F478928

General Info

Members Datasets Scaffolds Average Seq Length
747 317 1494 215

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0016704|Ga0495626_0016704_36_788
Length 250
Sequence MSTSGRIIARTRSASRAVTARPIRSATLQLDSIHLNTTALWLTVLALGVYHGINPAMGWPLAVANGMAQQRASSVFAALLPLGAGHFMAIAVALAPFAWLGWYVEWSPAIRIGAGTLVLLFGAFRLVHRRHPRLLARIPPTRLAWWSFLMASAHGAGLMLVPFMLGLCVAPAQATGQAAVMSSVARANLGTAVLVAALHALAGLLAGIGMAWIVYRYLGLAFLRRAWLNLDALWGASLVLAGAAGIALGI

Samples

Sample ID Description Type Environment
1 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
251 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
308 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
309 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
310 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
311 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
312 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
313 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
314 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
315 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
316 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
317 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0.4
Rhizoplane 3.75
Rhizosphere 91.43
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495626_0016704 3300048091 Bacteria 3722
2 SwRhRL2b_contig_3689071 2162886007 Bacteria 1503
3 SwRhRL2b_contig_691832 2162886007 Bacteria 1501
4 rootH1_10020786 3300003316 Bacteria 1770
5 JGI25407J50210_10038483 3300003373 Bacteria 1227
6 Ga0065165_1003233 3300005262 Bacteria 11817
7 Ga0065704_10072564 3300005289 Bacteria 8297
8 Ga0065707_10001106 3300005295 Bacteria 7972
9 Ga0065707_10235855 3300005295 Bacteria 1172
10 Ga0070676_10042370 3300005328 Bacteria 2643
11 Ga0070666_10390781 3300005335 Bacteria 999
12 Ga0070680_100221825 3300005336 Bacteria 1596
13 Ga0070682_100259865 3300005337 Bacteria 1256
14 Ga0070660_100027134 3300005339 Bacteria 4271
15 Ga0070660_100511660 3300005339 Bacteria 999
16 Ga0070689_100373387 3300005340 Bacteria 1200
17 Ga0070661_100016223 3300005344 Bacteria 5262
18 Ga0070692_10239362 3300005345 Bacteria 1081
19 Ga0070692_10400158 3300005345 Bacteria 867
20 Ga0070669_100391611 3300005353 Bacteria 1135
21 Ga0070671_100098487 3300005355 Bacteria 2453
22 Ga0070674_100015594 3300005356 Bacteria 4747
23 Ga0070659_100042468 3300005366 Bacteria 3554
24 Ga0070659_100197976 3300005366 Bacteria 1653
25 Ga0070659_100203133 3300005366 Bacteria 1632
26 Ga0070667_100115549 3300005367 Bacteria 2331
27 Ga0070667_100324783 3300005367 Bacteria 1389
28 Ga0070667_100583602 3300005367 Bacteria 1029
29 Ga0070709_10016056 3300005434 Bacteria 4267
30 Ga0070713_100073288 3300005436 Bacteria 2898
31 Ga0070710_10147832 3300005437 Bacteria 1447
32 Ga0070711_100071093 3300005439 Bacteria 2451
33 Ga0070711_100127036 3300005439 Bacteria 1894
34 Ga0070700_100046936 3300005441 Bacteria 2671
35 Ga0070678_100079379 3300005456 Bacteria 2482
36 Ga0070662_100077805 3300005457 Bacteria 2462
37 Ga0070681_10206676 3300005458 Bacteria 1880
38 Ga0070681_10410566 3300005458 Bacteria 1266
39 Ga0068867_100025071 3300005459 Bacteria 4277
40 Ga0070699_100060930 3300005518 Bacteria 3270
41 Ga0070679_100050370 3300005530 Bacteria 4148
42 Ga0070679_100134593 3300005530 Bacteria 2452
43 Ga0070684_100740081 3300005535 Bacteria 918
44 Ga0068853_100466409 3300005539 Bacteria 1189
45 Ga0068853_100560846 3300005539 Bacteria 1082
46 Ga0068853_101054847 3300005539 Bacteria 783
47 Ga0070672_100168923 3300005543 Bacteria 1818
48 Ga0070696_100001766 3300005546 Bacteria 14180
49 Ga0070665_100236364 3300005548 Bacteria 1828
50 Ga0070665_100779908 3300005548 Bacteria 969
51 Ga0068855_100016751 3300005563 Bacteria 8814
52 Ga0068855_100029035 3300005563 Bacteria 6614
53 Ga0068855_100111433 3300005563 Bacteria 3141
54 Ga0068855_100124032 3300005563 Bacteria 2955
55 Ga0070664_100075582 3300005564 Bacteria 2893
56 Ga0070664_100506666 3300005564 Bacteria 1113
57 Ga0068857_100095316 3300005577 Bacteria 2666
58 Ga0068857_100282044 3300005577 Unclassified 1528
59 Ga0068856_100298325 3300005614 Bacteria 1629
60 Ga0070702_100006377 3300005615 Bacteria 5581
61 Ga0068852_100552211 3300005616 Bacteria 1152
62 Ga0068852_100848199 3300005616 Bacteria 929
63 Ga0068852_101308337 3300005616 Bacteria 746
64 Ga0068859_100782907 3300005617 Bacteria 1042
65 Ga0068866_10045161 3300005718 Bacteria 2208
66 Ga0068861_100003803 3300005719 Bacteria 10080
67 Ga0068861_100290932 3300005719 Bacteria 1410
68 Ga0068851_10270520 3300005834 Bacteria 969
69 Ga0068858_100061634 3300005842 Bacteria 3468
70 Ga0068858_100541926 3300005842 Bacteria 1126
71 Ga0068860_100029669 3300005843 Bacteria 5262
72 Ga0068862_100073210 3300005844 Bacteria 2961
73 Ga0081538_10022702 3300005981 Bacteria 4538
74 Ga0081538_10113438 3300005981 Bacteria 1324
75 Ga0070712_100402387 3300006175 Bacteria 1131
76 Ga0075366_10059712 3300006195 Bacteria 2265
77 Ga0075370_10005241 3300006353 Bacteria 6415
78 Ga0075370_10074427 3300006353 Bacteria 1946
79 Ga0075370_10120390 3300006353 Bacteria 1528
80 Ga0075428_100193339 3300006844 Bacteria 2200
81 Ga0075428_101083391 3300006844 Bacteria 846
82 Ga0075430_100299204 3300006846 Bacteria 1331
83 Ga0075430_100459513 3300006846 Bacteria 1051
84 Ga0075430_100969239 3300006846 Bacteria 701
85 Ga0075429_100007849 3300006880 Bacteria 9270
86 Ga0075429_100011170 3300006880 Bacteria 7774
87 Ga0075429_100016236 3300006880 Bacteria 6451
88 Ga0075429_100047339 3300006880 Bacteria 3741
89 Ga0075429_100048159 3300006880 Bacteria 3708
90 Ga0075429_100489530 3300006880 Bacteria 1077
91 Ga0068865_100599241 3300006881 Bacteria 931
92 Ga0097620_100783007 3300006931 Bacteria 1042
93 Ga0105240_10002099 3300009093 Bacteria 32606
94 Ga0111539_10009836 3300009094 Bacteria 12067
95 Ga0105247_10546685 3300009101 Bacteria 851
96 Ga0114129_10012487 3300009147 Bacteria 12093
97 Ga0114129_10082229 3300009147 Bacteria 4475
98 Ga0114129_10224362 3300009147 Bacteria 2533
99 Ga0114129_10897319 3300009147 Bacteria 1123
100 Ga0105243_10106703 3300009148 Bacteria 2335
101 Ga0105243_10209633 3300009148 Bacteria 1715
102 Ga0105248_11004002 3300009177 Bacteria 943
103 Ga0105237_10220507 3300009545 Bacteria 1897
104 Ga0105237_10336066 3300009545 Bacteria 1515
105 Ga0105238_10021066 3300009551 Bacteria 6643
106 Ga0105238_10035120 3300009551 Bacteria 5099
107 Ga0105238_10241825 3300009551 Bacteria 1783
108 Ga0105238_10300975 3300009551 Bacteria 1587
109 Ga0105238_10974428 3300009551 Bacteria 868
110 Ga0105249_10241916 3300009553 Bacteria 1785
111 Ga0157370_10081352 3300013104 Bacteria 3048
112 Ga0157370_10577580 3300013104 Bacteria 1030
113 Ga0157369_10265515 3300013105 Bacteria 1789
114 Ga0157374_10082454 3300013296 Bacteria 3053
115 Ga0157378_10074989 3300013297 Bacteria 3045
116 Ga0163162_10028413 3300013306 Bacteria 5534
117 Ga0163162_10062499 3300013306 Bacteria 3764
118 Ga0157372_10006140 3300013307 Bacteria 12763
119 Ga0157372_10406165 3300013307 Bacteria 1587
120 Ga0157372_10415440 3300013307 Bacteria 1568
121 Ga0157375_10110095 3300013308 Bacteria 2851
122 Ga0163163_10634836 3300014325 Bacteria 1131
123 Ga0157380_10079549 3300014326 Bacteria 2677
124 Ga0157380_10877486 3300014326 Bacteria 921
125 Ga0182008_10006544 3300014497 Bacteria 6504
126 Ga0182006_1025195 3300015261 Bacteria 2445
127 Ga0182007_10001940 3300015262 Bacteria 10708
128 Ga0213875_10004817 3300021388 Bacteria 7333
129 Ga0209051_1002550 3300025303 Bacteria 12865
130 Ga0209051_1008603 3300025303 Bacteria 5382
131 Ga0207682_10041522 3300025893 Bacteria 1877
132 Ga0207682_10057574 3300025893 Bacteria 1621
133 Ga0207692_10090681 3300025898 Bacteria 1657
134 Ga0207680_10462675 3300025903 Bacteria 901
135 Ga0207707_10101000 3300025912 Bacteria 2521
136 Ga0207695_10254316 3300025913 Bacteria 1656
137 Ga0207693_10251507 3300025915 Bacteria 1387
138 Ga0207663_10046549 3300025916 Bacteria 2673
139 Ga0207660_10174837 3300025917 Bacteria 1664
140 Ga0207662_10504122 3300025918 Bacteria 834
141 Ga0207657_10303264 3300025919 Bacteria 1265
142 Ga0207649_10579062 3300025920 Unclassified 862
143 Ga0207652_10024345 3300025921 Bacteria 5022
144 Ga0207652_10150780 3300025921 Bacteria 2082
145 Ga0207652_10210043 3300025921 Bacteria 1753
146 Ga0207694_10138556 3300025924 Bacteria 1955
147 Ga0207700_10069547 3300025928 Bacteria 2702
148 Ga0207664_10198088 3300025929 Bacteria 1732
149 Ga0207690_10029251 3300025932 Bacteria 3501
150 Ga0207690_10474582 3300025932 Bacteria 1009
151 Ga0207690_10868071 3300025932 Bacteria 747
152 Ga0207706_10176268 3300025933 Bacteria 1878
153 Ga0207669_10277136 3300025937 Bacteria 1263
154 Ga0207704_10034759 3300025938 Bacteria 2879
155 Ga0207691_10170113 3300025940 Bacteria 1908
156 Ga0207679_10425922 3300025945 Bacteria 1172
157 Ga0207667_10193783 3300025949 Bacteria 2085
158 Ga0207667_10212676 3300025949 Bacteria 1982
159 Ga0207667_10247033 3300025949 Bacteria 1826
160 Ga0207667_10463788 3300025949 Bacteria 1286
161 Ga0207712_10055408 3300025961 Bacteria 2789
162 Ga0207668_10428534 3300025972 Bacteria 1124
163 Ga0207640_10796944 3300025981 Bacteria 818
164 Ga0207658_10094643 3300025986 Bacteria 2325
165 Ga0207677_10809171 3300026023 Bacteria 839
166 Ga0207639_10535346 3300026041 Bacteria 1074
167 Ga0207678_10080001 3300026067 Bacteria 2798
168 Ga0207708_10042293 3300026075 Bacteria 3473
169 Ga0207708_10056930 3300026075 Bacteria 2982
170 Ga0207702_10628909 3300026078 Bacteria 1055
171 Ga0207648_10002759 3300026089 Bacteria 18661
172 Ga0207648_10508489 3300026089 Bacteria 1103
173 Ga0207674_10146990 3300026116 Bacteria 2315
174 Ga0207675_100089740 3300026118 Bacteria 2889
175 Ga0207675_100207706 3300026118 Bacteria 1882
176 Ga0207683_10774313 3300026121 Bacteria 890
177 Ga0209974_10001262 3300027876 Bacteria 9081
178 Ga0207428_10014792 3300027907 Bacteria 6758
179 Ga0268266_10107633 3300028379 Bacteria 2466
180 Ga0268266_10312057 3300028379 Bacteria 1470
181 Ga0268265_10071825 3300028380 Bacteria 2697
182 Ga0307517_10079942 3300028786 Bacteria 2806
183 Ga0307515_10000240 3300028794 Bacteria 135655
184 Ga0307515_10035008 3300028794 Bacteria 8189
185 Ga0265327_10157056 3300031251 Bacteria 1053
186 Ga0307513_10124044 3300031456 Bacteria 2543
187 Ga0307408_100122295 3300031548 Bacteria 2018
188 Ga0307508_10146074 3300031616 Bacteria 1969
189 Ga0307516_10000178 3300031730 Bacteria 81997
190 Ga0307405_10126732 3300031731 Bacteria 1757
191 Ga0307405_10536784 3300031731 Bacteria 944
192 Ga0307406_10039460 3300031901 Bacteria 2930
193 Ga0307406_10261272 3300031901 Bacteria 1310
194 Ga0307407_10120013 3300031903 Bacteria 1665
195 Ga0307412_10050187 3300031911 Bacteria 2753
196 Ga0307409_100046083 3300031995 Bacteria 3298
197 Ga0307416_100308248 3300032002 Bacteria 1578
198 Ga0307416_100557767 3300032002 Unclassified 1220
199 Ga0307416_100628916 3300032002 Bacteria 1156
200 Ga0307411_10009916 3300032005 Bacteria 5043
201 Ga0307415_100723599 3300032126 Unclassified 901
202 Ga0373932_0149698 3300035112 Bacteria 800
203 Ga0373931_0005378 3300035691 Bacteria 5913
204 Ga0373927_0187164 3300035695 Bacteria 1358
205 Ga0373947_0199461 3300035725 Bacteria 1309
206 Ga0395899_0256566 3300037312 Bacteria 1198
207 Ga0395900_0030240 3300037418 Bacteria 5559
208 Ga0395900_0233966 3300037418 Bacteria 1846
209 Ga0395900_0463490 3300037418 Bacteria 1222
210 Ga0395900_1138898 3300037418 Bacteria 697
211 Ga0395898_0015576 3300037466 Bacteria 7795
212 Ga0395898_0025664 3300037466 Bacteria 5936
213 Ga0395905_0013083 3300037471 Bacteria 7965
214 Ga0395905_0049512 3300037471 Bacteria 3937
215 Ga0436364_0397135 3300037853 Bacteria 10337
216 Ga0395901_0131440 3300038443 Bacteria 2630
217 Ga0395901_0189485 3300038443 Bacteria 2157
218 Ga0451807_0581502 3300041486 Unclassified 778
219 Ga0451853_2690907 3300041512 Bacteria 1189
220 Ga0450898_017121 3300042134 Bacteria 1244
221 Ga0439460_0016907 3300042461 Bacteria 1948
222 Ga0451577_0388554 3300042876 Bacteria 1266
223 Ga0466969_0021538 3300044656 Bacteria 3332
224 Ga0466972_0060216 3300044658 Bacteria 1822
225 Ga0466972_0349389 3300044658 Bacteria 692
226 Ga0453683_0003827 3300044673 Bacteria 10929
227 Ga0466965_0176611 3300044683 Bacteria 1125
228 Ga0466966_0009244 3300044684 Bacteria 6526
229 Ga0466966_0295617 3300044684 Bacteria 973
230 Ga0466961_0315002 3300044693 Bacteria 955
231 Ga0466963_0061592 3300044694 Bacteria 2509
232 Ga0466964_0021131 3300044706 Bacteria 2515
233 Ga0453684_0232665 3300044712 Bacteria 2126
234 Ga0453684_0450449 3300044712 Unclassified 1433
235 Ga0466971_0022195 3300044719 Bacteria 2827
236 Ga0466970_0075903 3300044765 Bacteria 1810
237 Ga0466970_0272555 3300044765 Bacteria 951
238 Ga0466957_0354745 3300044842 Bacteria 996
239 Ga0466957_0470343 3300044842 Bacteria 868
240 Ga0466960_0057093 3300044901 Bacteria 1902
241 Ga0466960_0260009 3300044901 Bacteria 967
242 Ga0466959_0512271 3300045049 Bacteria 810
243 Ga0451576_0013172 3300045051 Bacteria 9254
244 Ga0451576_0050287 3300045051 Bacteria 4371
245 Ga0451576_0298393 3300045051 Bacteria 1685
246 Ga0466958_0072360 3300045836 Bacteria 2111
247 Ga0466967_0200518 3300045976 Bacteria 1890
248 Ga0466967_0943501 3300045976 Bacteria 858
249 Ga0495617_023793 3300046452 Bacteria 2068
250 Ga0495617_069076 3300046452 Bacteria 1162
251 Ga0495627_000123 3300046453 Bacteria 94862
252 Ga0495627_041907 3300046453 Bacteria 1404
253 Ga0495592_0002556 3300046454 Bacteria 12854
254 Ga0495592_0036200 3300046454 Bacteria 3718
255 Ga0495592_0150500 3300046454 Bacteria 1610
256 Ga0495592_0309971 3300046454 Bacteria 1023
257 Ga0495603_0018829 3300046455 Bacteria 4179
258 Ga0495590_0000013 3300046457 Bacteria 271977
259 Ga0495590_0006656 3300046457 Bacteria 4503
260 Ga0495590_0048968 3300046457 Bacteria 1474
261 Ga0495590_0218929 3300046457 Bacteria 703
262 Ga0495591_000176 3300046458 Bacteria 66020
263 Ga0495591_001974 3300046458 Bacteria 11977
264 Ga0495591_022165 3300046458 Bacteria 2058
265 Ga0495629_0002874 3300046459 Bacteria 13164
266 Ga0495629_0010779 3300046459 Bacteria 6648
267 Ga0495629_0040661 3300046459 Bacteria 3271
268 Ga0495629_0043689 3300046459 Bacteria 3146
269 Ga0495629_0552502 3300046459 Bacteria 773
270 Ga0495641_0007351 3300046461 Bacteria 6897
271 Ga0495651_0006500 3300046462 Bacteria 8931
272 Ga0495651_0094885 3300046462 Bacteria 2232
273 Ga0495653_0024517 3300046463 Bacteria 4859
274 Ga0495653_0039895 3300046463 Bacteria 3674
275 Ga0495653_0066935 3300046463 Bacteria 2700
276 Ga0495650_0000351 3300046471 Bacteria 81358
277 Ga0495650_0008888 3300046471 Bacteria 5790
278 Ga0495650_0018786 3300046471 Bacteria 3426
279 Ga0495650_0034727 3300046471 Bacteria 2228
280 Ga0495580_0003010 3300046472 Bacteria 14451
281 Ga0495580_0006041 3300046472 Bacteria 9912
282 Ga0495580_0020633 3300046472 Bacteria 4873
283 Ga0495580_0031056 3300046472 Bacteria 3863
284 Ga0495580_0041850 3300046472 Bacteria 3266
285 Ga0495580_0138913 3300046472 Bacteria 1685
286 Ga0495580_0207020 3300046472 Bacteria 1350
287 Ga0495582_0001111 3300046473 Bacteria 15122
288 Ga0495582_0003293 3300046473 Bacteria 9075
289 Ga0495582_0050673 3300046473 Bacteria 2288
290 Ga0495605_0000035 3300046474 Bacteria 208069
291 Ga0495605_0000304 3300046474 Bacteria 52709
292 Ga0495605_0009658 3300046474 Bacteria 5420
293 Ga0495605_0018039 3300046474 Bacteria 3789
294 Ga0495605_0033330 3300046474 Bacteria 2615
295 Ga0495605_0099139 3300046474 Bacteria 1341
296 Ga0495605_0142685 3300046474 Bacteria 1073
297 Ga0495605_0227948 3300046474 Bacteria 803
298 Ga0495662_0017509 3300046476 Bacteria 3467
299 Ga0495664_0000124 3300046477 Bacteria 38912
300 Ga0495664_0066327 3300046477 Bacteria 2152
301 Ga0495664_0072002 3300046477 Bacteria 2065
302 Ga0495664_0109251 3300046477 Bacteria 1669
303 Ga0495664_0146918 3300046477 Bacteria 1430
304 Ga0495584_0000029 3300046491 Bacteria 105850
305 Ga0495584_0003088 3300046491 Bacteria 9258
306 Ga0495584_0005616 3300046491 Bacteria 6632
307 Ga0495584_0021549 3300046491 Bacteria 3273
308 Ga0495584_0086811 3300046491 Bacteria 1576
309 Ga0495585_0005636 3300046492 Bacteria 7864
310 Ga0495585_0007619 3300046492 Bacteria 6614
311 Ga0495585_0024263 3300046492 Bacteria 3478
312 Ga0495585_0040910 3300046492 Bacteria 2601
313 Ga0495585_0062135 3300046492 Bacteria 2051
314 Ga0495585_0096783 3300046492 Bacteria 1583
315 Ga0495585_0191930 3300046492 Bacteria 1044
316 Ga0495594_0069067 3300046499 Bacteria 1962
317 Ga0495594_0073726 3300046499 Bacteria 1900
318 Ga0495594_0214566 3300046499 Bacteria 1097
319 Ga0495596_0001306 3300046500 Bacteria 14374
320 Ga0495596_0001904 3300046500 Bacteria 11589
321 Ga0495596_0004541 3300046500 Bacteria 6744
322 Ga0495596_0005279 3300046500 Bacteria 6131
323 Ga0495596_0010930 3300046500 Bacteria 3933
324 Ga0495596_0012564 3300046500 Bacteria 3621
325 Ga0495596_0013086 3300046500 Bacteria 3531
326 Ga0495596_0016193 3300046500 Bacteria 3101
327 Ga0495596_0024049 3300046500 Bacteria 2470
328 Ga0495607_0001166 3300046501 Bacteria 23766
329 Ga0495607_0002941 3300046501 Bacteria 13403
330 Ga0495607_0006050 3300046501 Bacteria 8566
331 Ga0495607_0008238 3300046501 Bacteria 7132
332 Ga0495607_0012193 3300046501 Bacteria 5683
333 Ga0495607_0016296 3300046501 Bacteria 4798
334 Ga0495607_0095959 3300046501 Bacteria 1597
335 Ga0495607_0184039 3300046501 Bacteria 1045
336 Ga0495583_0000388 3300046506 Bacteria 67604
337 Ga0495583_0000461 3300046506 Bacteria 60164
338 Ga0495583_0001436 3300046506 Bacteria 24217
339 Ga0495583_0005194 3300046506 Bacteria 8959
340 Ga0495583_0007573 3300046506 Bacteria 6788
341 Ga0495583_0014656 3300046506 Bacteria 4312
342 Ga0495583_0020902 3300046506 Bacteria 3376
343 Ga0495583_0055118 3300046506 Bacteria 1797
344 Ga0495606_0010213 3300046507 Bacteria 7824
345 Ga0495606_0018876 3300046507 Bacteria 5155
346 Ga0495606_0147335 3300046507 Bacteria 1384
347 Ga0495606_0170613 3300046507 Bacteria 1262
348 Ga0495606_0192235 3300046507 Bacteria 1169
349 Ga0495606_0215670 3300046507 Bacteria 1084
350 Ga0495606_0247208 3300046507 Bacteria 991
351 Ga0495608_0015926 3300046511 Bacteria 5204
352 Ga0495610_0001374 3300046512 Bacteria 21625
353 Ga0495616_0000148 3300046513 Bacteria 61405
354 Ga0495616_0003086 3300046513 Bacteria 10789
355 Ga0495616_0006608 3300046513 Bacteria 7007
356 Ga0495616_0014900 3300046513 Bacteria 4338
357 Ga0495616_0019471 3300046513 Bacteria 3703
358 Ga0495616_0034549 3300046513 Bacteria 2625
359 Ga0495616_0036597 3300046513 Bacteria 2531
360 Ga0495616_0103100 3300046513 Bacteria 1336
361 Ga0495616_0117138 3300046513 Bacteria 1232
362 Ga0495616_0208249 3300046513 Bacteria 856
363 Ga0495618_0044874 3300046514 Bacteria 2787
364 Ga0495618_0067484 3300046514 Bacteria 2274
365 Ga0495618_0320478 3300046514 Bacteria 960
366 Ga0495628_0008593 3300046516 Bacteria 8749
367 Ga0495628_0015716 3300046516 Bacteria 6318
368 Ga0495630_0029695 3300046517 Bacteria 4064
369 Ga0495630_0031213 3300046517 Bacteria 3966
370 Ga0495630_0042276 3300046517 Bacteria 3403
371 Ga0495630_0044092 3300046517 Bacteria 3333
372 Ga0495631_0000191 3300046518 Bacteria 41842
373 Ga0495631_0000975 3300046518 Bacteria 17773
374 Ga0495631_0004482 3300046518 Bacteria 7427
375 Ga0495631_0010050 3300046518 Bacteria 4701
376 Ga0495631_0018271 3300046518 Bacteria 3303
377 Ga0495631_0038561 3300046518 Bacteria 2123
378 Ga0495631_0099632 3300046518 Bacteria 1251
379 Ga0495631_0182120 3300046518 Bacteria 900
380 Ga0495632_0000029 3300046519 Bacteria 171022
381 Ga0495632_0000093 3300046519 Bacteria 91309
382 Ga0495632_0001294 3300046519 Bacteria 21160
383 Ga0495632_0001378 3300046519 Bacteria 20371
384 Ga0495632_0018980 3300046519 Bacteria 3755
385 Ga0495632_0023488 3300046519 Bacteria 3292
386 Ga0495632_0067138 3300046519 Bacteria 1730
387 Ga0495632_0136204 3300046519 Bacteria 1141
388 Ga0495637_0000008 3300046520 Bacteria 404658
389 Ga0495643_0000355 3300046522 Bacteria 62412
390 Ga0495643_0026182 3300046522 Bacteria 3293
391 Ga0495643_0027950 3300046522 Bacteria 3166
392 Ga0495643_0029224 3300046522 Bacteria 3084
393 Ga0495643_0040238 3300046522 Bacteria 2553
394 Ga0495643_0161693 3300046522 Bacteria 1101
395 Ga0495644_0002986 3300046523 Bacteria 6696
396 Ga0495644_0005537 3300046523 Bacteria 4930
397 Ga0495644_0005993 3300046523 Bacteria 4735
398 Ga0495644_0006162 3300046523 Bacteria 4662
399 Ga0495644_0015064 3300046523 Bacteria 2961
400 Ga0495644_0015287 3300046523 Bacteria 2939
401 Ga0495644_0065410 3300046523 Bacteria 1366
402 Ga0495648_0000527 3300046524 Bacteria 41184
403 Ga0495648_0001273 3300046524 Bacteria 25146
404 Ga0495648_0002906 3300046524 Bacteria 15405
405 Ga0495648_0011650 3300046524 Bacteria 6607
406 Ga0495648_0013677 3300046524 Bacteria 5985
407 Ga0495648_0015647 3300046524 Bacteria 5497
408 Ga0495648_0016954 3300046524 Bacteria 5231
409 Ga0495663_0047666 3300046525 Bacteria 1320
410 Ga0495666_0000740 3300046526 Bacteria 14988
411 Ga0495666_0003427 3300046526 Bacteria 7997
412 Ga0495666_0006786 3300046526 Bacteria 5751
413 Ga0495666_0008845 3300046526 Bacteria 5045
414 Ga0495666_0028759 3300046526 Bacteria 2734
415 Ga0495642_0000005 3300046528 Bacteria 176726
416 Ga0495642_0000238 3300046528 Bacteria 30959
417 Ga0495642_0002922 3300046528 Bacteria 6804
418 Ga0495642_0009964 3300046528 Bacteria 3640
419 Ga0495642_0010670 3300046528 Bacteria 3518
420 Ga0495642_0019409 3300046528 Bacteria 2665
421 Ga0495642_0019701 3300046528 Bacteria 2646
422 Ga0495642_0070542 3300046528 Bacteria 1461
423 Ga0495642_0095648 3300046528 Bacteria 1260
424 Ga0495642_0158882 3300046528 Bacteria 979
425 Ga0495642_0180646 3300046528 Bacteria 918
426 Ga0495652_0007826 3300046529 Bacteria 9815
427 Ga0495652_0083182 3300046529 Bacteria 2635
428 Ga0495652_0113017 3300046529 Bacteria 2181
429 Ga0495654_0051963 3300046530 Bacteria 1998
430 Ga0495654_0098360 3300046530 Bacteria 1350
431 Ga0495654_0102430 3300046530 Bacteria 1316
432 Ga0495665_0008512 3300046531 Bacteria 5569
433 Ga0495665_0008545 3300046531 Bacteria 5555
434 Ga0495665_0033593 3300046531 Bacteria 2743
435 Ga0495640_0065254 3300046533 Bacteria 2458
436 Ga0495586_0009831 3300046535 Bacteria 5093
437 Ga0495586_0022226 3300046535 Bacteria 3383
438 Ga0495586_0035942 3300046535 Bacteria 2660
439 Ga0495587_0004101 3300046536 Bacteria 9639
440 Ga0495587_0004606 3300046536 Bacteria 9066
441 Ga0495587_0038961 3300046536 Bacteria 2847
442 Ga0495587_0058301 3300046536 Bacteria 2268
443 Ga0495587_0162482 3300046536 Bacteria 1270
444 Ga0495609_0000150 3300046538 Bacteria 72210
445 Ga0495609_0019544 3300046538 Bacteria 3133
446 Ga0495609_0020142 3300046538 Bacteria 3082
447 Ga0495609_0021075 3300046538 Bacteria 3007
448 Ga0495621_0003279 3300046539 Bacteria 4451
449 Ga0495621_0090333 3300046539 Bacteria 1154
450 Ga0495597_0000244 3300046542 Bacteria 49472
451 Ga0495597_0005205 3300046542 Bacteria 6922
452 Ga0495597_0109600 3300046542 Bacteria 1158
453 Ga0495597_0134407 3300046542 Bacteria 1024
454 Ga0495645_0007421 3300046543 Bacteria 7629
455 Ga0495622_0001215 3300046557 Bacteria 13247
456 Ga0495622_0006953 3300046557 Bacteria 5251
457 Ga0495622_0035684 3300046557 Bacteria 2318
458 Ga0495633_0003760 3300046558 Bacteria 9976
459 Ga0495633_0004118 3300046558 Bacteria 9374
460 Ga0495633_0023176 3300046558 Bacteria 3076
461 Ga0495633_0273970 3300046558 Bacteria 768
462 Ga0495667_0166669 3300046559 Bacteria 1416
463 Ga0495656_0080680 3300046615 Bacteria 1467
464 Ga0495656_0148249 3300046615 Bacteria 1131
465 Ga0495668_0000608 3300046616 Bacteria 43304
466 Ga0495668_0001205 3300046616 Bacteria 26279
467 Ga0495668_0022324 3300046616 Bacteria 3618
468 Ga0495668_0157594 3300046616 Bacteria 1243
469 Ga0495668_0215770 3300046616 Bacteria 1050
470 Ga0495668_0278483 3300046616 Bacteria 916
471 Ga0495634_0007529 3300046642 Bacteria 8162
472 Ga0495634_0008241 3300046642 Bacteria 7772
473 Ga0495634_0019407 3300046642 Bacteria 4831
474 Ga0495611_0002549 3300046648 Bacteria 8265
475 Ga0495611_0022976 3300046648 Bacteria 2701
476 Ga0495611_0077107 3300046648 Bacteria 1528
477 Ga0495611_0086560 3300046648 Bacteria 1445
478 Ga0495625_0038980 3300046660 Bacteria 3473
479 Ga0495625_0055716 3300046660 Bacteria 2818
480 Ga0495625_0302862 3300046660 Bacteria 1022
481 Ga0495635_0001906 3300046663 Bacteria 14171
482 Ga0495635_0079530 3300046663 Bacteria 2244
483 Ga0495635_0080559 3300046663 Bacteria 2228
484 Ga0495661_0001202 3300046665 Bacteria 22463
485 Ga0495661_0006987 3300046665 Bacteria 7891
486 Ga0495661_0009987 3300046665 Bacteria 6489
487 Ga0495661_0015359 3300046665 Bacteria 5110
488 Ga0495661_0018272 3300046665 Bacteria 4615
489 Ga0495661_0025141 3300046665 Bacteria 3849
490 Ga0495661_0030708 3300046665 Bacteria 3418
491 Ga0495661_0034516 3300046665 Bacteria 3182
492 Ga0495661_0083380 3300046665 Bacteria 1837
493 Ga0495661_0150342 3300046665 Bacteria 1258
494 Ga0495661_0211404 3300046665 Bacteria 1010
495 Ga0495588_0000095 3300046674 Bacteria 175627
496 Ga0495588_0010598 3300046674 Bacteria 4292
497 Ga0495588_0021257 3300046674 Bacteria 3196
498 Ga0495588_0081005 3300046674 Bacteria 1694
499 Ga0495588_0094662 3300046674 Bacteria 1566
500 Ga0495599_0000488 3300046678 Bacteria 22611
501 Ga0495599_0052681 3300046678 Bacteria 2549
502 Ga0495599_0436193 3300046678 Bacteria 777
503 Ga0495623_0006968 3300046679 Bacteria 7345
504 Ga0495623_0012385 3300046679 Bacteria 5523
505 Ga0495623_0107075 3300046679 Bacteria 1698
506 Ga0495646_0008898 3300046680 Bacteria 6376
507 Ga0495646_0011397 3300046680 Bacteria 5645
508 Ga0495646_0049640 3300046680 Bacteria 2546
509 Ga0495646_0413832 3300046680 Bacteria 700
510 Ga0495669_0000057 3300046684 Bacteria 76704
511 Ga0495669_0000367 3300046684 Bacteria 23040
512 Ga0495669_0000909 3300046684 Bacteria 12404
513 Ga0495669_0003917 3300046684 Bacteria 6129
514 Ga0495669_0012185 3300046684 Bacteria 3658
515 Ga0495669_0025137 3300046684 Bacteria 2596
516 Ga0495669_0058925 3300046684 Bacteria 1733
517 Ga0495669_0116444 3300046684 Bacteria 1251
518 Ga0495613_0001911 3300046689 Bacteria 15798
519 Ga0495613_0050289 3300046689 Bacteria 3074
520 Ga0495613_0092311 3300046689 Bacteria 2192
521 Ga0495613_0103287 3300046689 Bacteria 2058
522 Ga0495613_0371032 3300046689 Bacteria 980
523 Ga0495624_0020156 3300046690 Bacteria 4441
524 Ga0495624_0052827 3300046690 Bacteria 2567
525 Ga0495624_0056614 3300046690 Bacteria 2466
526 Ga0495624_0182305 3300046690 Bacteria 1279
527 Ga0495670_0003327 3300046691 Bacteria 7917
528 Ga0495670_0008173 3300046691 Bacteria 5144
529 Ga0495670_0020979 3300046691 Bacteria 3221
530 Ga0495670_0069588 3300046691 Bacteria 1779
531 Ga0495670_0149423 3300046691 Bacteria 1225
532 Ga0495670_0242946 3300046691 Bacteria 959
533 Ga0495671_0000294 3300046692 Bacteria 41764
534 Ga0495671_0001931 3300046692 Bacteria 13306
535 Ga0495671_0003039 3300046692 Bacteria 10423
536 Ga0495671_0052504 3300046692 Bacteria 2026
537 Ga0495649_0000049 3300046694 Bacteria 113865
538 Ga0495649_0002523 3300046694 Bacteria 12843
539 Ga0495649_0009650 3300046694 Bacteria 5722
540 Ga0495649_0048083 3300046694 Bacteria 2318
541 Ga0495649_0107183 3300046694 Bacteria 1483
542 Ga0495649_0128105 3300046694 Bacteria 1340
543 Ga0495649_0177634 3300046694 Bacteria 1112
544 Ga0495649_0278369 3300046694 Bacteria 855
545 Ga0495589_0000301 3300046794 Bacteria 39328
546 Ga0495589_0001394 3300046794 Bacteria 14026
547 Ga0495589_0004430 3300046794 Bacteria 7479
548 Ga0495589_0008467 3300046794 Bacteria 5368
549 Ga0495589_0009707 3300046794 Bacteria 5000
550 Ga0495589_0072307 3300046794 Bacteria 1684
551 Ga0495589_0244241 3300046794 Bacteria 840
552 Ga0495600_0003369 3300046809 Bacteria 9399
553 Ga0495600_0085095 3300046809 Bacteria 2063
554 Ga0495660_0000033 3300046810 Bacteria 212425
555 Ga0495660_0002579 3300046810 Bacteria 11513
556 Ga0495660_0031266 3300046810 Bacteria 2993
557 Ga0495581_0029931 3300047315 Bacteria 3156
558 Ga0495581_0084120 3300047315 Bacteria 1843
559 Ga0495581_0200225 3300047315 Bacteria 1168
560 Ga0495604_0011057 3300047317 Bacteria 7162
561 Ga0495604_0042011 3300047317 Bacteria 3584
562 Ga0495604_0058876 3300047317 Bacteria 2948
563 Ga0495604_0061589 3300047317 Bacteria 2869
564 Ga0495604_0102741 3300047317 Bacteria 2098
565 Ga0495604_0150607 3300047317 Bacteria 1653
566 Ga0495636_0003471 3300047318 Bacteria 6121
567 Ga0495674_0009804 3300047319 Bacteria 9095
568 Ga0495674_0013766 3300047319 Bacteria 7593
569 Ga0495674_0054030 3300047319 Bacteria 3529
570 Ga0495672_0000033 3300047320 Bacteria 291992
571 Ga0495672_0000101 3300047320 Bacteria 139193
572 Ga0495672_0020896 3300047320 Bacteria 4280
573 Ga0495672_0051175 3300047320 Bacteria 2434
574 Ga0495672_0097117 3300047320 Bacteria 1605
575 Ga0495672_0133658 3300047320 Bacteria 1302
576 Ga0495676_0000342 3300047321 Bacteria 38031
577 Ga0495676_0018968 3300047321 Bacteria 6058
578 Ga0495676_0061214 3300047321 Bacteria 2945
579 Ga0495676_0152034 3300047321 Bacteria 1646
580 Ga0495676_0327116 3300047321 Bacteria 1029
581 Ga0495680_0008094 3300047322 Bacteria 9583
582 Ga0495680_0032156 3300047322 Bacteria 4263
583 Ga0495680_0050743 3300047322 Bacteria 3242
584 Ga0495680_0066722 3300047322 Bacteria 2753
585 Ga0495683_0000024 3300047323 Bacteria 156554
586 Ga0495683_0000736 3300047323 Bacteria 23733
587 Ga0495683_0025279 3300047323 Bacteria 3046
588 Ga0495683_0093457 3300047323 Bacteria 1454
589 Ga0495683_0095669 3300047323 Bacteria 1433
590 Ga0495687_000092 3300047443 Bacteria 140313
591 Ga0495687_000182 3300047443 Bacteria 91333
592 Ga0495687_005556 3300047443 Bacteria 7996
593 Ga0495687_050857 3300047443 Bacteria 1763
594 Ga0495675_0007505 3300047444 Bacteria 6719
595 Ga0495675_0007943 3300047444 Bacteria 6559
596 Ga0495675_0011852 3300047444 Bacteria 5479
597 Ga0495675_0026421 3300047444 Bacteria 3702
598 Ga0495677_0000109 3300047445 Bacteria 41192
599 Ga0495677_0000395 3300047445 Bacteria 18625
600 Ga0495677_0000472 3300047445 Bacteria 17222
601 Ga0495677_0002661 3300047445 Bacteria 6982
602 Ga0495677_0006507 3300047445 Bacteria 4413
603 Ga0495677_0023792 3300047445 Bacteria 2222
604 Ga0495677_0038592 3300047445 Bacteria 1745
605 Ga0495677_0042913 3300047445 Bacteria 1657
606 Ga0495677_0060835 3300047445 Bacteria 1400
607 Ga0495677_0202611 3300047445 Bacteria 771
608 Ga0495679_000512 3300047446 Bacteria 27579
609 Ga0495679_000887 3300047446 Bacteria 18727
610 Ga0495679_008449 3300047446 Bacteria 4185
611 Ga0495679_011876 3300047446 Bacteria 3344
612 Ga0495679_015783 3300047446 Bacteria 2750
613 Ga0495679_058686 3300047446 Bacteria 1134
614 Ga0495685_008691 3300047447 Bacteria 3380
615 Ga0495685_042577 3300047447 Bacteria 1550
616 Ga0495685_055604 3300047447 Bacteria 1338
617 Ga0495673_0015345 3300047469 Bacteria 3949
618 Ga0495681_0000105 3300047470 Bacteria 73364
619 Ga0495681_0002100 3300047470 Bacteria 14489
620 Ga0495681_0017507 3300047470 Bacteria 3975
621 Ga0495681_0083461 3300047470 Bacteria 1422
622 Ga0495681_0112632 3300047470 Bacteria 1176
623 Ga0495684_0045101 3300047471 Bacteria 3374
624 Ga0495686_0005097 3300047472 Bacteria 10506
625 Ga0495686_0027199 3300047472 Bacteria 3736
626 Ga0495593_0004644 3300047673 Bacteria 8166
627 Ga0495593_0008333 3300047673 Bacteria 6032
628 Ga0495593_0008999 3300047673 Bacteria 5795
629 Ga0495593_0131478 3300047673 Bacteria 1270
630 Ga0495593_0234806 3300047673 Bacteria 919
631 Ga0495602_0000903 3300048088 Bacteria 28669
632 Ga0495602_0005365 3300048088 Bacteria 13456
633 Ga0495602_0024837 3300048088 Bacteria 5809
634 Ga0495602_0039525 3300048088 Bacteria 4342
635 Ga0495602_0590403 3300048088 Bacteria 765
636 Ga0495614_0004149 3300048089 Bacteria 6525
637 Ga0495614_0010160 3300048089 Bacteria 4152
638 Ga0495614_0023771 3300048089 Bacteria 2645
639 Ga0495615_0008328 3300048090 Bacteria 2000
640 Ga0495626_0000159 3300048091 Bacteria 83571
641 Ga0495626_0004814 3300048091 Bacteria 8141
642 Ga0495626_0005050 3300048091 Bacteria 7873
643 Ga0495626_0006418 3300048091 Bacteria 6697
644 Ga0495626_0012028 3300048091 Bacteria 4553
645 Ga0495626_0015708 3300048091 Bacteria 3869
646 Ga0495626_0022317 3300048091 Bacteria 3128
647 Ga0495626_0028981 3300048091 Bacteria 2681
648 Ga0495626_0055510 3300048091 Bacteria 1815
649 Ga0495626_0059660 3300048091 Bacteria 1740
650 Ga0495626_0192875 3300048091 Bacteria 839
651 Ga0496100_0008797 3300048903 Bacteria 5647
652 Ga0496101_0006344 3300048904 Bacteria 7612
653 Ga0496101_0260757 3300048904 Bacteria 1352
654 Ga0496102_0030494 3300048905 Bacteria 4827
655 Ga0496102_0045330 3300048905 Bacteria 3992
656 Ga0496102_0290372 3300048905 Bacteria 1541
657 Ga0496102_0906396 3300048905 Bacteria 803
658 Ga0496103_0002586 3300048906 Bacteria 11339
659 Ga0496103_0030682 3300048906 Bacteria 3273
660 Ga0496104_0024323 3300048907 Bacteria 5571
661 Ga0496104_0050912 3300048907 Bacteria 3908
662 Ga0496104_0460240 3300048907 Bacteria 1184
663 Ga0496105_0004903 3300048908 Bacteria 10116
664 Ga0496105_0097231 3300048908 Bacteria 2432
665 Ga0496106_0022360 3300048909 Bacteria 4696
666 Ga0496106_0031827 3300048909 Bacteria 3931
667 Ga0496106_0033426 3300048909 Bacteria 3837
668 Ga0496106_0511183 3300048909 Bacteria 965
669 Ga0496108_0161299 3300048911 Bacteria 1938
670 Ga0496109_0166580 3300048912 Bacteria 2066
671 Ga0496110_0080901 3300048913 Bacteria 2895
672 Ga0496110_0118677 3300048913 Bacteria 2382
673 Ga0496110_0412856 3300048913 Bacteria 1231
674 Ga0496111_0092023 3300048914 Bacteria 2223
675 Ga0496112_0343136 3300048915 Bacteria 1437
676 Ga0496114_0054614 3300048917 Bacteria 3331
677 Ga0496114_1088589 3300048917 Bacteria 684
678 Ga0496117_0005784 3300048920 Bacteria 12840
679 Ga0496117_0167529 3300048920 Bacteria 1279
680 Ga0496118_0000191 3300048921 Bacteria 107968
681 Ga0496118_0011563 3300048921 Bacteria 8600
682 Ga0496122_0288324 3300048925 Bacteria 893
683 Ga0496124_0007903 3300048927 Bacteria 11203
684 Ga0496124_0341700 3300048927 Bacteria 1063
685 Ga0495678_000024 3300049459 Bacteria 229034
686 Ga0495678_000232 3300049459 Bacteria 63796
687 Ga0495678_001881 3300049459 Bacteria 15261
688 Ga0495678_014858 3300049459 Bacteria 3606
689 Ga0495682_0000210 3300049460 Bacteria 47048
690 Ga0495682_0059736 3300049460 Bacteria 1377
691 Ga0501031_0009849 3300049568 Bacteria 6223
692 Ga0501031_0116672 3300049568 Bacteria 1744
693 Ga0501036_0082121 3300049572 Bacteria 2724
694 Ga0501036_0212973 3300049572 Bacteria 1623
695 Ga0501037_0184195 3300049573 Bacteria 1481
696 Ga0501038_0308605 3300049574 Bacteria 1240
697 Ga0501039_0103676 3300049575 Bacteria 2220
698 Ga0501039_0374608 3300049575 Bacteria 1118
699 Ga0501040_0530270 3300049576 Bacteria 849
700 Ga0501041_0537559 3300049577 Bacteria 744
701 Ga0501042_0290336 3300049578 Bacteria 1181
702 Ga0501042_0509377 3300049578 Bacteria 874
703 Ga0501042_0589884 3300049578 Bacteria 808
704 Ga0501042_0663448 3300049578 Bacteria 758
705 Ga0501046_0452250 3300049580 Bacteria 923
706 Ga0501046_0468154 3300049580 Bacteria 905
707 Ga0501048_0031824 3300049582 Bacteria 3815
708 Ga0501048_0088048 3300049582 Bacteria 2190
709 Ga0501067_0139149 3300049583 Bacteria 1352
710 Ga0501069_0141732 3300049585 Bacteria 1379
711 Ga0501070_0210567 3300049586 Bacteria 1596
712 Ga0501071_0068610 3300049587 Bacteria 2580
713 Ga0501072_0122974 3300049588 Bacteria 2067
714 Ga0501072_0146704 3300049588 Bacteria 1881
715 Ga0501072_0675650 3300049588 Bacteria 812
716 Ga0501074_0275072 3300049590 Bacteria 1197
717 Ga0501076_0023191 3300049592 Bacteria 4781
718 Ga0501076_0940367 3300049592 Bacteria 712
719 Ga0501079_0264496 3300049741 Bacteria 1344
720 Ga0501079_0868381 3300049741 Bacteria 710
721 Ga0501045_0197394 3300049824 Bacteria 1499
722 nmdc:mga0k408_229311_c1 3300050493 Bacteria 1109
723 nmdc:mga07m45_6970_c1 3300050496 Bacteria 5745
724 nmdc:mga07m45_79487_c1 3300050496 Bacteria 1872
725 nmdc:mga05p37_11022_c1 3300050507 Bacteria 10738
726 nmdc:mga05p37_879889_c1 3300050507 Bacteria 969
727 nmdc:mga09592_120040_c1 3300050508 Bacteria 2258
728 nmdc:mga09592_1875_c1 3300050508 Bacteria 16913
729 nmdc:mga09592_21641_c1 3300050508 Bacteria 5300
730 nmdc:mga09592_384670_c1 3300050508 Bacteria 1213
731 nmdc:mga09592_82009_c1 3300050508 Bacteria 2749
732 nmdc:mga0qj67_53653_c1 3300050509 Bacteria 3191
733 nmdc:mga06r32_401712_c1 3300050510 Bacteria 1352
734 nmdc:mga08y16_142889_c1 3300050511 Bacteria 2488
735 Ga0500578_0038858 3300053086 Bacteria 3057
736 Ga0466962_0090127 3300061719 Bacteria 1469
737 2513952521 2513237150 Bacteria 6553639
738 2514041592 2513237165 Bacteria 6771773
739 2644028352 2643221603 Bacteria 6147767
740 2746089015 2744054900 Bacteria 8399525
741 2746097147 2744054901 Bacteria 8397047
742 2809145213 2808606418 Bacteria 6724496
743 2834641862 2834641062 Bacteria 5559922
744 2901308286 2901300506 Bacteria 8463898
745 644750864 644736347 Bacteria 6476522
746 8003404596 8003400568 Bacteria 5535898
747 8047675520 8047673197 Bacteria 7395230
748 Ga0495626_0016704
749 SwRhRL2b_contig_3689071
750 SwRhRL2b_contig_691832
751 rootH1_10020786
752 JGI25407J50210_10038483
753 Ga0065165_1003233
754 Ga0065704_10072564
755 Ga0065707_10001106
756 Ga0065707_10235855
757 Ga0070676_10042370
758 Ga0070666_10390781
759 Ga0070680_100221825
760 Ga0070682_100259865
761 Ga0070660_100027134
762 Ga0070660_100511660
763 Ga0070689_100373387
764 Ga0070661_100016223
765 Ga0070692_10239362
766 Ga0070692_10400158
767 Ga0070669_100391611
768 Ga0070671_100098487
769 Ga0070674_100015594
770 Ga0070659_100042468
771 Ga0070659_100197976
772 Ga0070659_100203133
773 Ga0070667_100115549
774 Ga0070667_100324783
775 Ga0070667_100583602
776 Ga0070709_10016056
777 Ga0070713_100073288
778 Ga0070710_10147832
779 Ga0070711_100071093
780 Ga0070711_100127036
781 Ga0070700_100046936
782 Ga0070678_100079379
783 Ga0070662_100077805
784 Ga0070681_10206676
785 Ga0070681_10410566
786 Ga0068867_100025071
787 Ga0070699_100060930
788 Ga0070679_100050370
789 Ga0070679_100134593
790 Ga0070684_100740081
791 Ga0068853_100466409
792 Ga0068853_100560846
793 Ga0068853_101054847
794 Ga0070672_100168923
795 Ga0070696_100001766
796 Ga0070665_100236364
797 Ga0070665_100779908
798 Ga0068855_100016751
799 Ga0068855_100029035
800 Ga0068855_100111433
801 Ga0068855_100124032
802 Ga0070664_100075582
803 Ga0070664_100506666
804 Ga0068857_100095316
805 Ga0068857_100282044
806 Ga0068856_100298325
807 Ga0070702_100006377
808 Ga0068852_100552211
809 Ga0068852_100848199
810 Ga0068852_101308337
811 Ga0068859_100782907
812 Ga0068866_10045161
813 Ga0068861_100003803
814 Ga0068861_100290932
815 Ga0068851_10270520
816 Ga0068858_100061634
817 Ga0068858_100541926
818 Ga0068860_100029669
819 Ga0068862_100073210
820 Ga0081538_10022702
821 Ga0081538_10113438
822 Ga0070712_100402387
823 Ga0075366_10059712
824 Ga0075370_10005241
825 Ga0075370_10074427
826 Ga0075370_10120390
827 Ga0075428_100193339
828 Ga0075428_101083391
829 Ga0075430_100299204
830 Ga0075430_100459513
831 Ga0075430_100969239
832 Ga0075429_100007849
833 Ga0075429_100011170
834 Ga0075429_100016236
835 Ga0075429_100047339
836 Ga0075429_100048159
837 Ga0075429_100489530
838 Ga0068865_100599241
839 Ga0097620_100783007
840 Ga0105240_10002099
841 Ga0111539_10009836
842 Ga0105247_10546685
843 Ga0114129_10012487
844 Ga0114129_10082229
845 Ga0114129_10224362
846 Ga0114129_10897319
847 Ga0105243_10106703
848 Ga0105243_10209633
849 Ga0105248_11004002
850 Ga0105237_10220507
851 Ga0105237_10336066
852 Ga0105238_10021066
853 Ga0105238_10035120
854 Ga0105238_10241825
855 Ga0105238_10300975
856 Ga0105238_10974428
857 Ga0105249_10241916
858 Ga0157370_10081352
859 Ga0157370_10577580
860 Ga0157369_10265515
861 Ga0157374_10082454
862 Ga0157378_10074989
863 Ga0163162_10028413
864 Ga0163162_10062499
865 Ga0157372_10006140
866 Ga0157372_10406165
867 Ga0157372_10415440
868 Ga0157375_10110095
869 Ga0163163_10634836
870 Ga0157380_10079549
871 Ga0157380_10877486
872 Ga0182008_10006544
873 Ga0182006_1025195
874 Ga0182007_10001940
875 Ga0213875_10004817
876 Ga0209051_1002550
877 Ga0209051_1008603
878 Ga0207682_10041522
879 Ga0207682_10057574
880 Ga0207692_10090681
881 Ga0207680_10462675
882 Ga0207707_10101000
883 Ga0207695_10254316
884 Ga0207693_10251507
885 Ga0207663_10046549
886 Ga0207660_10174837
887 Ga0207662_10504122
888 Ga0207657_10303264
889 Ga0207649_10579062
890 Ga0207652_10024345
891 Ga0207652_10150780
892 Ga0207652_10210043
893 Ga0207694_10138556
894 Ga0207700_10069547
895 Ga0207664_10198088
896 Ga0207690_10029251
897 Ga0207690_10474582
898 Ga0207690_10868071
899 Ga0207706_10176268
900 Ga0207669_10277136
901 Ga0207704_10034759
902 Ga0207691_10170113
903 Ga0207679_10425922
904 Ga0207667_10193783
905 Ga0207667_10212676
906 Ga0207667_10247033
907 Ga0207667_10463788
908 Ga0207712_10055408
909 Ga0207668_10428534
910 Ga0207640_10796944
911 Ga0207658_10094643
912 Ga0207677_10809171
913 Ga0207639_10535346
914 Ga0207678_10080001
915 Ga0207708_10042293
916 Ga0207708_10056930
917 Ga0207702_10628909
918 Ga0207648_10002759
919 Ga0207648_10508489
920 Ga0207674_10146990
921 Ga0207675_100089740
922 Ga0207675_100207706
923 Ga0207683_10774313
924 Ga0209974_10001262
925 Ga0207428_10014792
926 Ga0268266_10107633
927 Ga0268266_10312057
928 Ga0268265_10071825
929 Ga0307517_10079942
930 Ga0307515_10000240
931 Ga0307515_10035008
932 Ga0265327_10157056
933 Ga0307513_10124044
934 Ga0307408_100122295
935 Ga0307508_10146074
936 Ga0307516_10000178
937 Ga0307405_10126732
938 Ga0307405_10536784
939 Ga0307406_10039460
940 Ga0307406_10261272
941 Ga0307407_10120013
942 Ga0307412_10050187
943 Ga0307409_100046083
944 Ga0307416_100308248
945 Ga0307416_100557767
946 Ga0307416_100628916
947 Ga0307411_10009916
948 Ga0307415_100723599
949 Ga0373932_0149698
950 Ga0373931_0005378
951 Ga0373927_0187164
952 Ga0373947_0199461
953 Ga0395899_0256566
954 Ga0395900_0030240
955 Ga0395900_0233966
956 Ga0395900_0463490
957 Ga0395900_1138898
958 Ga0395898_0015576
959 Ga0395898_0025664
960 Ga0395905_0013083
961 Ga0395905_0049512
962 Ga0436364_0397135
963 Ga0395901_0131440
964 Ga0395901_0189485
965 Ga0451807_0581502
966 Ga0451853_2690907
967 Ga0450898_017121
968 Ga0439460_0016907
969 Ga0451577_0388554
970 Ga0466969_0021538
971 Ga0466972_0060216
972 Ga0466972_0349389
973 Ga0453683_0003827
974 Ga0466965_0176611
975 Ga0466966_0009244
976 Ga0466966_0295617
977 Ga0466961_0315002
978 Ga0466963_0061592
979 Ga0466964_0021131
980 Ga0453684_0232665
981 Ga0453684_0450449
982 Ga0466971_0022195
983 Ga0466970_0075903
984 Ga0466970_0272555
985 Ga0466957_0354745
986 Ga0466957_0470343
987 Ga0466960_0057093
988 Ga0466960_0260009
989 Ga0466959_0512271
990 Ga0451576_0013172
991 Ga0451576_0050287
992 Ga0451576_0298393
993 Ga0466958_0072360
994 Ga0466967_0200518
995 Ga0466967_0943501
996 Ga0495617_023793
997 Ga0495617_069076
998 Ga0495627_000123
999 Ga0495627_041907
1000 Ga0495592_0002556
1001 Ga0495592_0036200
1002 Ga0495592_0150500
1003 Ga0495592_0309971
1004 Ga0495603_0018829
1005 Ga0495590_0000013
1006 Ga0495590_0006656
1007 Ga0495590_0048968
1008 Ga0495590_0218929
1009 Ga0495591_000176
1010 Ga0495591_001974
1011 Ga0495591_022165
1012 Ga0495629_0002874
1013 Ga0495629_0010779
1014 Ga0495629_0040661
1015 Ga0495629_0043689
1016 Ga0495629_0552502
1017 Ga0495641_0007351
1018 Ga0495651_0006500
1019 Ga0495651_0094885
1020 Ga0495653_0024517
1021 Ga0495653_0039895
1022 Ga0495653_0066935
1023 Ga0495650_0000351
1024 Ga0495650_0008888
1025 Ga0495650_0018786
1026 Ga0495650_0034727
1027 Ga0495580_0003010
1028 Ga0495580_0006041
1029 Ga0495580_0020633
1030 Ga0495580_0031056
1031 Ga0495580_0041850
1032 Ga0495580_0138913
1033 Ga0495580_0207020
1034 Ga0495582_0001111
1035 Ga0495582_0003293
1036 Ga0495582_0050673
1037 Ga0495605_0000035
1038 Ga0495605_0000304
1039 Ga0495605_0009658
1040 Ga0495605_0018039
1041 Ga0495605_0033330
1042 Ga0495605_0099139
1043 Ga0495605_0142685
1044 Ga0495605_0227948
1045 Ga0495662_0017509
1046 Ga0495664_0000124
1047 Ga0495664_0066327
1048 Ga0495664_0072002
1049 Ga0495664_0109251
1050 Ga0495664_0146918
1051 Ga0495584_0000029
1052 Ga0495584_0003088
1053 Ga0495584_0005616
1054 Ga0495584_0021549
1055 Ga0495584_0086811
1056 Ga0495585_0005636
1057 Ga0495585_0007619
1058 Ga0495585_0024263
1059 Ga0495585_0040910
1060 Ga0495585_0062135
1061 Ga0495585_0096783
1062 Ga0495585_0191930
1063 Ga0495594_0069067
1064 Ga0495594_0073726
1065 Ga0495594_0214566
1066 Ga0495596_0001306
1067 Ga0495596_0001904
1068 Ga0495596_0004541
1069 Ga0495596_0005279
1070 Ga0495596_0010930
1071 Ga0495596_0012564
1072 Ga0495596_0013086
1073 Ga0495596_0016193
1074 Ga0495596_0024049
1075 Ga0495607_0001166
1076 Ga0495607_0002941
1077 Ga0495607_0006050
1078 Ga0495607_0008238
1079 Ga0495607_0012193
1080 Ga0495607_0016296
1081 Ga0495607_0095959
1082 Ga0495607_0184039
1083 Ga0495583_0000388
1084 Ga0495583_0000461
1085 Ga0495583_0001436
1086 Ga0495583_0005194
1087 Ga0495583_0007573
1088 Ga0495583_0014656
1089 Ga0495583_0020902
1090 Ga0495583_0055118
1091 Ga0495606_0010213
1092 Ga0495606_0018876
1093 Ga0495606_0147335
1094 Ga0495606_0170613
1095 Ga0495606_0192235
1096 Ga0495606_0215670
1097 Ga0495606_0247208
1098 Ga0495608_0015926
1099 Ga0495610_0001374
1100 Ga0495616_0000148
1101 Ga0495616_0003086
1102 Ga0495616_0006608
1103 Ga0495616_0014900
1104 Ga0495616_0019471
1105 Ga0495616_0034549
1106 Ga0495616_0036597
1107 Ga0495616_0103100
1108 Ga0495616_0117138
1109 Ga0495616_0208249
1110 Ga0495618_0044874
1111 Ga0495618_0067484
1112 Ga0495618_0320478
1113 Ga0495628_0008593
1114 Ga0495628_0015716
1115 Ga0495630_0029695
1116 Ga0495630_0031213
1117 Ga0495630_0042276
1118 Ga0495630_0044092
1119 Ga0495631_0000191
1120 Ga0495631_0000975
1121 Ga0495631_0004482
1122 Ga0495631_0010050
1123 Ga0495631_0018271
1124 Ga0495631_0038561
1125 Ga0495631_0099632
1126 Ga0495631_0182120
1127 Ga0495632_0000029
1128 Ga0495632_0000093
1129 Ga0495632_0001294
1130 Ga0495632_0001378
1131 Ga0495632_0018980
1132 Ga0495632_0023488
1133 Ga0495632_0067138
1134 Ga0495632_0136204
1135 Ga0495637_0000008
1136 Ga0495643_0000355
1137 Ga0495643_0026182
1138 Ga0495643_0027950
1139 Ga0495643_0029224
1140 Ga0495643_0040238
1141 Ga0495643_0161693
1142 Ga0495644_0002986
1143 Ga0495644_0005537
1144 Ga0495644_0005993
1145 Ga0495644_0006162
1146 Ga0495644_0015064
1147 Ga0495644_0015287
1148 Ga0495644_0065410
1149 Ga0495648_0000527
1150 Ga0495648_0001273
1151 Ga0495648_0002906
1152 Ga0495648_0011650
1153 Ga0495648_0013677
1154 Ga0495648_0015647
1155 Ga0495648_0016954
1156 Ga0495663_0047666
1157 Ga0495666_0000740
1158 Ga0495666_0003427
1159 Ga0495666_0006786
1160 Ga0495666_0008845
1161 Ga0495666_0028759
1162 Ga0495642_0000005
1163 Ga0495642_0000238
1164 Ga0495642_0002922
1165 Ga0495642_0009964
1166 Ga0495642_0010670
1167 Ga0495642_0019409
1168 Ga0495642_0019701
1169 Ga0495642_0070542
1170 Ga0495642_0095648
1171 Ga0495642_0158882
1172 Ga0495642_0180646
1173 Ga0495652_0007826
1174 Ga0495652_0083182
1175 Ga0495652_0113017
1176 Ga0495654_0051963
1177 Ga0495654_0098360
1178 Ga0495654_0102430
1179 Ga0495665_0008512
1180 Ga0495665_0008545
1181 Ga0495665_0033593
1182 Ga0495640_0065254
1183 Ga0495586_0009831
1184 Ga0495586_0022226
1185 Ga0495586_0035942
1186 Ga0495587_0004101
1187 Ga0495587_0004606
1188 Ga0495587_0038961
1189 Ga0495587_0058301
1190 Ga0495587_0162482
1191 Ga0495609_0000150
1192 Ga0495609_0019544
1193 Ga0495609_0020142
1194 Ga0495609_0021075
1195 Ga0495621_0003279
1196 Ga0495621_0090333
1197 Ga0495597_0000244
1198 Ga0495597_0005205
1199 Ga0495597_0109600
1200 Ga0495597_0134407
1201 Ga0495645_0007421
1202 Ga0495622_0001215
1203 Ga0495622_0006953
1204 Ga0495622_0035684
1205 Ga0495633_0003760
1206 Ga0495633_0004118
1207 Ga0495633_0023176
1208 Ga0495633_0273970
1209 Ga0495667_0166669
1210 Ga0495656_0080680
1211 Ga0495656_0148249
1212 Ga0495668_0000608
1213 Ga0495668_0001205
1214 Ga0495668_0022324
1215 Ga0495668_0157594
1216 Ga0495668_0215770
1217 Ga0495668_0278483
1218 Ga0495634_0007529
1219 Ga0495634_0008241
1220 Ga0495634_0019407
1221 Ga0495611_0002549
1222 Ga0495611_0022976
1223 Ga0495611_0077107
1224 Ga0495611_0086560
1225 Ga0495625_0038980
1226 Ga0495625_0055716
1227 Ga0495625_0302862
1228 Ga0495635_0001906
1229 Ga0495635_0079530
1230 Ga0495635_0080559
1231 Ga0495661_0001202
1232 Ga0495661_0006987
1233 Ga0495661_0009987
1234 Ga0495661_0015359
1235 Ga0495661_0018272
1236 Ga0495661_0025141
1237 Ga0495661_0030708
1238 Ga0495661_0034516
1239 Ga0495661_0083380
1240 Ga0495661_0150342
1241 Ga0495661_0211404
1242 Ga0495588_0000095
1243 Ga0495588_0010598
1244 Ga0495588_0021257
1245 Ga0495588_0081005
1246 Ga0495588_0094662
1247 Ga0495599_0000488
1248 Ga0495599_0052681
1249 Ga0495599_0436193
1250 Ga0495623_0006968
1251 Ga0495623_0012385
1252 Ga0495623_0107075
1253 Ga0495646_0008898
1254 Ga0495646_0011397
1255 Ga0495646_0049640
1256 Ga0495646_0413832
1257 Ga0495669_0000057
1258 Ga0495669_0000367
1259 Ga0495669_0000909
1260 Ga0495669_0003917
1261 Ga0495669_0012185
1262 Ga0495669_0025137
1263 Ga0495669_0058925
1264 Ga0495669_0116444
1265 Ga0495613_0001911
1266 Ga0495613_0050289
1267 Ga0495613_0092311
1268 Ga0495613_0103287
1269 Ga0495613_0371032
1270 Ga0495624_0020156
1271 Ga0495624_0052827
1272 Ga0495624_0056614
1273 Ga0495624_0182305
1274 Ga0495670_0003327
1275 Ga0495670_0008173
1276 Ga0495670_0020979
1277 Ga0495670_0069588
1278 Ga0495670_0149423
1279 Ga0495670_0242946
1280 Ga0495671_0000294
1281 Ga0495671_0001931
1282 Ga0495671_0003039
1283 Ga0495671_0052504
1284 Ga0495649_0000049
1285 Ga0495649_0002523
1286 Ga0495649_0009650
1287 Ga0495649_0048083
1288 Ga0495649_0107183
1289 Ga0495649_0128105
1290 Ga0495649_0177634
1291 Ga0495649_0278369
1292 Ga0495589_0000301
1293 Ga0495589_0001394
1294 Ga0495589_0004430
1295 Ga0495589_0008467
1296 Ga0495589_0009707
1297 Ga0495589_0072307
1298 Ga0495589_0244241
1299 Ga0495600_0003369
1300 Ga0495600_0085095
1301 Ga0495660_0000033
1302 Ga0495660_0002579
1303 Ga0495660_0031266
1304 Ga0495581_0029931
1305 Ga0495581_0084120
1306 Ga0495581_0200225
1307 Ga0495604_0011057
1308 Ga0495604_0042011
1309 Ga0495604_0058876
1310 Ga0495604_0061589
1311 Ga0495604_0102741
1312 Ga0495604_0150607
1313 Ga0495636_0003471
1314 Ga0495674_0009804
1315 Ga0495674_0013766
1316 Ga0495674_0054030
1317 Ga0495672_0000033
1318 Ga0495672_0000101
1319 Ga0495672_0020896
1320 Ga0495672_0051175
1321 Ga0495672_0097117
1322 Ga0495672_0133658
1323 Ga0495676_0000342
1324 Ga0495676_0018968
1325 Ga0495676_0061214
1326 Ga0495676_0152034
1327 Ga0495676_0327116
1328 Ga0495680_0008094
1329 Ga0495680_0032156
1330 Ga0495680_0050743
1331 Ga0495680_0066722
1332 Ga0495683_0000024
1333 Ga0495683_0000736
1334 Ga0495683_0025279
1335 Ga0495683_0093457
1336 Ga0495683_0095669
1337 Ga0495687_000092
1338 Ga0495687_000182
1339 Ga0495687_005556
1340 Ga0495687_050857
1341 Ga0495675_0007505
1342 Ga0495675_0007943
1343 Ga0495675_0011852
1344 Ga0495675_0026421
1345 Ga0495677_0000109
1346 Ga0495677_0000395
1347 Ga0495677_0000472
1348 Ga0495677_0002661
1349 Ga0495677_0006507
1350 Ga0495677_0023792
1351 Ga0495677_0038592
1352 Ga0495677_0042913
1353 Ga0495677_0060835
1354 Ga0495677_0202611
1355 Ga0495679_000512
1356 Ga0495679_000887
1357 Ga0495679_008449
1358 Ga0495679_011876
1359 Ga0495679_015783
1360 Ga0495679_058686
1361 Ga0495685_008691
1362 Ga0495685_042577
1363 Ga0495685_055604
1364 Ga0495673_0015345
1365 Ga0495681_0000105
1366 Ga0495681_0002100
1367 Ga0495681_0017507
1368 Ga0495681_0083461
1369 Ga0495681_0112632
1370 Ga0495684_0045101
1371 Ga0495686_0005097
1372 Ga0495686_0027199
1373 Ga0495593_0004644
1374 Ga0495593_0008333
1375 Ga0495593_0008999
1376 Ga0495593_0131478
1377 Ga0495593_0234806
1378 Ga0495602_0000903
1379 Ga0495602_0005365
1380 Ga0495602_0024837
1381 Ga0495602_0039525
1382 Ga0495602_0590403
1383 Ga0495614_0004149
1384 Ga0495614_0010160
1385 Ga0495614_0023771
1386 Ga0495615_0008328
1387 Ga0495626_0000159
1388 Ga0495626_0004814
1389 Ga0495626_0005050
1390 Ga0495626_0006418
1391 Ga0495626_0012028
1392 Ga0495626_0015708
1393 Ga0495626_0022317
1394 Ga0495626_0028981
1395 Ga0495626_0055510
1396 Ga0495626_0059660
1397 Ga0495626_0192875
1398 Ga0496100_0008797
1399 Ga0496101_0006344
1400 Ga0496101_0260757
1401 Ga0496102_0030494
1402 Ga0496102_0045330
1403 Ga0496102_0290372
1404 Ga0496102_0906396
1405 Ga0496103_0002586
1406 Ga0496103_0030682
1407 Ga0496104_0024323
1408 Ga0496104_0050912
1409 Ga0496104_0460240
1410 Ga0496105_0004903
1411 Ga0496105_0097231
1412 Ga0496106_0022360
1413 Ga0496106_0031827
1414 Ga0496106_0033426
1415 Ga0496106_0511183
1416 Ga0496108_0161299
1417 Ga0496109_0166580
1418 Ga0496110_0080901
1419 Ga0496110_0118677
1420 Ga0496110_0412856
1421 Ga0496111_0092023
1422 Ga0496112_0343136
1423 Ga0496114_0054614
1424 Ga0496114_1088589
1425 Ga0496117_0005784
1426 Ga0496117_0167529
1427 Ga0496118_0000191
1428 Ga0496118_0011563
1429 Ga0496122_0288324
1430 Ga0496124_0007903
1431 Ga0496124_0341700
1432 Ga0495678_000024
1433 Ga0495678_000232
1434 Ga0495678_001881
1435 Ga0495678_014858
1436 Ga0495682_0000210
1437 Ga0495682_0059736
1438 Ga0501031_0009849
1439 Ga0501031_0116672
1440 Ga0501036_0082121
1441 Ga0501036_0212973
1442 Ga0501037_0184195
1443 Ga0501038_0308605
1444 Ga0501039_0103676
1445 Ga0501039_0374608
1446 Ga0501040_0530270
1447 Ga0501041_0537559
1448 Ga0501042_0290336
1449 Ga0501042_0509377
1450 Ga0501042_0589884
1451 Ga0501042_0663448
1452 Ga0501046_0452250
1453 Ga0501046_0468154
1454 Ga0501048_0031824
1455 Ga0501048_0088048
1456 Ga0501067_0139149
1457 Ga0501069_0141732
1458 Ga0501070_0210567
1459 Ga0501071_0068610
1460 Ga0501072_0122974
1461 Ga0501072_0146704
1462 Ga0501072_0675650
1463 Ga0501074_0275072
1464 Ga0501076_0023191
1465 Ga0501076_0940367
1466 Ga0501079_0264496
1467 Ga0501079_0868381
1468 Ga0501045_0197394
1469 nmdc:mga0k408_229311_c1
1470 nmdc:mga07m45_6970_c1
1471 nmdc:mga07m45_79487_c1
1472 nmdc:mga05p37_11022_c1
1473 nmdc:mga05p37_879889_c1
1474 nmdc:mga09592_120040_c1
1475 nmdc:mga09592_1875_c1
1476 nmdc:mga09592_21641_c1
1477 nmdc:mga09592_384670_c1
1478 nmdc:mga09592_82009_c1
1479 nmdc:mga0qj67_53653_c1
1480 nmdc:mga06r32_401712_c1
1481 nmdc:mga08y16_142889_c1
1482 Ga0500578_0038858
1483 Ga0466962_0090127
1484 2513952521
1485 2514041592
1486 2644028352
1487 2746089015
1488 2746097147
1489 2809145213
1490 2834641862
1491 2901308286
1492 644750864
1493 8003404596
1494 8047675520

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.4085 2 220
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.4008 2 215
5c65-assembly1.cif.gz_A structure of the human glucose transporter glut3 / slc2a3 0.3993 2 219
2kyh-assembly1.cif.gz_A solution structure of the voltage-sensing domain of kvap 0.3992 63 218
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.3892 2 219
ID Description Score Start End Superfamily
af_H2KYF2_219_420_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4705 2 216 1.20.1250.20
af_C6KSY4_77_351_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4661 2 214 1.20.1250.20
af_Q59WF2_48_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4658 2 216 1.20.1250.20
af_H2L0E6_75_299_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4428 2 215 1.20.1250.20
af_Q18544_272_478_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4421 2 216 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A399ZWD1-F1-model_v4 Uncharacterized protein 0.9313 2 222 GO:0016020
AF-A0A242MA57-F1-model_v4 Arginine/ornithine antiporter ArcD 0.9168 2 217 GO:0016020
AF-R4WWB2-F1-model_v4 Uncharacterized protein 0.9099 2 215 GO:0016020
AF-A0A838NE61-F1-model_v4 Uncharacterized protein 0.9027 2 218 GO:0016020
AF-A0A831WZQ8-F1-model_v4 Uncharacterized protein 0.9024 2 222 GO:0016020

Map