F478907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 747 | 392 | 1494 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300005441|Ga0070700_100061684|Ga0070700_1000616842 |
| Length | 345 |
| Sequence | MKQAFFAVFNDPKETPIMKRRFLGWLAACAVAALATGVAAPALAQTKLKFAHVYETSEPYHKWALWAAGEIKQRTQGRYEMDVFPASQLGKETDINQGLTLGTVDVIYTGQAFAARTHPPLAIGGAPFMFRDFDHWQKYSSSPLLQELMDGYFKKGGNKPLAVTYYGVRHTTANKPINVPDDMKGLKLRVPDAPLYVMYPKVVGANATPIAFAEVYLALQSKTVDAQENPLPTIEAKKFYEVQSHINLTGHITEMLLTIVSGQTWNKLSDADKKTFEAVFKEAGAKCTDDIAAAEIKLVDEFATKYKKTVVKSDRAAFAAAFQKFHLGPDATWDKATYDRLQAIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 209 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 210 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 214 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 253 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 259 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 260 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 261 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 262 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 263 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 264 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 265 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 266 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 267 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 268 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 269 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 270 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 329 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 330 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 349 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 351 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 357 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 358 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 359 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 360 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 361 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 362 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 363 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 364 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 365 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 366 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 367 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 368 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 369 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 370 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 371 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 372 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 373 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 374 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 375 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 376 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 377 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 378 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 379 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 380 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 381 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 382 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 383 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 384 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 385 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 386 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 387 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 388 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 389 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 390 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 391 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 392 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.18 |
| Metatranscriptomes | 0 |
| Isolates | 4.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.32 |
| Nodule | 1.74 |
| Rhizoplane | 2.95 |
| Rhizosphere | 75.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070700_100061684 | 3300005441 | Bacteria | 2366 |
| 2 | JGI25155J39150_1000028 | 3300002704 | Bacteria | 120158 |
| 3 | JGI25156J39149_1000013 | 3300002705 | Bacteria | 189553 |
| 4 | JGI25154J39366_1000032 | 3300002738 | Bacteria | 189265 |
| 5 | JGI25157J39369_1000017 | 3300002741 | Bacteria | 189553 |
| 6 | JGI25150J39212_1008334 | 3300002774 | Bacteria | 2032 |
| 7 | JGI25159J45721_1004214 | 3300002987 | Bacteria | 4848 |
| 8 | JGI25159J45721_1006741 | 3300002987 | Bacteria | 3385 |
| 9 | JGI25151J46595_10002986 | 3300003187 | Bacteria | 9645 |
| 10 | JGI25151J46595_10008595 | 3300003187 | Bacteria | 4895 |
| 11 | JGI25151J46595_10012976 | 3300003187 | Bacteria | 3764 |
| 12 | JGI25151J46595_10026532 | 3300003187 | Bacteria | 2336 |
| 13 | JGI25160J50197_1000106 | 3300003354 | Bacteria | 80449 |
| 14 | JGI25161J50226_1000041 | 3300003374 | Bacteria | 124485 |
| 15 | Ga0055526_1006939 | 3300003771 | Bacteria | 6021 |
| 16 | Ga0055526_1006976 | 3300003771 | Bacteria | 5993 |
| 17 | Ga0055537_1000029 | 3300003773 | Bacteria | 101797 |
| 18 | Ga0055537_1000229 | 3300003773 | Bacteria | 41052 |
| 19 | Ga0055537_1008434 | 3300003773 | Bacteria | 2379 |
| 20 | Ga0055524_1000040 | 3300003775 | Bacteria | 157409 |
| 21 | Ga0055536_1003958 | 3300003781 | Bacteria | 7764 |
| 22 | Ga0055536_1005991 | 3300003781 | Bacteria | 5784 |
| 23 | Ga0055534_1000081 | 3300003784 | Bacteria | 75591 |
| 24 | Ga0055534_1001320 | 3300003784 | Bacteria | 9970 |
| 25 | Ga0055528_1000107 | 3300003790 | Bacteria | 67056 |
| 26 | Ga0055528_1003803 | 3300003790 | Bacteria | 7436 |
| 27 | Ga0055530_10000493 | 3300003791 | Bacteria | 34162 |
| 28 | Ga0055540_1000030 | 3300003792 | Bacteria | 177871 |
| 29 | Ga0055540_1001837 | 3300003792 | Bacteria | 11979 |
| 30 | Ga0055540_1002684 | 3300003792 | Bacteria | 9173 |
| 31 | Ga0055531_10009620 | 3300003794 | Bacteria | 4920 |
| 32 | Ga0055543_1001200 | 3300004625 | Bacteria | 10901 |
| 33 | Ga0065165_1017710 | 3300005262 | Bacteria | 2612 |
| 34 | Ga0065714_10109949 | 3300005288 | Bacteria | 1492 |
| 35 | Ga0065704_10083585 | 3300005289 | Bacteria | 3445 |
| 36 | Ga0065712_10014625 | 3300005290 | Bacteria | 2000 |
| 37 | Ga0065715_10012822 | 3300005293 | Bacteria | 3362 |
| 38 | Ga0065715_10021301 | 3300005293 | Bacteria | 1978 |
| 39 | Ga0065707_10086478 | 3300005295 | Bacteria | 5441 |
| 40 | Ga0065707_10113710 | 3300005295 | Bacteria | 2305 |
| 41 | Ga0070658_10179870 | 3300005327 | Bacteria | 1779 |
| 42 | Ga0070676_10049045 | 3300005328 | Bacteria | 2470 |
| 43 | Ga0070676_10062704 | 3300005328 | Bacteria | 2212 |
| 44 | Ga0070676_10141185 | 3300005328 | Bacteria | 1533 |
| 45 | Ga0070676_10149960 | 3300005328 | Bacteria | 1492 |
| 46 | Ga0070690_100017765 | 3300005330 | Bacteria | 4285 |
| 47 | Ga0070690_100059812 | 3300005330 | Bacteria | 2450 |
| 48 | Ga0070690_100069129 | 3300005330 | Bacteria | 2291 |
| 49 | Ga0070690_100192824 | 3300005330 | Bacteria | 1414 |
| 50 | Ga0070670_100049162 | 3300005331 | Bacteria | 3626 |
| 51 | Ga0070670_100073813 | 3300005331 | Bacteria | 2930 |
| 52 | Ga0070670_100155929 | 3300005331 | Bacteria | 1977 |
| 53 | Ga0070677_10012753 | 3300005333 | Bacteria | 2923 |
| 54 | Ga0070677_10029393 | 3300005333 | Bacteria | 2083 |
| 55 | Ga0070677_10031593 | 3300005333 | Bacteria | 2025 |
| 56 | Ga0068869_100011970 | 3300005334 | Bacteria | 5709 |
| 57 | Ga0068869_100081511 | 3300005334 | Bacteria | 2416 |
| 58 | Ga0068869_100100809 | 3300005334 | Bacteria | 2184 |
| 59 | Ga0070666_10007413 | 3300005335 | Bacteria | 6762 |
| 60 | Ga0070666_10047403 | 3300005335 | Bacteria | 2884 |
| 61 | Ga0070666_10215970 | 3300005335 | Bacteria | 1352 |
| 62 | Ga0070680_100112248 | 3300005336 | Bacteria | 2270 |
| 63 | Ga0068868_100001955 | 3300005338 | Bacteria | 14135 |
| 64 | Ga0068868_100022609 | 3300005338 | Bacteria | 4749 |
| 65 | Ga0068868_100253216 | 3300005338 | Bacteria | 1482 |
| 66 | Ga0068868_100341558 | 3300005338 | Bacteria | 1280 |
| 67 | Ga0070660_100104911 | 3300005339 | Bacteria | 2242 |
| 68 | Ga0070689_100051287 | 3300005340 | Bacteria | 3189 |
| 69 | Ga0070689_100223463 | 3300005340 | Bacteria | 1545 |
| 70 | Ga0070687_100041294 | 3300005343 | Bacteria | 2330 |
| 71 | Ga0070687_100105808 | 3300005343 | Bacteria | 1584 |
| 72 | Ga0070661_100160399 | 3300005344 | Bacteria | 1703 |
| 73 | Ga0070668_100003555 | 3300005347 | Bacteria | 11496 |
| 74 | Ga0070668_100020892 | 3300005347 | Bacteria | 4945 |
| 75 | Ga0070668_100123058 | 3300005347 | Bacteria | 2075 |
| 76 | Ga0070669_100017475 | 3300005353 | Bacteria | 5115 |
| 77 | Ga0070669_100019673 | 3300005353 | Bacteria | 4823 |
| 78 | Ga0070669_100080235 | 3300005353 | Bacteria | 2428 |
| 79 | Ga0070669_100229947 | 3300005353 | Bacteria | 1469 |
| 80 | Ga0070675_100005320 | 3300005354 | Bacteria | 9835 |
| 81 | Ga0070675_100026424 | 3300005354 | Bacteria | 4659 |
| 82 | Ga0070675_100061363 | 3300005354 | Bacteria | 3104 |
| 83 | Ga0070675_100079423 | 3300005354 | Bacteria | 2733 |
| 84 | Ga0070675_100161306 | 3300005354 | Bacteria | 1928 |
| 85 | Ga0070675_100229391 | 3300005354 | Bacteria | 1619 |
| 86 | Ga0070675_100316084 | 3300005354 | Bacteria | 1379 |
| 87 | Ga0070671_100006632 | 3300005355 | Bacteria | 9251 |
| 88 | Ga0070671_100043326 | 3300005355 | Bacteria | 3740 |
| 89 | Ga0070671_100069616 | 3300005355 | Bacteria | 2935 |
| 90 | Ga0070671_100081519 | 3300005355 | Bacteria | 2705 |
| 91 | Ga0070674_100018239 | 3300005356 | Bacteria | 4433 |
| 92 | Ga0070674_100029397 | 3300005356 | Bacteria | 3619 |
| 93 | Ga0070674_100070201 | 3300005356 | Bacteria | 2474 |
| 94 | Ga0070674_100140602 | 3300005356 | Bacteria | 1811 |
| 95 | Ga0070674_100216580 | 3300005356 | Bacteria | 1487 |
| 96 | Ga0070674_100308897 | 3300005356 | Bacteria | 1263 |
| 97 | Ga0070673_100029782 | 3300005364 | Bacteria | 4075 |
| 98 | Ga0070673_100067350 | 3300005364 | Bacteria | 2863 |
| 99 | Ga0070673_100107639 | 3300005364 | Bacteria | 2306 |
| 100 | Ga0070688_100043204 | 3300005365 | Bacteria | 2775 |
| 101 | Ga0070659_100135367 | 3300005366 | Bacteria | 2003 |
| 102 | Ga0070667_100018788 | 3300005367 | Bacteria | 5732 |
| 103 | Ga0070667_100036122 | 3300005367 | Bacteria | 4142 |
| 104 | Ga0070667_100038123 | 3300005367 | Bacteria | 4029 |
| 105 | Ga0070667_100201894 | 3300005367 | Bacteria | 1764 |
| 106 | Ga0070667_100262937 | 3300005367 | Bacteria | 1545 |
| 107 | Ga0070701_10009247 | 3300005438 | Bacteria | 4309 |
| 108 | Ga0070701_10125573 | 3300005438 | Bacteria | 1452 |
| 109 | Ga0070663_100325826 | 3300005455 | Bacteria | 1236 |
| 110 | Ga0070678_100053734 | 3300005456 | Bacteria | 2931 |
| 111 | Ga0070678_100058482 | 3300005456 | Bacteria | 2829 |
| 112 | Ga0070678_100075327 | 3300005456 | Bacteria | 2538 |
| 113 | Ga0070678_100081587 | 3300005456 | Bacteria | 2452 |
| 114 | Ga0070678_100105411 | 3300005456 | Bacteria | 2194 |
| 115 | Ga0070678_100206128 | 3300005456 | Bacteria | 1626 |
| 116 | Ga0070662_100012157 | 3300005457 | Bacteria | 5700 |
| 117 | Ga0070662_100023662 | 3300005457 | Bacteria | 4222 |
| 118 | Ga0070662_100047737 | 3300005457 | Bacteria | 3081 |
| 119 | Ga0070662_100091956 | 3300005457 | Bacteria | 2279 |
| 120 | Ga0070681_10014937 | 3300005458 | Bacteria | 7721 |
| 121 | Ga0070681_10130574 | 3300005458 | Bacteria | 2444 |
| 122 | Ga0068867_100002211 | 3300005459 | Bacteria | 13654 |
| 123 | Ga0068867_100033665 | 3300005459 | Bacteria | 3712 |
| 124 | Ga0068867_100036909 | 3300005459 | Bacteria | 3550 |
| 125 | Ga0068867_100047053 | 3300005459 | Bacteria | 3170 |
| 126 | Ga0070679_100010948 | 3300005530 | Bacteria | 8620 |
| 127 | Ga0070679_100021873 | 3300005530 | Bacteria | 6246 |
| 128 | Ga0070679_100212154 | 3300005530 | Bacteria | 1900 |
| 129 | Ga0070684_100019585 | 3300005535 | Bacteria | 5600 |
| 130 | Ga0070697_100165757 | 3300005536 | Bacteria | 1868 |
| 131 | Ga0068853_100046393 | 3300005539 | Bacteria | 3725 |
| 132 | Ga0068853_100241264 | 3300005539 | Bacteria | 1656 |
| 133 | Ga0070672_100060460 | 3300005543 | Bacteria | 2983 |
| 134 | Ga0070672_100061360 | 3300005543 | Bacteria | 2963 |
| 135 | Ga0070672_100153963 | 3300005543 | Bacteria | 1903 |
| 136 | Ga0070672_100343199 | 3300005543 | Bacteria | 1272 |
| 137 | Ga0070686_100028269 | 3300005544 | Bacteria | 3399 |
| 138 | Ga0070686_100087148 | 3300005544 | Bacteria | 2081 |
| 139 | Ga0070686_100175520 | 3300005544 | Bacteria | 1519 |
| 140 | Ga0070696_100004763 | 3300005546 | Bacteria | 9063 |
| 141 | Ga0070693_100045512 | 3300005547 | Bacteria | 2488 |
| 142 | Ga0070665_100013700 | 3300005548 | Bacteria | 8159 |
| 143 | Ga0070665_100041030 | 3300005548 | Bacteria | 4651 |
| 144 | Ga0070665_100111220 | 3300005548 | Bacteria | 2742 |
| 145 | Ga0070665_100195858 | 3300005548 | Bacteria | 2021 |
| 146 | Ga0070665_100220512 | 3300005548 | Bacteria | 1897 |
| 147 | Ga0070665_100583693 | 3300005548 | Bacteria | 1130 |
| 148 | Ga0070704_100281280 | 3300005549 | Bacteria | 1378 |
| 149 | Ga0068855_100039058 | 3300005563 | Bacteria | 5636 |
| 150 | Ga0070664_100325584 | 3300005564 | Bacteria | 1393 |
| 151 | Ga0068857_100177520 | 3300005577 | Bacteria | 1938 |
| 152 | Ga0068854_100147454 | 3300005578 | Bacteria | 1811 |
| 153 | Ga0068856_100083350 | 3300005614 | Bacteria | 3174 |
| 154 | Ga0070702_100063806 | 3300005615 | Bacteria | 2152 |
| 155 | Ga0068852_100244512 | 3300005616 | Bacteria | 1716 |
| 156 | Ga0068852_100248037 | 3300005616 | Bacteria | 1705 |
| 157 | Ga0068859_100004027 | 3300005617 | Bacteria | 14982 |
| 158 | Ga0068859_100068114 | 3300005617 | Bacteria | 3594 |
| 159 | Ga0068859_100381668 | 3300005617 | Bacteria | 1504 |
| 160 | Ga0068859_100558755 | 3300005617 | Bacteria | 1239 |
| 161 | Ga0068864_100083775 | 3300005618 | Bacteria | 2800 |
| 162 | Ga0068864_100126759 | 3300005618 | Bacteria | 2288 |
| 163 | Ga0068866_10008823 | 3300005718 | Bacteria | 4262 |
| 164 | Ga0068861_100002079 | 3300005719 | Bacteria | 12984 |
| 165 | Ga0068861_100011946 | 3300005719 | Bacteria | 6048 |
| 166 | Ga0068851_10036813 | 3300005834 | Bacteria | 2451 |
| 167 | Ga0068851_10048399 | 3300005834 | Bacteria | 2154 |
| 168 | Ga0068851_10122175 | 3300005834 | Bacteria | 1400 |
| 169 | Ga0068870_10048317 | 3300005840 | Bacteria | 2240 |
| 170 | Ga0068863_100004155 | 3300005841 | Bacteria | 14296 |
| 171 | Ga0068863_100062379 | 3300005841 | Bacteria | 3525 |
| 172 | Ga0068863_100071438 | 3300005841 | Bacteria | 3283 |
| 173 | Ga0068863_100167627 | 3300005841 | Bacteria | 2106 |
| 174 | Ga0068863_100333192 | 3300005841 | Bacteria | 1475 |
| 175 | Ga0068858_100002678 | 3300005842 | Bacteria | 17932 |
| 176 | Ga0068858_100117342 | 3300005842 | Bacteria | 2487 |
| 177 | Ga0068858_100219961 | 3300005842 | Bacteria | 1798 |
| 178 | Ga0068858_100429739 | 3300005842 | Bacteria | 1271 |
| 179 | Ga0068860_100003245 | 3300005843 | Bacteria | 16767 |
| 180 | Ga0068860_100005443 | 3300005843 | Bacteria | 12906 |
| 181 | Ga0068860_100033915 | 3300005843 | Bacteria | 4897 |
| 182 | Ga0068860_100100078 | 3300005843 | Bacteria | 2765 |
| 183 | Ga0068862_100020138 | 3300005844 | Bacteria | 5572 |
| 184 | Ga0068862_100027364 | 3300005844 | Bacteria | 4800 |
| 185 | Ga0068862_100224900 | 3300005844 | Bacteria | 1700 |
| 186 | Ga0081540_1015210 | 3300005983 | Bacteria | 4881 |
| 187 | Ga0070717_10399214 | 3300006028 | Bacteria | 1235 |
| 188 | Ga0075365_10070319 | 3300006038 | Bacteria | 2354 |
| 189 | Ga0075365_10143044 | 3300006038 | Bacteria | 1661 |
| 190 | Ga0075363_100010846 | 3300006048 | Bacteria | 4346 |
| 191 | Ga0075364_10079127 | 3300006051 | Bacteria | 2172 |
| 192 | Ga0070716_100009470 | 3300006173 | Bacteria | 4858 |
| 193 | Ga0075362_10007059 | 3300006177 | Bacteria | 4224 |
| 194 | Ga0075362_10030954 | 3300006177 | Bacteria | 2313 |
| 195 | Ga0075369_10042662 | 3300006186 | Bacteria | 1945 |
| 196 | Ga0075366_10001983 | 3300006195 | Bacteria | 10365 |
| 197 | Ga0075366_10012005 | 3300006195 | Bacteria | 4905 |
| 198 | Ga0097621_100001880 | 3300006237 | Bacteria | 14378 |
| 199 | Ga0097621_100061406 | 3300006237 | Bacteria | 3082 |
| 200 | Ga0097621_100117798 | 3300006237 | Bacteria | 2251 |
| 201 | Ga0075370_10021532 | 3300006353 | Bacteria | 3532 |
| 202 | Ga0068871_100002226 | 3300006358 | Bacteria | 13179 |
| 203 | Ga0068871_100040497 | 3300006358 | Bacteria | 3732 |
| 204 | Ga0075428_100000130 | 3300006844 | Bacteria | 65814 |
| 205 | Ga0075430_100009841 | 3300006846 | Bacteria | 8087 |
| 206 | Ga0075433_10067380 | 3300006852 | Bacteria | 3142 |
| 207 | Ga0075429_100000541 | 3300006880 | Bacteria | 28764 |
| 208 | Ga0075429_100003178 | 3300006880 | Bacteria | 13964 |
| 209 | Ga0068865_100037005 | 3300006881 | Bacteria | 3293 |
| 210 | Ga0068865_100152279 | 3300006881 | Bacteria | 1756 |
| 211 | Ga0068865_100217357 | 3300006881 | Bacteria | 1492 |
| 212 | Ga0075436_100097370 | 3300006914 | Bacteria | 2047 |
| 213 | Ga0075436_100102475 | 3300006914 | Bacteria | 1994 |
| 214 | Ga0097620_100004027 | 3300006931 | Bacteria | 14982 |
| 215 | Ga0097620_100068114 | 3300006931 | Bacteria | 3594 |
| 216 | Ga0097620_100381709 | 3300006931 | Bacteria | 1504 |
| 217 | Ga0097620_100558827 | 3300006931 | Bacteria | 1239 |
| 218 | Ga0099826_10000087 | 3300006948 | Bacteria | 46364 |
| 219 | Ga0099826_10073699 | 3300006948 | Bacteria | 2156 |
| 220 | Ga0075435_100002374 | 3300007076 | Bacteria | 12484 |
| 221 | Ga0075435_100118338 | 3300007076 | Bacteria | 2208 |
| 222 | Ga0099794_10097702 | 3300007265 | Bacteria | 1463 |
| 223 | Ga0111539_10000801 | 3300009094 | Bacteria | 40972 |
| 224 | Ga0111539_10016103 | 3300009094 | Bacteria | 9277 |
| 225 | Ga0111539_10017872 | 3300009094 | Bacteria | 8782 |
| 226 | Ga0111539_10023989 | 3300009094 | Bacteria | 7493 |
| 227 | Ga0105245_10075153 | 3300009098 | Bacteria | 3076 |
| 228 | Ga0105245_10083242 | 3300009098 | Bacteria | 2928 |
| 229 | Ga0114129_10000604 | 3300009147 | Bacteria | 44388 |
| 230 | Ga0105243_10002623 | 3300009148 | Bacteria | 14958 |
| 231 | Ga0105243_10068322 | 3300009148 | Bacteria | 2864 |
| 232 | Ga0105243_10080527 | 3300009148 | Bacteria | 2657 |
| 233 | Ga0105243_10222758 | 3300009148 | Bacteria | 1668 |
| 234 | Ga0105241_10351492 | 3300009174 | Bacteria | 1280 |
| 235 | Ga0105242_10002310 | 3300009176 | Bacteria | 15045 |
| 236 | Ga0105242_10021682 | 3300009176 | Bacteria | 5046 |
| 237 | Ga0105242_10064669 | 3300009176 | Bacteria | 3016 |
| 238 | Ga0105248_10051302 | 3300009177 | Bacteria | 4629 |
| 239 | Ga0105248_10128074 | 3300009177 | Bacteria | 2864 |
| 240 | Ga0105237_10060033 | 3300009545 | Bacteria | 3804 |
| 241 | Ga0105238_10293509 | 3300009551 | Bacteria | 1608 |
| 242 | Ga0105249_10017865 | 3300009553 | Bacteria | 6302 |
| 243 | Ga0105249_10139785 | 3300009553 | Bacteria | 2321 |
| 244 | Ga0105249_10166771 | 3300009553 | Bacteria | 2132 |
| 245 | Ga0105249_10248077 | 3300009553 | Bacteria | 1764 |
| 246 | Ga0099796_10066554 | 3300010159 | Bacteria | 1291 |
| 247 | Ga0105239_10066299 | 3300010375 | Bacteria | 3966 |
| 248 | Ga0105246_10158720 | 3300011119 | Bacteria | 1721 |
| 249 | Ga0157327_1000947 | 3300012512 | Bacteria | 1713 |
| 250 | Ga0157326_1000451 | 3300012513 | Bacteria | 4870 |
| 251 | Ga0157370_10003845 | 3300013104 | Bacteria | 17512 |
| 252 | Ga0157369_10166440 | 3300013105 | Bacteria | 2325 |
| 253 | Ga0157374_10037741 | 3300013296 | Bacteria | 4437 |
| 254 | Ga0157374_10100494 | 3300013296 | Bacteria | 2773 |
| 255 | Ga0157378_10022765 | 3300013297 | Bacteria | 5514 |
| 256 | Ga0157378_10076992 | 3300013297 | Bacteria | 3006 |
| 257 | Ga0163162_10005074 | 3300013306 | Bacteria | 12688 |
| 258 | Ga0163162_10106194 | 3300013306 | Bacteria | 2903 |
| 259 | Ga0163162_10222435 | 3300013306 | Bacteria | 2017 |
| 260 | Ga0163162_10538660 | 3300013306 | Bacteria | 1296 |
| 261 | Ga0157375_10024303 | 3300013308 | Bacteria | 5605 |
| 262 | Ga0157375_10125411 | 3300013308 | Bacteria | 2682 |
| 263 | Ga0163163_10016809 | 3300014325 | Bacteria | 6810 |
| 264 | Ga0163163_10078290 | 3300014325 | Bacteria | 3302 |
| 265 | Ga0157380_10019496 | 3300014326 | Bacteria | 5055 |
| 266 | Ga0157380_10019525 | 3300014326 | Bacteria | 5051 |
| 267 | Ga0157380_10067279 | 3300014326 | Bacteria | 2884 |
| 268 | Ga0157377_10012265 | 3300014745 | Bacteria | 4304 |
| 269 | Ga0157377_10080764 | 3300014745 | Bacteria | 1900 |
| 270 | Ga0157377_10090220 | 3300014745 | Bacteria | 1808 |
| 271 | Ga0157379_10052219 | 3300014968 | Bacteria | 3651 |
| 272 | Ga0157379_10076187 | 3300014968 | Bacteria | 3004 |
| 273 | Ga0157376_10103751 | 3300014969 | Bacteria | 2490 |
| 274 | Ga0157376_10163317 | 3300014969 | Bacteria | 2021 |
| 275 | Ga0182005_1028784 | 3300015265 | Bacteria | 1515 |
| 276 | Ga0182005_1036246 | 3300015265 | Bacteria | 1341 |
| 277 | Ga0163161_10000329 | 3300017792 | Bacteria | 40476 |
| 278 | Ga0163161_10013701 | 3300017792 | Bacteria | 5646 |
| 279 | Ga0163161_10053805 | 3300017792 | Bacteria | 2920 |
| 280 | Ga0163161_10098799 | 3300017792 | Bacteria | 2170 |
| 281 | Ga0163161_10129110 | 3300017792 | Bacteria | 1905 |
| 282 | Ga0163161_10212954 | 3300017792 | Bacteria | 1493 |
| 283 | Ga0213876_10027453 | 3300021384 | Bacteria | 3003 |
| 284 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 285 | Ga0209436_105046 | 3300025208 | Bacteria | 3126 |
| 286 | Ga0207425_1007648 | 3300025245 | Bacteria | 2831 |
| 287 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 288 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 289 | Ga0209759_1000026 | 3300025256 | Bacteria | 311743 |
| 290 | Ga0209129_1007409 | 3300025258 | Bacteria | 3276 |
| 291 | Ga0209129_1020623 | 3300025258 | Bacteria | 1223 |
| 292 | Ga0209565_1000026 | 3300025263 | Bacteria | 365910 |
| 293 | Ga0209565_1000150 | 3300025263 | Bacteria | 94073 |
| 294 | Ga0209565_1001312 | 3300025263 | Bacteria | 11421 |
| 295 | Ga0207666_1001766 | 3300025271 | Bacteria | 2567 |
| 296 | Ga0207666_1005525 | 3300025271 | Bacteria | 1617 |
| 297 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 298 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 299 | Ga0209673_1000114 | 3300025273 | Bacteria | 178557 |
| 300 | Ga0209673_1008634 | 3300025273 | Bacteria | 4514 |
| 301 | Ga0209130_1000099 | 3300025284 | Bacteria | 141717 |
| 302 | Ga0209130_1000123 | 3300025284 | Bacteria | 125840 |
| 303 | Ga0209130_1006153 | 3300025284 | Bacteria | 3960 |
| 304 | Ga0209675_1000062 | 3300025291 | Bacteria | 178557 |
| 305 | Ga0209675_1000155 | 3300025291 | Bacteria | 89020 |
| 306 | Ga0209675_1004791 | 3300025291 | Bacteria | 5878 |
| 307 | Ga0209675_1005864 | 3300025291 | Bacteria | 5045 |
| 308 | Ga0209676_1000051 | 3300025292 | Bacteria | 389016 |
| 309 | Ga0209676_1000325 | 3300025292 | Bacteria | 91840 |
| 310 | Ga0209676_1008862 | 3300025292 | Bacteria | 4423 |
| 311 | Ga0209676_1009460 | 3300025292 | Bacteria | 4200 |
| 312 | Ga0209676_1026578 | 3300025292 | Bacteria | 1836 |
| 313 | Ga0209025_1000521 | 3300025294 | Bacteria | 73251 |
| 314 | Ga0209025_1004061 | 3300025294 | Bacteria | 13090 |
| 315 | Ga0209025_1007738 | 3300025294 | Bacteria | 7920 |
| 316 | Ga0209025_1009286 | 3300025294 | Bacteria | 6885 |
| 317 | Ga0209564_1000211 | 3300025295 | Bacteria | 133277 |
| 318 | Ga0209564_1000228 | 3300025295 | Bacteria | 125206 |
| 319 | Ga0209564_1004815 | 3300025295 | Bacteria | 8037 |
| 320 | Ga0209758_1054147 | 3300025297 | Bacteria | 1372 |
| 321 | Ga0209050_1000044 | 3300025298 | Bacteria | 391114 |
| 322 | Ga0209050_1003950 | 3300025298 | Bacteria | 10477 |
| 323 | Ga0209050_1010312 | 3300025298 | Bacteria | 4620 |
| 324 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 325 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 326 | Ga0207426_1003919 | 3300025302 | Bacteria | 7633 |
| 327 | Ga0209051_1000031 | 3300025303 | Bacteria | 391114 |
| 328 | Ga0209051_1000208 | 3300025303 | Bacteria | 102967 |
| 329 | Ga0209051_1000760 | 3300025303 | Bacteria | 34370 |
| 330 | Ga0209051_1042140 | 3300025303 | Bacteria | 1616 |
| 331 | Ga0209257_1000058 | 3300025304 | Bacteria | 381686 |
| 332 | Ga0209257_1008393 | 3300025304 | Bacteria | 5887 |
| 333 | Ga0209257_1014090 | 3300025304 | Bacteria | 3474 |
| 334 | Ga0207697_10009556 | 3300025315 | Bacteria | 4185 |
| 335 | Ga0207697_10032926 | 3300025315 | Bacteria | 2122 |
| 336 | Ga0207697_10065936 | 3300025315 | Bacteria | 1512 |
| 337 | Ga0207682_10001921 | 3300025893 | Bacteria | 9445 |
| 338 | Ga0207682_10009146 | 3300025893 | Bacteria | 3914 |
| 339 | Ga0207682_10038424 | 3300025893 | Bacteria | 1942 |
| 340 | Ga0207682_10057923 | 3300025893 | Bacteria | 1616 |
| 341 | Ga0207642_10015639 | 3300025899 | Bacteria | 2834 |
| 342 | Ga0207688_10004631 | 3300025901 | Bacteria | 7495 |
| 343 | Ga0207688_10033243 | 3300025901 | Bacteria | 2852 |
| 344 | Ga0207699_10067868 | 3300025906 | Bacteria | 2170 |
| 345 | Ga0207645_10003092 | 3300025907 | Bacteria | 12763 |
| 346 | Ga0207645_10007091 | 3300025907 | Bacteria | 7965 |
| 347 | Ga0207645_10027206 | 3300025907 | Bacteria | 3694 |
| 348 | Ga0207645_10115523 | 3300025907 | Bacteria | 1740 |
| 349 | Ga0207643_10003923 | 3300025908 | Bacteria | 8004 |
| 350 | Ga0207643_10054228 | 3300025908 | Bacteria | 2278 |
| 351 | Ga0207707_10044809 | 3300025912 | Bacteria | 3855 |
| 352 | Ga0207707_10104139 | 3300025912 | Bacteria | 2480 |
| 353 | Ga0207671_10162669 | 3300025914 | Bacteria | 1729 |
| 354 | Ga0207660_10007738 | 3300025917 | Bacteria | 6956 |
| 355 | Ga0207660_10131999 | 3300025917 | Bacteria | 1902 |
| 356 | Ga0207662_10003730 | 3300025918 | Bacteria | 7899 |
| 357 | Ga0207662_10076536 | 3300025918 | Bacteria | 2034 |
| 358 | Ga0207657_10049797 | 3300025919 | Bacteria | 3648 |
| 359 | Ga0207652_10005260 | 3300025921 | Bacteria | 10509 |
| 360 | Ga0207652_10282909 | 3300025921 | Bacteria | 1496 |
| 361 | Ga0207681_10007401 | 3300025923 | Bacteria | 6721 |
| 362 | Ga0207681_10018416 | 3300025923 | Bacteria | 4400 |
| 363 | Ga0207681_10074401 | 3300025923 | Bacteria | 2379 |
| 364 | Ga0207681_10081248 | 3300025923 | Bacteria | 2288 |
| 365 | Ga0207681_10124240 | 3300025923 | Bacteria | 1897 |
| 366 | Ga0207681_10215106 | 3300025923 | Bacteria | 1484 |
| 367 | Ga0207694_10076303 | 3300025924 | Bacteria | 2625 |
| 368 | Ga0207650_10023527 | 3300025925 | Bacteria | 4369 |
| 369 | Ga0207650_10069686 | 3300025925 | Bacteria | 2642 |
| 370 | Ga0207659_10007169 | 3300025926 | Bacteria | 6843 |
| 371 | Ga0207659_10020490 | 3300025926 | Bacteria | 4372 |
| 372 | Ga0207659_10058986 | 3300025926 | Bacteria | 2757 |
| 373 | Ga0207659_10059908 | 3300025926 | Bacteria | 2738 |
| 374 | Ga0207659_10138499 | 3300025926 | Bacteria | 1887 |
| 375 | Ga0207659_10356728 | 3300025926 | Bacteria | 1214 |
| 376 | Ga0207659_10492099 | 3300025926 | Bacteria | 1037 |
| 377 | Ga0207687_10049293 | 3300025927 | Bacteria | 2928 |
| 378 | Ga0207687_10322388 | 3300025927 | Bacteria | 1251 |
| 379 | Ga0207644_10000068 | 3300025931 | Bacteria | 76090 |
| 380 | Ga0207644_10015661 | 3300025931 | Bacteria | 5094 |
| 381 | Ga0207644_10051778 | 3300025931 | Bacteria | 2948 |
| 382 | Ga0207690_10095883 | 3300025932 | Bacteria | 2108 |
| 383 | Ga0207706_10052263 | 3300025933 | Bacteria | 3607 |
| 384 | Ga0207706_10152950 | 3300025933 | Bacteria | 2029 |
| 385 | Ga0207686_10028134 | 3300025934 | Bacteria | 3301 |
| 386 | Ga0207686_10031426 | 3300025934 | Bacteria | 3152 |
| 387 | Ga0207709_10002195 | 3300025935 | Bacteria | 12448 |
| 388 | Ga0207709_10021397 | 3300025935 | Bacteria | 3661 |
| 389 | Ga0207709_10186987 | 3300025935 | Bacteria | 1468 |
| 390 | Ga0207709_10338157 | 3300025935 | Bacteria | 1132 |
| 391 | Ga0207670_10099193 | 3300025936 | Bacteria | 2077 |
| 392 | Ga0207669_10017506 | 3300025937 | Bacteria | 3679 |
| 393 | Ga0207669_10026733 | 3300025937 | Bacteria | 3145 |
| 394 | Ga0207669_10067712 | 3300025937 | Bacteria | 2226 |
| 395 | Ga0207704_10002833 | 3300025938 | Bacteria | 7826 |
| 396 | Ga0207704_10058905 | 3300025938 | Bacteria | 2368 |
| 397 | Ga0207704_10186226 | 3300025938 | Bacteria | 1505 |
| 398 | Ga0207665_10019966 | 3300025939 | Bacteria | 4403 |
| 399 | Ga0207665_10062982 | 3300025939 | Bacteria | 2518 |
| 400 | Ga0207691_10017865 | 3300025940 | Bacteria | 6721 |
| 401 | Ga0207691_10038713 | 3300025940 | Bacteria | 4412 |
| 402 | Ga0207691_10076011 | 3300025940 | Bacteria | 3027 |
| 403 | Ga0207691_10096530 | 3300025940 | Bacteria | 2642 |
| 404 | Ga0207691_10135806 | 3300025940 | Bacteria | 2169 |
| 405 | Ga0207691_10140623 | 3300025940 | Bacteria | 2127 |
| 406 | Ga0207691_10168616 | 3300025940 | Bacteria | 1918 |
| 407 | Ga0207711_10019765 | 3300025941 | Bacteria | 5612 |
| 408 | Ga0207711_10054755 | 3300025941 | Bacteria | 3424 |
| 409 | Ga0207689_10001957 | 3300025942 | Bacteria | 19463 |
| 410 | Ga0207689_10003617 | 3300025942 | Bacteria | 14127 |
| 411 | Ga0207689_10028597 | 3300025942 | Bacteria | 4661 |
| 412 | Ga0207689_10057292 | 3300025942 | Bacteria | 3206 |
| 413 | Ga0207689_10093231 | 3300025942 | Bacteria | 2474 |
| 414 | Ga0207651_10183129 | 3300025960 | Bacteria | 1664 |
| 415 | Ga0207651_10425300 | 3300025960 | Bacteria | 1135 |
| 416 | Ga0207712_10085529 | 3300025961 | Bacteria | 2308 |
| 417 | Ga0207712_10291971 | 3300025961 | Bacteria | 1335 |
| 418 | Ga0207668_10050743 | 3300025972 | Bacteria | 2861 |
| 419 | Ga0207668_10159663 | 3300025972 | Bacteria | 1755 |
| 420 | Ga0207640_10167449 | 3300025981 | Bacteria | 1633 |
| 421 | Ga0207640_10314162 | 3300025981 | Bacteria | 1245 |
| 422 | Ga0207640_10359120 | 3300025981 | Bacteria | 1173 |
| 423 | Ga0207658_10040984 | 3300025986 | Bacteria | 3350 |
| 424 | Ga0207677_10003663 | 3300026023 | Bacteria | 8158 |
| 425 | Ga0207677_10010533 | 3300026023 | Bacteria | 5237 |
| 426 | Ga0207703_10007902 | 3300026035 | Bacteria | 8412 |
| 427 | Ga0207703_10021291 | 3300026035 | Bacteria | 5076 |
| 428 | Ga0207703_10340960 | 3300026035 | Bacteria | 1377 |
| 429 | Ga0207639_10169145 | 3300026041 | Bacteria | 1849 |
| 430 | Ga0207708_10003042 | 3300026075 | Bacteria | 12362 |
| 431 | Ga0207708_10174301 | 3300026075 | Bacteria | 1705 |
| 432 | Ga0207702_10121901 | 3300026078 | Bacteria | 2335 |
| 433 | Ga0207641_10005089 | 3300026088 | Bacteria | 11267 |
| 434 | Ga0207641_10012091 | 3300026088 | Bacteria | 7079 |
| 435 | Ga0207641_10021771 | 3300026088 | Bacteria | 5269 |
| 436 | Ga0207641_10045647 | 3300026088 | Bacteria | 3690 |
| 437 | Ga0207641_10097342 | 3300026088 | Bacteria | 2586 |
| 438 | Ga0207641_10202929 | 3300026088 | Bacteria | 1829 |
| 439 | Ga0207648_10003800 | 3300026089 | Bacteria | 15788 |
| 440 | Ga0207648_10005299 | 3300026089 | Bacteria | 13011 |
| 441 | Ga0207648_10031498 | 3300026089 | Bacteria | 4689 |
| 442 | Ga0207648_10120272 | 3300026089 | Bacteria | 2309 |
| 443 | Ga0207648_10135611 | 3300026089 | Bacteria | 2168 |
| 444 | Ga0207648_10230632 | 3300026089 | Bacteria | 1647 |
| 445 | Ga0207648_10256610 | 3300026089 | Bacteria | 1559 |
| 446 | Ga0207676_10005921 | 3300026095 | Bacteria | 8637 |
| 447 | Ga0207676_10037212 | 3300026095 | Bacteria | 3707 |
| 448 | Ga0207676_10067533 | 3300026095 | Bacteria | 2856 |
| 449 | Ga0207674_10188848 | 3300026116 | Bacteria | 2010 |
| 450 | Ga0207675_100002241 | 3300026118 | Bacteria | 19232 |
| 451 | Ga0207675_100003993 | 3300026118 | Bacteria | 14308 |
| 452 | Ga0207675_100004245 | 3300026118 | Bacteria | 13857 |
| 453 | Ga0207675_100004891 | 3300026118 | Bacteria | 12915 |
| 454 | Ga0207675_100313582 | 3300026118 | Bacteria | 1530 |
| 455 | Ga0207683_10006887 | 3300026121 | Bacteria | 9732 |
| 456 | Ga0207683_10009318 | 3300026121 | Bacteria | 8364 |
| 457 | Ga0207683_10037761 | 3300026121 | Bacteria | 4207 |
| 458 | Ga0207683_10051292 | 3300026121 | Bacteria | 3615 |
| 459 | Ga0207683_10066018 | 3300026121 | Bacteria | 3190 |
| 460 | Ga0207683_10082714 | 3300026121 | Bacteria | 2852 |
| 461 | Ga0207683_10135215 | 3300026121 | Bacteria | 2219 |
| 462 | Ga0207683_10145642 | 3300026121 | Bacteria | 2136 |
| 463 | Ga0207683_10177550 | 3300026121 | Bacteria | 1930 |
| 464 | Ga0207698_10136339 | 3300026142 | Bacteria | 2106 |
| 465 | Ga0209282_1000307 | 3300027666 | Bacteria | 24300 |
| 466 | Ga0209813_10018671 | 3300027866 | Bacteria | 1919 |
| 467 | Ga0207428_10001393 | 3300027907 | Bacteria | 25520 |
| 468 | Ga0207428_10214401 | 3300027907 | Bacteria | 1445 |
| 469 | Ga0207428_10297530 | 3300027907 | Bacteria | 1195 |
| 470 | Ga0268266_10028790 | 3300028379 | Bacteria | 4722 |
| 471 | Ga0268266_10078383 | 3300028379 | Bacteria | 2875 |
| 472 | Ga0268266_10084949 | 3300028379 | Bacteria | 2765 |
| 473 | Ga0268266_10173298 | 3300028379 | Bacteria | 1959 |
| 474 | Ga0268266_10260665 | 3300028379 | Bacteria | 1606 |
| 475 | Ga0268265_10050607 | 3300028380 | Bacteria | 3131 |
| 476 | Ga0268265_10093826 | 3300028380 | Bacteria | 2405 |
| 477 | Ga0268265_10311769 | 3300028380 | Bacteria | 1421 |
| 478 | Ga0268265_10315396 | 3300028380 | Bacteria | 1413 |
| 479 | Ga0268264_10004057 | 3300028381 | Bacteria | 12533 |
| 480 | Ga0268264_10011781 | 3300028381 | Bacteria | 7210 |
| 481 | Ga0268264_10015030 | 3300028381 | Bacteria | 6351 |
| 482 | Ga0307515_10000064 | 3300028794 | Bacteria | 245452 |
| 483 | Ga0307515_10131206 | 3300028794 | Bacteria | 2758 |
| 484 | Ga0314311_1070027 | 3300030733 | Bacteria | 2682 |
| 485 | Ga0316178_1126380 | 3300030735 | Bacteria | 3798 |
| 486 | Ga0316183_1110495 | 3300030742 | Bacteria | 3751 |
| 487 | Ga0307513_10000090 | 3300031456 | Bacteria | 129750 |
| 488 | Ga0307513_10152164 | 3300031456 | Bacteria | 2220 |
| 489 | Ga0307513_10282106 | 3300031456 | Bacteria | 1438 |
| 490 | Ga0307408_100005621 | 3300031548 | Bacteria | 8383 |
| 491 | Ga0307514_10011166 | 3300031649 | Bacteria | 7476 |
| 492 | Ga0316576_10022958 | 3300031727 | Bacteria | 4340 |
| 493 | Ga0307516_10003513 | 3300031730 | Bacteria | 20060 |
| 494 | Ga0307516_10289807 | 3300031730 | Bacteria | 1316 |
| 495 | Ga0307405_10005918 | 3300031731 | Bacteria | 5963 |
| 496 | Ga0307405_10037668 | 3300031731 | Bacteria | 2908 |
| 497 | Ga0307405_10156098 | 3300031731 | Bacteria | 1611 |
| 498 | Ga0307405_10172422 | 3300031731 | Bacteria | 1544 |
| 499 | Ga0307405_10312652 | 3300031731 | Bacteria | 1196 |
| 500 | Ga0307406_10006495 | 3300031901 | Bacteria | 6459 |
| 501 | Ga0307406_10018017 | 3300031901 | Bacteria | 4119 |
| 502 | Ga0307406_10056965 | 3300031901 | Bacteria | 2505 |
| 503 | Ga0307406_10237084 | 3300031901 | Bacteria | 1366 |
| 504 | Ga0307407_10039408 | 3300031903 | Bacteria | 2627 |
| 505 | Ga0307407_10044743 | 3300031903 | Bacteria | 2497 |
| 506 | Ga0307407_10125171 | 3300031903 | Bacteria | 1636 |
| 507 | Ga0307412_10002222 | 3300031911 | Bacteria | 10777 |
| 508 | Ga0307412_10046332 | 3300031911 | Bacteria | 2848 |
| 509 | Ga0307412_10071053 | 3300031911 | Bacteria | 2375 |
| 510 | Ga0307412_10139943 | 3300031911 | Bacteria | 1771 |
| 511 | Ga0307412_10206202 | 3300031911 | Bacteria | 1496 |
| 512 | Ga0307409_100000592 | 3300031995 | Bacteria | 15808 |
| 513 | Ga0307416_100006736 | 3300032002 | Bacteria | 7222 |
| 514 | Ga0307416_100030125 | 3300032002 | Bacteria | 4068 |
| 515 | Ga0307416_100214103 | 3300032002 | Bacteria | 1841 |
| 516 | Ga0307416_100377465 | 3300032002 | Bacteria | 1446 |
| 517 | Ga0307414_10011967 | 3300032004 | Bacteria | 5115 |
| 518 | Ga0307414_10146811 | 3300032004 | Bacteria | 1854 |
| 519 | Ga0307415_100002275 | 3300032126 | Bacteria | 9522 |
| 520 | Ga0373948_0008637 | 3300034817 | Bacteria | 1739 |
| 521 | Ga0373958_0011585 | 3300034819 | Bacteria | 1493 |
| 522 | Ga0373938_0002172 | 3300034957 | Bacteria | 3150 |
| 523 | Ga0373926_0056296 | 3300035083 | Bacteria | 1427 |
| 524 | Ga0373934_0003128 | 3300035086 | Bacteria | 6033 |
| 525 | Ga0373940_0002793 | 3300035088 | Bacteria | 3463 |
| 526 | Ga0373949_0005821 | 3300035090 | Bacteria | 2740 |
| 527 | Ga0373932_0000899 | 3300035112 | Bacteria | 8694 |
| 528 | Ga0373936_0042274 | 3300035113 | Bacteria | 1829 |
| 529 | Ga0373939_0031116 | 3300035114 | Bacteria | 1540 |
| 530 | Ga0373941_0001232 | 3300035115 | Bacteria | 5370 |
| 531 | Ga0373954_0001879 | 3300035118 | Bacteria | 8667 |
| 532 | Ga0373954_0010855 | 3300035118 | Bacteria | 4027 |
| 533 | Ga0373954_0075111 | 3300035118 | Bacteria | 1609 |
| 534 | Ga0373956_0004750 | 3300035119 | Bacteria | 5436 |
| 535 | Ga0373943_0021729 | 3300035170 | Bacteria | 2966 |
| 536 | Ga0373955_0014117 | 3300035172 | Bacteria | 3878 |
| 537 | Ga0373942_0004480 | 3300035207 | Bacteria | 3239 |
| 538 | Ga0373924_0072241 | 3300035410 | Bacteria | 1457 |
| 539 | Ga0373931_0000240 | 3300035691 | Bacteria | 23366 |
| 540 | Ga0373931_0045475 | 3300035691 | Bacteria | 2318 |
| 541 | Ga0373935_0005687 | 3300035692 | Bacteria | 7359 |
| 542 | Ga0373935_0214442 | 3300035692 | Bacteria | 1335 |
| 543 | Ga0373927_0015781 | 3300035695 | Bacteria | 4984 |
| 544 | Ga0373927_0094091 | 3300035695 | Bacteria | 1947 |
| 545 | Ga0373937_0051422 | 3300036401 | Bacteria | 3776 |
| 546 | Ga0373937_0055969 | 3300036401 | Bacteria | 3621 |
| 547 | Ga0373937_0218702 | 3300036401 | Bacteria | 1793 |
| 548 | Ga0373937_0328257 | 3300036401 | Bacteria | 1448 |
| 549 | Ga0373925_0005088 | 3300037068 | Bacteria | 9841 |
| 550 | Ga0373925_0006421 | 3300037068 | Bacteria | 8653 |
| 551 | Ga0373925_0077080 | 3300037068 | Bacteria | 2529 |
| 552 | Ga0373925_0232377 | 3300037068 | Bacteria | 1475 |
| 553 | Ga0395899_0003326 | 3300037312 | Bacteria | 12743 |
| 554 | Ga0395900_0145283 | 3300037418 | Bacteria | 2425 |
| 555 | Ga0395900_0409358 | 3300037418 | Bacteria | 1319 |
| 556 | Ga0395898_0007717 | 3300037466 | Bacteria | 11423 |
| 557 | Ga0395905_0000027 | 3300037471 | Bacteria | 297239 |
| 558 | Ga0395905_0000492 | 3300037471 | Bacteria | 54399 |
| 559 | Ga0395905_0005285 | 3300037471 | Bacteria | 13205 |
| 560 | Ga0395905_0024428 | 3300037471 | Bacteria | 5704 |
| 561 | Ga0395901_0060974 | 3300038443 | Bacteria | 3925 |
| 562 | Ga0395901_0325747 | 3300038443 | Bacteria | 1589 |
| 563 | Ga0436365_0797101 | 3300039437 | Bacteria | 4419 |
| 564 | Ga0439436_0032296 | 3300041404 | Bacteria | 1518 |
| 565 | Ga0439436_0040343 | 3300041404 | Bacteria | 1338 |
| 566 | Ga0439447_031399 | 3300041407 | Bacteria | 1333 |
| 567 | Ga0439466_0008218 | 3300041411 | Bacteria | 3935 |
| 568 | Ga0451845_0923310 | 3300041501 | Bacteria | 1065 |
| 569 | Ga0451853_2803178 | 3300041512 | Bacteria | 1073 |
| 570 | Ga0451853_2861878 | 3300041512 | Bacteria | 1975 |
| 571 | Ga0439445_0001503 | 3300042004 | Bacteria | 5070 |
| 572 | Ga0439445_0017625 | 3300042004 | Bacteria | 1766 |
| 573 | Ga0439432_000751 | 3300042006 | Bacteria | 12131 |
| 574 | Ga0439432_028932 | 3300042006 | Bacteria | 1803 |
| 575 | Ga0439449_0002753 | 3300042007 | Bacteria | 6842 |
| 576 | Ga0439450_002769 | 3300042008 | Bacteria | 2807 |
| 577 | Ga0439452_020482 | 3300042010 | Bacteria | 1734 |
| 578 | Ga0439462_0013144 | 3300042015 | Bacteria | 2121 |
| 579 | Ga0450911_000714 | 3300042115 | Bacteria | 9675 |
| 580 | Ga0450906_009514 | 3300042145 | Bacteria | 1851 |
| 581 | Ga0439446_0025803 | 3300042156 | Bacteria | 1681 |
| 582 | Ga0450908_023022 | 3300042184 | Bacteria | 1091 |
| 583 | Ga0439434_0000521 | 3300042435 | Bacteria | 10979 |
| 584 | Ga0439434_0032229 | 3300042435 | Bacteria | 1594 |
| 585 | Ga0439464_0009427 | 3300042439 | Bacteria | 2570 |
| 586 | Ga0450918_007268 | 3300042531 | Bacteria | 1964 |
| 587 | Ga0451577_0034708 | 3300042876 | Bacteria | 4545 |
| 588 | Ga0451577_0077656 | 3300042876 | Bacteria | 2961 |
| 589 | Ga0466960_0034266 | 3300044901 | Bacteria | 2365 |
| 590 | Ga0451576_0045169 | 3300045051 | Bacteria | 4641 |
| 591 | Ga0451576_0046886 | 3300045051 | Bacteria | 4548 |
| 592 | Ga0451576_0126883 | 3300045051 | Bacteria | 2658 |
| 593 | Ga0495592_0018276 | 3300046454 | Bacteria | 5328 |
| 594 | Ga0495592_0038629 | 3300046454 | Bacteria | 3590 |
| 595 | Ga0495592_0241699 | 3300046454 | Bacteria | 1198 |
| 596 | Ga0495651_0004864 | 3300046462 | Bacteria | 10278 |
| 597 | Ga0495653_0016586 | 3300046463 | Bacteria | 5995 |
| 598 | Ga0495580_0030828 | 3300046472 | Bacteria | 3879 |
| 599 | Ga0495639_0001883 | 3300046475 | Bacteria | 9302 |
| 600 | Ga0495662_0032003 | 3300046476 | Bacteria | 2540 |
| 601 | Ga0495664_0028228 | 3300046477 | Bacteria | 3277 |
| 602 | Ga0495608_0017319 | 3300046511 | Bacteria | 4984 |
| 603 | Ga0495608_0052053 | 3300046511 | Bacteria | 2711 |
| 604 | Ga0495628_0000826 | 3300046516 | Bacteria | 28697 |
| 605 | Ga0495663_0023705 | 3300046525 | Bacteria | 1780 |
| 606 | Ga0495642_0088778 | 3300046528 | Bacteria | 1307 |
| 607 | Ga0495652_0005167 | 3300046529 | Bacteria | 12342 |
| 608 | Ga0495652_0029175 | 3300046529 | Bacteria | 4847 |
| 609 | Ga0495654_0003475 | 3300046530 | Bacteria | 9623 |
| 610 | Ga0495665_0001363 | 3300046531 | Bacteria | 13069 |
| 611 | Ga0495640_0009540 | 3300046533 | Bacteria | 7549 |
| 612 | Ga0495586_0012113 | 3300046535 | Bacteria | 4578 |
| 613 | Ga0495587_0014208 | 3300046536 | Bacteria | 4997 |
| 614 | Ga0495598_0020186 | 3300046537 | Bacteria | 1756 |
| 615 | Ga0495621_0010048 | 3300046539 | Bacteria | 2888 |
| 616 | Ga0495645_0000419 | 3300046543 | Bacteria | 29318 |
| 617 | Ga0495645_0139853 | 3300046543 | Bacteria | 1690 |
| 618 | Ga0495633_0184763 | 3300046558 | Bacteria | 959 |
| 619 | Ga0495667_0022002 | 3300046559 | Bacteria | 4298 |
| 620 | Ga0495667_0214338 | 3300046559 | Bacteria | 1230 |
| 621 | Ga0495656_0002368 | 3300046615 | Bacteria | 6248 |
| 622 | Ga0495634_0007734 | 3300046642 | Bacteria | 8039 |
| 623 | Ga0495657_0012040 | 3300046675 | Bacteria | 6435 |
| 624 | Ga0495657_0206380 | 3300046675 | Bacteria | 1196 |
| 625 | Ga0495599_0000476 | 3300046678 | Bacteria | 22901 |
| 626 | Ga0495599_0006605 | 3300046678 | Bacteria | 6997 |
| 627 | Ga0495647_0018668 | 3300046681 | Bacteria | 2472 |
| 628 | Ga0495658_0063549 | 3300046683 | Bacteria | 2124 |
| 629 | Ga0495669_0032817 | 3300046684 | Bacteria | 2283 |
| 630 | Ga0495669_0104579 | 3300046684 | Bacteria | 1317 |
| 631 | Ga0495613_0078278 | 3300046689 | Bacteria | 2405 |
| 632 | Ga0495581_0155442 | 3300047315 | Bacteria | 1337 |
| 633 | Ga0495604_0019442 | 3300047317 | Bacteria | 5436 |
| 634 | Ga0495636_0003473 | 3300047318 | Bacteria | 6118 |
| 635 | Ga0495674_0009625 | 3300047319 | Bacteria | 9181 |
| 636 | Ga0495680_0008579 | 3300047322 | Bacteria | 9278 |
| 637 | Ga0495675_0001332 | 3300047444 | Bacteria | 14955 |
| 638 | Ga0495681_0101270 | 3300047470 | Bacteria | 1259 |
| 639 | Ga0495684_0008994 | 3300047471 | Bacteria | 7710 |
| 640 | Ga0496100_0190733 | 3300048903 | Bacteria | 1488 |
| 641 | Ga0496101_0004340 | 3300048904 | Bacteria | 8899 |
| 642 | Ga0496101_0251577 | 3300048904 | Bacteria | 1377 |
| 643 | Ga0496102_0043995 | 3300048905 | Bacteria | 4050 |
| 644 | Ga0496103_0042834 | 3300048906 | Bacteria | 2786 |
| 645 | Ga0496103_0065059 | 3300048906 | Bacteria | 2274 |
| 646 | Ga0496103_0228185 | 3300048906 | Bacteria | 1198 |
| 647 | Ga0496104_0075420 | 3300048907 | Bacteria | 3211 |
| 648 | Ga0496104_0135850 | 3300048907 | Bacteria | 2363 |
| 649 | Ga0496104_0358800 | 3300048907 | Bacteria | 1370 |
| 650 | Ga0496105_0013954 | 3300048908 | Bacteria | 6387 |
| 651 | Ga0496106_0113688 | 3300048909 | Bacteria | 2110 |
| 652 | Ga0496108_0188870 | 3300048911 | Bacteria | 1785 |
| 653 | Ga0496109_0033593 | 3300048912 | Bacteria | 4615 |
| 654 | Ga0496109_0192357 | 3300048912 | Bacteria | 1917 |
| 655 | Ga0496110_0070534 | 3300048913 | Bacteria | 3096 |
| 656 | Ga0496110_0178144 | 3300048913 | Bacteria | 1930 |
| 657 | Ga0496110_0241034 | 3300048913 | Bacteria | 1645 |
| 658 | Ga0496111_0112321 | 3300048914 | Bacteria | 2007 |
| 659 | Ga0496111_0134709 | 3300048914 | Bacteria | 1829 |
| 660 | Ga0496112_0104512 | 3300048915 | Bacteria | 2802 |
| 661 | Ga0496113_0373480 | 3300048916 | Bacteria | 1144 |
| 662 | Ga0496121_0004542 | 3300048924 | Bacteria | 18558 |
| 663 | Ga0496122_0000184 | 3300048925 | Bacteria | 144437 |
| 664 | Ga0496123_0000181 | 3300048926 | Bacteria | 127092 |
| 665 | Ga0496124_0033333 | 3300048927 | Bacteria | 4530 |
| 666 | Ga0496125_0007111 | 3300048928 | Bacteria | 11945 |
| 667 | Ga0496125_0007919 | 3300048928 | Bacteria | 11218 |
| 668 | Ga0496125_0033645 | 3300048928 | Bacteria | 4532 |
| 669 | Ga0501262_000209 | 3300049759 | Bacteria | 7284 |
| 670 | nmdc:mga03683_26926_c1 | 3300050489 | Bacteria | 2273 |
| 671 | nmdc:mga03683_7048_c1 | 3300050489 | Bacteria | 3880 |
| 672 | nmdc:mga03n38_58743_c1 | 3300050490 | Bacteria | 1744 |
| 673 | nmdc:mga0yw44_135850_c1 | 3300050492 | Bacteria | 1595 |
| 674 | nmdc:mga0yw44_66710_c1 | 3300050492 | Bacteria | 2221 |
| 675 | nmdc:mga0k408_29966_c1 | 3300050493 | Bacteria | 3101 |
| 676 | nmdc:mga0k408_34317_c1 | 3300050493 | Bacteria | 2904 |
| 677 | nmdc:mga0k408_70727_c1 | 3300050493 | Bacteria | 2036 |
| 678 | nmdc:mga06z11_5003_c1 | 3300050494 | Bacteria | 5269 |
| 679 | nmdc:mga07m45_36834_c1 | 3300050496 | Bacteria | 2726 |
| 680 | nmdc:mga07m45_43661_c1 | 3300050496 | Bacteria | 2514 |
| 681 | nmdc:mga07m45_60069_c2 | 3300050496 | Bacteria | 1837 |
| 682 | nmdc:mga07m45_67103_c1 | 3300050496 | Bacteria | 1083 |
| 683 | nmdc:mga05p37_2731_c1 | 3300050507 | Bacteria | 20509 |
| 684 | nmdc:mga09592_1651_c1 | 3300050508 | Bacteria | 17950 |
| 685 | nmdc:mga09592_34056_c1 | 3300050508 | Bacteria | 4257 |
| 686 | nmdc:mga09592_7768_c1 | 3300050508 | Bacteria | 8715 |
| 687 | nmdc:mga0qj67_8225_c2 | 3300050509 | Bacteria | 6603 |
| 688 | nmdc:mga08y16_2538_c1 | 3300050511 | Bacteria | 18780 |
| 689 | nmdc:mga08y16_260843_c1 | 3300050511 | Bacteria | 1790 |
| 690 | nmdc:mga08y16_328861_c1 | 3300050511 | Bacteria | 1573 |
| 691 | nmdc:mga08y16_49249_c1 | 3300050511 | Bacteria | 4410 |
| 692 | nmdc:mga0rr50_4644_c1 | 3300050513 | Bacteria | 8094 |
| 693 | nmdc:mga0rr50_95867_c1 | 3300050513 | Bacteria | 2320 |
| 694 | nmdc:mga08x19_4918_c1 | 3300050514 | Bacteria | 7889 |
| 695 | nmdc:mga0a205_26501_c1 | 3300050515 | Bacteria | 5529 |
| 696 | nmdc:mga0sz30_23984_c1 | 3300050516 | Bacteria | 2487 |
| 697 | Ga0495601_0009086 | 3300053077 | Bacteria | 5869 |
| 698 | Ga0495601_0017699 | 3300053077 | Bacteria | 4329 |
| 699 | Ga0495601_0107988 | 3300053077 | Bacteria | 1800 |
| 700 | Ga0495595_0005077 | 3300053084 | Bacteria | 5318 |
| 701 | Ga0495619_0022417 | 3300053085 | Bacteria | 4041 |
| 702 | Ga0500644_0001138 | 3300053088 | Bacteria | 7751 |
| 703 | Ga0500651_0005197 | 3300053093 | Bacteria | 7409 |
| 704 | Ga0500556_0114877 | 3300053104 | Bacteria | 1047 |
| 705 | Ga0500593_002149 | 3300053117 | Bacteria | 7169 |
| 706 | Ga0500594_0009084 | 3300053118 | Bacteria | 2281 |
| 707 | Ga0500573_0063734 | 3300053140 | Bacteria | 2109 |
| 708 | Ga0500616_0034346 | 3300053153 | Bacteria | 2762 |
| 709 | Ga0500634_0036397 | 3300053161 | Bacteria | 2679 |
| 710 | Ga0500645_000061 | 3300053730 | Bacteria | 85703 |
| 711 | Ga0500661_000809 | 3300055283 | Bacteria | 5830 |
| 712 | 2508733986 | 2508501050 | Bacteria | 9633614 |
| 713 | 2509140513 | 2508501127 | Bacteria | 7037543 |
| 714 | 2511243466 | 2511231002 | Bacteria | 5042903 |
| 715 | 2548497884 | 2547132374 | Bacteria | 5530232 |
| 716 | 2597813952 | 2597489875 | Bacteria | 7010078 |
| 717 | 2644466121 | 2643221683 | Bacteria | 5749203 |
| 718 | 2644649509 | 2643221717 | Bacteria | 5676132 |
| 719 | 2739251827 | 2738543013 | Bacteria | 5618633 |
| 720 | 2842681152 | 2842677519 | Bacteria | 5615038 |
| 721 | 2842737420 | 2842733646 | Bacteria | 5716726 |
| 722 | 2842749839 | 2842747753 | Bacteria | 5578255 |
| 723 | 2856344096 | 2856342000 | Bacteria | 7176905 |
| 724 | 2869167984 | 2869162929 | Bacteria | 6399702 |
| 725 | 2882639023 | 2882632389 | Bacteria | 8154593 |
| 726 | 2885196590 | 2885192300 | Bacteria | 5882526 |
| 727 | 2885317245 | 2885312484 | Bacteria | 6415165 |
| 728 | 2888347608 | 2888343758 | Bacteria | 6611049 |
| 729 | 2904454126 | 2904449895 | Bacteria | 6927402 |
| 730 | 2904462017 | 2904456579 | Bacteria | 6819253 |
| 731 | 2904545948 | 2904541872 | Bacteria | 8915136 |
| 732 | 2919465273 | 2919462493 | Bacteria | 5817112 |
| 733 | 2919707392 | 2919704043 | Bacteria | 5560311 |
| 734 | 2924761117 | 2924754689 | Bacteria | 6774424 |
| 735 | 2929161143 | 2929160207 | Bacteria | 9075316 |
| 736 | 2929521857 | 2929520902 | Bacteria | 6765052 |
| 737 | 2945914375 | 2945909444 | Bacteria | 7065066 |
| 738 | 2945949906 | 2945945610 | Bacteria | 5951079 |
| 739 | 2945973925 | 2945972063 | Bacteria | 6086495 |
| 740 | 2945990230 | 2945984333 | Bacteria | 7358892 |
| 741 | 2954770487 | 2954767861 | Bacteria | 5535784 |
| 742 | 2970530315 | 2970524798 | Bacteria | 6840927 |
| 743 | 2970542389 | 2970540015 | Bacteria | 6977556 |
| 744 | 8004401782 | 8004395343 | Bacteria | 6620908 |
| 745 | 8045867992 | 8045864390 | Bacteria | 5043873 |
| 746 | 8054568162 | 8054563764 | Bacteria | 5592885 |
| 747 | 8055621665 | 8055617313 | Bacteria | 7548464 |
| 748 | Ga0070700_100061684 | |||
| 749 | JGI25155J39150_1000028 | |||
| 750 | JGI25156J39149_1000013 | |||
| 751 | JGI25154J39366_1000032 | |||
| 752 | JGI25157J39369_1000017 | |||
| 753 | JGI25150J39212_1008334 | |||
| 754 | JGI25159J45721_1004214 | |||
| 755 | JGI25159J45721_1006741 | |||
| 756 | JGI25151J46595_10002986 | |||
| 757 | JGI25151J46595_10008595 | |||
| 758 | JGI25151J46595_10012976 | |||
| 759 | JGI25151J46595_10026532 | |||
| 760 | JGI25160J50197_1000106 | |||
| 761 | JGI25161J50226_1000041 | |||
| 762 | Ga0055526_1006939 | |||
| 763 | Ga0055526_1006976 | |||
| 764 | Ga0055537_1000029 | |||
| 765 | Ga0055537_1000229 | |||
| 766 | Ga0055537_1008434 | |||
| 767 | Ga0055524_1000040 | |||
| 768 | Ga0055536_1003958 | |||
| 769 | Ga0055536_1005991 | |||
| 770 | Ga0055534_1000081 | |||
| 771 | Ga0055534_1001320 | |||
| 772 | Ga0055528_1000107 | |||
| 773 | Ga0055528_1003803 | |||
| 774 | Ga0055530_10000493 | |||
| 775 | Ga0055540_1000030 | |||
| 776 | Ga0055540_1001837 | |||
| 777 | Ga0055540_1002684 | |||
| 778 | Ga0055531_10009620 | |||
| 779 | Ga0055543_1001200 | |||
| 780 | Ga0065165_1017710 | |||
| 781 | Ga0065714_10109949 | |||
| 782 | Ga0065704_10083585 | |||
| 783 | Ga0065712_10014625 | |||
| 784 | Ga0065715_10012822 | |||
| 785 | Ga0065715_10021301 | |||
| 786 | Ga0065707_10086478 | |||
| 787 | Ga0065707_10113710 | |||
| 788 | Ga0070658_10179870 | |||
| 789 | Ga0070676_10049045 | |||
| 790 | Ga0070676_10062704 | |||
| 791 | Ga0070676_10141185 | |||
| 792 | Ga0070676_10149960 | |||
| 793 | Ga0070690_100017765 | |||
| 794 | Ga0070690_100059812 | |||
| 795 | Ga0070690_100069129 | |||
| 796 | Ga0070690_100192824 | |||
| 797 | Ga0070670_100049162 | |||
| 798 | Ga0070670_100073813 | |||
| 799 | Ga0070670_100155929 | |||
| 800 | Ga0070677_10012753 | |||
| 801 | Ga0070677_10029393 | |||
| 802 | Ga0070677_10031593 | |||
| 803 | Ga0068869_100011970 | |||
| 804 | Ga0068869_100081511 | |||
| 805 | Ga0068869_100100809 | |||
| 806 | Ga0070666_10007413 | |||
| 807 | Ga0070666_10047403 | |||
| 808 | Ga0070666_10215970 | |||
| 809 | Ga0070680_100112248 | |||
| 810 | Ga0068868_100001955 | |||
| 811 | Ga0068868_100022609 | |||
| 812 | Ga0068868_100253216 | |||
| 813 | Ga0068868_100341558 | |||
| 814 | Ga0070660_100104911 | |||
| 815 | Ga0070689_100051287 | |||
| 816 | Ga0070689_100223463 | |||
| 817 | Ga0070687_100041294 | |||
| 818 | Ga0070687_100105808 | |||
| 819 | Ga0070661_100160399 | |||
| 820 | Ga0070668_100003555 | |||
| 821 | Ga0070668_100020892 | |||
| 822 | Ga0070668_100123058 | |||
| 823 | Ga0070669_100017475 | |||
| 824 | Ga0070669_100019673 | |||
| 825 | Ga0070669_100080235 | |||
| 826 | Ga0070669_100229947 | |||
| 827 | Ga0070675_100005320 | |||
| 828 | Ga0070675_100026424 | |||
| 829 | Ga0070675_100061363 | |||
| 830 | Ga0070675_100079423 | |||
| 831 | Ga0070675_100161306 | |||
| 832 | Ga0070675_100229391 | |||
| 833 | Ga0070675_100316084 | |||
| 834 | Ga0070671_100006632 | |||
| 835 | Ga0070671_100043326 | |||
| 836 | Ga0070671_100069616 | |||
| 837 | Ga0070671_100081519 | |||
| 838 | Ga0070674_100018239 | |||
| 839 | Ga0070674_100029397 | |||
| 840 | Ga0070674_100070201 | |||
| 841 | Ga0070674_100140602 | |||
| 842 | Ga0070674_100216580 | |||
| 843 | Ga0070674_100308897 | |||
| 844 | Ga0070673_100029782 | |||
| 845 | Ga0070673_100067350 | |||
| 846 | Ga0070673_100107639 | |||
| 847 | Ga0070688_100043204 | |||
| 848 | Ga0070659_100135367 | |||
| 849 | Ga0070667_100018788 | |||
| 850 | Ga0070667_100036122 | |||
| 851 | Ga0070667_100038123 | |||
| 852 | Ga0070667_100201894 | |||
| 853 | Ga0070667_100262937 | |||
| 854 | Ga0070701_10009247 | |||
| 855 | Ga0070701_10125573 | |||
| 856 | Ga0070663_100325826 | |||
| 857 | Ga0070678_100053734 | |||
| 858 | Ga0070678_100058482 | |||
| 859 | Ga0070678_100075327 | |||
| 860 | Ga0070678_100081587 | |||
| 861 | Ga0070678_100105411 | |||
| 862 | Ga0070678_100206128 | |||
| 863 | Ga0070662_100012157 | |||
| 864 | Ga0070662_100023662 | |||
| 865 | Ga0070662_100047737 | |||
| 866 | Ga0070662_100091956 | |||
| 867 | Ga0070681_10014937 | |||
| 868 | Ga0070681_10130574 | |||
| 869 | Ga0068867_100002211 | |||
| 870 | Ga0068867_100033665 | |||
| 871 | Ga0068867_100036909 | |||
| 872 | Ga0068867_100047053 | |||
| 873 | Ga0070679_100010948 | |||
| 874 | Ga0070679_100021873 | |||
| 875 | Ga0070679_100212154 | |||
| 876 | Ga0070684_100019585 | |||
| 877 | Ga0070697_100165757 | |||
| 878 | Ga0068853_100046393 | |||
| 879 | Ga0068853_100241264 | |||
| 880 | Ga0070672_100060460 | |||
| 881 | Ga0070672_100061360 | |||
| 882 | Ga0070672_100153963 | |||
| 883 | Ga0070672_100343199 | |||
| 884 | Ga0070686_100028269 | |||
| 885 | Ga0070686_100087148 | |||
| 886 | Ga0070686_100175520 | |||
| 887 | Ga0070696_100004763 | |||
| 888 | Ga0070693_100045512 | |||
| 889 | Ga0070665_100013700 | |||
| 890 | Ga0070665_100041030 | |||
| 891 | Ga0070665_100111220 | |||
| 892 | Ga0070665_100195858 | |||
| 893 | Ga0070665_100220512 | |||
| 894 | Ga0070665_100583693 | |||
| 895 | Ga0070704_100281280 | |||
| 896 | Ga0068855_100039058 | |||
| 897 | Ga0070664_100325584 | |||
| 898 | Ga0068857_100177520 | |||
| 899 | Ga0068854_100147454 | |||
| 900 | Ga0068856_100083350 | |||
| 901 | Ga0070702_100063806 | |||
| 902 | Ga0068852_100244512 | |||
| 903 | Ga0068852_100248037 | |||
| 904 | Ga0068859_100004027 | |||
| 905 | Ga0068859_100068114 | |||
| 906 | Ga0068859_100381668 | |||
| 907 | Ga0068859_100558755 | |||
| 908 | Ga0068864_100083775 | |||
| 909 | Ga0068864_100126759 | |||
| 910 | Ga0068866_10008823 | |||
| 911 | Ga0068861_100002079 | |||
| 912 | Ga0068861_100011946 | |||
| 913 | Ga0068851_10036813 | |||
| 914 | Ga0068851_10048399 | |||
| 915 | Ga0068851_10122175 | |||
| 916 | Ga0068870_10048317 | |||
| 917 | Ga0068863_100004155 | |||
| 918 | Ga0068863_100062379 | |||
| 919 | Ga0068863_100071438 | |||
| 920 | Ga0068863_100167627 | |||
| 921 | Ga0068863_100333192 | |||
| 922 | Ga0068858_100002678 | |||
| 923 | Ga0068858_100117342 | |||
| 924 | Ga0068858_100219961 | |||
| 925 | Ga0068858_100429739 | |||
| 926 | Ga0068860_100003245 | |||
| 927 | Ga0068860_100005443 | |||
| 928 | Ga0068860_100033915 | |||
| 929 | Ga0068860_100100078 | |||
| 930 | Ga0068862_100020138 | |||
| 931 | Ga0068862_100027364 | |||
| 932 | Ga0068862_100224900 | |||
| 933 | Ga0081540_1015210 | |||
| 934 | Ga0070717_10399214 | |||
| 935 | Ga0075365_10070319 | |||
| 936 | Ga0075365_10143044 | |||
| 937 | Ga0075363_100010846 | |||
| 938 | Ga0075364_10079127 | |||
| 939 | Ga0070716_100009470 | |||
| 940 | Ga0075362_10007059 | |||
| 941 | Ga0075362_10030954 | |||
| 942 | Ga0075369_10042662 | |||
| 943 | Ga0075366_10001983 | |||
| 944 | Ga0075366_10012005 | |||
| 945 | Ga0097621_100001880 | |||
| 946 | Ga0097621_100061406 | |||
| 947 | Ga0097621_100117798 | |||
| 948 | Ga0075370_10021532 | |||
| 949 | Ga0068871_100002226 | |||
| 950 | Ga0068871_100040497 | |||
| 951 | Ga0075428_100000130 | |||
| 952 | Ga0075430_100009841 | |||
| 953 | Ga0075433_10067380 | |||
| 954 | Ga0075429_100000541 | |||
| 955 | Ga0075429_100003178 | |||
| 956 | Ga0068865_100037005 | |||
| 957 | Ga0068865_100152279 | |||
| 958 | Ga0068865_100217357 | |||
| 959 | Ga0075436_100097370 | |||
| 960 | Ga0075436_100102475 | |||
| 961 | Ga0097620_100004027 | |||
| 962 | Ga0097620_100068114 | |||
| 963 | Ga0097620_100381709 | |||
| 964 | Ga0097620_100558827 | |||
| 965 | Ga0099826_10000087 | |||
| 966 | Ga0099826_10073699 | |||
| 967 | Ga0075435_100002374 | |||
| 968 | Ga0075435_100118338 | |||
| 969 | Ga0099794_10097702 | |||
| 970 | Ga0111539_10000801 | |||
| 971 | Ga0111539_10016103 | |||
| 972 | Ga0111539_10017872 | |||
| 973 | Ga0111539_10023989 | |||
| 974 | Ga0105245_10075153 | |||
| 975 | Ga0105245_10083242 | |||
| 976 | Ga0114129_10000604 | |||
| 977 | Ga0105243_10002623 | |||
| 978 | Ga0105243_10068322 | |||
| 979 | Ga0105243_10080527 | |||
| 980 | Ga0105243_10222758 | |||
| 981 | Ga0105241_10351492 | |||
| 982 | Ga0105242_10002310 | |||
| 983 | Ga0105242_10021682 | |||
| 984 | Ga0105242_10064669 | |||
| 985 | Ga0105248_10051302 | |||
| 986 | Ga0105248_10128074 | |||
| 987 | Ga0105237_10060033 | |||
| 988 | Ga0105238_10293509 | |||
| 989 | Ga0105249_10017865 | |||
| 990 | Ga0105249_10139785 | |||
| 991 | Ga0105249_10166771 | |||
| 992 | Ga0105249_10248077 | |||
| 993 | Ga0099796_10066554 | |||
| 994 | Ga0105239_10066299 | |||
| 995 | Ga0105246_10158720 | |||
| 996 | Ga0157327_1000947 | |||
| 997 | Ga0157326_1000451 | |||
| 998 | Ga0157370_10003845 | |||
| 999 | Ga0157369_10166440 | |||
| 1000 | Ga0157374_10037741 | |||
| 1001 | Ga0157374_10100494 | |||
| 1002 | Ga0157378_10022765 | |||
| 1003 | Ga0157378_10076992 | |||
| 1004 | Ga0163162_10005074 | |||
| 1005 | Ga0163162_10106194 | |||
| 1006 | Ga0163162_10222435 | |||
| 1007 | Ga0163162_10538660 | |||
| 1008 | Ga0157375_10024303 | |||
| 1009 | Ga0157375_10125411 | |||
| 1010 | Ga0163163_10016809 | |||
| 1011 | Ga0163163_10078290 | |||
| 1012 | Ga0157380_10019496 | |||
| 1013 | Ga0157380_10019525 | |||
| 1014 | Ga0157380_10067279 | |||
| 1015 | Ga0157377_10012265 | |||
| 1016 | Ga0157377_10080764 | |||
| 1017 | Ga0157377_10090220 | |||
| 1018 | Ga0157379_10052219 | |||
| 1019 | Ga0157379_10076187 | |||
| 1020 | Ga0157376_10103751 | |||
| 1021 | Ga0157376_10163317 | |||
| 1022 | Ga0182005_1028784 | |||
| 1023 | Ga0182005_1036246 | |||
| 1024 | Ga0163161_10000329 | |||
| 1025 | Ga0163161_10013701 | |||
| 1026 | Ga0163161_10053805 | |||
| 1027 | Ga0163161_10098799 | |||
| 1028 | Ga0163161_10129110 | |||
| 1029 | Ga0163161_10212954 | |||
| 1030 | Ga0213876_10027453 | |||
| 1031 | Ga0209435_100003 | |||
| 1032 | Ga0209436_105046 | |||
| 1033 | Ga0207425_1007648 | |||
| 1034 | Ga0209646_1000008 | |||
| 1035 | Ga0209026_1000007 | |||
| 1036 | Ga0209759_1000026 | |||
| 1037 | Ga0209129_1007409 | |||
| 1038 | Ga0209129_1020623 | |||
| 1039 | Ga0209565_1000026 | |||
| 1040 | Ga0209565_1000150 | |||
| 1041 | Ga0209565_1001312 | |||
| 1042 | Ga0207666_1001766 | |||
| 1043 | Ga0207666_1005525 | |||
| 1044 | Ga0209673_1000009 | |||
| 1045 | Ga0209673_1000012 | |||
| 1046 | Ga0209673_1000114 | |||
| 1047 | Ga0209673_1008634 | |||
| 1048 | Ga0209130_1000099 | |||
| 1049 | Ga0209130_1000123 | |||
| 1050 | Ga0209130_1006153 | |||
| 1051 | Ga0209675_1000062 | |||
| 1052 | Ga0209675_1000155 | |||
| 1053 | Ga0209675_1004791 | |||
| 1054 | Ga0209675_1005864 | |||
| 1055 | Ga0209676_1000051 | |||
| 1056 | Ga0209676_1000325 | |||
| 1057 | Ga0209676_1008862 | |||
| 1058 | Ga0209676_1009460 | |||
| 1059 | Ga0209676_1026578 | |||
| 1060 | Ga0209025_1000521 | |||
| 1061 | Ga0209025_1004061 | |||
| 1062 | Ga0209025_1007738 | |||
| 1063 | Ga0209025_1009286 | |||
| 1064 | Ga0209564_1000211 | |||
| 1065 | Ga0209564_1000228 | |||
| 1066 | Ga0209564_1004815 | |||
| 1067 | Ga0209758_1054147 | |||
| 1068 | Ga0209050_1000044 | |||
| 1069 | Ga0209050_1003950 | |||
| 1070 | Ga0209050_1010312 | |||
| 1071 | Ga0209256_1000003 | |||
| 1072 | Ga0207426_1000062 | |||
| 1073 | Ga0207426_1003919 | |||
| 1074 | Ga0209051_1000031 | |||
| 1075 | Ga0209051_1000208 | |||
| 1076 | Ga0209051_1000760 | |||
| 1077 | Ga0209051_1042140 | |||
| 1078 | Ga0209257_1000058 | |||
| 1079 | Ga0209257_1008393 | |||
| 1080 | Ga0209257_1014090 | |||
| 1081 | Ga0207697_10009556 | |||
| 1082 | Ga0207697_10032926 | |||
| 1083 | Ga0207697_10065936 | |||
| 1084 | Ga0207682_10001921 | |||
| 1085 | Ga0207682_10009146 | |||
| 1086 | Ga0207682_10038424 | |||
| 1087 | Ga0207682_10057923 | |||
| 1088 | Ga0207642_10015639 | |||
| 1089 | Ga0207688_10004631 | |||
| 1090 | Ga0207688_10033243 | |||
| 1091 | Ga0207699_10067868 | |||
| 1092 | Ga0207645_10003092 | |||
| 1093 | Ga0207645_10007091 | |||
| 1094 | Ga0207645_10027206 | |||
| 1095 | Ga0207645_10115523 | |||
| 1096 | Ga0207643_10003923 | |||
| 1097 | Ga0207643_10054228 | |||
| 1098 | Ga0207707_10044809 | |||
| 1099 | Ga0207707_10104139 | |||
| 1100 | Ga0207671_10162669 | |||
| 1101 | Ga0207660_10007738 | |||
| 1102 | Ga0207660_10131999 | |||
| 1103 | Ga0207662_10003730 | |||
| 1104 | Ga0207662_10076536 | |||
| 1105 | Ga0207657_10049797 | |||
| 1106 | Ga0207652_10005260 | |||
| 1107 | Ga0207652_10282909 | |||
| 1108 | Ga0207681_10007401 | |||
| 1109 | Ga0207681_10018416 | |||
| 1110 | Ga0207681_10074401 | |||
| 1111 | Ga0207681_10081248 | |||
| 1112 | Ga0207681_10124240 | |||
| 1113 | Ga0207681_10215106 | |||
| 1114 | Ga0207694_10076303 | |||
| 1115 | Ga0207650_10023527 | |||
| 1116 | Ga0207650_10069686 | |||
| 1117 | Ga0207659_10007169 | |||
| 1118 | Ga0207659_10020490 | |||
| 1119 | Ga0207659_10058986 | |||
| 1120 | Ga0207659_10059908 | |||
| 1121 | Ga0207659_10138499 | |||
| 1122 | Ga0207659_10356728 | |||
| 1123 | Ga0207659_10492099 | |||
| 1124 | Ga0207687_10049293 | |||
| 1125 | Ga0207687_10322388 | |||
| 1126 | Ga0207644_10000068 | |||
| 1127 | Ga0207644_10015661 | |||
| 1128 | Ga0207644_10051778 | |||
| 1129 | Ga0207690_10095883 | |||
| 1130 | Ga0207706_10052263 | |||
| 1131 | Ga0207706_10152950 | |||
| 1132 | Ga0207686_10028134 | |||
| 1133 | Ga0207686_10031426 | |||
| 1134 | Ga0207709_10002195 | |||
| 1135 | Ga0207709_10021397 | |||
| 1136 | Ga0207709_10186987 | |||
| 1137 | Ga0207709_10338157 | |||
| 1138 | Ga0207670_10099193 | |||
| 1139 | Ga0207669_10017506 | |||
| 1140 | Ga0207669_10026733 | |||
| 1141 | Ga0207669_10067712 | |||
| 1142 | Ga0207704_10002833 | |||
| 1143 | Ga0207704_10058905 | |||
| 1144 | Ga0207704_10186226 | |||
| 1145 | Ga0207665_10019966 | |||
| 1146 | Ga0207665_10062982 | |||
| 1147 | Ga0207691_10017865 | |||
| 1148 | Ga0207691_10038713 | |||
| 1149 | Ga0207691_10076011 | |||
| 1150 | Ga0207691_10096530 | |||
| 1151 | Ga0207691_10135806 | |||
| 1152 | Ga0207691_10140623 | |||
| 1153 | Ga0207691_10168616 | |||
| 1154 | Ga0207711_10019765 | |||
| 1155 | Ga0207711_10054755 | |||
| 1156 | Ga0207689_10001957 | |||
| 1157 | Ga0207689_10003617 | |||
| 1158 | Ga0207689_10028597 | |||
| 1159 | Ga0207689_10057292 | |||
| 1160 | Ga0207689_10093231 | |||
| 1161 | Ga0207651_10183129 | |||
| 1162 | Ga0207651_10425300 | |||
| 1163 | Ga0207712_10085529 | |||
| 1164 | Ga0207712_10291971 | |||
| 1165 | Ga0207668_10050743 | |||
| 1166 | Ga0207668_10159663 | |||
| 1167 | Ga0207640_10167449 | |||
| 1168 | Ga0207640_10314162 | |||
| 1169 | Ga0207640_10359120 | |||
| 1170 | Ga0207658_10040984 | |||
| 1171 | Ga0207677_10003663 | |||
| 1172 | Ga0207677_10010533 | |||
| 1173 | Ga0207703_10007902 | |||
| 1174 | Ga0207703_10021291 | |||
| 1175 | Ga0207703_10340960 | |||
| 1176 | Ga0207639_10169145 | |||
| 1177 | Ga0207708_10003042 | |||
| 1178 | Ga0207708_10174301 | |||
| 1179 | Ga0207702_10121901 | |||
| 1180 | Ga0207641_10005089 | |||
| 1181 | Ga0207641_10012091 | |||
| 1182 | Ga0207641_10021771 | |||
| 1183 | Ga0207641_10045647 | |||
| 1184 | Ga0207641_10097342 | |||
| 1185 | Ga0207641_10202929 | |||
| 1186 | Ga0207648_10003800 | |||
| 1187 | Ga0207648_10005299 | |||
| 1188 | Ga0207648_10031498 | |||
| 1189 | Ga0207648_10120272 | |||
| 1190 | Ga0207648_10135611 | |||
| 1191 | Ga0207648_10230632 | |||
| 1192 | Ga0207648_10256610 | |||
| 1193 | Ga0207676_10005921 | |||
| 1194 | Ga0207676_10037212 | |||
| 1195 | Ga0207676_10067533 | |||
| 1196 | Ga0207674_10188848 | |||
| 1197 | Ga0207675_100002241 | |||
| 1198 | Ga0207675_100003993 | |||
| 1199 | Ga0207675_100004245 | |||
| 1200 | Ga0207675_100004891 | |||
| 1201 | Ga0207675_100313582 | |||
| 1202 | Ga0207683_10006887 | |||
| 1203 | Ga0207683_10009318 | |||
| 1204 | Ga0207683_10037761 | |||
| 1205 | Ga0207683_10051292 | |||
| 1206 | Ga0207683_10066018 | |||
| 1207 | Ga0207683_10082714 | |||
| 1208 | Ga0207683_10135215 | |||
| 1209 | Ga0207683_10145642 | |||
| 1210 | Ga0207683_10177550 | |||
| 1211 | Ga0207698_10136339 | |||
| 1212 | Ga0209282_1000307 | |||
| 1213 | Ga0209813_10018671 | |||
| 1214 | Ga0207428_10001393 | |||
| 1215 | Ga0207428_10214401 | |||
| 1216 | Ga0207428_10297530 | |||
| 1217 | Ga0268266_10028790 | |||
| 1218 | Ga0268266_10078383 | |||
| 1219 | Ga0268266_10084949 | |||
| 1220 | Ga0268266_10173298 | |||
| 1221 | Ga0268266_10260665 | |||
| 1222 | Ga0268265_10050607 | |||
| 1223 | Ga0268265_10093826 | |||
| 1224 | Ga0268265_10311769 | |||
| 1225 | Ga0268265_10315396 | |||
| 1226 | Ga0268264_10004057 | |||
| 1227 | Ga0268264_10011781 | |||
| 1228 | Ga0268264_10015030 | |||
| 1229 | Ga0307515_10000064 | |||
| 1230 | Ga0307515_10131206 | |||
| 1231 | Ga0314311_1070027 | |||
| 1232 | Ga0316178_1126380 | |||
| 1233 | Ga0316183_1110495 | |||
| 1234 | Ga0307513_10000090 | |||
| 1235 | Ga0307513_10152164 | |||
| 1236 | Ga0307513_10282106 | |||
| 1237 | Ga0307408_100005621 | |||
| 1238 | Ga0307514_10011166 | |||
| 1239 | Ga0316576_10022958 | |||
| 1240 | Ga0307516_10003513 | |||
| 1241 | Ga0307516_10289807 | |||
| 1242 | Ga0307405_10005918 | |||
| 1243 | Ga0307405_10037668 | |||
| 1244 | Ga0307405_10156098 | |||
| 1245 | Ga0307405_10172422 | |||
| 1246 | Ga0307405_10312652 | |||
| 1247 | Ga0307406_10006495 | |||
| 1248 | Ga0307406_10018017 | |||
| 1249 | Ga0307406_10056965 | |||
| 1250 | Ga0307406_10237084 | |||
| 1251 | Ga0307407_10039408 | |||
| 1252 | Ga0307407_10044743 | |||
| 1253 | Ga0307407_10125171 | |||
| 1254 | Ga0307412_10002222 | |||
| 1255 | Ga0307412_10046332 | |||
| 1256 | Ga0307412_10071053 | |||
| 1257 | Ga0307412_10139943 | |||
| 1258 | Ga0307412_10206202 | |||
| 1259 | Ga0307409_100000592 | |||
| 1260 | Ga0307416_100006736 | |||
| 1261 | Ga0307416_100030125 | |||
| 1262 | Ga0307416_100214103 | |||
| 1263 | Ga0307416_100377465 | |||
| 1264 | Ga0307414_10011967 | |||
| 1265 | Ga0307414_10146811 | |||
| 1266 | Ga0307415_100002275 | |||
| 1267 | Ga0373948_0008637 | |||
| 1268 | Ga0373958_0011585 | |||
| 1269 | Ga0373938_0002172 | |||
| 1270 | Ga0373926_0056296 | |||
| 1271 | Ga0373934_0003128 | |||
| 1272 | Ga0373940_0002793 | |||
| 1273 | Ga0373949_0005821 | |||
| 1274 | Ga0373932_0000899 | |||
| 1275 | Ga0373936_0042274 | |||
| 1276 | Ga0373939_0031116 | |||
| 1277 | Ga0373941_0001232 | |||
| 1278 | Ga0373954_0001879 | |||
| 1279 | Ga0373954_0010855 | |||
| 1280 | Ga0373954_0075111 | |||
| 1281 | Ga0373956_0004750 | |||
| 1282 | Ga0373943_0021729 | |||
| 1283 | Ga0373955_0014117 | |||
| 1284 | Ga0373942_0004480 | |||
| 1285 | Ga0373924_0072241 | |||
| 1286 | Ga0373931_0000240 | |||
| 1287 | Ga0373931_0045475 | |||
| 1288 | Ga0373935_0005687 | |||
| 1289 | Ga0373935_0214442 | |||
| 1290 | Ga0373927_0015781 | |||
| 1291 | Ga0373927_0094091 | |||
| 1292 | Ga0373937_0051422 | |||
| 1293 | Ga0373937_0055969 | |||
| 1294 | Ga0373937_0218702 | |||
| 1295 | Ga0373937_0328257 | |||
| 1296 | Ga0373925_0005088 | |||
| 1297 | Ga0373925_0006421 | |||
| 1298 | Ga0373925_0077080 | |||
| 1299 | Ga0373925_0232377 | |||
| 1300 | Ga0395899_0003326 | |||
| 1301 | Ga0395900_0145283 | |||
| 1302 | Ga0395900_0409358 | |||
| 1303 | Ga0395898_0007717 | |||
| 1304 | Ga0395905_0000027 | |||
| 1305 | Ga0395905_0000492 | |||
| 1306 | Ga0395905_0005285 | |||
| 1307 | Ga0395905_0024428 | |||
| 1308 | Ga0395901_0060974 | |||
| 1309 | Ga0395901_0325747 | |||
| 1310 | Ga0436365_0797101 | |||
| 1311 | Ga0439436_0032296 | |||
| 1312 | Ga0439436_0040343 | |||
| 1313 | Ga0439447_031399 | |||
| 1314 | Ga0439466_0008218 | |||
| 1315 | Ga0451845_0923310 | |||
| 1316 | Ga0451853_2803178 | |||
| 1317 | Ga0451853_2861878 | |||
| 1318 | Ga0439445_0001503 | |||
| 1319 | Ga0439445_0017625 | |||
| 1320 | Ga0439432_000751 | |||
| 1321 | Ga0439432_028932 | |||
| 1322 | Ga0439449_0002753 | |||
| 1323 | Ga0439450_002769 | |||
| 1324 | Ga0439452_020482 | |||
| 1325 | Ga0439462_0013144 | |||
| 1326 | Ga0450911_000714 | |||
| 1327 | Ga0450906_009514 | |||
| 1328 | Ga0439446_0025803 | |||
| 1329 | Ga0450908_023022 | |||
| 1330 | Ga0439434_0000521 | |||
| 1331 | Ga0439434_0032229 | |||
| 1332 | Ga0439464_0009427 | |||
| 1333 | Ga0450918_007268 | |||
| 1334 | Ga0451577_0034708 | |||
| 1335 | Ga0451577_0077656 | |||
| 1336 | Ga0466960_0034266 | |||
| 1337 | Ga0451576_0045169 | |||
| 1338 | Ga0451576_0046886 | |||
| 1339 | Ga0451576_0126883 | |||
| 1340 | Ga0495592_0018276 | |||
| 1341 | Ga0495592_0038629 | |||
| 1342 | Ga0495592_0241699 | |||
| 1343 | Ga0495651_0004864 | |||
| 1344 | Ga0495653_0016586 | |||
| 1345 | Ga0495580_0030828 | |||
| 1346 | Ga0495639_0001883 | |||
| 1347 | Ga0495662_0032003 | |||
| 1348 | Ga0495664_0028228 | |||
| 1349 | Ga0495608_0017319 | |||
| 1350 | Ga0495608_0052053 | |||
| 1351 | Ga0495628_0000826 | |||
| 1352 | Ga0495663_0023705 | |||
| 1353 | Ga0495642_0088778 | |||
| 1354 | Ga0495652_0005167 | |||
| 1355 | Ga0495652_0029175 | |||
| 1356 | Ga0495654_0003475 | |||
| 1357 | Ga0495665_0001363 | |||
| 1358 | Ga0495640_0009540 | |||
| 1359 | Ga0495586_0012113 | |||
| 1360 | Ga0495587_0014208 | |||
| 1361 | Ga0495598_0020186 | |||
| 1362 | Ga0495621_0010048 | |||
| 1363 | Ga0495645_0000419 | |||
| 1364 | Ga0495645_0139853 | |||
| 1365 | Ga0495633_0184763 | |||
| 1366 | Ga0495667_0022002 | |||
| 1367 | Ga0495667_0214338 | |||
| 1368 | Ga0495656_0002368 | |||
| 1369 | Ga0495634_0007734 | |||
| 1370 | Ga0495657_0012040 | |||
| 1371 | Ga0495657_0206380 | |||
| 1372 | Ga0495599_0000476 | |||
| 1373 | Ga0495599_0006605 | |||
| 1374 | Ga0495647_0018668 | |||
| 1375 | Ga0495658_0063549 | |||
| 1376 | Ga0495669_0032817 | |||
| 1377 | Ga0495669_0104579 | |||
| 1378 | Ga0495613_0078278 | |||
| 1379 | Ga0495581_0155442 | |||
| 1380 | Ga0495604_0019442 | |||
| 1381 | Ga0495636_0003473 | |||
| 1382 | Ga0495674_0009625 | |||
| 1383 | Ga0495680_0008579 | |||
| 1384 | Ga0495675_0001332 | |||
| 1385 | Ga0495681_0101270 | |||
| 1386 | Ga0495684_0008994 | |||
| 1387 | Ga0496100_0190733 | |||
| 1388 | Ga0496101_0004340 | |||
| 1389 | Ga0496101_0251577 | |||
| 1390 | Ga0496102_0043995 | |||
| 1391 | Ga0496103_0042834 | |||
| 1392 | Ga0496103_0065059 | |||
| 1393 | Ga0496103_0228185 | |||
| 1394 | Ga0496104_0075420 | |||
| 1395 | Ga0496104_0135850 | |||
| 1396 | Ga0496104_0358800 | |||
| 1397 | Ga0496105_0013954 | |||
| 1398 | Ga0496106_0113688 | |||
| 1399 | Ga0496108_0188870 | |||
| 1400 | Ga0496109_0033593 | |||
| 1401 | Ga0496109_0192357 | |||
| 1402 | Ga0496110_0070534 | |||
| 1403 | Ga0496110_0178144 | |||
| 1404 | Ga0496110_0241034 | |||
| 1405 | Ga0496111_0112321 | |||
| 1406 | Ga0496111_0134709 | |||
| 1407 | Ga0496112_0104512 | |||
| 1408 | Ga0496113_0373480 | |||
| 1409 | Ga0496121_0004542 | |||
| 1410 | Ga0496122_0000184 | |||
| 1411 | Ga0496123_0000181 | |||
| 1412 | Ga0496124_0033333 | |||
| 1413 | Ga0496125_0007111 | |||
| 1414 | Ga0496125_0007919 | |||
| 1415 | Ga0496125_0033645 | |||
| 1416 | Ga0501262_000209 | |||
| 1417 | nmdc:mga03683_26926_c1 | |||
| 1418 | nmdc:mga03683_7048_c1 | |||
| 1419 | nmdc:mga03n38_58743_c1 | |||
| 1420 | nmdc:mga0yw44_135850_c1 | |||
| 1421 | nmdc:mga0yw44_66710_c1 | |||
| 1422 | nmdc:mga0k408_29966_c1 | |||
| 1423 | nmdc:mga0k408_34317_c1 | |||
| 1424 | nmdc:mga0k408_70727_c1 | |||
| 1425 | nmdc:mga06z11_5003_c1 | |||
| 1426 | nmdc:mga07m45_36834_c1 | |||
| 1427 | nmdc:mga07m45_43661_c1 | |||
| 1428 | nmdc:mga07m45_60069_c2 | |||
| 1429 | nmdc:mga07m45_67103_c1 | |||
| 1430 | nmdc:mga05p37_2731_c1 | |||
| 1431 | nmdc:mga09592_1651_c1 | |||
| 1432 | nmdc:mga09592_34056_c1 | |||
| 1433 | nmdc:mga09592_7768_c1 | |||
| 1434 | nmdc:mga0qj67_8225_c2 | |||
| 1435 | nmdc:mga08y16_2538_c1 | |||
| 1436 | nmdc:mga08y16_260843_c1 | |||
| 1437 | nmdc:mga08y16_328861_c1 | |||
| 1438 | nmdc:mga08y16_49249_c1 | |||
| 1439 | nmdc:mga0rr50_4644_c1 | |||
| 1440 | nmdc:mga0rr50_95867_c1 | |||
| 1441 | nmdc:mga08x19_4918_c1 | |||
| 1442 | nmdc:mga0a205_26501_c1 | |||
| 1443 | nmdc:mga0sz30_23984_c1 | |||
| 1444 | Ga0495601_0009086 | |||
| 1445 | Ga0495601_0017699 | |||
| 1446 | Ga0495601_0107988 | |||
| 1447 | Ga0495595_0005077 | |||
| 1448 | Ga0495619_0022417 | |||
| 1449 | Ga0500644_0001138 | |||
| 1450 | Ga0500651_0005197 | |||
| 1451 | Ga0500556_0114877 | |||
| 1452 | Ga0500593_002149 | |||
| 1453 | Ga0500594_0009084 | |||
| 1454 | Ga0500573_0063734 | |||
| 1455 | Ga0500616_0034346 | |||
| 1456 | Ga0500634_0036397 | |||
| 1457 | Ga0500645_000061 | |||
| 1458 | Ga0500661_000809 | |||
| 1459 | 2508733986 | |||
| 1460 | 2509140513 | |||
| 1461 | 2511243466 | |||
| 1462 | 2548497884 | |||
| 1463 | 2597813952 | |||
| 1464 | 2644466121 | |||
| 1465 | 2644649509 | |||
| 1466 | 2739251827 | |||
| 1467 | 2842681152 | |||
| 1468 | 2842737420 | |||
| 1469 | 2842749839 | |||
| 1470 | 2856344096 | |||
| 1471 | 2869167984 | |||
| 1472 | 2882639023 | |||
| 1473 | 2885196590 | |||
| 1474 | 2885317245 | |||
| 1475 | 2888347608 | |||
| 1476 | 2904454126 | |||
| 1477 | 2904462017 | |||
| 1478 | 2904545948 | |||
| 1479 | 2919465273 | |||
| 1480 | 2919707392 | |||
| 1481 | 2924761117 | |||
| 1482 | 2929161143 | |||
| 1483 | 2929521857 | |||
| 1484 | 2945914375 | |||
| 1485 | 2945949906 | |||
| 1486 | 2945973925 | |||
| 1487 | 2945990230 | |||
| 1488 | 2954770487 | |||
| 1489 | 2970530315 | |||
| 1490 | 2970542389 | |||
| 1491 | 8004401782 | |||
| 1492 | 8045867992 | |||
| 1493 | 8054568162 | |||
| 1494 | 8055621665 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pdd-assembly3.cif.gz_C | crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d-erythronate | 0.9397 | 33 | 334 |
| 4nq8-assembly2.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate | 0.9339 | 33 | 334 |
| 4xeq-assembly4.cif.gz_D | crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid | 0.9331 | 35 | 333 |
| 4p9k-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d-erythronate with residual density suggestive of superposition with copurified alternative ligand. | 0.932 | 32 | 334 |
| 4pdh-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d-erythronate | 0.9316 | 33 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nq8A00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9339 | 34 | 334 | 3.40.190.170 |
| 4nq8A00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9279 | 34 | 334 | 3.40.190.170 |
| 4xeqD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9257 | 35 | 334 | 3.40.190.170 |
| 4xeqD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9197 | 35 | 334 | 3.40.190.170 |
| 4nf0G00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9168 | 34 | 315 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3MNW1-F1-model_v4 | deleted | 0.9827 | 173 | 334 |
|
| AF-A0A4Q3MNW1-F1-model_v4 | deleted | 0.9708 | 173 | 334 |
|
| AF-A0A3D5VSW4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9675 | 23 | 334 |
GO:0030288
GO:0055085 |
| AF-A0A3P3EGW7-F1-model_v4 | DctP family TRAP transporter solute-binding subunit | 0.9661 | 70 | 334 |
GO:0030288
GO:0055085 |
| AF-A0A3P3EGW7-F1-model_v4 | DctP family TRAP transporter solute-binding subunit | 0.9625 | 70 | 334 |
GO:0030288
GO:0055085 |