F478928
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 747 | 317 | 1494 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300048091|Ga0495626_0016704|Ga0495626_0016704_36_788 |
| Length | 250 |
| Sequence | MSTSGRIIARTRSASRAVTARPIRSATLQLDSIHLNTTALWLTVLALGVYHGINPAMGWPLAVANGMAQQRASSVFAALLPLGAGHFMAIAVALAPFAWLGWYVEWSPAIRIGAGTLVLLFGAFRLVHRRHPRLLARIPPTRLAWWSFLMASAHGAGLMLVPFMLGLCVAPAQATGQAAVMSSVARANLGTAVLVAALHALAGLLAGIGMAWIVYRYLGLAFLRRAWLNLDALWGASLVLAGAAGIALGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 127 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 149 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 150 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 151 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 154 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 155 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 156 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 157 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 158 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 159 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 160 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 161 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 162 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 163 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 164 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 307 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 308 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 309 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 310 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 311 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 312 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 313 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 314 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 315 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 316 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 317 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 0 |
| Isolates | 1.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.47 |
| Nodule | 0.4 |
| Rhizoplane | 3.75 |
| Rhizosphere | 91.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495626_0016704 | 3300048091 | Bacteria | 3722 |
| 2 | SwRhRL2b_contig_3689071 | 2162886007 | Bacteria | 1503 |
| 3 | SwRhRL2b_contig_691832 | 2162886007 | Bacteria | 1501 |
| 4 | rootH1_10020786 | 3300003316 | Bacteria | 1770 |
| 5 | JGI25407J50210_10038483 | 3300003373 | Bacteria | 1227 |
| 6 | Ga0065165_1003233 | 3300005262 | Bacteria | 11817 |
| 7 | Ga0065704_10072564 | 3300005289 | Bacteria | 8297 |
| 8 | Ga0065707_10001106 | 3300005295 | Bacteria | 7972 |
| 9 | Ga0065707_10235855 | 3300005295 | Bacteria | 1172 |
| 10 | Ga0070676_10042370 | 3300005328 | Bacteria | 2643 |
| 11 | Ga0070666_10390781 | 3300005335 | Bacteria | 999 |
| 12 | Ga0070680_100221825 | 3300005336 | Bacteria | 1596 |
| 13 | Ga0070682_100259865 | 3300005337 | Bacteria | 1256 |
| 14 | Ga0070660_100027134 | 3300005339 | Bacteria | 4271 |
| 15 | Ga0070660_100511660 | 3300005339 | Bacteria | 999 |
| 16 | Ga0070689_100373387 | 3300005340 | Bacteria | 1200 |
| 17 | Ga0070661_100016223 | 3300005344 | Bacteria | 5262 |
| 18 | Ga0070692_10239362 | 3300005345 | Bacteria | 1081 |
| 19 | Ga0070692_10400158 | 3300005345 | Bacteria | 867 |
| 20 | Ga0070669_100391611 | 3300005353 | Bacteria | 1135 |
| 21 | Ga0070671_100098487 | 3300005355 | Bacteria | 2453 |
| 22 | Ga0070674_100015594 | 3300005356 | Bacteria | 4747 |
| 23 | Ga0070659_100042468 | 3300005366 | Bacteria | 3554 |
| 24 | Ga0070659_100197976 | 3300005366 | Bacteria | 1653 |
| 25 | Ga0070659_100203133 | 3300005366 | Bacteria | 1632 |
| 26 | Ga0070667_100115549 | 3300005367 | Bacteria | 2331 |
| 27 | Ga0070667_100324783 | 3300005367 | Bacteria | 1389 |
| 28 | Ga0070667_100583602 | 3300005367 | Bacteria | 1029 |
| 29 | Ga0070709_10016056 | 3300005434 | Bacteria | 4267 |
| 30 | Ga0070713_100073288 | 3300005436 | Bacteria | 2898 |
| 31 | Ga0070710_10147832 | 3300005437 | Bacteria | 1447 |
| 32 | Ga0070711_100071093 | 3300005439 | Bacteria | 2451 |
| 33 | Ga0070711_100127036 | 3300005439 | Bacteria | 1894 |
| 34 | Ga0070700_100046936 | 3300005441 | Bacteria | 2671 |
| 35 | Ga0070678_100079379 | 3300005456 | Bacteria | 2482 |
| 36 | Ga0070662_100077805 | 3300005457 | Bacteria | 2462 |
| 37 | Ga0070681_10206676 | 3300005458 | Bacteria | 1880 |
| 38 | Ga0070681_10410566 | 3300005458 | Bacteria | 1266 |
| 39 | Ga0068867_100025071 | 3300005459 | Bacteria | 4277 |
| 40 | Ga0070699_100060930 | 3300005518 | Bacteria | 3270 |
| 41 | Ga0070679_100050370 | 3300005530 | Bacteria | 4148 |
| 42 | Ga0070679_100134593 | 3300005530 | Bacteria | 2452 |
| 43 | Ga0070684_100740081 | 3300005535 | Bacteria | 918 |
| 44 | Ga0068853_100466409 | 3300005539 | Bacteria | 1189 |
| 45 | Ga0068853_100560846 | 3300005539 | Bacteria | 1082 |
| 46 | Ga0068853_101054847 | 3300005539 | Bacteria | 783 |
| 47 | Ga0070672_100168923 | 3300005543 | Bacteria | 1818 |
| 48 | Ga0070696_100001766 | 3300005546 | Bacteria | 14180 |
| 49 | Ga0070665_100236364 | 3300005548 | Bacteria | 1828 |
| 50 | Ga0070665_100779908 | 3300005548 | Bacteria | 969 |
| 51 | Ga0068855_100016751 | 3300005563 | Bacteria | 8814 |
| 52 | Ga0068855_100029035 | 3300005563 | Bacteria | 6614 |
| 53 | Ga0068855_100111433 | 3300005563 | Bacteria | 3141 |
| 54 | Ga0068855_100124032 | 3300005563 | Bacteria | 2955 |
| 55 | Ga0070664_100075582 | 3300005564 | Bacteria | 2893 |
| 56 | Ga0070664_100506666 | 3300005564 | Bacteria | 1113 |
| 57 | Ga0068857_100095316 | 3300005577 | Bacteria | 2666 |
| 58 | Ga0068857_100282044 | 3300005577 | Unclassified | 1528 |
| 59 | Ga0068856_100298325 | 3300005614 | Bacteria | 1629 |
| 60 | Ga0070702_100006377 | 3300005615 | Bacteria | 5581 |
| 61 | Ga0068852_100552211 | 3300005616 | Bacteria | 1152 |
| 62 | Ga0068852_100848199 | 3300005616 | Bacteria | 929 |
| 63 | Ga0068852_101308337 | 3300005616 | Bacteria | 746 |
| 64 | Ga0068859_100782907 | 3300005617 | Bacteria | 1042 |
| 65 | Ga0068866_10045161 | 3300005718 | Bacteria | 2208 |
| 66 | Ga0068861_100003803 | 3300005719 | Bacteria | 10080 |
| 67 | Ga0068861_100290932 | 3300005719 | Bacteria | 1410 |
| 68 | Ga0068851_10270520 | 3300005834 | Bacteria | 969 |
| 69 | Ga0068858_100061634 | 3300005842 | Bacteria | 3468 |
| 70 | Ga0068858_100541926 | 3300005842 | Bacteria | 1126 |
| 71 | Ga0068860_100029669 | 3300005843 | Bacteria | 5262 |
| 72 | Ga0068862_100073210 | 3300005844 | Bacteria | 2961 |
| 73 | Ga0081538_10022702 | 3300005981 | Bacteria | 4538 |
| 74 | Ga0081538_10113438 | 3300005981 | Bacteria | 1324 |
| 75 | Ga0070712_100402387 | 3300006175 | Bacteria | 1131 |
| 76 | Ga0075366_10059712 | 3300006195 | Bacteria | 2265 |
| 77 | Ga0075370_10005241 | 3300006353 | Bacteria | 6415 |
| 78 | Ga0075370_10074427 | 3300006353 | Bacteria | 1946 |
| 79 | Ga0075370_10120390 | 3300006353 | Bacteria | 1528 |
| 80 | Ga0075428_100193339 | 3300006844 | Bacteria | 2200 |
| 81 | Ga0075428_101083391 | 3300006844 | Bacteria | 846 |
| 82 | Ga0075430_100299204 | 3300006846 | Bacteria | 1331 |
| 83 | Ga0075430_100459513 | 3300006846 | Bacteria | 1051 |
| 84 | Ga0075430_100969239 | 3300006846 | Bacteria | 701 |
| 85 | Ga0075429_100007849 | 3300006880 | Bacteria | 9270 |
| 86 | Ga0075429_100011170 | 3300006880 | Bacteria | 7774 |
| 87 | Ga0075429_100016236 | 3300006880 | Bacteria | 6451 |
| 88 | Ga0075429_100047339 | 3300006880 | Bacteria | 3741 |
| 89 | Ga0075429_100048159 | 3300006880 | Bacteria | 3708 |
| 90 | Ga0075429_100489530 | 3300006880 | Bacteria | 1077 |
| 91 | Ga0068865_100599241 | 3300006881 | Bacteria | 931 |
| 92 | Ga0097620_100783007 | 3300006931 | Bacteria | 1042 |
| 93 | Ga0105240_10002099 | 3300009093 | Bacteria | 32606 |
| 94 | Ga0111539_10009836 | 3300009094 | Bacteria | 12067 |
| 95 | Ga0105247_10546685 | 3300009101 | Bacteria | 851 |
| 96 | Ga0114129_10012487 | 3300009147 | Bacteria | 12093 |
| 97 | Ga0114129_10082229 | 3300009147 | Bacteria | 4475 |
| 98 | Ga0114129_10224362 | 3300009147 | Bacteria | 2533 |
| 99 | Ga0114129_10897319 | 3300009147 | Bacteria | 1123 |
| 100 | Ga0105243_10106703 | 3300009148 | Bacteria | 2335 |
| 101 | Ga0105243_10209633 | 3300009148 | Bacteria | 1715 |
| 102 | Ga0105248_11004002 | 3300009177 | Bacteria | 943 |
| 103 | Ga0105237_10220507 | 3300009545 | Bacteria | 1897 |
| 104 | Ga0105237_10336066 | 3300009545 | Bacteria | 1515 |
| 105 | Ga0105238_10021066 | 3300009551 | Bacteria | 6643 |
| 106 | Ga0105238_10035120 | 3300009551 | Bacteria | 5099 |
| 107 | Ga0105238_10241825 | 3300009551 | Bacteria | 1783 |
| 108 | Ga0105238_10300975 | 3300009551 | Bacteria | 1587 |
| 109 | Ga0105238_10974428 | 3300009551 | Bacteria | 868 |
| 110 | Ga0105249_10241916 | 3300009553 | Bacteria | 1785 |
| 111 | Ga0157370_10081352 | 3300013104 | Bacteria | 3048 |
| 112 | Ga0157370_10577580 | 3300013104 | Bacteria | 1030 |
| 113 | Ga0157369_10265515 | 3300013105 | Bacteria | 1789 |
| 114 | Ga0157374_10082454 | 3300013296 | Bacteria | 3053 |
| 115 | Ga0157378_10074989 | 3300013297 | Bacteria | 3045 |
| 116 | Ga0163162_10028413 | 3300013306 | Bacteria | 5534 |
| 117 | Ga0163162_10062499 | 3300013306 | Bacteria | 3764 |
| 118 | Ga0157372_10006140 | 3300013307 | Bacteria | 12763 |
| 119 | Ga0157372_10406165 | 3300013307 | Bacteria | 1587 |
| 120 | Ga0157372_10415440 | 3300013307 | Bacteria | 1568 |
| 121 | Ga0157375_10110095 | 3300013308 | Bacteria | 2851 |
| 122 | Ga0163163_10634836 | 3300014325 | Bacteria | 1131 |
| 123 | Ga0157380_10079549 | 3300014326 | Bacteria | 2677 |
| 124 | Ga0157380_10877486 | 3300014326 | Bacteria | 921 |
| 125 | Ga0182008_10006544 | 3300014497 | Bacteria | 6504 |
| 126 | Ga0182006_1025195 | 3300015261 | Bacteria | 2445 |
| 127 | Ga0182007_10001940 | 3300015262 | Bacteria | 10708 |
| 128 | Ga0213875_10004817 | 3300021388 | Bacteria | 7333 |
| 129 | Ga0209051_1002550 | 3300025303 | Bacteria | 12865 |
| 130 | Ga0209051_1008603 | 3300025303 | Bacteria | 5382 |
| 131 | Ga0207682_10041522 | 3300025893 | Bacteria | 1877 |
| 132 | Ga0207682_10057574 | 3300025893 | Bacteria | 1621 |
| 133 | Ga0207692_10090681 | 3300025898 | Bacteria | 1657 |
| 134 | Ga0207680_10462675 | 3300025903 | Bacteria | 901 |
| 135 | Ga0207707_10101000 | 3300025912 | Bacteria | 2521 |
| 136 | Ga0207695_10254316 | 3300025913 | Bacteria | 1656 |
| 137 | Ga0207693_10251507 | 3300025915 | Bacteria | 1387 |
| 138 | Ga0207663_10046549 | 3300025916 | Bacteria | 2673 |
| 139 | Ga0207660_10174837 | 3300025917 | Bacteria | 1664 |
| 140 | Ga0207662_10504122 | 3300025918 | Bacteria | 834 |
| 141 | Ga0207657_10303264 | 3300025919 | Bacteria | 1265 |
| 142 | Ga0207649_10579062 | 3300025920 | Unclassified | 862 |
| 143 | Ga0207652_10024345 | 3300025921 | Bacteria | 5022 |
| 144 | Ga0207652_10150780 | 3300025921 | Bacteria | 2082 |
| 145 | Ga0207652_10210043 | 3300025921 | Bacteria | 1753 |
| 146 | Ga0207694_10138556 | 3300025924 | Bacteria | 1955 |
| 147 | Ga0207700_10069547 | 3300025928 | Bacteria | 2702 |
| 148 | Ga0207664_10198088 | 3300025929 | Bacteria | 1732 |
| 149 | Ga0207690_10029251 | 3300025932 | Bacteria | 3501 |
| 150 | Ga0207690_10474582 | 3300025932 | Bacteria | 1009 |
| 151 | Ga0207690_10868071 | 3300025932 | Bacteria | 747 |
| 152 | Ga0207706_10176268 | 3300025933 | Bacteria | 1878 |
| 153 | Ga0207669_10277136 | 3300025937 | Bacteria | 1263 |
| 154 | Ga0207704_10034759 | 3300025938 | Bacteria | 2879 |
| 155 | Ga0207691_10170113 | 3300025940 | Bacteria | 1908 |
| 156 | Ga0207679_10425922 | 3300025945 | Bacteria | 1172 |
| 157 | Ga0207667_10193783 | 3300025949 | Bacteria | 2085 |
| 158 | Ga0207667_10212676 | 3300025949 | Bacteria | 1982 |
| 159 | Ga0207667_10247033 | 3300025949 | Bacteria | 1826 |
| 160 | Ga0207667_10463788 | 3300025949 | Bacteria | 1286 |
| 161 | Ga0207712_10055408 | 3300025961 | Bacteria | 2789 |
| 162 | Ga0207668_10428534 | 3300025972 | Bacteria | 1124 |
| 163 | Ga0207640_10796944 | 3300025981 | Bacteria | 818 |
| 164 | Ga0207658_10094643 | 3300025986 | Bacteria | 2325 |
| 165 | Ga0207677_10809171 | 3300026023 | Bacteria | 839 |
| 166 | Ga0207639_10535346 | 3300026041 | Bacteria | 1074 |
| 167 | Ga0207678_10080001 | 3300026067 | Bacteria | 2798 |
| 168 | Ga0207708_10042293 | 3300026075 | Bacteria | 3473 |
| 169 | Ga0207708_10056930 | 3300026075 | Bacteria | 2982 |
| 170 | Ga0207702_10628909 | 3300026078 | Bacteria | 1055 |
| 171 | Ga0207648_10002759 | 3300026089 | Bacteria | 18661 |
| 172 | Ga0207648_10508489 | 3300026089 | Bacteria | 1103 |
| 173 | Ga0207674_10146990 | 3300026116 | Bacteria | 2315 |
| 174 | Ga0207675_100089740 | 3300026118 | Bacteria | 2889 |
| 175 | Ga0207675_100207706 | 3300026118 | Bacteria | 1882 |
| 176 | Ga0207683_10774313 | 3300026121 | Bacteria | 890 |
| 177 | Ga0209974_10001262 | 3300027876 | Bacteria | 9081 |
| 178 | Ga0207428_10014792 | 3300027907 | Bacteria | 6758 |
| 179 | Ga0268266_10107633 | 3300028379 | Bacteria | 2466 |
| 180 | Ga0268266_10312057 | 3300028379 | Bacteria | 1470 |
| 181 | Ga0268265_10071825 | 3300028380 | Bacteria | 2697 |
| 182 | Ga0307517_10079942 | 3300028786 | Bacteria | 2806 |
| 183 | Ga0307515_10000240 | 3300028794 | Bacteria | 135655 |
| 184 | Ga0307515_10035008 | 3300028794 | Bacteria | 8189 |
| 185 | Ga0265327_10157056 | 3300031251 | Bacteria | 1053 |
| 186 | Ga0307513_10124044 | 3300031456 | Bacteria | 2543 |
| 187 | Ga0307408_100122295 | 3300031548 | Bacteria | 2018 |
| 188 | Ga0307508_10146074 | 3300031616 | Bacteria | 1969 |
| 189 | Ga0307516_10000178 | 3300031730 | Bacteria | 81997 |
| 190 | Ga0307405_10126732 | 3300031731 | Bacteria | 1757 |
| 191 | Ga0307405_10536784 | 3300031731 | Bacteria | 944 |
| 192 | Ga0307406_10039460 | 3300031901 | Bacteria | 2930 |
| 193 | Ga0307406_10261272 | 3300031901 | Bacteria | 1310 |
| 194 | Ga0307407_10120013 | 3300031903 | Bacteria | 1665 |
| 195 | Ga0307412_10050187 | 3300031911 | Bacteria | 2753 |
| 196 | Ga0307409_100046083 | 3300031995 | Bacteria | 3298 |
| 197 | Ga0307416_100308248 | 3300032002 | Bacteria | 1578 |
| 198 | Ga0307416_100557767 | 3300032002 | Unclassified | 1220 |
| 199 | Ga0307416_100628916 | 3300032002 | Bacteria | 1156 |
| 200 | Ga0307411_10009916 | 3300032005 | Bacteria | 5043 |
| 201 | Ga0307415_100723599 | 3300032126 | Unclassified | 901 |
| 202 | Ga0373932_0149698 | 3300035112 | Bacteria | 800 |
| 203 | Ga0373931_0005378 | 3300035691 | Bacteria | 5913 |
| 204 | Ga0373927_0187164 | 3300035695 | Bacteria | 1358 |
| 205 | Ga0373947_0199461 | 3300035725 | Bacteria | 1309 |
| 206 | Ga0395899_0256566 | 3300037312 | Bacteria | 1198 |
| 207 | Ga0395900_0030240 | 3300037418 | Bacteria | 5559 |
| 208 | Ga0395900_0233966 | 3300037418 | Bacteria | 1846 |
| 209 | Ga0395900_0463490 | 3300037418 | Bacteria | 1222 |
| 210 | Ga0395900_1138898 | 3300037418 | Bacteria | 697 |
| 211 | Ga0395898_0015576 | 3300037466 | Bacteria | 7795 |
| 212 | Ga0395898_0025664 | 3300037466 | Bacteria | 5936 |
| 213 | Ga0395905_0013083 | 3300037471 | Bacteria | 7965 |
| 214 | Ga0395905_0049512 | 3300037471 | Bacteria | 3937 |
| 215 | Ga0436364_0397135 | 3300037853 | Bacteria | 10337 |
| 216 | Ga0395901_0131440 | 3300038443 | Bacteria | 2630 |
| 217 | Ga0395901_0189485 | 3300038443 | Bacteria | 2157 |
| 218 | Ga0451807_0581502 | 3300041486 | Unclassified | 778 |
| 219 | Ga0451853_2690907 | 3300041512 | Bacteria | 1189 |
| 220 | Ga0450898_017121 | 3300042134 | Bacteria | 1244 |
| 221 | Ga0439460_0016907 | 3300042461 | Bacteria | 1948 |
| 222 | Ga0451577_0388554 | 3300042876 | Bacteria | 1266 |
| 223 | Ga0466969_0021538 | 3300044656 | Bacteria | 3332 |
| 224 | Ga0466972_0060216 | 3300044658 | Bacteria | 1822 |
| 225 | Ga0466972_0349389 | 3300044658 | Bacteria | 692 |
| 226 | Ga0453683_0003827 | 3300044673 | Bacteria | 10929 |
| 227 | Ga0466965_0176611 | 3300044683 | Bacteria | 1125 |
| 228 | Ga0466966_0009244 | 3300044684 | Bacteria | 6526 |
| 229 | Ga0466966_0295617 | 3300044684 | Bacteria | 973 |
| 230 | Ga0466961_0315002 | 3300044693 | Bacteria | 955 |
| 231 | Ga0466963_0061592 | 3300044694 | Bacteria | 2509 |
| 232 | Ga0466964_0021131 | 3300044706 | Bacteria | 2515 |
| 233 | Ga0453684_0232665 | 3300044712 | Bacteria | 2126 |
| 234 | Ga0453684_0450449 | 3300044712 | Unclassified | 1433 |
| 235 | Ga0466971_0022195 | 3300044719 | Bacteria | 2827 |
| 236 | Ga0466970_0075903 | 3300044765 | Bacteria | 1810 |
| 237 | Ga0466970_0272555 | 3300044765 | Bacteria | 951 |
| 238 | Ga0466957_0354745 | 3300044842 | Bacteria | 996 |
| 239 | Ga0466957_0470343 | 3300044842 | Bacteria | 868 |
| 240 | Ga0466960_0057093 | 3300044901 | Bacteria | 1902 |
| 241 | Ga0466960_0260009 | 3300044901 | Bacteria | 967 |
| 242 | Ga0466959_0512271 | 3300045049 | Bacteria | 810 |
| 243 | Ga0451576_0013172 | 3300045051 | Bacteria | 9254 |
| 244 | Ga0451576_0050287 | 3300045051 | Bacteria | 4371 |
| 245 | Ga0451576_0298393 | 3300045051 | Bacteria | 1685 |
| 246 | Ga0466958_0072360 | 3300045836 | Bacteria | 2111 |
| 247 | Ga0466967_0200518 | 3300045976 | Bacteria | 1890 |
| 248 | Ga0466967_0943501 | 3300045976 | Bacteria | 858 |
| 249 | Ga0495617_023793 | 3300046452 | Bacteria | 2068 |
| 250 | Ga0495617_069076 | 3300046452 | Bacteria | 1162 |
| 251 | Ga0495627_000123 | 3300046453 | Bacteria | 94862 |
| 252 | Ga0495627_041907 | 3300046453 | Bacteria | 1404 |
| 253 | Ga0495592_0002556 | 3300046454 | Bacteria | 12854 |
| 254 | Ga0495592_0036200 | 3300046454 | Bacteria | 3718 |
| 255 | Ga0495592_0150500 | 3300046454 | Bacteria | 1610 |
| 256 | Ga0495592_0309971 | 3300046454 | Bacteria | 1023 |
| 257 | Ga0495603_0018829 | 3300046455 | Bacteria | 4179 |
| 258 | Ga0495590_0000013 | 3300046457 | Bacteria | 271977 |
| 259 | Ga0495590_0006656 | 3300046457 | Bacteria | 4503 |
| 260 | Ga0495590_0048968 | 3300046457 | Bacteria | 1474 |
| 261 | Ga0495590_0218929 | 3300046457 | Bacteria | 703 |
| 262 | Ga0495591_000176 | 3300046458 | Bacteria | 66020 |
| 263 | Ga0495591_001974 | 3300046458 | Bacteria | 11977 |
| 264 | Ga0495591_022165 | 3300046458 | Bacteria | 2058 |
| 265 | Ga0495629_0002874 | 3300046459 | Bacteria | 13164 |
| 266 | Ga0495629_0010779 | 3300046459 | Bacteria | 6648 |
| 267 | Ga0495629_0040661 | 3300046459 | Bacteria | 3271 |
| 268 | Ga0495629_0043689 | 3300046459 | Bacteria | 3146 |
| 269 | Ga0495629_0552502 | 3300046459 | Bacteria | 773 |
| 270 | Ga0495641_0007351 | 3300046461 | Bacteria | 6897 |
| 271 | Ga0495651_0006500 | 3300046462 | Bacteria | 8931 |
| 272 | Ga0495651_0094885 | 3300046462 | Bacteria | 2232 |
| 273 | Ga0495653_0024517 | 3300046463 | Bacteria | 4859 |
| 274 | Ga0495653_0039895 | 3300046463 | Bacteria | 3674 |
| 275 | Ga0495653_0066935 | 3300046463 | Bacteria | 2700 |
| 276 | Ga0495650_0000351 | 3300046471 | Bacteria | 81358 |
| 277 | Ga0495650_0008888 | 3300046471 | Bacteria | 5790 |
| 278 | Ga0495650_0018786 | 3300046471 | Bacteria | 3426 |
| 279 | Ga0495650_0034727 | 3300046471 | Bacteria | 2228 |
| 280 | Ga0495580_0003010 | 3300046472 | Bacteria | 14451 |
| 281 | Ga0495580_0006041 | 3300046472 | Bacteria | 9912 |
| 282 | Ga0495580_0020633 | 3300046472 | Bacteria | 4873 |
| 283 | Ga0495580_0031056 | 3300046472 | Bacteria | 3863 |
| 284 | Ga0495580_0041850 | 3300046472 | Bacteria | 3266 |
| 285 | Ga0495580_0138913 | 3300046472 | Bacteria | 1685 |
| 286 | Ga0495580_0207020 | 3300046472 | Bacteria | 1350 |
| 287 | Ga0495582_0001111 | 3300046473 | Bacteria | 15122 |
| 288 | Ga0495582_0003293 | 3300046473 | Bacteria | 9075 |
| 289 | Ga0495582_0050673 | 3300046473 | Bacteria | 2288 |
| 290 | Ga0495605_0000035 | 3300046474 | Bacteria | 208069 |
| 291 | Ga0495605_0000304 | 3300046474 | Bacteria | 52709 |
| 292 | Ga0495605_0009658 | 3300046474 | Bacteria | 5420 |
| 293 | Ga0495605_0018039 | 3300046474 | Bacteria | 3789 |
| 294 | Ga0495605_0033330 | 3300046474 | Bacteria | 2615 |
| 295 | Ga0495605_0099139 | 3300046474 | Bacteria | 1341 |
| 296 | Ga0495605_0142685 | 3300046474 | Bacteria | 1073 |
| 297 | Ga0495605_0227948 | 3300046474 | Bacteria | 803 |
| 298 | Ga0495662_0017509 | 3300046476 | Bacteria | 3467 |
| 299 | Ga0495664_0000124 | 3300046477 | Bacteria | 38912 |
| 300 | Ga0495664_0066327 | 3300046477 | Bacteria | 2152 |
| 301 | Ga0495664_0072002 | 3300046477 | Bacteria | 2065 |
| 302 | Ga0495664_0109251 | 3300046477 | Bacteria | 1669 |
| 303 | Ga0495664_0146918 | 3300046477 | Bacteria | 1430 |
| 304 | Ga0495584_0000029 | 3300046491 | Bacteria | 105850 |
| 305 | Ga0495584_0003088 | 3300046491 | Bacteria | 9258 |
| 306 | Ga0495584_0005616 | 3300046491 | Bacteria | 6632 |
| 307 | Ga0495584_0021549 | 3300046491 | Bacteria | 3273 |
| 308 | Ga0495584_0086811 | 3300046491 | Bacteria | 1576 |
| 309 | Ga0495585_0005636 | 3300046492 | Bacteria | 7864 |
| 310 | Ga0495585_0007619 | 3300046492 | Bacteria | 6614 |
| 311 | Ga0495585_0024263 | 3300046492 | Bacteria | 3478 |
| 312 | Ga0495585_0040910 | 3300046492 | Bacteria | 2601 |
| 313 | Ga0495585_0062135 | 3300046492 | Bacteria | 2051 |
| 314 | Ga0495585_0096783 | 3300046492 | Bacteria | 1583 |
| 315 | Ga0495585_0191930 | 3300046492 | Bacteria | 1044 |
| 316 | Ga0495594_0069067 | 3300046499 | Bacteria | 1962 |
| 317 | Ga0495594_0073726 | 3300046499 | Bacteria | 1900 |
| 318 | Ga0495594_0214566 | 3300046499 | Bacteria | 1097 |
| 319 | Ga0495596_0001306 | 3300046500 | Bacteria | 14374 |
| 320 | Ga0495596_0001904 | 3300046500 | Bacteria | 11589 |
| 321 | Ga0495596_0004541 | 3300046500 | Bacteria | 6744 |
| 322 | Ga0495596_0005279 | 3300046500 | Bacteria | 6131 |
| 323 | Ga0495596_0010930 | 3300046500 | Bacteria | 3933 |
| 324 | Ga0495596_0012564 | 3300046500 | Bacteria | 3621 |
| 325 | Ga0495596_0013086 | 3300046500 | Bacteria | 3531 |
| 326 | Ga0495596_0016193 | 3300046500 | Bacteria | 3101 |
| 327 | Ga0495596_0024049 | 3300046500 | Bacteria | 2470 |
| 328 | Ga0495607_0001166 | 3300046501 | Bacteria | 23766 |
| 329 | Ga0495607_0002941 | 3300046501 | Bacteria | 13403 |
| 330 | Ga0495607_0006050 | 3300046501 | Bacteria | 8566 |
| 331 | Ga0495607_0008238 | 3300046501 | Bacteria | 7132 |
| 332 | Ga0495607_0012193 | 3300046501 | Bacteria | 5683 |
| 333 | Ga0495607_0016296 | 3300046501 | Bacteria | 4798 |
| 334 | Ga0495607_0095959 | 3300046501 | Bacteria | 1597 |
| 335 | Ga0495607_0184039 | 3300046501 | Bacteria | 1045 |
| 336 | Ga0495583_0000388 | 3300046506 | Bacteria | 67604 |
| 337 | Ga0495583_0000461 | 3300046506 | Bacteria | 60164 |
| 338 | Ga0495583_0001436 | 3300046506 | Bacteria | 24217 |
| 339 | Ga0495583_0005194 | 3300046506 | Bacteria | 8959 |
| 340 | Ga0495583_0007573 | 3300046506 | Bacteria | 6788 |
| 341 | Ga0495583_0014656 | 3300046506 | Bacteria | 4312 |
| 342 | Ga0495583_0020902 | 3300046506 | Bacteria | 3376 |
| 343 | Ga0495583_0055118 | 3300046506 | Bacteria | 1797 |
| 344 | Ga0495606_0010213 | 3300046507 | Bacteria | 7824 |
| 345 | Ga0495606_0018876 | 3300046507 | Bacteria | 5155 |
| 346 | Ga0495606_0147335 | 3300046507 | Bacteria | 1384 |
| 347 | Ga0495606_0170613 | 3300046507 | Bacteria | 1262 |
| 348 | Ga0495606_0192235 | 3300046507 | Bacteria | 1169 |
| 349 | Ga0495606_0215670 | 3300046507 | Bacteria | 1084 |
| 350 | Ga0495606_0247208 | 3300046507 | Bacteria | 991 |
| 351 | Ga0495608_0015926 | 3300046511 | Bacteria | 5204 |
| 352 | Ga0495610_0001374 | 3300046512 | Bacteria | 21625 |
| 353 | Ga0495616_0000148 | 3300046513 | Bacteria | 61405 |
| 354 | Ga0495616_0003086 | 3300046513 | Bacteria | 10789 |
| 355 | Ga0495616_0006608 | 3300046513 | Bacteria | 7007 |
| 356 | Ga0495616_0014900 | 3300046513 | Bacteria | 4338 |
| 357 | Ga0495616_0019471 | 3300046513 | Bacteria | 3703 |
| 358 | Ga0495616_0034549 | 3300046513 | Bacteria | 2625 |
| 359 | Ga0495616_0036597 | 3300046513 | Bacteria | 2531 |
| 360 | Ga0495616_0103100 | 3300046513 | Bacteria | 1336 |
| 361 | Ga0495616_0117138 | 3300046513 | Bacteria | 1232 |
| 362 | Ga0495616_0208249 | 3300046513 | Bacteria | 856 |
| 363 | Ga0495618_0044874 | 3300046514 | Bacteria | 2787 |
| 364 | Ga0495618_0067484 | 3300046514 | Bacteria | 2274 |
| 365 | Ga0495618_0320478 | 3300046514 | Bacteria | 960 |
| 366 | Ga0495628_0008593 | 3300046516 | Bacteria | 8749 |
| 367 | Ga0495628_0015716 | 3300046516 | Bacteria | 6318 |
| 368 | Ga0495630_0029695 | 3300046517 | Bacteria | 4064 |
| 369 | Ga0495630_0031213 | 3300046517 | Bacteria | 3966 |
| 370 | Ga0495630_0042276 | 3300046517 | Bacteria | 3403 |
| 371 | Ga0495630_0044092 | 3300046517 | Bacteria | 3333 |
| 372 | Ga0495631_0000191 | 3300046518 | Bacteria | 41842 |
| 373 | Ga0495631_0000975 | 3300046518 | Bacteria | 17773 |
| 374 | Ga0495631_0004482 | 3300046518 | Bacteria | 7427 |
| 375 | Ga0495631_0010050 | 3300046518 | Bacteria | 4701 |
| 376 | Ga0495631_0018271 | 3300046518 | Bacteria | 3303 |
| 377 | Ga0495631_0038561 | 3300046518 | Bacteria | 2123 |
| 378 | Ga0495631_0099632 | 3300046518 | Bacteria | 1251 |
| 379 | Ga0495631_0182120 | 3300046518 | Bacteria | 900 |
| 380 | Ga0495632_0000029 | 3300046519 | Bacteria | 171022 |
| 381 | Ga0495632_0000093 | 3300046519 | Bacteria | 91309 |
| 382 | Ga0495632_0001294 | 3300046519 | Bacteria | 21160 |
| 383 | Ga0495632_0001378 | 3300046519 | Bacteria | 20371 |
| 384 | Ga0495632_0018980 | 3300046519 | Bacteria | 3755 |
| 385 | Ga0495632_0023488 | 3300046519 | Bacteria | 3292 |
| 386 | Ga0495632_0067138 | 3300046519 | Bacteria | 1730 |
| 387 | Ga0495632_0136204 | 3300046519 | Bacteria | 1141 |
| 388 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 389 | Ga0495643_0000355 | 3300046522 | Bacteria | 62412 |
| 390 | Ga0495643_0026182 | 3300046522 | Bacteria | 3293 |
| 391 | Ga0495643_0027950 | 3300046522 | Bacteria | 3166 |
| 392 | Ga0495643_0029224 | 3300046522 | Bacteria | 3084 |
| 393 | Ga0495643_0040238 | 3300046522 | Bacteria | 2553 |
| 394 | Ga0495643_0161693 | 3300046522 | Bacteria | 1101 |
| 395 | Ga0495644_0002986 | 3300046523 | Bacteria | 6696 |
| 396 | Ga0495644_0005537 | 3300046523 | Bacteria | 4930 |
| 397 | Ga0495644_0005993 | 3300046523 | Bacteria | 4735 |
| 398 | Ga0495644_0006162 | 3300046523 | Bacteria | 4662 |
| 399 | Ga0495644_0015064 | 3300046523 | Bacteria | 2961 |
| 400 | Ga0495644_0015287 | 3300046523 | Bacteria | 2939 |
| 401 | Ga0495644_0065410 | 3300046523 | Bacteria | 1366 |
| 402 | Ga0495648_0000527 | 3300046524 | Bacteria | 41184 |
| 403 | Ga0495648_0001273 | 3300046524 | Bacteria | 25146 |
| 404 | Ga0495648_0002906 | 3300046524 | Bacteria | 15405 |
| 405 | Ga0495648_0011650 | 3300046524 | Bacteria | 6607 |
| 406 | Ga0495648_0013677 | 3300046524 | Bacteria | 5985 |
| 407 | Ga0495648_0015647 | 3300046524 | Bacteria | 5497 |
| 408 | Ga0495648_0016954 | 3300046524 | Bacteria | 5231 |
| 409 | Ga0495663_0047666 | 3300046525 | Bacteria | 1320 |
| 410 | Ga0495666_0000740 | 3300046526 | Bacteria | 14988 |
| 411 | Ga0495666_0003427 | 3300046526 | Bacteria | 7997 |
| 412 | Ga0495666_0006786 | 3300046526 | Bacteria | 5751 |
| 413 | Ga0495666_0008845 | 3300046526 | Bacteria | 5045 |
| 414 | Ga0495666_0028759 | 3300046526 | Bacteria | 2734 |
| 415 | Ga0495642_0000005 | 3300046528 | Bacteria | 176726 |
| 416 | Ga0495642_0000238 | 3300046528 | Bacteria | 30959 |
| 417 | Ga0495642_0002922 | 3300046528 | Bacteria | 6804 |
| 418 | Ga0495642_0009964 | 3300046528 | Bacteria | 3640 |
| 419 | Ga0495642_0010670 | 3300046528 | Bacteria | 3518 |
| 420 | Ga0495642_0019409 | 3300046528 | Bacteria | 2665 |
| 421 | Ga0495642_0019701 | 3300046528 | Bacteria | 2646 |
| 422 | Ga0495642_0070542 | 3300046528 | Bacteria | 1461 |
| 423 | Ga0495642_0095648 | 3300046528 | Bacteria | 1260 |
| 424 | Ga0495642_0158882 | 3300046528 | Bacteria | 979 |
| 425 | Ga0495642_0180646 | 3300046528 | Bacteria | 918 |
| 426 | Ga0495652_0007826 | 3300046529 | Bacteria | 9815 |
| 427 | Ga0495652_0083182 | 3300046529 | Bacteria | 2635 |
| 428 | Ga0495652_0113017 | 3300046529 | Bacteria | 2181 |
| 429 | Ga0495654_0051963 | 3300046530 | Bacteria | 1998 |
| 430 | Ga0495654_0098360 | 3300046530 | Bacteria | 1350 |
| 431 | Ga0495654_0102430 | 3300046530 | Bacteria | 1316 |
| 432 | Ga0495665_0008512 | 3300046531 | Bacteria | 5569 |
| 433 | Ga0495665_0008545 | 3300046531 | Bacteria | 5555 |
| 434 | Ga0495665_0033593 | 3300046531 | Bacteria | 2743 |
| 435 | Ga0495640_0065254 | 3300046533 | Bacteria | 2458 |
| 436 | Ga0495586_0009831 | 3300046535 | Bacteria | 5093 |
| 437 | Ga0495586_0022226 | 3300046535 | Bacteria | 3383 |
| 438 | Ga0495586_0035942 | 3300046535 | Bacteria | 2660 |
| 439 | Ga0495587_0004101 | 3300046536 | Bacteria | 9639 |
| 440 | Ga0495587_0004606 | 3300046536 | Bacteria | 9066 |
| 441 | Ga0495587_0038961 | 3300046536 | Bacteria | 2847 |
| 442 | Ga0495587_0058301 | 3300046536 | Bacteria | 2268 |
| 443 | Ga0495587_0162482 | 3300046536 | Bacteria | 1270 |
| 444 | Ga0495609_0000150 | 3300046538 | Bacteria | 72210 |
| 445 | Ga0495609_0019544 | 3300046538 | Bacteria | 3133 |
| 446 | Ga0495609_0020142 | 3300046538 | Bacteria | 3082 |
| 447 | Ga0495609_0021075 | 3300046538 | Bacteria | 3007 |
| 448 | Ga0495621_0003279 | 3300046539 | Bacteria | 4451 |
| 449 | Ga0495621_0090333 | 3300046539 | Bacteria | 1154 |
| 450 | Ga0495597_0000244 | 3300046542 | Bacteria | 49472 |
| 451 | Ga0495597_0005205 | 3300046542 | Bacteria | 6922 |
| 452 | Ga0495597_0109600 | 3300046542 | Bacteria | 1158 |
| 453 | Ga0495597_0134407 | 3300046542 | Bacteria | 1024 |
| 454 | Ga0495645_0007421 | 3300046543 | Bacteria | 7629 |
| 455 | Ga0495622_0001215 | 3300046557 | Bacteria | 13247 |
| 456 | Ga0495622_0006953 | 3300046557 | Bacteria | 5251 |
| 457 | Ga0495622_0035684 | 3300046557 | Bacteria | 2318 |
| 458 | Ga0495633_0003760 | 3300046558 | Bacteria | 9976 |
| 459 | Ga0495633_0004118 | 3300046558 | Bacteria | 9374 |
| 460 | Ga0495633_0023176 | 3300046558 | Bacteria | 3076 |
| 461 | Ga0495633_0273970 | 3300046558 | Bacteria | 768 |
| 462 | Ga0495667_0166669 | 3300046559 | Bacteria | 1416 |
| 463 | Ga0495656_0080680 | 3300046615 | Bacteria | 1467 |
| 464 | Ga0495656_0148249 | 3300046615 | Bacteria | 1131 |
| 465 | Ga0495668_0000608 | 3300046616 | Bacteria | 43304 |
| 466 | Ga0495668_0001205 | 3300046616 | Bacteria | 26279 |
| 467 | Ga0495668_0022324 | 3300046616 | Bacteria | 3618 |
| 468 | Ga0495668_0157594 | 3300046616 | Bacteria | 1243 |
| 469 | Ga0495668_0215770 | 3300046616 | Bacteria | 1050 |
| 470 | Ga0495668_0278483 | 3300046616 | Bacteria | 916 |
| 471 | Ga0495634_0007529 | 3300046642 | Bacteria | 8162 |
| 472 | Ga0495634_0008241 | 3300046642 | Bacteria | 7772 |
| 473 | Ga0495634_0019407 | 3300046642 | Bacteria | 4831 |
| 474 | Ga0495611_0002549 | 3300046648 | Bacteria | 8265 |
| 475 | Ga0495611_0022976 | 3300046648 | Bacteria | 2701 |
| 476 | Ga0495611_0077107 | 3300046648 | Bacteria | 1528 |
| 477 | Ga0495611_0086560 | 3300046648 | Bacteria | 1445 |
| 478 | Ga0495625_0038980 | 3300046660 | Bacteria | 3473 |
| 479 | Ga0495625_0055716 | 3300046660 | Bacteria | 2818 |
| 480 | Ga0495625_0302862 | 3300046660 | Bacteria | 1022 |
| 481 | Ga0495635_0001906 | 3300046663 | Bacteria | 14171 |
| 482 | Ga0495635_0079530 | 3300046663 | Bacteria | 2244 |
| 483 | Ga0495635_0080559 | 3300046663 | Bacteria | 2228 |
| 484 | Ga0495661_0001202 | 3300046665 | Bacteria | 22463 |
| 485 | Ga0495661_0006987 | 3300046665 | Bacteria | 7891 |
| 486 | Ga0495661_0009987 | 3300046665 | Bacteria | 6489 |
| 487 | Ga0495661_0015359 | 3300046665 | Bacteria | 5110 |
| 488 | Ga0495661_0018272 | 3300046665 | Bacteria | 4615 |
| 489 | Ga0495661_0025141 | 3300046665 | Bacteria | 3849 |
| 490 | Ga0495661_0030708 | 3300046665 | Bacteria | 3418 |
| 491 | Ga0495661_0034516 | 3300046665 | Bacteria | 3182 |
| 492 | Ga0495661_0083380 | 3300046665 | Bacteria | 1837 |
| 493 | Ga0495661_0150342 | 3300046665 | Bacteria | 1258 |
| 494 | Ga0495661_0211404 | 3300046665 | Bacteria | 1010 |
| 495 | Ga0495588_0000095 | 3300046674 | Bacteria | 175627 |
| 496 | Ga0495588_0010598 | 3300046674 | Bacteria | 4292 |
| 497 | Ga0495588_0021257 | 3300046674 | Bacteria | 3196 |
| 498 | Ga0495588_0081005 | 3300046674 | Bacteria | 1694 |
| 499 | Ga0495588_0094662 | 3300046674 | Bacteria | 1566 |
| 500 | Ga0495599_0000488 | 3300046678 | Bacteria | 22611 |
| 501 | Ga0495599_0052681 | 3300046678 | Bacteria | 2549 |
| 502 | Ga0495599_0436193 | 3300046678 | Bacteria | 777 |
| 503 | Ga0495623_0006968 | 3300046679 | Bacteria | 7345 |
| 504 | Ga0495623_0012385 | 3300046679 | Bacteria | 5523 |
| 505 | Ga0495623_0107075 | 3300046679 | Bacteria | 1698 |
| 506 | Ga0495646_0008898 | 3300046680 | Bacteria | 6376 |
| 507 | Ga0495646_0011397 | 3300046680 | Bacteria | 5645 |
| 508 | Ga0495646_0049640 | 3300046680 | Bacteria | 2546 |
| 509 | Ga0495646_0413832 | 3300046680 | Bacteria | 700 |
| 510 | Ga0495669_0000057 | 3300046684 | Bacteria | 76704 |
| 511 | Ga0495669_0000367 | 3300046684 | Bacteria | 23040 |
| 512 | Ga0495669_0000909 | 3300046684 | Bacteria | 12404 |
| 513 | Ga0495669_0003917 | 3300046684 | Bacteria | 6129 |
| 514 | Ga0495669_0012185 | 3300046684 | Bacteria | 3658 |
| 515 | Ga0495669_0025137 | 3300046684 | Bacteria | 2596 |
| 516 | Ga0495669_0058925 | 3300046684 | Bacteria | 1733 |
| 517 | Ga0495669_0116444 | 3300046684 | Bacteria | 1251 |
| 518 | Ga0495613_0001911 | 3300046689 | Bacteria | 15798 |
| 519 | Ga0495613_0050289 | 3300046689 | Bacteria | 3074 |
| 520 | Ga0495613_0092311 | 3300046689 | Bacteria | 2192 |
| 521 | Ga0495613_0103287 | 3300046689 | Bacteria | 2058 |
| 522 | Ga0495613_0371032 | 3300046689 | Bacteria | 980 |
| 523 | Ga0495624_0020156 | 3300046690 | Bacteria | 4441 |
| 524 | Ga0495624_0052827 | 3300046690 | Bacteria | 2567 |
| 525 | Ga0495624_0056614 | 3300046690 | Bacteria | 2466 |
| 526 | Ga0495624_0182305 | 3300046690 | Bacteria | 1279 |
| 527 | Ga0495670_0003327 | 3300046691 | Bacteria | 7917 |
| 528 | Ga0495670_0008173 | 3300046691 | Bacteria | 5144 |
| 529 | Ga0495670_0020979 | 3300046691 | Bacteria | 3221 |
| 530 | Ga0495670_0069588 | 3300046691 | Bacteria | 1779 |
| 531 | Ga0495670_0149423 | 3300046691 | Bacteria | 1225 |
| 532 | Ga0495670_0242946 | 3300046691 | Bacteria | 959 |
| 533 | Ga0495671_0000294 | 3300046692 | Bacteria | 41764 |
| 534 | Ga0495671_0001931 | 3300046692 | Bacteria | 13306 |
| 535 | Ga0495671_0003039 | 3300046692 | Bacteria | 10423 |
| 536 | Ga0495671_0052504 | 3300046692 | Bacteria | 2026 |
| 537 | Ga0495649_0000049 | 3300046694 | Bacteria | 113865 |
| 538 | Ga0495649_0002523 | 3300046694 | Bacteria | 12843 |
| 539 | Ga0495649_0009650 | 3300046694 | Bacteria | 5722 |
| 540 | Ga0495649_0048083 | 3300046694 | Bacteria | 2318 |
| 541 | Ga0495649_0107183 | 3300046694 | Bacteria | 1483 |
| 542 | Ga0495649_0128105 | 3300046694 | Bacteria | 1340 |
| 543 | Ga0495649_0177634 | 3300046694 | Bacteria | 1112 |
| 544 | Ga0495649_0278369 | 3300046694 | Bacteria | 855 |
| 545 | Ga0495589_0000301 | 3300046794 | Bacteria | 39328 |
| 546 | Ga0495589_0001394 | 3300046794 | Bacteria | 14026 |
| 547 | Ga0495589_0004430 | 3300046794 | Bacteria | 7479 |
| 548 | Ga0495589_0008467 | 3300046794 | Bacteria | 5368 |
| 549 | Ga0495589_0009707 | 3300046794 | Bacteria | 5000 |
| 550 | Ga0495589_0072307 | 3300046794 | Bacteria | 1684 |
| 551 | Ga0495589_0244241 | 3300046794 | Bacteria | 840 |
| 552 | Ga0495600_0003369 | 3300046809 | Bacteria | 9399 |
| 553 | Ga0495600_0085095 | 3300046809 | Bacteria | 2063 |
| 554 | Ga0495660_0000033 | 3300046810 | Bacteria | 212425 |
| 555 | Ga0495660_0002579 | 3300046810 | Bacteria | 11513 |
| 556 | Ga0495660_0031266 | 3300046810 | Bacteria | 2993 |
| 557 | Ga0495581_0029931 | 3300047315 | Bacteria | 3156 |
| 558 | Ga0495581_0084120 | 3300047315 | Bacteria | 1843 |
| 559 | Ga0495581_0200225 | 3300047315 | Bacteria | 1168 |
| 560 | Ga0495604_0011057 | 3300047317 | Bacteria | 7162 |
| 561 | Ga0495604_0042011 | 3300047317 | Bacteria | 3584 |
| 562 | Ga0495604_0058876 | 3300047317 | Bacteria | 2948 |
| 563 | Ga0495604_0061589 | 3300047317 | Bacteria | 2869 |
| 564 | Ga0495604_0102741 | 3300047317 | Bacteria | 2098 |
| 565 | Ga0495604_0150607 | 3300047317 | Bacteria | 1653 |
| 566 | Ga0495636_0003471 | 3300047318 | Bacteria | 6121 |
| 567 | Ga0495674_0009804 | 3300047319 | Bacteria | 9095 |
| 568 | Ga0495674_0013766 | 3300047319 | Bacteria | 7593 |
| 569 | Ga0495674_0054030 | 3300047319 | Bacteria | 3529 |
| 570 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 571 | Ga0495672_0000101 | 3300047320 | Bacteria | 139193 |
| 572 | Ga0495672_0020896 | 3300047320 | Bacteria | 4280 |
| 573 | Ga0495672_0051175 | 3300047320 | Bacteria | 2434 |
| 574 | Ga0495672_0097117 | 3300047320 | Bacteria | 1605 |
| 575 | Ga0495672_0133658 | 3300047320 | Bacteria | 1302 |
| 576 | Ga0495676_0000342 | 3300047321 | Bacteria | 38031 |
| 577 | Ga0495676_0018968 | 3300047321 | Bacteria | 6058 |
| 578 | Ga0495676_0061214 | 3300047321 | Bacteria | 2945 |
| 579 | Ga0495676_0152034 | 3300047321 | Bacteria | 1646 |
| 580 | Ga0495676_0327116 | 3300047321 | Bacteria | 1029 |
| 581 | Ga0495680_0008094 | 3300047322 | Bacteria | 9583 |
| 582 | Ga0495680_0032156 | 3300047322 | Bacteria | 4263 |
| 583 | Ga0495680_0050743 | 3300047322 | Bacteria | 3242 |
| 584 | Ga0495680_0066722 | 3300047322 | Bacteria | 2753 |
| 585 | Ga0495683_0000024 | 3300047323 | Bacteria | 156554 |
| 586 | Ga0495683_0000736 | 3300047323 | Bacteria | 23733 |
| 587 | Ga0495683_0025279 | 3300047323 | Bacteria | 3046 |
| 588 | Ga0495683_0093457 | 3300047323 | Bacteria | 1454 |
| 589 | Ga0495683_0095669 | 3300047323 | Bacteria | 1433 |
| 590 | Ga0495687_000092 | 3300047443 | Bacteria | 140313 |
| 591 | Ga0495687_000182 | 3300047443 | Bacteria | 91333 |
| 592 | Ga0495687_005556 | 3300047443 | Bacteria | 7996 |
| 593 | Ga0495687_050857 | 3300047443 | Bacteria | 1763 |
| 594 | Ga0495675_0007505 | 3300047444 | Bacteria | 6719 |
| 595 | Ga0495675_0007943 | 3300047444 | Bacteria | 6559 |
| 596 | Ga0495675_0011852 | 3300047444 | Bacteria | 5479 |
| 597 | Ga0495675_0026421 | 3300047444 | Bacteria | 3702 |
| 598 | Ga0495677_0000109 | 3300047445 | Bacteria | 41192 |
| 599 | Ga0495677_0000395 | 3300047445 | Bacteria | 18625 |
| 600 | Ga0495677_0000472 | 3300047445 | Bacteria | 17222 |
| 601 | Ga0495677_0002661 | 3300047445 | Bacteria | 6982 |
| 602 | Ga0495677_0006507 | 3300047445 | Bacteria | 4413 |
| 603 | Ga0495677_0023792 | 3300047445 | Bacteria | 2222 |
| 604 | Ga0495677_0038592 | 3300047445 | Bacteria | 1745 |
| 605 | Ga0495677_0042913 | 3300047445 | Bacteria | 1657 |
| 606 | Ga0495677_0060835 | 3300047445 | Bacteria | 1400 |
| 607 | Ga0495677_0202611 | 3300047445 | Bacteria | 771 |
| 608 | Ga0495679_000512 | 3300047446 | Bacteria | 27579 |
| 609 | Ga0495679_000887 | 3300047446 | Bacteria | 18727 |
| 610 | Ga0495679_008449 | 3300047446 | Bacteria | 4185 |
| 611 | Ga0495679_011876 | 3300047446 | Bacteria | 3344 |
| 612 | Ga0495679_015783 | 3300047446 | Bacteria | 2750 |
| 613 | Ga0495679_058686 | 3300047446 | Bacteria | 1134 |
| 614 | Ga0495685_008691 | 3300047447 | Bacteria | 3380 |
| 615 | Ga0495685_042577 | 3300047447 | Bacteria | 1550 |
| 616 | Ga0495685_055604 | 3300047447 | Bacteria | 1338 |
| 617 | Ga0495673_0015345 | 3300047469 | Bacteria | 3949 |
| 618 | Ga0495681_0000105 | 3300047470 | Bacteria | 73364 |
| 619 | Ga0495681_0002100 | 3300047470 | Bacteria | 14489 |
| 620 | Ga0495681_0017507 | 3300047470 | Bacteria | 3975 |
| 621 | Ga0495681_0083461 | 3300047470 | Bacteria | 1422 |
| 622 | Ga0495681_0112632 | 3300047470 | Bacteria | 1176 |
| 623 | Ga0495684_0045101 | 3300047471 | Bacteria | 3374 |
| 624 | Ga0495686_0005097 | 3300047472 | Bacteria | 10506 |
| 625 | Ga0495686_0027199 | 3300047472 | Bacteria | 3736 |
| 626 | Ga0495593_0004644 | 3300047673 | Bacteria | 8166 |
| 627 | Ga0495593_0008333 | 3300047673 | Bacteria | 6032 |
| 628 | Ga0495593_0008999 | 3300047673 | Bacteria | 5795 |
| 629 | Ga0495593_0131478 | 3300047673 | Bacteria | 1270 |
| 630 | Ga0495593_0234806 | 3300047673 | Bacteria | 919 |
| 631 | Ga0495602_0000903 | 3300048088 | Bacteria | 28669 |
| 632 | Ga0495602_0005365 | 3300048088 | Bacteria | 13456 |
| 633 | Ga0495602_0024837 | 3300048088 | Bacteria | 5809 |
| 634 | Ga0495602_0039525 | 3300048088 | Bacteria | 4342 |
| 635 | Ga0495602_0590403 | 3300048088 | Bacteria | 765 |
| 636 | Ga0495614_0004149 | 3300048089 | Bacteria | 6525 |
| 637 | Ga0495614_0010160 | 3300048089 | Bacteria | 4152 |
| 638 | Ga0495614_0023771 | 3300048089 | Bacteria | 2645 |
| 639 | Ga0495615_0008328 | 3300048090 | Bacteria | 2000 |
| 640 | Ga0495626_0000159 | 3300048091 | Bacteria | 83571 |
| 641 | Ga0495626_0004814 | 3300048091 | Bacteria | 8141 |
| 642 | Ga0495626_0005050 | 3300048091 | Bacteria | 7873 |
| 643 | Ga0495626_0006418 | 3300048091 | Bacteria | 6697 |
| 644 | Ga0495626_0012028 | 3300048091 | Bacteria | 4553 |
| 645 | Ga0495626_0015708 | 3300048091 | Bacteria | 3869 |
| 646 | Ga0495626_0022317 | 3300048091 | Bacteria | 3128 |
| 647 | Ga0495626_0028981 | 3300048091 | Bacteria | 2681 |
| 648 | Ga0495626_0055510 | 3300048091 | Bacteria | 1815 |
| 649 | Ga0495626_0059660 | 3300048091 | Bacteria | 1740 |
| 650 | Ga0495626_0192875 | 3300048091 | Bacteria | 839 |
| 651 | Ga0496100_0008797 | 3300048903 | Bacteria | 5647 |
| 652 | Ga0496101_0006344 | 3300048904 | Bacteria | 7612 |
| 653 | Ga0496101_0260757 | 3300048904 | Bacteria | 1352 |
| 654 | Ga0496102_0030494 | 3300048905 | Bacteria | 4827 |
| 655 | Ga0496102_0045330 | 3300048905 | Bacteria | 3992 |
| 656 | Ga0496102_0290372 | 3300048905 | Bacteria | 1541 |
| 657 | Ga0496102_0906396 | 3300048905 | Bacteria | 803 |
| 658 | Ga0496103_0002586 | 3300048906 | Bacteria | 11339 |
| 659 | Ga0496103_0030682 | 3300048906 | Bacteria | 3273 |
| 660 | Ga0496104_0024323 | 3300048907 | Bacteria | 5571 |
| 661 | Ga0496104_0050912 | 3300048907 | Bacteria | 3908 |
| 662 | Ga0496104_0460240 | 3300048907 | Bacteria | 1184 |
| 663 | Ga0496105_0004903 | 3300048908 | Bacteria | 10116 |
| 664 | Ga0496105_0097231 | 3300048908 | Bacteria | 2432 |
| 665 | Ga0496106_0022360 | 3300048909 | Bacteria | 4696 |
| 666 | Ga0496106_0031827 | 3300048909 | Bacteria | 3931 |
| 667 | Ga0496106_0033426 | 3300048909 | Bacteria | 3837 |
| 668 | Ga0496106_0511183 | 3300048909 | Bacteria | 965 |
| 669 | Ga0496108_0161299 | 3300048911 | Bacteria | 1938 |
| 670 | Ga0496109_0166580 | 3300048912 | Bacteria | 2066 |
| 671 | Ga0496110_0080901 | 3300048913 | Bacteria | 2895 |
| 672 | Ga0496110_0118677 | 3300048913 | Bacteria | 2382 |
| 673 | Ga0496110_0412856 | 3300048913 | Bacteria | 1231 |
| 674 | Ga0496111_0092023 | 3300048914 | Bacteria | 2223 |
| 675 | Ga0496112_0343136 | 3300048915 | Bacteria | 1437 |
| 676 | Ga0496114_0054614 | 3300048917 | Bacteria | 3331 |
| 677 | Ga0496114_1088589 | 3300048917 | Bacteria | 684 |
| 678 | Ga0496117_0005784 | 3300048920 | Bacteria | 12840 |
| 679 | Ga0496117_0167529 | 3300048920 | Bacteria | 1279 |
| 680 | Ga0496118_0000191 | 3300048921 | Bacteria | 107968 |
| 681 | Ga0496118_0011563 | 3300048921 | Bacteria | 8600 |
| 682 | Ga0496122_0288324 | 3300048925 | Bacteria | 893 |
| 683 | Ga0496124_0007903 | 3300048927 | Bacteria | 11203 |
| 684 | Ga0496124_0341700 | 3300048927 | Bacteria | 1063 |
| 685 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 686 | Ga0495678_000232 | 3300049459 | Bacteria | 63796 |
| 687 | Ga0495678_001881 | 3300049459 | Bacteria | 15261 |
| 688 | Ga0495678_014858 | 3300049459 | Bacteria | 3606 |
| 689 | Ga0495682_0000210 | 3300049460 | Bacteria | 47048 |
| 690 | Ga0495682_0059736 | 3300049460 | Bacteria | 1377 |
| 691 | Ga0501031_0009849 | 3300049568 | Bacteria | 6223 |
| 692 | Ga0501031_0116672 | 3300049568 | Bacteria | 1744 |
| 693 | Ga0501036_0082121 | 3300049572 | Bacteria | 2724 |
| 694 | Ga0501036_0212973 | 3300049572 | Bacteria | 1623 |
| 695 | Ga0501037_0184195 | 3300049573 | Bacteria | 1481 |
| 696 | Ga0501038_0308605 | 3300049574 | Bacteria | 1240 |
| 697 | Ga0501039_0103676 | 3300049575 | Bacteria | 2220 |
| 698 | Ga0501039_0374608 | 3300049575 | Bacteria | 1118 |
| 699 | Ga0501040_0530270 | 3300049576 | Bacteria | 849 |
| 700 | Ga0501041_0537559 | 3300049577 | Bacteria | 744 |
| 701 | Ga0501042_0290336 | 3300049578 | Bacteria | 1181 |
| 702 | Ga0501042_0509377 | 3300049578 | Bacteria | 874 |
| 703 | Ga0501042_0589884 | 3300049578 | Bacteria | 808 |
| 704 | Ga0501042_0663448 | 3300049578 | Bacteria | 758 |
| 705 | Ga0501046_0452250 | 3300049580 | Bacteria | 923 |
| 706 | Ga0501046_0468154 | 3300049580 | Bacteria | 905 |
| 707 | Ga0501048_0031824 | 3300049582 | Bacteria | 3815 |
| 708 | Ga0501048_0088048 | 3300049582 | Bacteria | 2190 |
| 709 | Ga0501067_0139149 | 3300049583 | Bacteria | 1352 |
| 710 | Ga0501069_0141732 | 3300049585 | Bacteria | 1379 |
| 711 | Ga0501070_0210567 | 3300049586 | Bacteria | 1596 |
| 712 | Ga0501071_0068610 | 3300049587 | Bacteria | 2580 |
| 713 | Ga0501072_0122974 | 3300049588 | Bacteria | 2067 |
| 714 | Ga0501072_0146704 | 3300049588 | Bacteria | 1881 |
| 715 | Ga0501072_0675650 | 3300049588 | Bacteria | 812 |
| 716 | Ga0501074_0275072 | 3300049590 | Bacteria | 1197 |
| 717 | Ga0501076_0023191 | 3300049592 | Bacteria | 4781 |
| 718 | Ga0501076_0940367 | 3300049592 | Bacteria | 712 |
| 719 | Ga0501079_0264496 | 3300049741 | Bacteria | 1344 |
| 720 | Ga0501079_0868381 | 3300049741 | Bacteria | 710 |
| 721 | Ga0501045_0197394 | 3300049824 | Bacteria | 1499 |
| 722 | nmdc:mga0k408_229311_c1 | 3300050493 | Bacteria | 1109 |
| 723 | nmdc:mga07m45_6970_c1 | 3300050496 | Bacteria | 5745 |
| 724 | nmdc:mga07m45_79487_c1 | 3300050496 | Bacteria | 1872 |
| 725 | nmdc:mga05p37_11022_c1 | 3300050507 | Bacteria | 10738 |
| 726 | nmdc:mga05p37_879889_c1 | 3300050507 | Bacteria | 969 |
| 727 | nmdc:mga09592_120040_c1 | 3300050508 | Bacteria | 2258 |
| 728 | nmdc:mga09592_1875_c1 | 3300050508 | Bacteria | 16913 |
| 729 | nmdc:mga09592_21641_c1 | 3300050508 | Bacteria | 5300 |
| 730 | nmdc:mga09592_384670_c1 | 3300050508 | Bacteria | 1213 |
| 731 | nmdc:mga09592_82009_c1 | 3300050508 | Bacteria | 2749 |
| 732 | nmdc:mga0qj67_53653_c1 | 3300050509 | Bacteria | 3191 |
| 733 | nmdc:mga06r32_401712_c1 | 3300050510 | Bacteria | 1352 |
| 734 | nmdc:mga08y16_142889_c1 | 3300050511 | Bacteria | 2488 |
| 735 | Ga0500578_0038858 | 3300053086 | Bacteria | 3057 |
| 736 | Ga0466962_0090127 | 3300061719 | Bacteria | 1469 |
| 737 | 2513952521 | 2513237150 | Bacteria | 6553639 |
| 738 | 2514041592 | 2513237165 | Bacteria | 6771773 |
| 739 | 2644028352 | 2643221603 | Bacteria | 6147767 |
| 740 | 2746089015 | 2744054900 | Bacteria | 8399525 |
| 741 | 2746097147 | 2744054901 | Bacteria | 8397047 |
| 742 | 2809145213 | 2808606418 | Bacteria | 6724496 |
| 743 | 2834641862 | 2834641062 | Bacteria | 5559922 |
| 744 | 2901308286 | 2901300506 | Bacteria | 8463898 |
| 745 | 644750864 | 644736347 | Bacteria | 6476522 |
| 746 | 8003404596 | 8003400568 | Bacteria | 5535898 |
| 747 | 8047675520 | 8047673197 | Bacteria | 7395230 |
| 748 | Ga0495626_0016704 | |||
| 749 | SwRhRL2b_contig_3689071 | |||
| 750 | SwRhRL2b_contig_691832 | |||
| 751 | rootH1_10020786 | |||
| 752 | JGI25407J50210_10038483 | |||
| 753 | Ga0065165_1003233 | |||
| 754 | Ga0065704_10072564 | |||
| 755 | Ga0065707_10001106 | |||
| 756 | Ga0065707_10235855 | |||
| 757 | Ga0070676_10042370 | |||
| 758 | Ga0070666_10390781 | |||
| 759 | Ga0070680_100221825 | |||
| 760 | Ga0070682_100259865 | |||
| 761 | Ga0070660_100027134 | |||
| 762 | Ga0070660_100511660 | |||
| 763 | Ga0070689_100373387 | |||
| 764 | Ga0070661_100016223 | |||
| 765 | Ga0070692_10239362 | |||
| 766 | Ga0070692_10400158 | |||
| 767 | Ga0070669_100391611 | |||
| 768 | Ga0070671_100098487 | |||
| 769 | Ga0070674_100015594 | |||
| 770 | Ga0070659_100042468 | |||
| 771 | Ga0070659_100197976 | |||
| 772 | Ga0070659_100203133 | |||
| 773 | Ga0070667_100115549 | |||
| 774 | Ga0070667_100324783 | |||
| 775 | Ga0070667_100583602 | |||
| 776 | Ga0070709_10016056 | |||
| 777 | Ga0070713_100073288 | |||
| 778 | Ga0070710_10147832 | |||
| 779 | Ga0070711_100071093 | |||
| 780 | Ga0070711_100127036 | |||
| 781 | Ga0070700_100046936 | |||
| 782 | Ga0070678_100079379 | |||
| 783 | Ga0070662_100077805 | |||
| 784 | Ga0070681_10206676 | |||
| 785 | Ga0070681_10410566 | |||
| 786 | Ga0068867_100025071 | |||
| 787 | Ga0070699_100060930 | |||
| 788 | Ga0070679_100050370 | |||
| 789 | Ga0070679_100134593 | |||
| 790 | Ga0070684_100740081 | |||
| 791 | Ga0068853_100466409 | |||
| 792 | Ga0068853_100560846 | |||
| 793 | Ga0068853_101054847 | |||
| 794 | Ga0070672_100168923 | |||
| 795 | Ga0070696_100001766 | |||
| 796 | Ga0070665_100236364 | |||
| 797 | Ga0070665_100779908 | |||
| 798 | Ga0068855_100016751 | |||
| 799 | Ga0068855_100029035 | |||
| 800 | Ga0068855_100111433 | |||
| 801 | Ga0068855_100124032 | |||
| 802 | Ga0070664_100075582 | |||
| 803 | Ga0070664_100506666 | |||
| 804 | Ga0068857_100095316 | |||
| 805 | Ga0068857_100282044 | |||
| 806 | Ga0068856_100298325 | |||
| 807 | Ga0070702_100006377 | |||
| 808 | Ga0068852_100552211 | |||
| 809 | Ga0068852_100848199 | |||
| 810 | Ga0068852_101308337 | |||
| 811 | Ga0068859_100782907 | |||
| 812 | Ga0068866_10045161 | |||
| 813 | Ga0068861_100003803 | |||
| 814 | Ga0068861_100290932 | |||
| 815 | Ga0068851_10270520 | |||
| 816 | Ga0068858_100061634 | |||
| 817 | Ga0068858_100541926 | |||
| 818 | Ga0068860_100029669 | |||
| 819 | Ga0068862_100073210 | |||
| 820 | Ga0081538_10022702 | |||
| 821 | Ga0081538_10113438 | |||
| 822 | Ga0070712_100402387 | |||
| 823 | Ga0075366_10059712 | |||
| 824 | Ga0075370_10005241 | |||
| 825 | Ga0075370_10074427 | |||
| 826 | Ga0075370_10120390 | |||
| 827 | Ga0075428_100193339 | |||
| 828 | Ga0075428_101083391 | |||
| 829 | Ga0075430_100299204 | |||
| 830 | Ga0075430_100459513 | |||
| 831 | Ga0075430_100969239 | |||
| 832 | Ga0075429_100007849 | |||
| 833 | Ga0075429_100011170 | |||
| 834 | Ga0075429_100016236 | |||
| 835 | Ga0075429_100047339 | |||
| 836 | Ga0075429_100048159 | |||
| 837 | Ga0075429_100489530 | |||
| 838 | Ga0068865_100599241 | |||
| 839 | Ga0097620_100783007 | |||
| 840 | Ga0105240_10002099 | |||
| 841 | Ga0111539_10009836 | |||
| 842 | Ga0105247_10546685 | |||
| 843 | Ga0114129_10012487 | |||
| 844 | Ga0114129_10082229 | |||
| 845 | Ga0114129_10224362 | |||
| 846 | Ga0114129_10897319 | |||
| 847 | Ga0105243_10106703 | |||
| 848 | Ga0105243_10209633 | |||
| 849 | Ga0105248_11004002 | |||
| 850 | Ga0105237_10220507 | |||
| 851 | Ga0105237_10336066 | |||
| 852 | Ga0105238_10021066 | |||
| 853 | Ga0105238_10035120 | |||
| 854 | Ga0105238_10241825 | |||
| 855 | Ga0105238_10300975 | |||
| 856 | Ga0105238_10974428 | |||
| 857 | Ga0105249_10241916 | |||
| 858 | Ga0157370_10081352 | |||
| 859 | Ga0157370_10577580 | |||
| 860 | Ga0157369_10265515 | |||
| 861 | Ga0157374_10082454 | |||
| 862 | Ga0157378_10074989 | |||
| 863 | Ga0163162_10028413 | |||
| 864 | Ga0163162_10062499 | |||
| 865 | Ga0157372_10006140 | |||
| 866 | Ga0157372_10406165 | |||
| 867 | Ga0157372_10415440 | |||
| 868 | Ga0157375_10110095 | |||
| 869 | Ga0163163_10634836 | |||
| 870 | Ga0157380_10079549 | |||
| 871 | Ga0157380_10877486 | |||
| 872 | Ga0182008_10006544 | |||
| 873 | Ga0182006_1025195 | |||
| 874 | Ga0182007_10001940 | |||
| 875 | Ga0213875_10004817 | |||
| 876 | Ga0209051_1002550 | |||
| 877 | Ga0209051_1008603 | |||
| 878 | Ga0207682_10041522 | |||
| 879 | Ga0207682_10057574 | |||
| 880 | Ga0207692_10090681 | |||
| 881 | Ga0207680_10462675 | |||
| 882 | Ga0207707_10101000 | |||
| 883 | Ga0207695_10254316 | |||
| 884 | Ga0207693_10251507 | |||
| 885 | Ga0207663_10046549 | |||
| 886 | Ga0207660_10174837 | |||
| 887 | Ga0207662_10504122 | |||
| 888 | Ga0207657_10303264 | |||
| 889 | Ga0207649_10579062 | |||
| 890 | Ga0207652_10024345 | |||
| 891 | Ga0207652_10150780 | |||
| 892 | Ga0207652_10210043 | |||
| 893 | Ga0207694_10138556 | |||
| 894 | Ga0207700_10069547 | |||
| 895 | Ga0207664_10198088 | |||
| 896 | Ga0207690_10029251 | |||
| 897 | Ga0207690_10474582 | |||
| 898 | Ga0207690_10868071 | |||
| 899 | Ga0207706_10176268 | |||
| 900 | Ga0207669_10277136 | |||
| 901 | Ga0207704_10034759 | |||
| 902 | Ga0207691_10170113 | |||
| 903 | Ga0207679_10425922 | |||
| 904 | Ga0207667_10193783 | |||
| 905 | Ga0207667_10212676 | |||
| 906 | Ga0207667_10247033 | |||
| 907 | Ga0207667_10463788 | |||
| 908 | Ga0207712_10055408 | |||
| 909 | Ga0207668_10428534 | |||
| 910 | Ga0207640_10796944 | |||
| 911 | Ga0207658_10094643 | |||
| 912 | Ga0207677_10809171 | |||
| 913 | Ga0207639_10535346 | |||
| 914 | Ga0207678_10080001 | |||
| 915 | Ga0207708_10042293 | |||
| 916 | Ga0207708_10056930 | |||
| 917 | Ga0207702_10628909 | |||
| 918 | Ga0207648_10002759 | |||
| 919 | Ga0207648_10508489 | |||
| 920 | Ga0207674_10146990 | |||
| 921 | Ga0207675_100089740 | |||
| 922 | Ga0207675_100207706 | |||
| 923 | Ga0207683_10774313 | |||
| 924 | Ga0209974_10001262 | |||
| 925 | Ga0207428_10014792 | |||
| 926 | Ga0268266_10107633 | |||
| 927 | Ga0268266_10312057 | |||
| 928 | Ga0268265_10071825 | |||
| 929 | Ga0307517_10079942 | |||
| 930 | Ga0307515_10000240 | |||
| 931 | Ga0307515_10035008 | |||
| 932 | Ga0265327_10157056 | |||
| 933 | Ga0307513_10124044 | |||
| 934 | Ga0307408_100122295 | |||
| 935 | Ga0307508_10146074 | |||
| 936 | Ga0307516_10000178 | |||
| 937 | Ga0307405_10126732 | |||
| 938 | Ga0307405_10536784 | |||
| 939 | Ga0307406_10039460 | |||
| 940 | Ga0307406_10261272 | |||
| 941 | Ga0307407_10120013 | |||
| 942 | Ga0307412_10050187 | |||
| 943 | Ga0307409_100046083 | |||
| 944 | Ga0307416_100308248 | |||
| 945 | Ga0307416_100557767 | |||
| 946 | Ga0307416_100628916 | |||
| 947 | Ga0307411_10009916 | |||
| 948 | Ga0307415_100723599 | |||
| 949 | Ga0373932_0149698 | |||
| 950 | Ga0373931_0005378 | |||
| 951 | Ga0373927_0187164 | |||
| 952 | Ga0373947_0199461 | |||
| 953 | Ga0395899_0256566 | |||
| 954 | Ga0395900_0030240 | |||
| 955 | Ga0395900_0233966 | |||
| 956 | Ga0395900_0463490 | |||
| 957 | Ga0395900_1138898 | |||
| 958 | Ga0395898_0015576 | |||
| 959 | Ga0395898_0025664 | |||
| 960 | Ga0395905_0013083 | |||
| 961 | Ga0395905_0049512 | |||
| 962 | Ga0436364_0397135 | |||
| 963 | Ga0395901_0131440 | |||
| 964 | Ga0395901_0189485 | |||
| 965 | Ga0451807_0581502 | |||
| 966 | Ga0451853_2690907 | |||
| 967 | Ga0450898_017121 | |||
| 968 | Ga0439460_0016907 | |||
| 969 | Ga0451577_0388554 | |||
| 970 | Ga0466969_0021538 | |||
| 971 | Ga0466972_0060216 | |||
| 972 | Ga0466972_0349389 | |||
| 973 | Ga0453683_0003827 | |||
| 974 | Ga0466965_0176611 | |||
| 975 | Ga0466966_0009244 | |||
| 976 | Ga0466966_0295617 | |||
| 977 | Ga0466961_0315002 | |||
| 978 | Ga0466963_0061592 | |||
| 979 | Ga0466964_0021131 | |||
| 980 | Ga0453684_0232665 | |||
| 981 | Ga0453684_0450449 | |||
| 982 | Ga0466971_0022195 | |||
| 983 | Ga0466970_0075903 | |||
| 984 | Ga0466970_0272555 | |||
| 985 | Ga0466957_0354745 | |||
| 986 | Ga0466957_0470343 | |||
| 987 | Ga0466960_0057093 | |||
| 988 | Ga0466960_0260009 | |||
| 989 | Ga0466959_0512271 | |||
| 990 | Ga0451576_0013172 | |||
| 991 | Ga0451576_0050287 | |||
| 992 | Ga0451576_0298393 | |||
| 993 | Ga0466958_0072360 | |||
| 994 | Ga0466967_0200518 | |||
| 995 | Ga0466967_0943501 | |||
| 996 | Ga0495617_023793 | |||
| 997 | Ga0495617_069076 | |||
| 998 | Ga0495627_000123 | |||
| 999 | Ga0495627_041907 | |||
| 1000 | Ga0495592_0002556 | |||
| 1001 | Ga0495592_0036200 | |||
| 1002 | Ga0495592_0150500 | |||
| 1003 | Ga0495592_0309971 | |||
| 1004 | Ga0495603_0018829 | |||
| 1005 | Ga0495590_0000013 | |||
| 1006 | Ga0495590_0006656 | |||
| 1007 | Ga0495590_0048968 | |||
| 1008 | Ga0495590_0218929 | |||
| 1009 | Ga0495591_000176 | |||
| 1010 | Ga0495591_001974 | |||
| 1011 | Ga0495591_022165 | |||
| 1012 | Ga0495629_0002874 | |||
| 1013 | Ga0495629_0010779 | |||
| 1014 | Ga0495629_0040661 | |||
| 1015 | Ga0495629_0043689 | |||
| 1016 | Ga0495629_0552502 | |||
| 1017 | Ga0495641_0007351 | |||
| 1018 | Ga0495651_0006500 | |||
| 1019 | Ga0495651_0094885 | |||
| 1020 | Ga0495653_0024517 | |||
| 1021 | Ga0495653_0039895 | |||
| 1022 | Ga0495653_0066935 | |||
| 1023 | Ga0495650_0000351 | |||
| 1024 | Ga0495650_0008888 | |||
| 1025 | Ga0495650_0018786 | |||
| 1026 | Ga0495650_0034727 | |||
| 1027 | Ga0495580_0003010 | |||
| 1028 | Ga0495580_0006041 | |||
| 1029 | Ga0495580_0020633 | |||
| 1030 | Ga0495580_0031056 | |||
| 1031 | Ga0495580_0041850 | |||
| 1032 | Ga0495580_0138913 | |||
| 1033 | Ga0495580_0207020 | |||
| 1034 | Ga0495582_0001111 | |||
| 1035 | Ga0495582_0003293 | |||
| 1036 | Ga0495582_0050673 | |||
| 1037 | Ga0495605_0000035 | |||
| 1038 | Ga0495605_0000304 | |||
| 1039 | Ga0495605_0009658 | |||
| 1040 | Ga0495605_0018039 | |||
| 1041 | Ga0495605_0033330 | |||
| 1042 | Ga0495605_0099139 | |||
| 1043 | Ga0495605_0142685 | |||
| 1044 | Ga0495605_0227948 | |||
| 1045 | Ga0495662_0017509 | |||
| 1046 | Ga0495664_0000124 | |||
| 1047 | Ga0495664_0066327 | |||
| 1048 | Ga0495664_0072002 | |||
| 1049 | Ga0495664_0109251 | |||
| 1050 | Ga0495664_0146918 | |||
| 1051 | Ga0495584_0000029 | |||
| 1052 | Ga0495584_0003088 | |||
| 1053 | Ga0495584_0005616 | |||
| 1054 | Ga0495584_0021549 | |||
| 1055 | Ga0495584_0086811 | |||
| 1056 | Ga0495585_0005636 | |||
| 1057 | Ga0495585_0007619 | |||
| 1058 | Ga0495585_0024263 | |||
| 1059 | Ga0495585_0040910 | |||
| 1060 | Ga0495585_0062135 | |||
| 1061 | Ga0495585_0096783 | |||
| 1062 | Ga0495585_0191930 | |||
| 1063 | Ga0495594_0069067 | |||
| 1064 | Ga0495594_0073726 | |||
| 1065 | Ga0495594_0214566 | |||
| 1066 | Ga0495596_0001306 | |||
| 1067 | Ga0495596_0001904 | |||
| 1068 | Ga0495596_0004541 | |||
| 1069 | Ga0495596_0005279 | |||
| 1070 | Ga0495596_0010930 | |||
| 1071 | Ga0495596_0012564 | |||
| 1072 | Ga0495596_0013086 | |||
| 1073 | Ga0495596_0016193 | |||
| 1074 | Ga0495596_0024049 | |||
| 1075 | Ga0495607_0001166 | |||
| 1076 | Ga0495607_0002941 | |||
| 1077 | Ga0495607_0006050 | |||
| 1078 | Ga0495607_0008238 | |||
| 1079 | Ga0495607_0012193 | |||
| 1080 | Ga0495607_0016296 | |||
| 1081 | Ga0495607_0095959 | |||
| 1082 | Ga0495607_0184039 | |||
| 1083 | Ga0495583_0000388 | |||
| 1084 | Ga0495583_0000461 | |||
| 1085 | Ga0495583_0001436 | |||
| 1086 | Ga0495583_0005194 | |||
| 1087 | Ga0495583_0007573 | |||
| 1088 | Ga0495583_0014656 | |||
| 1089 | Ga0495583_0020902 | |||
| 1090 | Ga0495583_0055118 | |||
| 1091 | Ga0495606_0010213 | |||
| 1092 | Ga0495606_0018876 | |||
| 1093 | Ga0495606_0147335 | |||
| 1094 | Ga0495606_0170613 | |||
| 1095 | Ga0495606_0192235 | |||
| 1096 | Ga0495606_0215670 | |||
| 1097 | Ga0495606_0247208 | |||
| 1098 | Ga0495608_0015926 | |||
| 1099 | Ga0495610_0001374 | |||
| 1100 | Ga0495616_0000148 | |||
| 1101 | Ga0495616_0003086 | |||
| 1102 | Ga0495616_0006608 | |||
| 1103 | Ga0495616_0014900 | |||
| 1104 | Ga0495616_0019471 | |||
| 1105 | Ga0495616_0034549 | |||
| 1106 | Ga0495616_0036597 | |||
| 1107 | Ga0495616_0103100 | |||
| 1108 | Ga0495616_0117138 | |||
| 1109 | Ga0495616_0208249 | |||
| 1110 | Ga0495618_0044874 | |||
| 1111 | Ga0495618_0067484 | |||
| 1112 | Ga0495618_0320478 | |||
| 1113 | Ga0495628_0008593 | |||
| 1114 | Ga0495628_0015716 | |||
| 1115 | Ga0495630_0029695 | |||
| 1116 | Ga0495630_0031213 | |||
| 1117 | Ga0495630_0042276 | |||
| 1118 | Ga0495630_0044092 | |||
| 1119 | Ga0495631_0000191 | |||
| 1120 | Ga0495631_0000975 | |||
| 1121 | Ga0495631_0004482 | |||
| 1122 | Ga0495631_0010050 | |||
| 1123 | Ga0495631_0018271 | |||
| 1124 | Ga0495631_0038561 | |||
| 1125 | Ga0495631_0099632 | |||
| 1126 | Ga0495631_0182120 | |||
| 1127 | Ga0495632_0000029 | |||
| 1128 | Ga0495632_0000093 | |||
| 1129 | Ga0495632_0001294 | |||
| 1130 | Ga0495632_0001378 | |||
| 1131 | Ga0495632_0018980 | |||
| 1132 | Ga0495632_0023488 | |||
| 1133 | Ga0495632_0067138 | |||
| 1134 | Ga0495632_0136204 | |||
| 1135 | Ga0495637_0000008 | |||
| 1136 | Ga0495643_0000355 | |||
| 1137 | Ga0495643_0026182 | |||
| 1138 | Ga0495643_0027950 | |||
| 1139 | Ga0495643_0029224 | |||
| 1140 | Ga0495643_0040238 | |||
| 1141 | Ga0495643_0161693 | |||
| 1142 | Ga0495644_0002986 | |||
| 1143 | Ga0495644_0005537 | |||
| 1144 | Ga0495644_0005993 | |||
| 1145 | Ga0495644_0006162 | |||
| 1146 | Ga0495644_0015064 | |||
| 1147 | Ga0495644_0015287 | |||
| 1148 | Ga0495644_0065410 | |||
| 1149 | Ga0495648_0000527 | |||
| 1150 | Ga0495648_0001273 | |||
| 1151 | Ga0495648_0002906 | |||
| 1152 | Ga0495648_0011650 | |||
| 1153 | Ga0495648_0013677 | |||
| 1154 | Ga0495648_0015647 | |||
| 1155 | Ga0495648_0016954 | |||
| 1156 | Ga0495663_0047666 | |||
| 1157 | Ga0495666_0000740 | |||
| 1158 | Ga0495666_0003427 | |||
| 1159 | Ga0495666_0006786 | |||
| 1160 | Ga0495666_0008845 | |||
| 1161 | Ga0495666_0028759 | |||
| 1162 | Ga0495642_0000005 | |||
| 1163 | Ga0495642_0000238 | |||
| 1164 | Ga0495642_0002922 | |||
| 1165 | Ga0495642_0009964 | |||
| 1166 | Ga0495642_0010670 | |||
| 1167 | Ga0495642_0019409 | |||
| 1168 | Ga0495642_0019701 | |||
| 1169 | Ga0495642_0070542 | |||
| 1170 | Ga0495642_0095648 | |||
| 1171 | Ga0495642_0158882 | |||
| 1172 | Ga0495642_0180646 | |||
| 1173 | Ga0495652_0007826 | |||
| 1174 | Ga0495652_0083182 | |||
| 1175 | Ga0495652_0113017 | |||
| 1176 | Ga0495654_0051963 | |||
| 1177 | Ga0495654_0098360 | |||
| 1178 | Ga0495654_0102430 | |||
| 1179 | Ga0495665_0008512 | |||
| 1180 | Ga0495665_0008545 | |||
| 1181 | Ga0495665_0033593 | |||
| 1182 | Ga0495640_0065254 | |||
| 1183 | Ga0495586_0009831 | |||
| 1184 | Ga0495586_0022226 | |||
| 1185 | Ga0495586_0035942 | |||
| 1186 | Ga0495587_0004101 | |||
| 1187 | Ga0495587_0004606 | |||
| 1188 | Ga0495587_0038961 | |||
| 1189 | Ga0495587_0058301 | |||
| 1190 | Ga0495587_0162482 | |||
| 1191 | Ga0495609_0000150 | |||
| 1192 | Ga0495609_0019544 | |||
| 1193 | Ga0495609_0020142 | |||
| 1194 | Ga0495609_0021075 | |||
| 1195 | Ga0495621_0003279 | |||
| 1196 | Ga0495621_0090333 | |||
| 1197 | Ga0495597_0000244 | |||
| 1198 | Ga0495597_0005205 | |||
| 1199 | Ga0495597_0109600 | |||
| 1200 | Ga0495597_0134407 | |||
| 1201 | Ga0495645_0007421 | |||
| 1202 | Ga0495622_0001215 | |||
| 1203 | Ga0495622_0006953 | |||
| 1204 | Ga0495622_0035684 | |||
| 1205 | Ga0495633_0003760 | |||
| 1206 | Ga0495633_0004118 | |||
| 1207 | Ga0495633_0023176 | |||
| 1208 | Ga0495633_0273970 | |||
| 1209 | Ga0495667_0166669 | |||
| 1210 | Ga0495656_0080680 | |||
| 1211 | Ga0495656_0148249 | |||
| 1212 | Ga0495668_0000608 | |||
| 1213 | Ga0495668_0001205 | |||
| 1214 | Ga0495668_0022324 | |||
| 1215 | Ga0495668_0157594 | |||
| 1216 | Ga0495668_0215770 | |||
| 1217 | Ga0495668_0278483 | |||
| 1218 | Ga0495634_0007529 | |||
| 1219 | Ga0495634_0008241 | |||
| 1220 | Ga0495634_0019407 | |||
| 1221 | Ga0495611_0002549 | |||
| 1222 | Ga0495611_0022976 | |||
| 1223 | Ga0495611_0077107 | |||
| 1224 | Ga0495611_0086560 | |||
| 1225 | Ga0495625_0038980 | |||
| 1226 | Ga0495625_0055716 | |||
| 1227 | Ga0495625_0302862 | |||
| 1228 | Ga0495635_0001906 | |||
| 1229 | Ga0495635_0079530 | |||
| 1230 | Ga0495635_0080559 | |||
| 1231 | Ga0495661_0001202 | |||
| 1232 | Ga0495661_0006987 | |||
| 1233 | Ga0495661_0009987 | |||
| 1234 | Ga0495661_0015359 | |||
| 1235 | Ga0495661_0018272 | |||
| 1236 | Ga0495661_0025141 | |||
| 1237 | Ga0495661_0030708 | |||
| 1238 | Ga0495661_0034516 | |||
| 1239 | Ga0495661_0083380 | |||
| 1240 | Ga0495661_0150342 | |||
| 1241 | Ga0495661_0211404 | |||
| 1242 | Ga0495588_0000095 | |||
| 1243 | Ga0495588_0010598 | |||
| 1244 | Ga0495588_0021257 | |||
| 1245 | Ga0495588_0081005 | |||
| 1246 | Ga0495588_0094662 | |||
| 1247 | Ga0495599_0000488 | |||
| 1248 | Ga0495599_0052681 | |||
| 1249 | Ga0495599_0436193 | |||
| 1250 | Ga0495623_0006968 | |||
| 1251 | Ga0495623_0012385 | |||
| 1252 | Ga0495623_0107075 | |||
| 1253 | Ga0495646_0008898 | |||
| 1254 | Ga0495646_0011397 | |||
| 1255 | Ga0495646_0049640 | |||
| 1256 | Ga0495646_0413832 | |||
| 1257 | Ga0495669_0000057 | |||
| 1258 | Ga0495669_0000367 | |||
| 1259 | Ga0495669_0000909 | |||
| 1260 | Ga0495669_0003917 | |||
| 1261 | Ga0495669_0012185 | |||
| 1262 | Ga0495669_0025137 | |||
| 1263 | Ga0495669_0058925 | |||
| 1264 | Ga0495669_0116444 | |||
| 1265 | Ga0495613_0001911 | |||
| 1266 | Ga0495613_0050289 | |||
| 1267 | Ga0495613_0092311 | |||
| 1268 | Ga0495613_0103287 | |||
| 1269 | Ga0495613_0371032 | |||
| 1270 | Ga0495624_0020156 | |||
| 1271 | Ga0495624_0052827 | |||
| 1272 | Ga0495624_0056614 | |||
| 1273 | Ga0495624_0182305 | |||
| 1274 | Ga0495670_0003327 | |||
| 1275 | Ga0495670_0008173 | |||
| 1276 | Ga0495670_0020979 | |||
| 1277 | Ga0495670_0069588 | |||
| 1278 | Ga0495670_0149423 | |||
| 1279 | Ga0495670_0242946 | |||
| 1280 | Ga0495671_0000294 | |||
| 1281 | Ga0495671_0001931 | |||
| 1282 | Ga0495671_0003039 | |||
| 1283 | Ga0495671_0052504 | |||
| 1284 | Ga0495649_0000049 | |||
| 1285 | Ga0495649_0002523 | |||
| 1286 | Ga0495649_0009650 | |||
| 1287 | Ga0495649_0048083 | |||
| 1288 | Ga0495649_0107183 | |||
| 1289 | Ga0495649_0128105 | |||
| 1290 | Ga0495649_0177634 | |||
| 1291 | Ga0495649_0278369 | |||
| 1292 | Ga0495589_0000301 | |||
| 1293 | Ga0495589_0001394 | |||
| 1294 | Ga0495589_0004430 | |||
| 1295 | Ga0495589_0008467 | |||
| 1296 | Ga0495589_0009707 | |||
| 1297 | Ga0495589_0072307 | |||
| 1298 | Ga0495589_0244241 | |||
| 1299 | Ga0495600_0003369 | |||
| 1300 | Ga0495600_0085095 | |||
| 1301 | Ga0495660_0000033 | |||
| 1302 | Ga0495660_0002579 | |||
| 1303 | Ga0495660_0031266 | |||
| 1304 | Ga0495581_0029931 | |||
| 1305 | Ga0495581_0084120 | |||
| 1306 | Ga0495581_0200225 | |||
| 1307 | Ga0495604_0011057 | |||
| 1308 | Ga0495604_0042011 | |||
| 1309 | Ga0495604_0058876 | |||
| 1310 | Ga0495604_0061589 | |||
| 1311 | Ga0495604_0102741 | |||
| 1312 | Ga0495604_0150607 | |||
| 1313 | Ga0495636_0003471 | |||
| 1314 | Ga0495674_0009804 | |||
| 1315 | Ga0495674_0013766 | |||
| 1316 | Ga0495674_0054030 | |||
| 1317 | Ga0495672_0000033 | |||
| 1318 | Ga0495672_0000101 | |||
| 1319 | Ga0495672_0020896 | |||
| 1320 | Ga0495672_0051175 | |||
| 1321 | Ga0495672_0097117 | |||
| 1322 | Ga0495672_0133658 | |||
| 1323 | Ga0495676_0000342 | |||
| 1324 | Ga0495676_0018968 | |||
| 1325 | Ga0495676_0061214 | |||
| 1326 | Ga0495676_0152034 | |||
| 1327 | Ga0495676_0327116 | |||
| 1328 | Ga0495680_0008094 | |||
| 1329 | Ga0495680_0032156 | |||
| 1330 | Ga0495680_0050743 | |||
| 1331 | Ga0495680_0066722 | |||
| 1332 | Ga0495683_0000024 | |||
| 1333 | Ga0495683_0000736 | |||
| 1334 | Ga0495683_0025279 | |||
| 1335 | Ga0495683_0093457 | |||
| 1336 | Ga0495683_0095669 | |||
| 1337 | Ga0495687_000092 | |||
| 1338 | Ga0495687_000182 | |||
| 1339 | Ga0495687_005556 | |||
| 1340 | Ga0495687_050857 | |||
| 1341 | Ga0495675_0007505 | |||
| 1342 | Ga0495675_0007943 | |||
| 1343 | Ga0495675_0011852 | |||
| 1344 | Ga0495675_0026421 | |||
| 1345 | Ga0495677_0000109 | |||
| 1346 | Ga0495677_0000395 | |||
| 1347 | Ga0495677_0000472 | |||
| 1348 | Ga0495677_0002661 | |||
| 1349 | Ga0495677_0006507 | |||
| 1350 | Ga0495677_0023792 | |||
| 1351 | Ga0495677_0038592 | |||
| 1352 | Ga0495677_0042913 | |||
| 1353 | Ga0495677_0060835 | |||
| 1354 | Ga0495677_0202611 | |||
| 1355 | Ga0495679_000512 | |||
| 1356 | Ga0495679_000887 | |||
| 1357 | Ga0495679_008449 | |||
| 1358 | Ga0495679_011876 | |||
| 1359 | Ga0495679_015783 | |||
| 1360 | Ga0495679_058686 | |||
| 1361 | Ga0495685_008691 | |||
| 1362 | Ga0495685_042577 | |||
| 1363 | Ga0495685_055604 | |||
| 1364 | Ga0495673_0015345 | |||
| 1365 | Ga0495681_0000105 | |||
| 1366 | Ga0495681_0002100 | |||
| 1367 | Ga0495681_0017507 | |||
| 1368 | Ga0495681_0083461 | |||
| 1369 | Ga0495681_0112632 | |||
| 1370 | Ga0495684_0045101 | |||
| 1371 | Ga0495686_0005097 | |||
| 1372 | Ga0495686_0027199 | |||
| 1373 | Ga0495593_0004644 | |||
| 1374 | Ga0495593_0008333 | |||
| 1375 | Ga0495593_0008999 | |||
| 1376 | Ga0495593_0131478 | |||
| 1377 | Ga0495593_0234806 | |||
| 1378 | Ga0495602_0000903 | |||
| 1379 | Ga0495602_0005365 | |||
| 1380 | Ga0495602_0024837 | |||
| 1381 | Ga0495602_0039525 | |||
| 1382 | Ga0495602_0590403 | |||
| 1383 | Ga0495614_0004149 | |||
| 1384 | Ga0495614_0010160 | |||
| 1385 | Ga0495614_0023771 | |||
| 1386 | Ga0495615_0008328 | |||
| 1387 | Ga0495626_0000159 | |||
| 1388 | Ga0495626_0004814 | |||
| 1389 | Ga0495626_0005050 | |||
| 1390 | Ga0495626_0006418 | |||
| 1391 | Ga0495626_0012028 | |||
| 1392 | Ga0495626_0015708 | |||
| 1393 | Ga0495626_0022317 | |||
| 1394 | Ga0495626_0028981 | |||
| 1395 | Ga0495626_0055510 | |||
| 1396 | Ga0495626_0059660 | |||
| 1397 | Ga0495626_0192875 | |||
| 1398 | Ga0496100_0008797 | |||
| 1399 | Ga0496101_0006344 | |||
| 1400 | Ga0496101_0260757 | |||
| 1401 | Ga0496102_0030494 | |||
| 1402 | Ga0496102_0045330 | |||
| 1403 | Ga0496102_0290372 | |||
| 1404 | Ga0496102_0906396 | |||
| 1405 | Ga0496103_0002586 | |||
| 1406 | Ga0496103_0030682 | |||
| 1407 | Ga0496104_0024323 | |||
| 1408 | Ga0496104_0050912 | |||
| 1409 | Ga0496104_0460240 | |||
| 1410 | Ga0496105_0004903 | |||
| 1411 | Ga0496105_0097231 | |||
| 1412 | Ga0496106_0022360 | |||
| 1413 | Ga0496106_0031827 | |||
| 1414 | Ga0496106_0033426 | |||
| 1415 | Ga0496106_0511183 | |||
| 1416 | Ga0496108_0161299 | |||
| 1417 | Ga0496109_0166580 | |||
| 1418 | Ga0496110_0080901 | |||
| 1419 | Ga0496110_0118677 | |||
| 1420 | Ga0496110_0412856 | |||
| 1421 | Ga0496111_0092023 | |||
| 1422 | Ga0496112_0343136 | |||
| 1423 | Ga0496114_0054614 | |||
| 1424 | Ga0496114_1088589 | |||
| 1425 | Ga0496117_0005784 | |||
| 1426 | Ga0496117_0167529 | |||
| 1427 | Ga0496118_0000191 | |||
| 1428 | Ga0496118_0011563 | |||
| 1429 | Ga0496122_0288324 | |||
| 1430 | Ga0496124_0007903 | |||
| 1431 | Ga0496124_0341700 | |||
| 1432 | Ga0495678_000024 | |||
| 1433 | Ga0495678_000232 | |||
| 1434 | Ga0495678_001881 | |||
| 1435 | Ga0495678_014858 | |||
| 1436 | Ga0495682_0000210 | |||
| 1437 | Ga0495682_0059736 | |||
| 1438 | Ga0501031_0009849 | |||
| 1439 | Ga0501031_0116672 | |||
| 1440 | Ga0501036_0082121 | |||
| 1441 | Ga0501036_0212973 | |||
| 1442 | Ga0501037_0184195 | |||
| 1443 | Ga0501038_0308605 | |||
| 1444 | Ga0501039_0103676 | |||
| 1445 | Ga0501039_0374608 | |||
| 1446 | Ga0501040_0530270 | |||
| 1447 | Ga0501041_0537559 | |||
| 1448 | Ga0501042_0290336 | |||
| 1449 | Ga0501042_0509377 | |||
| 1450 | Ga0501042_0589884 | |||
| 1451 | Ga0501042_0663448 | |||
| 1452 | Ga0501046_0452250 | |||
| 1453 | Ga0501046_0468154 | |||
| 1454 | Ga0501048_0031824 | |||
| 1455 | Ga0501048_0088048 | |||
| 1456 | Ga0501067_0139149 | |||
| 1457 | Ga0501069_0141732 | |||
| 1458 | Ga0501070_0210567 | |||
| 1459 | Ga0501071_0068610 | |||
| 1460 | Ga0501072_0122974 | |||
| 1461 | Ga0501072_0146704 | |||
| 1462 | Ga0501072_0675650 | |||
| 1463 | Ga0501074_0275072 | |||
| 1464 | Ga0501076_0023191 | |||
| 1465 | Ga0501076_0940367 | |||
| 1466 | Ga0501079_0264496 | |||
| 1467 | Ga0501079_0868381 | |||
| 1468 | Ga0501045_0197394 | |||
| 1469 | nmdc:mga0k408_229311_c1 | |||
| 1470 | nmdc:mga07m45_6970_c1 | |||
| 1471 | nmdc:mga07m45_79487_c1 | |||
| 1472 | nmdc:mga05p37_11022_c1 | |||
| 1473 | nmdc:mga05p37_879889_c1 | |||
| 1474 | nmdc:mga09592_120040_c1 | |||
| 1475 | nmdc:mga09592_1875_c1 | |||
| 1476 | nmdc:mga09592_21641_c1 | |||
| 1477 | nmdc:mga09592_384670_c1 | |||
| 1478 | nmdc:mga09592_82009_c1 | |||
| 1479 | nmdc:mga0qj67_53653_c1 | |||
| 1480 | nmdc:mga06r32_401712_c1 | |||
| 1481 | nmdc:mga08y16_142889_c1 | |||
| 1482 | Ga0500578_0038858 | |||
| 1483 | Ga0466962_0090127 | |||
| 1484 | 2513952521 | |||
| 1485 | 2514041592 | |||
| 1486 | 2644028352 | |||
| 1487 | 2746089015 | |||
| 1488 | 2746097147 | |||
| 1489 | 2809145213 | |||
| 1490 | 2834641862 | |||
| 1491 | 2901308286 | |||
| 1492 | 644750864 | |||
| 1493 | 8003404596 | |||
| 1494 | 8047675520 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yr5-assembly1.cif.gz_A | embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state | 0.4085 | 2 | 220 |
| 8jtc-assembly1.cif.gz_A | human vmat2 complex with reserpine | 0.4008 | 2 | 215 |
| 5c65-assembly1.cif.gz_A | structure of the human glucose transporter glut3 / slc2a3 | 0.3993 | 2 | 219 |
| 2kyh-assembly1.cif.gz_A | solution structure of the voltage-sensing domain of kvap | 0.3992 | 63 | 218 |
| 6lyy-assembly1.cif.gz_A | cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. | 0.3892 | 2 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_H2KYF2_219_420_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4705 | 2 | 216 | 1.20.1250.20 |
| af_C6KSY4_77_351_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4661 | 2 | 214 | 1.20.1250.20 |
| af_Q59WF2_48_242_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4658 | 2 | 216 | 1.20.1250.20 |
| af_H2L0E6_75_299_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4428 | 2 | 215 | 1.20.1250.20 |
| af_Q18544_272_478_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4421 | 2 | 216 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A399ZWD1-F1-model_v4 | Uncharacterized protein | 0.9313 | 2 | 222 |
GO:0016020
|
| AF-A0A242MA57-F1-model_v4 | Arginine/ornithine antiporter ArcD | 0.9168 | 2 | 217 |
GO:0016020
|
| AF-R4WWB2-F1-model_v4 | Uncharacterized protein | 0.9099 | 2 | 215 |
GO:0016020
|
| AF-A0A838NE61-F1-model_v4 | Uncharacterized protein | 0.9027 | 2 | 218 |
GO:0016020
|
| AF-A0A831WZQ8-F1-model_v4 | Uncharacterized protein | 0.9024 | 2 | 222 |
GO:0016020
|