F478907

General Info

Members Datasets Scaffolds Average Seq Length
747 392 1494 326

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100061684|Ga0070700_1000616842
Length 345
Sequence MKQAFFAVFNDPKETPIMKRRFLGWLAACAVAALATGVAAPALAQTKLKFAHVYETSEPYHKWALWAAGEIKQRTQGRYEMDVFPASQLGKETDINQGLTLGTVDVIYTGQAFAARTHPPLAIGGAPFMFRDFDHWQKYSSSPLLQELMDGYFKKGGNKPLAVTYYGVRHTTANKPINVPDDMKGLKLRVPDAPLYVMYPKVVGANATPIAFAEVYLALQSKTVDAQENPLPTIEAKKFYEVQSHINLTGHITEMLLTIVSGQTWNKLSDADKKTFEAVFKEAGAKCTDDIAAAEIKLVDEFATKYKKTVVKSDRAAFAAAFQKFHLGPDATWDKATYDRLQAIK

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
118 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
209 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
210 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
214 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
225 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
253 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
260 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
261 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
262 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
263 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
264 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
265 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
266 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
267 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
268 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
269 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
348 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
349 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
350 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
357 2508501050 Microvirga lupini Lut6 Isolate Nodule
358 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
359 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
360 2547132374 Acidovorax radicis N35 Isolate Unclassified
361 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
362 2643221683 Variovorax sp. Root473 Isolate Unclassified
363 2643221717 Acidovorax sp. Root267 Isolate Unclassified
364 2738543013 Variovorax sp. BT01 Isolate Unclassified
365 2842677519 Variovorax sp. R-72495 Isolate Unclassified
366 2842733646 Variovorax sp. R-72446 Isolate Unclassified
367 2842747753 Variovorax sp. R-72060 Isolate Unclassified
368 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
369 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
370 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
371 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
372 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
373 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
374 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
375 2904456579 Variovorax sp. 2002 Isolate Unclassified
376 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
377 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
378 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
379 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
380 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
381 2929520902 Variovorax beijingensis 502 Isolate Unclassified
382 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
383 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
384 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
385 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
386 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
387 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
388 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
389 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
390 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
391 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
392 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 0
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.32
Nodule 1.74
Rhizoplane 2.95
Rhizosphere 75.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100061684 3300005441 Bacteria 2366
2 JGI25155J39150_1000028 3300002704 Bacteria 120158
3 JGI25156J39149_1000013 3300002705 Bacteria 189553
4 JGI25154J39366_1000032 3300002738 Bacteria 189265
5 JGI25157J39369_1000017 3300002741 Bacteria 189553
6 JGI25150J39212_1008334 3300002774 Bacteria 2032
7 JGI25159J45721_1004214 3300002987 Bacteria 4848
8 JGI25159J45721_1006741 3300002987 Bacteria 3385
9 JGI25151J46595_10002986 3300003187 Bacteria 9645
10 JGI25151J46595_10008595 3300003187 Bacteria 4895
11 JGI25151J46595_10012976 3300003187 Bacteria 3764
12 JGI25151J46595_10026532 3300003187 Bacteria 2336
13 JGI25160J50197_1000106 3300003354 Bacteria 80449
14 JGI25161J50226_1000041 3300003374 Bacteria 124485
15 Ga0055526_1006939 3300003771 Bacteria 6021
16 Ga0055526_1006976 3300003771 Bacteria 5993
17 Ga0055537_1000029 3300003773 Bacteria 101797
18 Ga0055537_1000229 3300003773 Bacteria 41052
19 Ga0055537_1008434 3300003773 Bacteria 2379
20 Ga0055524_1000040 3300003775 Bacteria 157409
21 Ga0055536_1003958 3300003781 Bacteria 7764
22 Ga0055536_1005991 3300003781 Bacteria 5784
23 Ga0055534_1000081 3300003784 Bacteria 75591
24 Ga0055534_1001320 3300003784 Bacteria 9970
25 Ga0055528_1000107 3300003790 Bacteria 67056
26 Ga0055528_1003803 3300003790 Bacteria 7436
27 Ga0055530_10000493 3300003791 Bacteria 34162
28 Ga0055540_1000030 3300003792 Bacteria 177871
29 Ga0055540_1001837 3300003792 Bacteria 11979
30 Ga0055540_1002684 3300003792 Bacteria 9173
31 Ga0055531_10009620 3300003794 Bacteria 4920
32 Ga0055543_1001200 3300004625 Bacteria 10901
33 Ga0065165_1017710 3300005262 Bacteria 2612
34 Ga0065714_10109949 3300005288 Bacteria 1492
35 Ga0065704_10083585 3300005289 Bacteria 3445
36 Ga0065712_10014625 3300005290 Bacteria 2000
37 Ga0065715_10012822 3300005293 Bacteria 3362
38 Ga0065715_10021301 3300005293 Bacteria 1978
39 Ga0065707_10086478 3300005295 Bacteria 5441
40 Ga0065707_10113710 3300005295 Bacteria 2305
41 Ga0070658_10179870 3300005327 Bacteria 1779
42 Ga0070676_10049045 3300005328 Bacteria 2470
43 Ga0070676_10062704 3300005328 Bacteria 2212
44 Ga0070676_10141185 3300005328 Bacteria 1533
45 Ga0070676_10149960 3300005328 Bacteria 1492
46 Ga0070690_100017765 3300005330 Bacteria 4285
47 Ga0070690_100059812 3300005330 Bacteria 2450
48 Ga0070690_100069129 3300005330 Bacteria 2291
49 Ga0070690_100192824 3300005330 Bacteria 1414
50 Ga0070670_100049162 3300005331 Bacteria 3626
51 Ga0070670_100073813 3300005331 Bacteria 2930
52 Ga0070670_100155929 3300005331 Bacteria 1977
53 Ga0070677_10012753 3300005333 Bacteria 2923
54 Ga0070677_10029393 3300005333 Bacteria 2083
55 Ga0070677_10031593 3300005333 Bacteria 2025
56 Ga0068869_100011970 3300005334 Bacteria 5709
57 Ga0068869_100081511 3300005334 Bacteria 2416
58 Ga0068869_100100809 3300005334 Bacteria 2184
59 Ga0070666_10007413 3300005335 Bacteria 6762
60 Ga0070666_10047403 3300005335 Bacteria 2884
61 Ga0070666_10215970 3300005335 Bacteria 1352
62 Ga0070680_100112248 3300005336 Bacteria 2270
63 Ga0068868_100001955 3300005338 Bacteria 14135
64 Ga0068868_100022609 3300005338 Bacteria 4749
65 Ga0068868_100253216 3300005338 Bacteria 1482
66 Ga0068868_100341558 3300005338 Bacteria 1280
67 Ga0070660_100104911 3300005339 Bacteria 2242
68 Ga0070689_100051287 3300005340 Bacteria 3189
69 Ga0070689_100223463 3300005340 Bacteria 1545
70 Ga0070687_100041294 3300005343 Bacteria 2330
71 Ga0070687_100105808 3300005343 Bacteria 1584
72 Ga0070661_100160399 3300005344 Bacteria 1703
73 Ga0070668_100003555 3300005347 Bacteria 11496
74 Ga0070668_100020892 3300005347 Bacteria 4945
75 Ga0070668_100123058 3300005347 Bacteria 2075
76 Ga0070669_100017475 3300005353 Bacteria 5115
77 Ga0070669_100019673 3300005353 Bacteria 4823
78 Ga0070669_100080235 3300005353 Bacteria 2428
79 Ga0070669_100229947 3300005353 Bacteria 1469
80 Ga0070675_100005320 3300005354 Bacteria 9835
81 Ga0070675_100026424 3300005354 Bacteria 4659
82 Ga0070675_100061363 3300005354 Bacteria 3104
83 Ga0070675_100079423 3300005354 Bacteria 2733
84 Ga0070675_100161306 3300005354 Bacteria 1928
85 Ga0070675_100229391 3300005354 Bacteria 1619
86 Ga0070675_100316084 3300005354 Bacteria 1379
87 Ga0070671_100006632 3300005355 Bacteria 9251
88 Ga0070671_100043326 3300005355 Bacteria 3740
89 Ga0070671_100069616 3300005355 Bacteria 2935
90 Ga0070671_100081519 3300005355 Bacteria 2705
91 Ga0070674_100018239 3300005356 Bacteria 4433
92 Ga0070674_100029397 3300005356 Bacteria 3619
93 Ga0070674_100070201 3300005356 Bacteria 2474
94 Ga0070674_100140602 3300005356 Bacteria 1811
95 Ga0070674_100216580 3300005356 Bacteria 1487
96 Ga0070674_100308897 3300005356 Bacteria 1263
97 Ga0070673_100029782 3300005364 Bacteria 4075
98 Ga0070673_100067350 3300005364 Bacteria 2863
99 Ga0070673_100107639 3300005364 Bacteria 2306
100 Ga0070688_100043204 3300005365 Bacteria 2775
101 Ga0070659_100135367 3300005366 Bacteria 2003
102 Ga0070667_100018788 3300005367 Bacteria 5732
103 Ga0070667_100036122 3300005367 Bacteria 4142
104 Ga0070667_100038123 3300005367 Bacteria 4029
105 Ga0070667_100201894 3300005367 Bacteria 1764
106 Ga0070667_100262937 3300005367 Bacteria 1545
107 Ga0070701_10009247 3300005438 Bacteria 4309
108 Ga0070701_10125573 3300005438 Bacteria 1452
109 Ga0070663_100325826 3300005455 Bacteria 1236
110 Ga0070678_100053734 3300005456 Bacteria 2931
111 Ga0070678_100058482 3300005456 Bacteria 2829
112 Ga0070678_100075327 3300005456 Bacteria 2538
113 Ga0070678_100081587 3300005456 Bacteria 2452
114 Ga0070678_100105411 3300005456 Bacteria 2194
115 Ga0070678_100206128 3300005456 Bacteria 1626
116 Ga0070662_100012157 3300005457 Bacteria 5700
117 Ga0070662_100023662 3300005457 Bacteria 4222
118 Ga0070662_100047737 3300005457 Bacteria 3081
119 Ga0070662_100091956 3300005457 Bacteria 2279
120 Ga0070681_10014937 3300005458 Bacteria 7721
121 Ga0070681_10130574 3300005458 Bacteria 2444
122 Ga0068867_100002211 3300005459 Bacteria 13654
123 Ga0068867_100033665 3300005459 Bacteria 3712
124 Ga0068867_100036909 3300005459 Bacteria 3550
125 Ga0068867_100047053 3300005459 Bacteria 3170
126 Ga0070679_100010948 3300005530 Bacteria 8620
127 Ga0070679_100021873 3300005530 Bacteria 6246
128 Ga0070679_100212154 3300005530 Bacteria 1900
129 Ga0070684_100019585 3300005535 Bacteria 5600
130 Ga0070697_100165757 3300005536 Bacteria 1868
131 Ga0068853_100046393 3300005539 Bacteria 3725
132 Ga0068853_100241264 3300005539 Bacteria 1656
133 Ga0070672_100060460 3300005543 Bacteria 2983
134 Ga0070672_100061360 3300005543 Bacteria 2963
135 Ga0070672_100153963 3300005543 Bacteria 1903
136 Ga0070672_100343199 3300005543 Bacteria 1272
137 Ga0070686_100028269 3300005544 Bacteria 3399
138 Ga0070686_100087148 3300005544 Bacteria 2081
139 Ga0070686_100175520 3300005544 Bacteria 1519
140 Ga0070696_100004763 3300005546 Bacteria 9063
141 Ga0070693_100045512 3300005547 Bacteria 2488
142 Ga0070665_100013700 3300005548 Bacteria 8159
143 Ga0070665_100041030 3300005548 Bacteria 4651
144 Ga0070665_100111220 3300005548 Bacteria 2742
145 Ga0070665_100195858 3300005548 Bacteria 2021
146 Ga0070665_100220512 3300005548 Bacteria 1897
147 Ga0070665_100583693 3300005548 Bacteria 1130
148 Ga0070704_100281280 3300005549 Bacteria 1378
149 Ga0068855_100039058 3300005563 Bacteria 5636
150 Ga0070664_100325584 3300005564 Bacteria 1393
151 Ga0068857_100177520 3300005577 Bacteria 1938
152 Ga0068854_100147454 3300005578 Bacteria 1811
153 Ga0068856_100083350 3300005614 Bacteria 3174
154 Ga0070702_100063806 3300005615 Bacteria 2152
155 Ga0068852_100244512 3300005616 Bacteria 1716
156 Ga0068852_100248037 3300005616 Bacteria 1705
157 Ga0068859_100004027 3300005617 Bacteria 14982
158 Ga0068859_100068114 3300005617 Bacteria 3594
159 Ga0068859_100381668 3300005617 Bacteria 1504
160 Ga0068859_100558755 3300005617 Bacteria 1239
161 Ga0068864_100083775 3300005618 Bacteria 2800
162 Ga0068864_100126759 3300005618 Bacteria 2288
163 Ga0068866_10008823 3300005718 Bacteria 4262
164 Ga0068861_100002079 3300005719 Bacteria 12984
165 Ga0068861_100011946 3300005719 Bacteria 6048
166 Ga0068851_10036813 3300005834 Bacteria 2451
167 Ga0068851_10048399 3300005834 Bacteria 2154
168 Ga0068851_10122175 3300005834 Bacteria 1400
169 Ga0068870_10048317 3300005840 Bacteria 2240
170 Ga0068863_100004155 3300005841 Bacteria 14296
171 Ga0068863_100062379 3300005841 Bacteria 3525
172 Ga0068863_100071438 3300005841 Bacteria 3283
173 Ga0068863_100167627 3300005841 Bacteria 2106
174 Ga0068863_100333192 3300005841 Bacteria 1475
175 Ga0068858_100002678 3300005842 Bacteria 17932
176 Ga0068858_100117342 3300005842 Bacteria 2487
177 Ga0068858_100219961 3300005842 Bacteria 1798
178 Ga0068858_100429739 3300005842 Bacteria 1271
179 Ga0068860_100003245 3300005843 Bacteria 16767
180 Ga0068860_100005443 3300005843 Bacteria 12906
181 Ga0068860_100033915 3300005843 Bacteria 4897
182 Ga0068860_100100078 3300005843 Bacteria 2765
183 Ga0068862_100020138 3300005844 Bacteria 5572
184 Ga0068862_100027364 3300005844 Bacteria 4800
185 Ga0068862_100224900 3300005844 Bacteria 1700
186 Ga0081540_1015210 3300005983 Bacteria 4881
187 Ga0070717_10399214 3300006028 Bacteria 1235
188 Ga0075365_10070319 3300006038 Bacteria 2354
189 Ga0075365_10143044 3300006038 Bacteria 1661
190 Ga0075363_100010846 3300006048 Bacteria 4346
191 Ga0075364_10079127 3300006051 Bacteria 2172
192 Ga0070716_100009470 3300006173 Bacteria 4858
193 Ga0075362_10007059 3300006177 Bacteria 4224
194 Ga0075362_10030954 3300006177 Bacteria 2313
195 Ga0075369_10042662 3300006186 Bacteria 1945
196 Ga0075366_10001983 3300006195 Bacteria 10365
197 Ga0075366_10012005 3300006195 Bacteria 4905
198 Ga0097621_100001880 3300006237 Bacteria 14378
199 Ga0097621_100061406 3300006237 Bacteria 3082
200 Ga0097621_100117798 3300006237 Bacteria 2251
201 Ga0075370_10021532 3300006353 Bacteria 3532
202 Ga0068871_100002226 3300006358 Bacteria 13179
203 Ga0068871_100040497 3300006358 Bacteria 3732
204 Ga0075428_100000130 3300006844 Bacteria 65814
205 Ga0075430_100009841 3300006846 Bacteria 8087
206 Ga0075433_10067380 3300006852 Bacteria 3142
207 Ga0075429_100000541 3300006880 Bacteria 28764
208 Ga0075429_100003178 3300006880 Bacteria 13964
209 Ga0068865_100037005 3300006881 Bacteria 3293
210 Ga0068865_100152279 3300006881 Bacteria 1756
211 Ga0068865_100217357 3300006881 Bacteria 1492
212 Ga0075436_100097370 3300006914 Bacteria 2047
213 Ga0075436_100102475 3300006914 Bacteria 1994
214 Ga0097620_100004027 3300006931 Bacteria 14982
215 Ga0097620_100068114 3300006931 Bacteria 3594
216 Ga0097620_100381709 3300006931 Bacteria 1504
217 Ga0097620_100558827 3300006931 Bacteria 1239
218 Ga0099826_10000087 3300006948 Bacteria 46364
219 Ga0099826_10073699 3300006948 Bacteria 2156
220 Ga0075435_100002374 3300007076 Bacteria 12484
221 Ga0075435_100118338 3300007076 Bacteria 2208
222 Ga0099794_10097702 3300007265 Bacteria 1463
223 Ga0111539_10000801 3300009094 Bacteria 40972
224 Ga0111539_10016103 3300009094 Bacteria 9277
225 Ga0111539_10017872 3300009094 Bacteria 8782
226 Ga0111539_10023989 3300009094 Bacteria 7493
227 Ga0105245_10075153 3300009098 Bacteria 3076
228 Ga0105245_10083242 3300009098 Bacteria 2928
229 Ga0114129_10000604 3300009147 Bacteria 44388
230 Ga0105243_10002623 3300009148 Bacteria 14958
231 Ga0105243_10068322 3300009148 Bacteria 2864
232 Ga0105243_10080527 3300009148 Bacteria 2657
233 Ga0105243_10222758 3300009148 Bacteria 1668
234 Ga0105241_10351492 3300009174 Bacteria 1280
235 Ga0105242_10002310 3300009176 Bacteria 15045
236 Ga0105242_10021682 3300009176 Bacteria 5046
237 Ga0105242_10064669 3300009176 Bacteria 3016
238 Ga0105248_10051302 3300009177 Bacteria 4629
239 Ga0105248_10128074 3300009177 Bacteria 2864
240 Ga0105237_10060033 3300009545 Bacteria 3804
241 Ga0105238_10293509 3300009551 Bacteria 1608
242 Ga0105249_10017865 3300009553 Bacteria 6302
243 Ga0105249_10139785 3300009553 Bacteria 2321
244 Ga0105249_10166771 3300009553 Bacteria 2132
245 Ga0105249_10248077 3300009553 Bacteria 1764
246 Ga0099796_10066554 3300010159 Bacteria 1291
247 Ga0105239_10066299 3300010375 Bacteria 3966
248 Ga0105246_10158720 3300011119 Bacteria 1721
249 Ga0157327_1000947 3300012512 Bacteria 1713
250 Ga0157326_1000451 3300012513 Bacteria 4870
251 Ga0157370_10003845 3300013104 Bacteria 17512
252 Ga0157369_10166440 3300013105 Bacteria 2325
253 Ga0157374_10037741 3300013296 Bacteria 4437
254 Ga0157374_10100494 3300013296 Bacteria 2773
255 Ga0157378_10022765 3300013297 Bacteria 5514
256 Ga0157378_10076992 3300013297 Bacteria 3006
257 Ga0163162_10005074 3300013306 Bacteria 12688
258 Ga0163162_10106194 3300013306 Bacteria 2903
259 Ga0163162_10222435 3300013306 Bacteria 2017
260 Ga0163162_10538660 3300013306 Bacteria 1296
261 Ga0157375_10024303 3300013308 Bacteria 5605
262 Ga0157375_10125411 3300013308 Bacteria 2682
263 Ga0163163_10016809 3300014325 Bacteria 6810
264 Ga0163163_10078290 3300014325 Bacteria 3302
265 Ga0157380_10019496 3300014326 Bacteria 5055
266 Ga0157380_10019525 3300014326 Bacteria 5051
267 Ga0157380_10067279 3300014326 Bacteria 2884
268 Ga0157377_10012265 3300014745 Bacteria 4304
269 Ga0157377_10080764 3300014745 Bacteria 1900
270 Ga0157377_10090220 3300014745 Bacteria 1808
271 Ga0157379_10052219 3300014968 Bacteria 3651
272 Ga0157379_10076187 3300014968 Bacteria 3004
273 Ga0157376_10103751 3300014969 Bacteria 2490
274 Ga0157376_10163317 3300014969 Bacteria 2021
275 Ga0182005_1028784 3300015265 Bacteria 1515
276 Ga0182005_1036246 3300015265 Bacteria 1341
277 Ga0163161_10000329 3300017792 Bacteria 40476
278 Ga0163161_10013701 3300017792 Bacteria 5646
279 Ga0163161_10053805 3300017792 Bacteria 2920
280 Ga0163161_10098799 3300017792 Bacteria 2170
281 Ga0163161_10129110 3300017792 Bacteria 1905
282 Ga0163161_10212954 3300017792 Bacteria 1493
283 Ga0213876_10027453 3300021384 Bacteria 3003
284 Ga0209435_100003 3300025206 Bacteria 669534
285 Ga0209436_105046 3300025208 Bacteria 3126
286 Ga0207425_1007648 3300025245 Bacteria 2831
287 Ga0209646_1000008 3300025246 Bacteria 669534
288 Ga0209026_1000007 3300025250 Bacteria 669534
289 Ga0209759_1000026 3300025256 Bacteria 311743
290 Ga0209129_1007409 3300025258 Bacteria 3276
291 Ga0209129_1020623 3300025258 Bacteria 1223
292 Ga0209565_1000026 3300025263 Bacteria 365910
293 Ga0209565_1000150 3300025263 Bacteria 94073
294 Ga0209565_1001312 3300025263 Bacteria 11421
295 Ga0207666_1001766 3300025271 Bacteria 2567
296 Ga0207666_1005525 3300025271 Bacteria 1617
297 Ga0209673_1000009 3300025273 Bacteria 620735
298 Ga0209673_1000012 3300025273 Bacteria 579480
299 Ga0209673_1000114 3300025273 Bacteria 178557
300 Ga0209673_1008634 3300025273 Bacteria 4514
301 Ga0209130_1000099 3300025284 Bacteria 141717
302 Ga0209130_1000123 3300025284 Bacteria 125840
303 Ga0209130_1006153 3300025284 Bacteria 3960
304 Ga0209675_1000062 3300025291 Bacteria 178557
305 Ga0209675_1000155 3300025291 Bacteria 89020
306 Ga0209675_1004791 3300025291 Bacteria 5878
307 Ga0209675_1005864 3300025291 Bacteria 5045
308 Ga0209676_1000051 3300025292 Bacteria 389016
309 Ga0209676_1000325 3300025292 Bacteria 91840
310 Ga0209676_1008862 3300025292 Bacteria 4423
311 Ga0209676_1009460 3300025292 Bacteria 4200
312 Ga0209676_1026578 3300025292 Bacteria 1836
313 Ga0209025_1000521 3300025294 Bacteria 73251
314 Ga0209025_1004061 3300025294 Bacteria 13090
315 Ga0209025_1007738 3300025294 Bacteria 7920
316 Ga0209025_1009286 3300025294 Bacteria 6885
317 Ga0209564_1000211 3300025295 Bacteria 133277
318 Ga0209564_1000228 3300025295 Bacteria 125206
319 Ga0209564_1004815 3300025295 Bacteria 8037
320 Ga0209758_1054147 3300025297 Bacteria 1372
321 Ga0209050_1000044 3300025298 Bacteria 391114
322 Ga0209050_1003950 3300025298 Bacteria 10477
323 Ga0209050_1010312 3300025298 Bacteria 4620
324 Ga0209256_1000003 3300025299 Bacteria 1661127
325 Ga0207426_1000062 3300025302 Bacteria 362040
326 Ga0207426_1003919 3300025302 Bacteria 7633
327 Ga0209051_1000031 3300025303 Bacteria 391114
328 Ga0209051_1000208 3300025303 Bacteria 102967
329 Ga0209051_1000760 3300025303 Bacteria 34370
330 Ga0209051_1042140 3300025303 Bacteria 1616
331 Ga0209257_1000058 3300025304 Bacteria 381686
332 Ga0209257_1008393 3300025304 Bacteria 5887
333 Ga0209257_1014090 3300025304 Bacteria 3474
334 Ga0207697_10009556 3300025315 Bacteria 4185
335 Ga0207697_10032926 3300025315 Bacteria 2122
336 Ga0207697_10065936 3300025315 Bacteria 1512
337 Ga0207682_10001921 3300025893 Bacteria 9445
338 Ga0207682_10009146 3300025893 Bacteria 3914
339 Ga0207682_10038424 3300025893 Bacteria 1942
340 Ga0207682_10057923 3300025893 Bacteria 1616
341 Ga0207642_10015639 3300025899 Bacteria 2834
342 Ga0207688_10004631 3300025901 Bacteria 7495
343 Ga0207688_10033243 3300025901 Bacteria 2852
344 Ga0207699_10067868 3300025906 Bacteria 2170
345 Ga0207645_10003092 3300025907 Bacteria 12763
346 Ga0207645_10007091 3300025907 Bacteria 7965
347 Ga0207645_10027206 3300025907 Bacteria 3694
348 Ga0207645_10115523 3300025907 Bacteria 1740
349 Ga0207643_10003923 3300025908 Bacteria 8004
350 Ga0207643_10054228 3300025908 Bacteria 2278
351 Ga0207707_10044809 3300025912 Bacteria 3855
352 Ga0207707_10104139 3300025912 Bacteria 2480
353 Ga0207671_10162669 3300025914 Bacteria 1729
354 Ga0207660_10007738 3300025917 Bacteria 6956
355 Ga0207660_10131999 3300025917 Bacteria 1902
356 Ga0207662_10003730 3300025918 Bacteria 7899
357 Ga0207662_10076536 3300025918 Bacteria 2034
358 Ga0207657_10049797 3300025919 Bacteria 3648
359 Ga0207652_10005260 3300025921 Bacteria 10509
360 Ga0207652_10282909 3300025921 Bacteria 1496
361 Ga0207681_10007401 3300025923 Bacteria 6721
362 Ga0207681_10018416 3300025923 Bacteria 4400
363 Ga0207681_10074401 3300025923 Bacteria 2379
364 Ga0207681_10081248 3300025923 Bacteria 2288
365 Ga0207681_10124240 3300025923 Bacteria 1897
366 Ga0207681_10215106 3300025923 Bacteria 1484
367 Ga0207694_10076303 3300025924 Bacteria 2625
368 Ga0207650_10023527 3300025925 Bacteria 4369
369 Ga0207650_10069686 3300025925 Bacteria 2642
370 Ga0207659_10007169 3300025926 Bacteria 6843
371 Ga0207659_10020490 3300025926 Bacteria 4372
372 Ga0207659_10058986 3300025926 Bacteria 2757
373 Ga0207659_10059908 3300025926 Bacteria 2738
374 Ga0207659_10138499 3300025926 Bacteria 1887
375 Ga0207659_10356728 3300025926 Bacteria 1214
376 Ga0207659_10492099 3300025926 Bacteria 1037
377 Ga0207687_10049293 3300025927 Bacteria 2928
378 Ga0207687_10322388 3300025927 Bacteria 1251
379 Ga0207644_10000068 3300025931 Bacteria 76090
380 Ga0207644_10015661 3300025931 Bacteria 5094
381 Ga0207644_10051778 3300025931 Bacteria 2948
382 Ga0207690_10095883 3300025932 Bacteria 2108
383 Ga0207706_10052263 3300025933 Bacteria 3607
384 Ga0207706_10152950 3300025933 Bacteria 2029
385 Ga0207686_10028134 3300025934 Bacteria 3301
386 Ga0207686_10031426 3300025934 Bacteria 3152
387 Ga0207709_10002195 3300025935 Bacteria 12448
388 Ga0207709_10021397 3300025935 Bacteria 3661
389 Ga0207709_10186987 3300025935 Bacteria 1468
390 Ga0207709_10338157 3300025935 Bacteria 1132
391 Ga0207670_10099193 3300025936 Bacteria 2077
392 Ga0207669_10017506 3300025937 Bacteria 3679
393 Ga0207669_10026733 3300025937 Bacteria 3145
394 Ga0207669_10067712 3300025937 Bacteria 2226
395 Ga0207704_10002833 3300025938 Bacteria 7826
396 Ga0207704_10058905 3300025938 Bacteria 2368
397 Ga0207704_10186226 3300025938 Bacteria 1505
398 Ga0207665_10019966 3300025939 Bacteria 4403
399 Ga0207665_10062982 3300025939 Bacteria 2518
400 Ga0207691_10017865 3300025940 Bacteria 6721
401 Ga0207691_10038713 3300025940 Bacteria 4412
402 Ga0207691_10076011 3300025940 Bacteria 3027
403 Ga0207691_10096530 3300025940 Bacteria 2642
404 Ga0207691_10135806 3300025940 Bacteria 2169
405 Ga0207691_10140623 3300025940 Bacteria 2127
406 Ga0207691_10168616 3300025940 Bacteria 1918
407 Ga0207711_10019765 3300025941 Bacteria 5612
408 Ga0207711_10054755 3300025941 Bacteria 3424
409 Ga0207689_10001957 3300025942 Bacteria 19463
410 Ga0207689_10003617 3300025942 Bacteria 14127
411 Ga0207689_10028597 3300025942 Bacteria 4661
412 Ga0207689_10057292 3300025942 Bacteria 3206
413 Ga0207689_10093231 3300025942 Bacteria 2474
414 Ga0207651_10183129 3300025960 Bacteria 1664
415 Ga0207651_10425300 3300025960 Bacteria 1135
416 Ga0207712_10085529 3300025961 Bacteria 2308
417 Ga0207712_10291971 3300025961 Bacteria 1335
418 Ga0207668_10050743 3300025972 Bacteria 2861
419 Ga0207668_10159663 3300025972 Bacteria 1755
420 Ga0207640_10167449 3300025981 Bacteria 1633
421 Ga0207640_10314162 3300025981 Bacteria 1245
422 Ga0207640_10359120 3300025981 Bacteria 1173
423 Ga0207658_10040984 3300025986 Bacteria 3350
424 Ga0207677_10003663 3300026023 Bacteria 8158
425 Ga0207677_10010533 3300026023 Bacteria 5237
426 Ga0207703_10007902 3300026035 Bacteria 8412
427 Ga0207703_10021291 3300026035 Bacteria 5076
428 Ga0207703_10340960 3300026035 Bacteria 1377
429 Ga0207639_10169145 3300026041 Bacteria 1849
430 Ga0207708_10003042 3300026075 Bacteria 12362
431 Ga0207708_10174301 3300026075 Bacteria 1705
432 Ga0207702_10121901 3300026078 Bacteria 2335
433 Ga0207641_10005089 3300026088 Bacteria 11267
434 Ga0207641_10012091 3300026088 Bacteria 7079
435 Ga0207641_10021771 3300026088 Bacteria 5269
436 Ga0207641_10045647 3300026088 Bacteria 3690
437 Ga0207641_10097342 3300026088 Bacteria 2586
438 Ga0207641_10202929 3300026088 Bacteria 1829
439 Ga0207648_10003800 3300026089 Bacteria 15788
440 Ga0207648_10005299 3300026089 Bacteria 13011
441 Ga0207648_10031498 3300026089 Bacteria 4689
442 Ga0207648_10120272 3300026089 Bacteria 2309
443 Ga0207648_10135611 3300026089 Bacteria 2168
444 Ga0207648_10230632 3300026089 Bacteria 1647
445 Ga0207648_10256610 3300026089 Bacteria 1559
446 Ga0207676_10005921 3300026095 Bacteria 8637
447 Ga0207676_10037212 3300026095 Bacteria 3707
448 Ga0207676_10067533 3300026095 Bacteria 2856
449 Ga0207674_10188848 3300026116 Bacteria 2010
450 Ga0207675_100002241 3300026118 Bacteria 19232
451 Ga0207675_100003993 3300026118 Bacteria 14308
452 Ga0207675_100004245 3300026118 Bacteria 13857
453 Ga0207675_100004891 3300026118 Bacteria 12915
454 Ga0207675_100313582 3300026118 Bacteria 1530
455 Ga0207683_10006887 3300026121 Bacteria 9732
456 Ga0207683_10009318 3300026121 Bacteria 8364
457 Ga0207683_10037761 3300026121 Bacteria 4207
458 Ga0207683_10051292 3300026121 Bacteria 3615
459 Ga0207683_10066018 3300026121 Bacteria 3190
460 Ga0207683_10082714 3300026121 Bacteria 2852
461 Ga0207683_10135215 3300026121 Bacteria 2219
462 Ga0207683_10145642 3300026121 Bacteria 2136
463 Ga0207683_10177550 3300026121 Bacteria 1930
464 Ga0207698_10136339 3300026142 Bacteria 2106
465 Ga0209282_1000307 3300027666 Bacteria 24300
466 Ga0209813_10018671 3300027866 Bacteria 1919
467 Ga0207428_10001393 3300027907 Bacteria 25520
468 Ga0207428_10214401 3300027907 Bacteria 1445
469 Ga0207428_10297530 3300027907 Bacteria 1195
470 Ga0268266_10028790 3300028379 Bacteria 4722
471 Ga0268266_10078383 3300028379 Bacteria 2875
472 Ga0268266_10084949 3300028379 Bacteria 2765
473 Ga0268266_10173298 3300028379 Bacteria 1959
474 Ga0268266_10260665 3300028379 Bacteria 1606
475 Ga0268265_10050607 3300028380 Bacteria 3131
476 Ga0268265_10093826 3300028380 Bacteria 2405
477 Ga0268265_10311769 3300028380 Bacteria 1421
478 Ga0268265_10315396 3300028380 Bacteria 1413
479 Ga0268264_10004057 3300028381 Bacteria 12533
480 Ga0268264_10011781 3300028381 Bacteria 7210
481 Ga0268264_10015030 3300028381 Bacteria 6351
482 Ga0307515_10000064 3300028794 Bacteria 245452
483 Ga0307515_10131206 3300028794 Bacteria 2758
484 Ga0314311_1070027 3300030733 Bacteria 2682
485 Ga0316178_1126380 3300030735 Bacteria 3798
486 Ga0316183_1110495 3300030742 Bacteria 3751
487 Ga0307513_10000090 3300031456 Bacteria 129750
488 Ga0307513_10152164 3300031456 Bacteria 2220
489 Ga0307513_10282106 3300031456 Bacteria 1438
490 Ga0307408_100005621 3300031548 Bacteria 8383
491 Ga0307514_10011166 3300031649 Bacteria 7476
492 Ga0316576_10022958 3300031727 Bacteria 4340
493 Ga0307516_10003513 3300031730 Bacteria 20060
494 Ga0307516_10289807 3300031730 Bacteria 1316
495 Ga0307405_10005918 3300031731 Bacteria 5963
496 Ga0307405_10037668 3300031731 Bacteria 2908
497 Ga0307405_10156098 3300031731 Bacteria 1611
498 Ga0307405_10172422 3300031731 Bacteria 1544
499 Ga0307405_10312652 3300031731 Bacteria 1196
500 Ga0307406_10006495 3300031901 Bacteria 6459
501 Ga0307406_10018017 3300031901 Bacteria 4119
502 Ga0307406_10056965 3300031901 Bacteria 2505
503 Ga0307406_10237084 3300031901 Bacteria 1366
504 Ga0307407_10039408 3300031903 Bacteria 2627
505 Ga0307407_10044743 3300031903 Bacteria 2497
506 Ga0307407_10125171 3300031903 Bacteria 1636
507 Ga0307412_10002222 3300031911 Bacteria 10777
508 Ga0307412_10046332 3300031911 Bacteria 2848
509 Ga0307412_10071053 3300031911 Bacteria 2375
510 Ga0307412_10139943 3300031911 Bacteria 1771
511 Ga0307412_10206202 3300031911 Bacteria 1496
512 Ga0307409_100000592 3300031995 Bacteria 15808
513 Ga0307416_100006736 3300032002 Bacteria 7222
514 Ga0307416_100030125 3300032002 Bacteria 4068
515 Ga0307416_100214103 3300032002 Bacteria 1841
516 Ga0307416_100377465 3300032002 Bacteria 1446
517 Ga0307414_10011967 3300032004 Bacteria 5115
518 Ga0307414_10146811 3300032004 Bacteria 1854
519 Ga0307415_100002275 3300032126 Bacteria 9522
520 Ga0373948_0008637 3300034817 Bacteria 1739
521 Ga0373958_0011585 3300034819 Bacteria 1493
522 Ga0373938_0002172 3300034957 Bacteria 3150
523 Ga0373926_0056296 3300035083 Bacteria 1427
524 Ga0373934_0003128 3300035086 Bacteria 6033
525 Ga0373940_0002793 3300035088 Bacteria 3463
526 Ga0373949_0005821 3300035090 Bacteria 2740
527 Ga0373932_0000899 3300035112 Bacteria 8694
528 Ga0373936_0042274 3300035113 Bacteria 1829
529 Ga0373939_0031116 3300035114 Bacteria 1540
530 Ga0373941_0001232 3300035115 Bacteria 5370
531 Ga0373954_0001879 3300035118 Bacteria 8667
532 Ga0373954_0010855 3300035118 Bacteria 4027
533 Ga0373954_0075111 3300035118 Bacteria 1609
534 Ga0373956_0004750 3300035119 Bacteria 5436
535 Ga0373943_0021729 3300035170 Bacteria 2966
536 Ga0373955_0014117 3300035172 Bacteria 3878
537 Ga0373942_0004480 3300035207 Bacteria 3239
538 Ga0373924_0072241 3300035410 Bacteria 1457
539 Ga0373931_0000240 3300035691 Bacteria 23366
540 Ga0373931_0045475 3300035691 Bacteria 2318
541 Ga0373935_0005687 3300035692 Bacteria 7359
542 Ga0373935_0214442 3300035692 Bacteria 1335
543 Ga0373927_0015781 3300035695 Bacteria 4984
544 Ga0373927_0094091 3300035695 Bacteria 1947
545 Ga0373937_0051422 3300036401 Bacteria 3776
546 Ga0373937_0055969 3300036401 Bacteria 3621
547 Ga0373937_0218702 3300036401 Bacteria 1793
548 Ga0373937_0328257 3300036401 Bacteria 1448
549 Ga0373925_0005088 3300037068 Bacteria 9841
550 Ga0373925_0006421 3300037068 Bacteria 8653
551 Ga0373925_0077080 3300037068 Bacteria 2529
552 Ga0373925_0232377 3300037068 Bacteria 1475
553 Ga0395899_0003326 3300037312 Bacteria 12743
554 Ga0395900_0145283 3300037418 Bacteria 2425
555 Ga0395900_0409358 3300037418 Bacteria 1319
556 Ga0395898_0007717 3300037466 Bacteria 11423
557 Ga0395905_0000027 3300037471 Bacteria 297239
558 Ga0395905_0000492 3300037471 Bacteria 54399
559 Ga0395905_0005285 3300037471 Bacteria 13205
560 Ga0395905_0024428 3300037471 Bacteria 5704
561 Ga0395901_0060974 3300038443 Bacteria 3925
562 Ga0395901_0325747 3300038443 Bacteria 1589
563 Ga0436365_0797101 3300039437 Bacteria 4419
564 Ga0439436_0032296 3300041404 Bacteria 1518
565 Ga0439436_0040343 3300041404 Bacteria 1338
566 Ga0439447_031399 3300041407 Bacteria 1333
567 Ga0439466_0008218 3300041411 Bacteria 3935
568 Ga0451845_0923310 3300041501 Bacteria 1065
569 Ga0451853_2803178 3300041512 Bacteria 1073
570 Ga0451853_2861878 3300041512 Bacteria 1975
571 Ga0439445_0001503 3300042004 Bacteria 5070
572 Ga0439445_0017625 3300042004 Bacteria 1766
573 Ga0439432_000751 3300042006 Bacteria 12131
574 Ga0439432_028932 3300042006 Bacteria 1803
575 Ga0439449_0002753 3300042007 Bacteria 6842
576 Ga0439450_002769 3300042008 Bacteria 2807
577 Ga0439452_020482 3300042010 Bacteria 1734
578 Ga0439462_0013144 3300042015 Bacteria 2121
579 Ga0450911_000714 3300042115 Bacteria 9675
580 Ga0450906_009514 3300042145 Bacteria 1851
581 Ga0439446_0025803 3300042156 Bacteria 1681
582 Ga0450908_023022 3300042184 Bacteria 1091
583 Ga0439434_0000521 3300042435 Bacteria 10979
584 Ga0439434_0032229 3300042435 Bacteria 1594
585 Ga0439464_0009427 3300042439 Bacteria 2570
586 Ga0450918_007268 3300042531 Bacteria 1964
587 Ga0451577_0034708 3300042876 Bacteria 4545
588 Ga0451577_0077656 3300042876 Bacteria 2961
589 Ga0466960_0034266 3300044901 Bacteria 2365
590 Ga0451576_0045169 3300045051 Bacteria 4641
591 Ga0451576_0046886 3300045051 Bacteria 4548
592 Ga0451576_0126883 3300045051 Bacteria 2658
593 Ga0495592_0018276 3300046454 Bacteria 5328
594 Ga0495592_0038629 3300046454 Bacteria 3590
595 Ga0495592_0241699 3300046454 Bacteria 1198
596 Ga0495651_0004864 3300046462 Bacteria 10278
597 Ga0495653_0016586 3300046463 Bacteria 5995
598 Ga0495580_0030828 3300046472 Bacteria 3879
599 Ga0495639_0001883 3300046475 Bacteria 9302
600 Ga0495662_0032003 3300046476 Bacteria 2540
601 Ga0495664_0028228 3300046477 Bacteria 3277
602 Ga0495608_0017319 3300046511 Bacteria 4984
603 Ga0495608_0052053 3300046511 Bacteria 2711
604 Ga0495628_0000826 3300046516 Bacteria 28697
605 Ga0495663_0023705 3300046525 Bacteria 1780
606 Ga0495642_0088778 3300046528 Bacteria 1307
607 Ga0495652_0005167 3300046529 Bacteria 12342
608 Ga0495652_0029175 3300046529 Bacteria 4847
609 Ga0495654_0003475 3300046530 Bacteria 9623
610 Ga0495665_0001363 3300046531 Bacteria 13069
611 Ga0495640_0009540 3300046533 Bacteria 7549
612 Ga0495586_0012113 3300046535 Bacteria 4578
613 Ga0495587_0014208 3300046536 Bacteria 4997
614 Ga0495598_0020186 3300046537 Bacteria 1756
615 Ga0495621_0010048 3300046539 Bacteria 2888
616 Ga0495645_0000419 3300046543 Bacteria 29318
617 Ga0495645_0139853 3300046543 Bacteria 1690
618 Ga0495633_0184763 3300046558 Bacteria 959
619 Ga0495667_0022002 3300046559 Bacteria 4298
620 Ga0495667_0214338 3300046559 Bacteria 1230
621 Ga0495656_0002368 3300046615 Bacteria 6248
622 Ga0495634_0007734 3300046642 Bacteria 8039
623 Ga0495657_0012040 3300046675 Bacteria 6435
624 Ga0495657_0206380 3300046675 Bacteria 1196
625 Ga0495599_0000476 3300046678 Bacteria 22901
626 Ga0495599_0006605 3300046678 Bacteria 6997
627 Ga0495647_0018668 3300046681 Bacteria 2472
628 Ga0495658_0063549 3300046683 Bacteria 2124
629 Ga0495669_0032817 3300046684 Bacteria 2283
630 Ga0495669_0104579 3300046684 Bacteria 1317
631 Ga0495613_0078278 3300046689 Bacteria 2405
632 Ga0495581_0155442 3300047315 Bacteria 1337
633 Ga0495604_0019442 3300047317 Bacteria 5436
634 Ga0495636_0003473 3300047318 Bacteria 6118
635 Ga0495674_0009625 3300047319 Bacteria 9181
636 Ga0495680_0008579 3300047322 Bacteria 9278
637 Ga0495675_0001332 3300047444 Bacteria 14955
638 Ga0495681_0101270 3300047470 Bacteria 1259
639 Ga0495684_0008994 3300047471 Bacteria 7710
640 Ga0496100_0190733 3300048903 Bacteria 1488
641 Ga0496101_0004340 3300048904 Bacteria 8899
642 Ga0496101_0251577 3300048904 Bacteria 1377
643 Ga0496102_0043995 3300048905 Bacteria 4050
644 Ga0496103_0042834 3300048906 Bacteria 2786
645 Ga0496103_0065059 3300048906 Bacteria 2274
646 Ga0496103_0228185 3300048906 Bacteria 1198
647 Ga0496104_0075420 3300048907 Bacteria 3211
648 Ga0496104_0135850 3300048907 Bacteria 2363
649 Ga0496104_0358800 3300048907 Bacteria 1370
650 Ga0496105_0013954 3300048908 Bacteria 6387
651 Ga0496106_0113688 3300048909 Bacteria 2110
652 Ga0496108_0188870 3300048911 Bacteria 1785
653 Ga0496109_0033593 3300048912 Bacteria 4615
654 Ga0496109_0192357 3300048912 Bacteria 1917
655 Ga0496110_0070534 3300048913 Bacteria 3096
656 Ga0496110_0178144 3300048913 Bacteria 1930
657 Ga0496110_0241034 3300048913 Bacteria 1645
658 Ga0496111_0112321 3300048914 Bacteria 2007
659 Ga0496111_0134709 3300048914 Bacteria 1829
660 Ga0496112_0104512 3300048915 Bacteria 2802
661 Ga0496113_0373480 3300048916 Bacteria 1144
662 Ga0496121_0004542 3300048924 Bacteria 18558
663 Ga0496122_0000184 3300048925 Bacteria 144437
664 Ga0496123_0000181 3300048926 Bacteria 127092
665 Ga0496124_0033333 3300048927 Bacteria 4530
666 Ga0496125_0007111 3300048928 Bacteria 11945
667 Ga0496125_0007919 3300048928 Bacteria 11218
668 Ga0496125_0033645 3300048928 Bacteria 4532
669 Ga0501262_000209 3300049759 Bacteria 7284
670 nmdc:mga03683_26926_c1 3300050489 Bacteria 2273
671 nmdc:mga03683_7048_c1 3300050489 Bacteria 3880
672 nmdc:mga03n38_58743_c1 3300050490 Bacteria 1744
673 nmdc:mga0yw44_135850_c1 3300050492 Bacteria 1595
674 nmdc:mga0yw44_66710_c1 3300050492 Bacteria 2221
675 nmdc:mga0k408_29966_c1 3300050493 Bacteria 3101
676 nmdc:mga0k408_34317_c1 3300050493 Bacteria 2904
677 nmdc:mga0k408_70727_c1 3300050493 Bacteria 2036
678 nmdc:mga06z11_5003_c1 3300050494 Bacteria 5269
679 nmdc:mga07m45_36834_c1 3300050496 Bacteria 2726
680 nmdc:mga07m45_43661_c1 3300050496 Bacteria 2514
681 nmdc:mga07m45_60069_c2 3300050496 Bacteria 1837
682 nmdc:mga07m45_67103_c1 3300050496 Bacteria 1083
683 nmdc:mga05p37_2731_c1 3300050507 Bacteria 20509
684 nmdc:mga09592_1651_c1 3300050508 Bacteria 17950
685 nmdc:mga09592_34056_c1 3300050508 Bacteria 4257
686 nmdc:mga09592_7768_c1 3300050508 Bacteria 8715
687 nmdc:mga0qj67_8225_c2 3300050509 Bacteria 6603
688 nmdc:mga08y16_2538_c1 3300050511 Bacteria 18780
689 nmdc:mga08y16_260843_c1 3300050511 Bacteria 1790
690 nmdc:mga08y16_328861_c1 3300050511 Bacteria 1573
691 nmdc:mga08y16_49249_c1 3300050511 Bacteria 4410
692 nmdc:mga0rr50_4644_c1 3300050513 Bacteria 8094
693 nmdc:mga0rr50_95867_c1 3300050513 Bacteria 2320
694 nmdc:mga08x19_4918_c1 3300050514 Bacteria 7889
695 nmdc:mga0a205_26501_c1 3300050515 Bacteria 5529
696 nmdc:mga0sz30_23984_c1 3300050516 Bacteria 2487
697 Ga0495601_0009086 3300053077 Bacteria 5869
698 Ga0495601_0017699 3300053077 Bacteria 4329
699 Ga0495601_0107988 3300053077 Bacteria 1800
700 Ga0495595_0005077 3300053084 Bacteria 5318
701 Ga0495619_0022417 3300053085 Bacteria 4041
702 Ga0500644_0001138 3300053088 Bacteria 7751
703 Ga0500651_0005197 3300053093 Bacteria 7409
704 Ga0500556_0114877 3300053104 Bacteria 1047
705 Ga0500593_002149 3300053117 Bacteria 7169
706 Ga0500594_0009084 3300053118 Bacteria 2281
707 Ga0500573_0063734 3300053140 Bacteria 2109
708 Ga0500616_0034346 3300053153 Bacteria 2762
709 Ga0500634_0036397 3300053161 Bacteria 2679
710 Ga0500645_000061 3300053730 Bacteria 85703
711 Ga0500661_000809 3300055283 Bacteria 5830
712 2508733986 2508501050 Bacteria 9633614
713 2509140513 2508501127 Bacteria 7037543
714 2511243466 2511231002 Bacteria 5042903
715 2548497884 2547132374 Bacteria 5530232
716 2597813952 2597489875 Bacteria 7010078
717 2644466121 2643221683 Bacteria 5749203
718 2644649509 2643221717 Bacteria 5676132
719 2739251827 2738543013 Bacteria 5618633
720 2842681152 2842677519 Bacteria 5615038
721 2842737420 2842733646 Bacteria 5716726
722 2842749839 2842747753 Bacteria 5578255
723 2856344096 2856342000 Bacteria 7176905
724 2869167984 2869162929 Bacteria 6399702
725 2882639023 2882632389 Bacteria 8154593
726 2885196590 2885192300 Bacteria 5882526
727 2885317245 2885312484 Bacteria 6415165
728 2888347608 2888343758 Bacteria 6611049
729 2904454126 2904449895 Bacteria 6927402
730 2904462017 2904456579 Bacteria 6819253
731 2904545948 2904541872 Bacteria 8915136
732 2919465273 2919462493 Bacteria 5817112
733 2919707392 2919704043 Bacteria 5560311
734 2924761117 2924754689 Bacteria 6774424
735 2929161143 2929160207 Bacteria 9075316
736 2929521857 2929520902 Bacteria 6765052
737 2945914375 2945909444 Bacteria 7065066
738 2945949906 2945945610 Bacteria 5951079
739 2945973925 2945972063 Bacteria 6086495
740 2945990230 2945984333 Bacteria 7358892
741 2954770487 2954767861 Bacteria 5535784
742 2970530315 2970524798 Bacteria 6840927
743 2970542389 2970540015 Bacteria 6977556
744 8004401782 8004395343 Bacteria 6620908
745 8045867992 8045864390 Bacteria 5043873
746 8054568162 8054563764 Bacteria 5592885
747 8055621665 8055617313 Bacteria 7548464
748 Ga0070700_100061684
749 JGI25155J39150_1000028
750 JGI25156J39149_1000013
751 JGI25154J39366_1000032
752 JGI25157J39369_1000017
753 JGI25150J39212_1008334
754 JGI25159J45721_1004214
755 JGI25159J45721_1006741
756 JGI25151J46595_10002986
757 JGI25151J46595_10008595
758 JGI25151J46595_10012976
759 JGI25151J46595_10026532
760 JGI25160J50197_1000106
761 JGI25161J50226_1000041
762 Ga0055526_1006939
763 Ga0055526_1006976
764 Ga0055537_1000029
765 Ga0055537_1000229
766 Ga0055537_1008434
767 Ga0055524_1000040
768 Ga0055536_1003958
769 Ga0055536_1005991
770 Ga0055534_1000081
771 Ga0055534_1001320
772 Ga0055528_1000107
773 Ga0055528_1003803
774 Ga0055530_10000493
775 Ga0055540_1000030
776 Ga0055540_1001837
777 Ga0055540_1002684
778 Ga0055531_10009620
779 Ga0055543_1001200
780 Ga0065165_1017710
781 Ga0065714_10109949
782 Ga0065704_10083585
783 Ga0065712_10014625
784 Ga0065715_10012822
785 Ga0065715_10021301
786 Ga0065707_10086478
787 Ga0065707_10113710
788 Ga0070658_10179870
789 Ga0070676_10049045
790 Ga0070676_10062704
791 Ga0070676_10141185
792 Ga0070676_10149960
793 Ga0070690_100017765
794 Ga0070690_100059812
795 Ga0070690_100069129
796 Ga0070690_100192824
797 Ga0070670_100049162
798 Ga0070670_100073813
799 Ga0070670_100155929
800 Ga0070677_10012753
801 Ga0070677_10029393
802 Ga0070677_10031593
803 Ga0068869_100011970
804 Ga0068869_100081511
805 Ga0068869_100100809
806 Ga0070666_10007413
807 Ga0070666_10047403
808 Ga0070666_10215970
809 Ga0070680_100112248
810 Ga0068868_100001955
811 Ga0068868_100022609
812 Ga0068868_100253216
813 Ga0068868_100341558
814 Ga0070660_100104911
815 Ga0070689_100051287
816 Ga0070689_100223463
817 Ga0070687_100041294
818 Ga0070687_100105808
819 Ga0070661_100160399
820 Ga0070668_100003555
821 Ga0070668_100020892
822 Ga0070668_100123058
823 Ga0070669_100017475
824 Ga0070669_100019673
825 Ga0070669_100080235
826 Ga0070669_100229947
827 Ga0070675_100005320
828 Ga0070675_100026424
829 Ga0070675_100061363
830 Ga0070675_100079423
831 Ga0070675_100161306
832 Ga0070675_100229391
833 Ga0070675_100316084
834 Ga0070671_100006632
835 Ga0070671_100043326
836 Ga0070671_100069616
837 Ga0070671_100081519
838 Ga0070674_100018239
839 Ga0070674_100029397
840 Ga0070674_100070201
841 Ga0070674_100140602
842 Ga0070674_100216580
843 Ga0070674_100308897
844 Ga0070673_100029782
845 Ga0070673_100067350
846 Ga0070673_100107639
847 Ga0070688_100043204
848 Ga0070659_100135367
849 Ga0070667_100018788
850 Ga0070667_100036122
851 Ga0070667_100038123
852 Ga0070667_100201894
853 Ga0070667_100262937
854 Ga0070701_10009247
855 Ga0070701_10125573
856 Ga0070663_100325826
857 Ga0070678_100053734
858 Ga0070678_100058482
859 Ga0070678_100075327
860 Ga0070678_100081587
861 Ga0070678_100105411
862 Ga0070678_100206128
863 Ga0070662_100012157
864 Ga0070662_100023662
865 Ga0070662_100047737
866 Ga0070662_100091956
867 Ga0070681_10014937
868 Ga0070681_10130574
869 Ga0068867_100002211
870 Ga0068867_100033665
871 Ga0068867_100036909
872 Ga0068867_100047053
873 Ga0070679_100010948
874 Ga0070679_100021873
875 Ga0070679_100212154
876 Ga0070684_100019585
877 Ga0070697_100165757
878 Ga0068853_100046393
879 Ga0068853_100241264
880 Ga0070672_100060460
881 Ga0070672_100061360
882 Ga0070672_100153963
883 Ga0070672_100343199
884 Ga0070686_100028269
885 Ga0070686_100087148
886 Ga0070686_100175520
887 Ga0070696_100004763
888 Ga0070693_100045512
889 Ga0070665_100013700
890 Ga0070665_100041030
891 Ga0070665_100111220
892 Ga0070665_100195858
893 Ga0070665_100220512
894 Ga0070665_100583693
895 Ga0070704_100281280
896 Ga0068855_100039058
897 Ga0070664_100325584
898 Ga0068857_100177520
899 Ga0068854_100147454
900 Ga0068856_100083350
901 Ga0070702_100063806
902 Ga0068852_100244512
903 Ga0068852_100248037
904 Ga0068859_100004027
905 Ga0068859_100068114
906 Ga0068859_100381668
907 Ga0068859_100558755
908 Ga0068864_100083775
909 Ga0068864_100126759
910 Ga0068866_10008823
911 Ga0068861_100002079
912 Ga0068861_100011946
913 Ga0068851_10036813
914 Ga0068851_10048399
915 Ga0068851_10122175
916 Ga0068870_10048317
917 Ga0068863_100004155
918 Ga0068863_100062379
919 Ga0068863_100071438
920 Ga0068863_100167627
921 Ga0068863_100333192
922 Ga0068858_100002678
923 Ga0068858_100117342
924 Ga0068858_100219961
925 Ga0068858_100429739
926 Ga0068860_100003245
927 Ga0068860_100005443
928 Ga0068860_100033915
929 Ga0068860_100100078
930 Ga0068862_100020138
931 Ga0068862_100027364
932 Ga0068862_100224900
933 Ga0081540_1015210
934 Ga0070717_10399214
935 Ga0075365_10070319
936 Ga0075365_10143044
937 Ga0075363_100010846
938 Ga0075364_10079127
939 Ga0070716_100009470
940 Ga0075362_10007059
941 Ga0075362_10030954
942 Ga0075369_10042662
943 Ga0075366_10001983
944 Ga0075366_10012005
945 Ga0097621_100001880
946 Ga0097621_100061406
947 Ga0097621_100117798
948 Ga0075370_10021532
949 Ga0068871_100002226
950 Ga0068871_100040497
951 Ga0075428_100000130
952 Ga0075430_100009841
953 Ga0075433_10067380
954 Ga0075429_100000541
955 Ga0075429_100003178
956 Ga0068865_100037005
957 Ga0068865_100152279
958 Ga0068865_100217357
959 Ga0075436_100097370
960 Ga0075436_100102475
961 Ga0097620_100004027
962 Ga0097620_100068114
963 Ga0097620_100381709
964 Ga0097620_100558827
965 Ga0099826_10000087
966 Ga0099826_10073699
967 Ga0075435_100002374
968 Ga0075435_100118338
969 Ga0099794_10097702
970 Ga0111539_10000801
971 Ga0111539_10016103
972 Ga0111539_10017872
973 Ga0111539_10023989
974 Ga0105245_10075153
975 Ga0105245_10083242
976 Ga0114129_10000604
977 Ga0105243_10002623
978 Ga0105243_10068322
979 Ga0105243_10080527
980 Ga0105243_10222758
981 Ga0105241_10351492
982 Ga0105242_10002310
983 Ga0105242_10021682
984 Ga0105242_10064669
985 Ga0105248_10051302
986 Ga0105248_10128074
987 Ga0105237_10060033
988 Ga0105238_10293509
989 Ga0105249_10017865
990 Ga0105249_10139785
991 Ga0105249_10166771
992 Ga0105249_10248077
993 Ga0099796_10066554
994 Ga0105239_10066299
995 Ga0105246_10158720
996 Ga0157327_1000947
997 Ga0157326_1000451
998 Ga0157370_10003845
999 Ga0157369_10166440
1000 Ga0157374_10037741
1001 Ga0157374_10100494
1002 Ga0157378_10022765
1003 Ga0157378_10076992
1004 Ga0163162_10005074
1005 Ga0163162_10106194
1006 Ga0163162_10222435
1007 Ga0163162_10538660
1008 Ga0157375_10024303
1009 Ga0157375_10125411
1010 Ga0163163_10016809
1011 Ga0163163_10078290
1012 Ga0157380_10019496
1013 Ga0157380_10019525
1014 Ga0157380_10067279
1015 Ga0157377_10012265
1016 Ga0157377_10080764
1017 Ga0157377_10090220
1018 Ga0157379_10052219
1019 Ga0157379_10076187
1020 Ga0157376_10103751
1021 Ga0157376_10163317
1022 Ga0182005_1028784
1023 Ga0182005_1036246
1024 Ga0163161_10000329
1025 Ga0163161_10013701
1026 Ga0163161_10053805
1027 Ga0163161_10098799
1028 Ga0163161_10129110
1029 Ga0163161_10212954
1030 Ga0213876_10027453
1031 Ga0209435_100003
1032 Ga0209436_105046
1033 Ga0207425_1007648
1034 Ga0209646_1000008
1035 Ga0209026_1000007
1036 Ga0209759_1000026
1037 Ga0209129_1007409
1038 Ga0209129_1020623
1039 Ga0209565_1000026
1040 Ga0209565_1000150
1041 Ga0209565_1001312
1042 Ga0207666_1001766
1043 Ga0207666_1005525
1044 Ga0209673_1000009
1045 Ga0209673_1000012
1046 Ga0209673_1000114
1047 Ga0209673_1008634
1048 Ga0209130_1000099
1049 Ga0209130_1000123
1050 Ga0209130_1006153
1051 Ga0209675_1000062
1052 Ga0209675_1000155
1053 Ga0209675_1004791
1054 Ga0209675_1005864
1055 Ga0209676_1000051
1056 Ga0209676_1000325
1057 Ga0209676_1008862
1058 Ga0209676_1009460
1059 Ga0209676_1026578
1060 Ga0209025_1000521
1061 Ga0209025_1004061
1062 Ga0209025_1007738
1063 Ga0209025_1009286
1064 Ga0209564_1000211
1065 Ga0209564_1000228
1066 Ga0209564_1004815
1067 Ga0209758_1054147
1068 Ga0209050_1000044
1069 Ga0209050_1003950
1070 Ga0209050_1010312
1071 Ga0209256_1000003
1072 Ga0207426_1000062
1073 Ga0207426_1003919
1074 Ga0209051_1000031
1075 Ga0209051_1000208
1076 Ga0209051_1000760
1077 Ga0209051_1042140
1078 Ga0209257_1000058
1079 Ga0209257_1008393
1080 Ga0209257_1014090
1081 Ga0207697_10009556
1082 Ga0207697_10032926
1083 Ga0207697_10065936
1084 Ga0207682_10001921
1085 Ga0207682_10009146
1086 Ga0207682_10038424
1087 Ga0207682_10057923
1088 Ga0207642_10015639
1089 Ga0207688_10004631
1090 Ga0207688_10033243
1091 Ga0207699_10067868
1092 Ga0207645_10003092
1093 Ga0207645_10007091
1094 Ga0207645_10027206
1095 Ga0207645_10115523
1096 Ga0207643_10003923
1097 Ga0207643_10054228
1098 Ga0207707_10044809
1099 Ga0207707_10104139
1100 Ga0207671_10162669
1101 Ga0207660_10007738
1102 Ga0207660_10131999
1103 Ga0207662_10003730
1104 Ga0207662_10076536
1105 Ga0207657_10049797
1106 Ga0207652_10005260
1107 Ga0207652_10282909
1108 Ga0207681_10007401
1109 Ga0207681_10018416
1110 Ga0207681_10074401
1111 Ga0207681_10081248
1112 Ga0207681_10124240
1113 Ga0207681_10215106
1114 Ga0207694_10076303
1115 Ga0207650_10023527
1116 Ga0207650_10069686
1117 Ga0207659_10007169
1118 Ga0207659_10020490
1119 Ga0207659_10058986
1120 Ga0207659_10059908
1121 Ga0207659_10138499
1122 Ga0207659_10356728
1123 Ga0207659_10492099
1124 Ga0207687_10049293
1125 Ga0207687_10322388
1126 Ga0207644_10000068
1127 Ga0207644_10015661
1128 Ga0207644_10051778
1129 Ga0207690_10095883
1130 Ga0207706_10052263
1131 Ga0207706_10152950
1132 Ga0207686_10028134
1133 Ga0207686_10031426
1134 Ga0207709_10002195
1135 Ga0207709_10021397
1136 Ga0207709_10186987
1137 Ga0207709_10338157
1138 Ga0207670_10099193
1139 Ga0207669_10017506
1140 Ga0207669_10026733
1141 Ga0207669_10067712
1142 Ga0207704_10002833
1143 Ga0207704_10058905
1144 Ga0207704_10186226
1145 Ga0207665_10019966
1146 Ga0207665_10062982
1147 Ga0207691_10017865
1148 Ga0207691_10038713
1149 Ga0207691_10076011
1150 Ga0207691_10096530
1151 Ga0207691_10135806
1152 Ga0207691_10140623
1153 Ga0207691_10168616
1154 Ga0207711_10019765
1155 Ga0207711_10054755
1156 Ga0207689_10001957
1157 Ga0207689_10003617
1158 Ga0207689_10028597
1159 Ga0207689_10057292
1160 Ga0207689_10093231
1161 Ga0207651_10183129
1162 Ga0207651_10425300
1163 Ga0207712_10085529
1164 Ga0207712_10291971
1165 Ga0207668_10050743
1166 Ga0207668_10159663
1167 Ga0207640_10167449
1168 Ga0207640_10314162
1169 Ga0207640_10359120
1170 Ga0207658_10040984
1171 Ga0207677_10003663
1172 Ga0207677_10010533
1173 Ga0207703_10007902
1174 Ga0207703_10021291
1175 Ga0207703_10340960
1176 Ga0207639_10169145
1177 Ga0207708_10003042
1178 Ga0207708_10174301
1179 Ga0207702_10121901
1180 Ga0207641_10005089
1181 Ga0207641_10012091
1182 Ga0207641_10021771
1183 Ga0207641_10045647
1184 Ga0207641_10097342
1185 Ga0207641_10202929
1186 Ga0207648_10003800
1187 Ga0207648_10005299
1188 Ga0207648_10031498
1189 Ga0207648_10120272
1190 Ga0207648_10135611
1191 Ga0207648_10230632
1192 Ga0207648_10256610
1193 Ga0207676_10005921
1194 Ga0207676_10037212
1195 Ga0207676_10067533
1196 Ga0207674_10188848
1197 Ga0207675_100002241
1198 Ga0207675_100003993
1199 Ga0207675_100004245
1200 Ga0207675_100004891
1201 Ga0207675_100313582
1202 Ga0207683_10006887
1203 Ga0207683_10009318
1204 Ga0207683_10037761
1205 Ga0207683_10051292
1206 Ga0207683_10066018
1207 Ga0207683_10082714
1208 Ga0207683_10135215
1209 Ga0207683_10145642
1210 Ga0207683_10177550
1211 Ga0207698_10136339
1212 Ga0209282_1000307
1213 Ga0209813_10018671
1214 Ga0207428_10001393
1215 Ga0207428_10214401
1216 Ga0207428_10297530
1217 Ga0268266_10028790
1218 Ga0268266_10078383
1219 Ga0268266_10084949
1220 Ga0268266_10173298
1221 Ga0268266_10260665
1222 Ga0268265_10050607
1223 Ga0268265_10093826
1224 Ga0268265_10311769
1225 Ga0268265_10315396
1226 Ga0268264_10004057
1227 Ga0268264_10011781
1228 Ga0268264_10015030
1229 Ga0307515_10000064
1230 Ga0307515_10131206
1231 Ga0314311_1070027
1232 Ga0316178_1126380
1233 Ga0316183_1110495
1234 Ga0307513_10000090
1235 Ga0307513_10152164
1236 Ga0307513_10282106
1237 Ga0307408_100005621
1238 Ga0307514_10011166
1239 Ga0316576_10022958
1240 Ga0307516_10003513
1241 Ga0307516_10289807
1242 Ga0307405_10005918
1243 Ga0307405_10037668
1244 Ga0307405_10156098
1245 Ga0307405_10172422
1246 Ga0307405_10312652
1247 Ga0307406_10006495
1248 Ga0307406_10018017
1249 Ga0307406_10056965
1250 Ga0307406_10237084
1251 Ga0307407_10039408
1252 Ga0307407_10044743
1253 Ga0307407_10125171
1254 Ga0307412_10002222
1255 Ga0307412_10046332
1256 Ga0307412_10071053
1257 Ga0307412_10139943
1258 Ga0307412_10206202
1259 Ga0307409_100000592
1260 Ga0307416_100006736
1261 Ga0307416_100030125
1262 Ga0307416_100214103
1263 Ga0307416_100377465
1264 Ga0307414_10011967
1265 Ga0307414_10146811
1266 Ga0307415_100002275
1267 Ga0373948_0008637
1268 Ga0373958_0011585
1269 Ga0373938_0002172
1270 Ga0373926_0056296
1271 Ga0373934_0003128
1272 Ga0373940_0002793
1273 Ga0373949_0005821
1274 Ga0373932_0000899
1275 Ga0373936_0042274
1276 Ga0373939_0031116
1277 Ga0373941_0001232
1278 Ga0373954_0001879
1279 Ga0373954_0010855
1280 Ga0373954_0075111
1281 Ga0373956_0004750
1282 Ga0373943_0021729
1283 Ga0373955_0014117
1284 Ga0373942_0004480
1285 Ga0373924_0072241
1286 Ga0373931_0000240
1287 Ga0373931_0045475
1288 Ga0373935_0005687
1289 Ga0373935_0214442
1290 Ga0373927_0015781
1291 Ga0373927_0094091
1292 Ga0373937_0051422
1293 Ga0373937_0055969
1294 Ga0373937_0218702
1295 Ga0373937_0328257
1296 Ga0373925_0005088
1297 Ga0373925_0006421
1298 Ga0373925_0077080
1299 Ga0373925_0232377
1300 Ga0395899_0003326
1301 Ga0395900_0145283
1302 Ga0395900_0409358
1303 Ga0395898_0007717
1304 Ga0395905_0000027
1305 Ga0395905_0000492
1306 Ga0395905_0005285
1307 Ga0395905_0024428
1308 Ga0395901_0060974
1309 Ga0395901_0325747
1310 Ga0436365_0797101
1311 Ga0439436_0032296
1312 Ga0439436_0040343
1313 Ga0439447_031399
1314 Ga0439466_0008218
1315 Ga0451845_0923310
1316 Ga0451853_2803178
1317 Ga0451853_2861878
1318 Ga0439445_0001503
1319 Ga0439445_0017625
1320 Ga0439432_000751
1321 Ga0439432_028932
1322 Ga0439449_0002753
1323 Ga0439450_002769
1324 Ga0439452_020482
1325 Ga0439462_0013144
1326 Ga0450911_000714
1327 Ga0450906_009514
1328 Ga0439446_0025803
1329 Ga0450908_023022
1330 Ga0439434_0000521
1331 Ga0439434_0032229
1332 Ga0439464_0009427
1333 Ga0450918_007268
1334 Ga0451577_0034708
1335 Ga0451577_0077656
1336 Ga0466960_0034266
1337 Ga0451576_0045169
1338 Ga0451576_0046886
1339 Ga0451576_0126883
1340 Ga0495592_0018276
1341 Ga0495592_0038629
1342 Ga0495592_0241699
1343 Ga0495651_0004864
1344 Ga0495653_0016586
1345 Ga0495580_0030828
1346 Ga0495639_0001883
1347 Ga0495662_0032003
1348 Ga0495664_0028228
1349 Ga0495608_0017319
1350 Ga0495608_0052053
1351 Ga0495628_0000826
1352 Ga0495663_0023705
1353 Ga0495642_0088778
1354 Ga0495652_0005167
1355 Ga0495652_0029175
1356 Ga0495654_0003475
1357 Ga0495665_0001363
1358 Ga0495640_0009540
1359 Ga0495586_0012113
1360 Ga0495587_0014208
1361 Ga0495598_0020186
1362 Ga0495621_0010048
1363 Ga0495645_0000419
1364 Ga0495645_0139853
1365 Ga0495633_0184763
1366 Ga0495667_0022002
1367 Ga0495667_0214338
1368 Ga0495656_0002368
1369 Ga0495634_0007734
1370 Ga0495657_0012040
1371 Ga0495657_0206380
1372 Ga0495599_0000476
1373 Ga0495599_0006605
1374 Ga0495647_0018668
1375 Ga0495658_0063549
1376 Ga0495669_0032817
1377 Ga0495669_0104579
1378 Ga0495613_0078278
1379 Ga0495581_0155442
1380 Ga0495604_0019442
1381 Ga0495636_0003473
1382 Ga0495674_0009625
1383 Ga0495680_0008579
1384 Ga0495675_0001332
1385 Ga0495681_0101270
1386 Ga0495684_0008994
1387 Ga0496100_0190733
1388 Ga0496101_0004340
1389 Ga0496101_0251577
1390 Ga0496102_0043995
1391 Ga0496103_0042834
1392 Ga0496103_0065059
1393 Ga0496103_0228185
1394 Ga0496104_0075420
1395 Ga0496104_0135850
1396 Ga0496104_0358800
1397 Ga0496105_0013954
1398 Ga0496106_0113688
1399 Ga0496108_0188870
1400 Ga0496109_0033593
1401 Ga0496109_0192357
1402 Ga0496110_0070534
1403 Ga0496110_0178144
1404 Ga0496110_0241034
1405 Ga0496111_0112321
1406 Ga0496111_0134709
1407 Ga0496112_0104512
1408 Ga0496113_0373480
1409 Ga0496121_0004542
1410 Ga0496122_0000184
1411 Ga0496123_0000181
1412 Ga0496124_0033333
1413 Ga0496125_0007111
1414 Ga0496125_0007919
1415 Ga0496125_0033645
1416 Ga0501262_000209
1417 nmdc:mga03683_26926_c1
1418 nmdc:mga03683_7048_c1
1419 nmdc:mga03n38_58743_c1
1420 nmdc:mga0yw44_135850_c1
1421 nmdc:mga0yw44_66710_c1
1422 nmdc:mga0k408_29966_c1
1423 nmdc:mga0k408_34317_c1
1424 nmdc:mga0k408_70727_c1
1425 nmdc:mga06z11_5003_c1
1426 nmdc:mga07m45_36834_c1
1427 nmdc:mga07m45_43661_c1
1428 nmdc:mga07m45_60069_c2
1429 nmdc:mga07m45_67103_c1
1430 nmdc:mga05p37_2731_c1
1431 nmdc:mga09592_1651_c1
1432 nmdc:mga09592_34056_c1
1433 nmdc:mga09592_7768_c1
1434 nmdc:mga0qj67_8225_c2
1435 nmdc:mga08y16_2538_c1
1436 nmdc:mga08y16_260843_c1
1437 nmdc:mga08y16_328861_c1
1438 nmdc:mga08y16_49249_c1
1439 nmdc:mga0rr50_4644_c1
1440 nmdc:mga0rr50_95867_c1
1441 nmdc:mga08x19_4918_c1
1442 nmdc:mga0a205_26501_c1
1443 nmdc:mga0sz30_23984_c1
1444 Ga0495601_0009086
1445 Ga0495601_0017699
1446 Ga0495601_0107988
1447 Ga0495595_0005077
1448 Ga0495619_0022417
1449 Ga0500644_0001138
1450 Ga0500651_0005197
1451 Ga0500556_0114877
1452 Ga0500593_002149
1453 Ga0500594_0009084
1454 Ga0500573_0063734
1455 Ga0500616_0034346
1456 Ga0500634_0036397
1457 Ga0500645_000061
1458 Ga0500661_000809
1459 2508733986
1460 2509140513
1461 2511243466
1462 2548497884
1463 2597813952
1464 2644466121
1465 2644649509
1466 2739251827
1467 2842681152
1468 2842737420
1469 2842749839
1470 2856344096
1471 2869167984
1472 2882639023
1473 2885196590
1474 2885317245
1475 2888347608
1476 2904454126
1477 2904462017
1478 2904545948
1479 2919465273
1480 2919707392
1481 2924761117
1482 2929161143
1483 2929521857
1484 2945914375
1485 2945949906
1486 2945973925
1487 2945990230
1488 2954770487
1489 2970530315
1490 2970542389
1491 8004401782
1492 8045867992
1493 8054568162
1494 8055621665

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

50

328

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pdd-assembly3.cif.gz_C crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d-erythronate 0.9397 33 334
4nq8-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate 0.9339 33 334
4xeq-assembly4.cif.gz_D crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid 0.9331 35 333
4p9k-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d-erythronate with residual density suggestive of superposition with copurified alternative ligand. 0.932 32 334
4pdh-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d-erythronate 0.9316 33 334
ID Description Score Start End Superfamily
4nq8A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9339 34 334 3.40.190.170
4nq8A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9279 34 334 3.40.190.170
4xeqD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9257 35 334 3.40.190.170
4xeqD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9197 35 334 3.40.190.170
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9168 34 315 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A4Q3MNW1-F1-model_v4 deleted 0.9827 173 334
AF-A0A4Q3MNW1-F1-model_v4 deleted 0.9708 173 334
AF-A0A3D5VSW4-F1-model_v4 ABC transporter substrate-binding protein 0.9675 23 334 GO:0030288
GO:0055085
AF-A0A3P3EGW7-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9661 70 334 GO:0030288
GO:0055085
AF-A0A3P3EGW7-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9625 70 334 GO:0030288
GO:0055085

Map