300005455 Ga0070663_100082466 Ga0070663_1000824663 245
656 3300005457 Ga0070662_100001810 Ga0070662_10000181014 245
657 3300005458 Ga0070681_10022976 Ga0070681_100229765 245
658 3300005466 Ga0070685_10006868 Ga0070685_100068684 245
659 3300005507 Ga0074259_10441056 Ga0074259_104410561 245
660 3300005530 Ga0070679_100059858 Ga0070679_1000598582 245
661 3300005543 Ga0070672_100083939 Ga0070672_1000839393 245
662 3300005544 Ga0070686_100079120 Ga0070686_1000791202 245
663 3300005545 Ga0070695_100028142 Ga0070695_1000281423 245
664 3300005546 Ga0070696_100055263 Ga0070696_1000552633 245
665 3300005549 Ga0070704_100008914 Ga0070704_1000089143 245
666 3300005719 Ga0068861_100062512 Ga0068861_1000625123 245
667 3300005841 Ga0068863_100474921 Ga0068863_1004749212 245
668 3300005842 Ga0068858_100042274 Ga0068858_1000422744 245
669 3300009094 Ga0111539_10207974 Ga0111539_102079742 245
670 3300009148 Ga0105243_10124097 Ga0105243_101240972 245
671 3300009174 Ga0105241_10247267 Ga0105241_102472672 245
672 3300009177 Ga0105248_10034721 Ga0105248_100347211 245
673 3300009553 Ga0105249_10065149 Ga0105249_100651492 245
674 3300010375 Ga0105239_10035447 Ga0105239_100354472 245
675 3300012505 Ga0157339_1000936 Ga0157339_10009362 245
676 3300013100 Ga0157373_10432321 Ga0157373_104323211 245
677 3300013306 Ga0163162_10011076 Ga0163162_100110762 245
678 3300013308 Ga0157375_10188167 Ga0157375_101881673 245
679 3300014325 Ga0163163_10016530 Ga0163163_100165307 245
680 3300025271 Ga0207666_1000394 Ga0207666_10003946 245
681 3300025315 Ga0207697_10044924 Ga0207697_100449241 245
682 3300025901 Ga0207688_10001691 Ga0207688_100016913 245
683 3300025904 Ga0207647_10023727 Ga0207647_100237272 245
684 3300025912 Ga0207707_10165869 Ga0207707_101658692 245
685 3300025915 Ga0207693_10396546 Ga0207693_103965461 245
686 3300025917 Ga0207660_10101409 Ga0207660_101014091 245
687 3300025919 Ga0207657_10014984 Ga0207657_100149842 245
688 3300025921 Ga0207652_10196609 Ga0207652_101966092 245
689 3300025933 Ga0207706_10264061 Ga0207706_102640612 245
690 3300025937 Ga0207669_10194135 Ga0207669_101941351 245
691 3300025940 Ga0207691_10162026 Ga0207691_101620262 245
692 3300025942 Ga0207689_10164753 Ga0207689_101647533 245
693 3300025944 Ga0207661_10169458 Ga0207661_101694582 245
694 3300025945 Ga0207679_10188373 Ga0207679_101883732 245
695 3300025960 Ga0207651_10234872 Ga0207651_102348721 245
696 3300025961 Ga0207712_10136291 Ga0207712_101362912 245
697 3300026035 Ga0207703_10668501 Ga0207703_106685011 245
698 3300026067 Ga0207678_10043085 Ga0207678_100430852 245
699 3300026075 Ga0207708_10029616 Ga0207708_100296162 245
700 3300026118 Ga0207675_100048918 Ga0207675_1000489182 245
701 3300027552 Ga0209982_1014937 Ga0209982_10149371 245
702 3300027682 Ga0209971_1012497 Ga0209971_10124972 245
703 3300027695 Ga0209966_1010800 Ga0209966_10108002 245
704 3300027717 Ga0209998_10006433 Ga0209998_100064332 245
705 3300027907 Ga0207428_10169255 Ga0207428_101692553 245
706 3300028380 Ga0268265_10459201 Ga0268265_104592011 245
707 3300028381 Ga0268264_10185461 Ga0268264_101854611 245
708 3300028800 Ga0265338_10075788 Ga0265338_100757882 245
709 3300031250 Ga0265331_10074499 Ga0265331_100744993 245
710 3300031595 Ga0265313_10009755 Ga0265313_100097559 245
711 3300034817 Ga0373948_0015571 Ga0373948_0015571_545_1366 245
712 3300035084 Ga0373928_0002309 Ga0373928_0002309_2395_3216 245
713 3300035085 Ga0373929_0016449 Ga0373929_0016449_17_838 245
714 3300035088 Ga0373940_0012286 Ga0373940_0012286_1038_1859 245
715 3300035091 Ga0373951_0064848 Ga0373951_0064848_77_898 245
716 3300035092 Ga0373952_0003689 Ga0373952_0003689_1913_2734 245
717 3300035112 Ga0373932_0003334 Ga0373932_0003334_2564_3385 245
718 3300035114 Ga0373939_0000354 Ga0373939_0000354_4347_5168 245
719 3300035115 Ga0373941_0000729 Ga0373941_0000729_543_1364 245
720 3300035121 Ga0373960_0000114 Ga0373960_0000114_9230_10051 245
721 3300035242 Ga0373962_0010726 Ga0373962_0010726_19_840 245
722 3300035691 Ga0373931_0011401 Ga0373931_0011401_542_1363 245
723 3300035724 Ga0373933_0456464 Ga0373933_0456464_10_795 245
724 3300036401 Ga0373937_0354592 Ga0373937_0354592_379_1164 245
725 3300037466 Ga0395898_0008249 Ga0395898_0008249_2461_3240 245
726 3300045976 Ga0466967_0030498 Ga0466967_0030498_1027_1797 245
727 3300046476 Ga0495662_0104251 Ga0495662_0104251_22_810 245
728 3300048908 Ga0496105_0251297 Ga0496105_0251297_93_914 245
729 3300048909 Ga0496106_0026946 Ga0496106_0026946_512_1333 245
730 3300048910 Ga0496107_0035893 Ga0496107_0035893_2523_3344 245
731 3300048910 Ga0496107_0081619 Ga0496107_0081619_428_1222 245
732 3300048912 Ga0496109_0029090 Ga0496109_0029090_3605_4399 245
733 3300048913 Ga0496110_0230537 Ga0496110_0230537_528_1349 245
734 3300048913 Ga0496110_0330239 Ga0496110_0330239_532_1326 245
735 3300048914 Ga0496111_0235983 Ga0496111_0235983_501_1322 245
736 3300048915 Ga0496112_0004182 Ga0496112_0004182_2384_3178 245
737 3300048915 Ga0496112_0505139 Ga0496112_0505139_309_1130 245
738 3300048916 Ga0496113_0052028 Ga0496113_0052028_380_1174 245
739 3300049581 Ga0501047_0452222 Ga0501047_0452222_228_1001 245
740 3300049586 Ga0501070_0064609 Ga0501070_0064609_2002_2844 245
741 3300049741 Ga0501079_0327996 Ga0501079_0327996_327_1169 245
742 3300050511 nmdc:mga08y16_248815_c1 nmdc:mga08y16_248815_c1_272_1045 245
743 3300050512 nmdc:mga0n895_216859_c1 nmdc:mga0n895_216859_c1_852_1634 245
744 3300050512 nmdc:mga0n895_902858_c1 nmdc:mga0n895_902858_c1_32_853 245
745 3300050513 nmdc:mga0rr50_479651_c1 nmdc:mga0rr50_479651_c1_196_978 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

159

223

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

32

112

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

41

113

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

136

228

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

36

117

0.87

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

146

232

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9669 17 218
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9641 17 216
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9635 17 217
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.959 15 218
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9549 18 215
ID Description Score Start End Superfamily
4ecjB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9733 102 209 1.20.1050.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9718 18 100 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9706 17 98 3.40.30.10
af_P77526_87_192_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9706 102 204 1.20.1050.10
4f0bB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9652 104 209 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A523FIZ1-F1-model_v4 Glutathione S-transferase family protein 0.9965 17 87 GO:0016740
AF-A0A348G006-F1-model_v4 Thiol:disulfide oxidoreductase 0.9883 14 224
AF-A0A5M6HID1-F1-model_v4 Glutathione S-transferase family protein 0.9874 14 224 GO:0016740
AF-A0A833LL52-F1-model_v4 Glutathione S-transferase family protein 0.9862 13 218 GO:0016740
AF-A0A383DJX2-F1-model_v4 GST N-terminal domain-containing protein 0.9841 17 115

Feature Viewer

pLDDT pTM Quality
91.43 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map