F478934

General Info

Members Datasets Scaffolds Average Seq Length
747 425 670 133

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_218115_c1|nmdc:mga03n38_218115_c1_82_534
Length 150
Sequence MNELIGSTGGDCEPMLVRDAMSTVVLTIGPAHTLRQAAALMSARRVGAAVVLDPDGTGTGILTERDILNSVGLGQSPDTEYAHAHTTTDVVFATPTWTLEEAAQAMAHGGFRHLIVLDHGEPTGIVSVRDIIRCWAPAPRRVPATTGSPH

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
22 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
23 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
24 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
25 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
26 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
27 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
28 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
29 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
30 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
31 2862574272 Streptomyces sp. AcE210 Isolate Nodule
32 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
33 2867369537 Streptomyces sp. Z26 Isolate Unclassified
34 2867428634 Streptomyces sp. RP5T Isolate Unclassified
35 2867475112 Streptomyces sp. TM32 Isolate Unclassified
36 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
37 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
38 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
39 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
40 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
41 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
42 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
43 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
44 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
45 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
46 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
47 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
48 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
49 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
50 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
51 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
52 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
53 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
54 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
55 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
56 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
57 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
58 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
59 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
60 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
61 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
62 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
63 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
64 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
65 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
66 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
205 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
206 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
207 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
215 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
219 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
220 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
221 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
222 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
223 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
224 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
225 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
226 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
227 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
228 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
343 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
344 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
364 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
372 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
373 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
374 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
375 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
376 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
379 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
385 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
386 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
387 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
388 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
391 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
414 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
415 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
416 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
417 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
418 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
419 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
420 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
421 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
422 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
423 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
424 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
425 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.27
Metatranscriptomes 6.43
Isolates 10.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0.67
Rhizoplane 2.54
Rhizosphere 80.32
Stem 0
Stem Tuber 0
Unclassified 11.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10021826 3300001990 Bacteria 2036
2 rootH1_10019195 3300003316 Bacteria 3884
3 rootH1_10080830 3300003316 Bacteria 1532
4 rootH2_10040067 3300003320 Bacteria 8912
5 rootH2_10217107 3300003320 Bacteria 1021
6 rootH1_10017685 3300003323 Bacteria 1843
7 rootH1_10091162 3300003323 Bacteria 1685
8 rootH1_10178559 3300003323 Bacteria 1842
9 JGI25160J50197_1033513 3300003354 Bacteria 1290
10 JGI25160J50197_1035808 3300003354 Bacteria 1213
11 JGI25160J50197_1036056 3300003354 Bacteria 1205
12 Ga0006562J51391_1044019 3300003578 Bacteria 810
13 Ga0006562J51391_1130510 3300003578 Bacteria 1670
14 Ga0006562J51391_1130511 3300003578 Bacteria 1656
15 Ga0058863_11226352 3300004799 Bacteria 600
16 Ga0058862_12670130 3300004803 Bacteria 519
17 Ga0070682_100046806 3300005337 Bacteria 2686
18 Ga0068868_100005573 3300005338 Bacteria 8854
19 Ga0070691_10076958 3300005341 Bacteria 1628
20 Ga0070659_101902934 3300005366 Bacteria 533
21 Ga0070709_10892199 3300005434 Bacteria 703
22 Ga0070714_100461616 3300005435 Bacteria 1207
23 Ga0070713_101037832 3300005436 Bacteria 791
24 Ga0070711_100036179 3300005439 Bacteria 3307
25 Ga0070705_100474532 3300005440 Bacteria 944
26 Ga0070708_100469459 3300005445 Bacteria 1187
27 Ga0070681_10091417 3300005458 Bacteria 2994
28 Ga0070685_10052437 3300005466 Bacteria 2360
29 Ga0070707_100062789 3300005468 Bacteria 3564
30 Ga0070684_100174499 3300005535 Bacteria 1953
31 Ga0068853_100093609 3300005539 Bacteria 2646
32 Ga0070686_100555896 3300005544 Bacteria 898
33 Ga0070686_101224166 3300005544 Bacteria 624
34 Ga0070665_100167946 3300005548 Bacteria 2196
35 Ga0070704_100171955 3300005549 Bacteria 1724
36 Ga0068855_100132732 3300005563 Bacteria 2843
37 Ga0068855_100213914 3300005563 Bacteria 2165
38 Ga0070664_100377792 3300005564 Bacteria 1293
39 Ga0068857_100522691 3300005577 Bacteria 1115
40 Ga0068854_100412849 3300005578 Bacteria 1120
41 Ga0068854_102144232 3300005578 Bacteria 516
42 Ga0068856_100057484 3300005614 Bacteria 3840
43 Ga0068856_100126077 3300005614 Bacteria 2563
44 Ga0068856_100484683 3300005614 Bacteria 1258
45 Ga0068864_100058542 3300005618 Bacteria 3331
46 Ga0068864_101707311 3300005618 Bacteria 634
47 Ga0068866_10079829 3300005718 Unclassified 1754
48 Ga0068863_101470662 3300005841 Bacteria 690
49 Ga0068858_100142698 3300005842 Bacteria 2249
50 Ga0068860_100156734 3300005843 Bacteria 2195
51 Ga0081455_10195754 3300005937 Bacteria 1518
52 Ga0075363_100560356 3300006048 Bacteria 682
53 Ga0070716_100073556 3300006173 Bacteria 2016
54 Ga0070712_100758843 3300006175 Bacteria 830
55 Ga0070712_100821183 3300006175 Bacteria 798
56 Ga0070712_100825366 3300006175 Bacteria 796
57 Ga0070712_101336267 3300006175 Bacteria 625
58 Ga0075367_10003746 3300006178 Bacteria 7319
59 Ga0075370_10076640 3300006353 Bacteria 1918
60 Ga0068871_102039528 3300006358 Bacteria 546
61 Ga0075428_101693119 3300006844 Bacteria 660
62 Ga0075433_10675322 3300006852 Bacteria 905
63 Ga0068865_101039796 3300006881 Bacteria 719
64 Ga0099826_10067827 3300006948 Bacteria 2281
65 Ga0075435_100070671 3300007076 Bacteria 2849
66 Ga0105251_10060354 3300009011 Bacteria 1785
67 Ga0105244_10122288 3300009036 Bacteria 1260
68 Ga0105250_10059204 3300009092 Bacteria 1538
69 Ga0105245_10098489 3300009098 Bacteria 2702
70 Ga0105245_10134622 3300009098 Bacteria 2321
71 Ga0105245_10142376 3300009098 Bacteria 2260
72 Ga0105243_10646484 3300009148 Bacteria 1024
73 Ga0105241_10615957 3300009174 Bacteria 982
74 Ga0105248_10365069 3300009177 Bacteria 1625
75 Ga0105237_10191741 3300009545 Bacteria 2044
76 Ga0105238_10118711 3300009551 Bacteria 2625
77 Ga0105238_10522624 3300009551 Bacteria 1189
78 Ga0105249_10650002 3300009553 Unclassified 1112
79 Ga0105239_10082718 3300010375 Bacteria 3535
80 Ga0105246_10249858 3300011119 Bacteria 1407
81 Ga0105246_10667927 3300011119 Unclassified 907
82 Ga0105246_11748045 3300011119 Bacteria 592
83 Ga0157370_10144068 3300013104 Bacteria 2219
84 Ga0157369_10087579 3300013105 Bacteria 3325
85 Ga0157369_10592981 3300013105 Bacteria 1144
86 Ga0157374_10070724 3300013296 Bacteria 3289
87 Ga0157378_10717988 3300013297 Bacteria 1020
88 Ga0163162_10031791 3300013306 Bacteria 5237
89 Ga0157372_10137947 3300013307 Bacteria 2809
90 Ga0157375_10085836 3300013308 Bacteria 3198
91 Ga0157375_10176735 3300013308 Bacteria 2285
92 Ga0163163_10006307 3300014325 Bacteria 10356
93 Ga0182008_10001423 3300014497 Bacteria 16047
94 Ga0157379_10028186 3300014968 Bacteria 4999
95 Ga0157376_10097190 3300014969 Bacteria 2565
96 Ga0182007_10002422 3300015262 Bacteria 9315
97 Ga0183367_1002 3300015688 Bacteria 1101531
98 Ga0197907_10381786 3300020069 Bacteria 530
99 Ga0206356_10995431 3300020070 Bacteria 771
100 Ga0206356_11206245 3300020070 Bacteria 932
101 Ga0206356_11219520 3300020070 Bacteria 1002
102 Ga0206355_1208892 3300020076 Bacteria 1013
103 Ga0206352_10401905 3300020078 Bacteria 934
104 Ga0206352_11348545 3300020078 Bacteria 596
105 Ga0206354_10196881 3300020081 Bacteria 606
106 Ga0206354_10216677 3300020081 Bacteria 557
107 Ga0224712_10531268 3300022467 Bacteria 570
108 Ga0209758_1013617 3300025297 Bacteria 4413
109 Ga0207426_1001513 3300025302 Bacteria 18969
110 Ga0207426_1003399 3300025302 Bacteria 8709
111 Ga0207426_1006696 3300025302 Bacteria 4946
112 Ga0207426_1025201 3300025302 Bacteria 2006
113 Ga0207426_1100418 3300025302 Bacteria 748
114 Ga0207647_10005240 3300025904 Bacteria 9543
115 Ga0207685_10234473 3300025905 Bacteria 880
116 Ga0207654_10578735 3300025911 Bacteria 800
117 Ga0207707_11159889 3300025912 Bacteria 627
118 Ga0207671_10281426 3300025914 Bacteria 1312
119 Ga0207693_10918745 3300025915 Bacteria 671
120 Ga0207663_10637261 3300025916 Bacteria 840
121 Ga0207663_11216645 3300025916 Bacteria 606
122 Ga0207652_11647249 3300025921 Bacteria 546
123 Ga0207646_10580955 3300025922 Bacteria 1006
124 Ga0207694_10104344 3300025924 Bacteria 2249
125 Ga0207687_10059664 3300025927 Bacteria 2688
126 Ga0207687_10060309 3300025927 Bacteria 2675
127 Ga0207664_10608710 3300025929 Bacteria 981
128 Ga0207709_10168473 3300025935 Bacteria 1535
129 Ga0207665_10036601 3300025939 Bacteria 3265
130 Ga0207711_10296652 3300025941 Bacteria 1490
131 Ga0207661_11886983 3300025944 Bacteria 543
132 Ga0207667_10408358 3300025949 Bacteria 1382
133 Ga0207667_10499254 3300025949 Bacteria 1234
134 Ga0207640_10069392 3300025981 Bacteria 2366
135 Ga0207677_10006535 3300026023 Bacteria 6402
136 Ga0207702_10116605 3300026078 Bacteria 2383
137 Ga0207702_11461414 3300026078 Bacteria 677
138 Ga0207702_12164519 3300026078 Bacteria 545
139 Ga0207676_10026782 3300026095 Bacteria 4289
140 Ga0209371_1021986 3300027312 Bacteria 1534
141 Ga0209282_1100910 3300027666 Bacteria 1486
142 Ga0268266_10439512 3300028379 Bacteria 1239
143 Ga0268264_10817089 3300028381 Bacteria 932
144 Ga0307517_10004597 3300028786 Bacteria 21141
145 Ga0307515_10000699 3300028794 Bacteria 77489
146 Ga0307515_10088843 3300028794 Bacteria 3899
147 Ga0307515_10672081 3300028794 Bacteria 649
148 Ga0268256_1018141 3300030500 Bacteria 1963
149 Ga0307511_10000438 3300030521 Bacteria 44529
150 Ga0307511_10064014 3300030521 Bacteria 2770
151 Ga0307512_10004518 3300030522 Bacteria 15212
152 Ga0307512_10099826 3300030522 Bacteria 1973
153 Ga0307513_10009135 3300031456 Bacteria 12558
154 Ga0307513_10174813 3300031456 Bacteria 2019
155 Ga0307513_10974988 3300031456 Bacteria 557
156 Ga0307509_10039154 3300031507 Bacteria 5166
157 Ga0307508_10006837 3300031616 Bacteria 10669
158 Ga0307508_10006908 3300031616 Bacteria 10607
159 Ga0307508_10007827 3300031616 Bacteria 9923
160 Ga0307508_10050424 3300031616 Bacteria 3705
161 Ga0307508_10190740 3300031616 Bacteria 1651
162 Ga0307514_10049324 3300031649 Bacteria 3274
163 Ga0307514_10050574 3300031649 Bacteria 3224
164 Ga0307514_10059521 3300031649 Bacteria 2918
165 Ga0307514_10126484 3300031649 Bacteria 1770
166 Ga0307516_10002231 3300031730 Bacteria 26212
167 Ga0307516_10417422 3300031730 Bacteria 1000
168 Ga0307516_10516121 3300031730 Bacteria 849
169 Ga0307516_10588871 3300031730 Bacteria 766
170 Ga0307518_10063769 3300031838 Bacteria 2674
171 Ga0307518_10336111 3300031838 Bacteria 890
172 Ga0307518_10621871 3300031838 Bacteria 508
173 Ga0307416_100849287 3300032002 Bacteria 1011
174 Ga0307416_101486896 3300032002 Bacteria 783
175 Ga0307416_103424366 3300032002 Bacteria 531
176 Ga0307507_10045296 3300033179 Bacteria 4330
177 Ga0307507_10079103 3300033179 Bacteria 2909
178 Ga0307507_10115847 3300033179 Bacteria 2166
179 Ga0307507_10539758 3300033179 Bacteria 618
180 Ga0307510_10011458 3300033180 Bacteria 10534
181 Ga0307510_10023835 3300033180 Bacteria 7085
182 Ga0307510_10240025 3300033180 Bacteria 1307
183 Ga0373934_0294083 3300035086 Bacteria 673
184 Ga0373945_0098141 3300035116 Bacteria 1143
185 Ga0373945_0166859 3300035116 Bacteria 900
186 Ga0373954_0056855 3300035118 Bacteria 1842
187 Ga0373956_0192362 3300035119 Bacteria 966
188 Ga0373943_0164675 3300035170 Bacteria 1209
189 Ga0373946_0433400 3300035171 Bacteria 667
190 Ga0373931_0769697 3300035691 Bacteria 640
191 Ga0373937_0039588 3300036401 Bacteria 4295
192 Ga0373925_0443148 3300037068 Bacteria 1063
193 Ga0395900_0193003 3300037418 Bacteria 2065
194 Ga0395898_0003092 3300037466 Bacteria 18832
195 Ga0395898_0030289 3300037466 Bacteria 5416
196 Ga0395901_0074271 3300038443 Bacteria 3547
197 Ga0395901_0244404 3300038443 Bacteria 1871
198 Ga0439436_0002729 3300041404 Bacteria 5333
199 Ga0439436_0003166 3300041404 Bacteria 4989
200 Ga0439439_0007385 3300041406 Bacteria 2569
201 Ga0451789_0944422 3300041443 Bacteria 723
202 Ga0451800_1114010 3300041459 Bacteria 1389
203 Ga0451807_1614476 3300041486 Bacteria 895
204 Ga0451807_1804336 3300041486 Bacteria 708
205 Ga0451837_0010181 3300041494 Bacteria 2844
206 Ga0451841_1407059 3300041498 Bacteria 605
207 Ga0451845_0506071 3300041501 Bacteria 751
208 Ga0451847_0278125 3300041503 Bacteria 547
209 Ga0451843_1617188 3300041509 Bacteria 663
210 Ga0451853_0301595 3300041512 Bacteria 2221
211 Ga0451853_0393940 3300041512 Bacteria 1824
212 Ga0451853_1059851 3300041512 Bacteria 1060
213 Ga0451853_2009427 3300041512 Bacteria 2464
214 Ga0439431_0066081 3300041997 Bacteria 958
215 Ga0439433_0012142 3300041999 Bacteria 1887
216 Ga0439442_001532 3300042002 Bacteria 4535
217 Ga0439442_003644 3300042002 Bacteria 3051
218 Ga0439448_0004898 3300042005 Bacteria 3799
219 Ga0439449_0000358 3300042007 Bacteria 16753
220 Ga0439449_0041114 3300042007 Bacteria 1718
221 Ga0439449_0089795 3300042007 Bacteria 1134
222 Ga0439449_0122340 3300042007 Bacteria 966
223 Ga0439450_155205 3300042008 Bacteria 601
224 Ga0439454_016112 3300042011 Bacteria 1053
225 Ga0439457_002398 3300042014 Bacteria 5357
226 Ga0439457_004233 3300042014 Bacteria 3778
227 Ga0439457_061953 3300042014 Bacteria 848
228 Ga0439462_0010822 3300042015 Bacteria 2315
229 Ga0439463_142957 3300042016 Bacteria 620
230 Ga0450897_009761 3300042128 Bacteria 913
231 Ga0450894_000136 3300042131 Bacteria 12932
232 Ga0450898_000424 3300042134 Bacteria 4906
233 Ga0450899_018844 3300042135 Bacteria 799
234 Ga0450900_004670 3300042136 Bacteria 1585
235 Ga0450902_008532 3300042137 Bacteria 1602
236 Ga0450903_000233 3300042138 Bacteria 12380
237 Ga0450906_018467 3300042145 Bacteria 1251
238 Ga0439458_0018008 3300042157 Bacteria 1615
239 Ga0439458_0020162 3300042157 Bacteria 1539
240 Ga0450908_010768 3300042184 Bacteria 1683
241 Ga0466969_0083017 3300044656 Bacteria 1526
242 Ga0466969_0135318 3300044656 Bacteria 1141
243 Ga0466972_0004540 3300044658 Bacteria 6952
244 Ga0466972_0056941 3300044658 Bacteria 1878
245 Ga0466972_0067178 3300044658 Bacteria 1713
246 Ga0466972_0172952 3300044658 Bacteria 1013
247 Ga0466965_0031059 3300044683 Bacteria 2603
248 Ga0466965_0297837 3300044683 Bacteria 874
249 Ga0466965_0361990 3300044683 Bacteria 796
250 Ga0466965_0912746 3300044683 Bacteria 513
251 Ga0466966_0191081 3300044684 Bacteria 1240
252 Ga0466961_0017066 3300044693 Bacteria 4662
253 Ga0466961_0080676 3300044693 Bacteria 2059
254 Ga0466961_0190965 3300044693 Bacteria 1269
255 Ga0466961_0724040 3300044693 Bacteria 595
256 Ga0466963_0000213 3300044694 Bacteria 24764
257 Ga0466963_0031993 3300044694 Bacteria 3403
258 Ga0466963_0072827 3300044694 Bacteria 2315
259 Ga0466963_0168700 3300044694 Bacteria 1525
260 Ga0466963_0686842 3300044694 Bacteria 722
261 Ga0466964_0102966 3300044706 Bacteria 1261
262 Ga0466964_0518622 3300044706 Bacteria 642
263 Ga0466971_0000575 3300044719 Bacteria 14492
264 Ga0466971_0038665 3300044719 Bacteria 2141
265 Ga0466971_0647823 3300044719 Bacteria 529
266 Ga0466968_0169956 3300044735 Bacteria 1010
267 Ga0466970_0001274 3300044765 Bacteria 12183
268 Ga0466970_0006583 3300044765 Bacteria 5810
269 Ga0466970_0680531 3300044765 Bacteria 599
270 Ga0466957_0023199 3300044842 Bacteria 3666
271 Ga0466957_0205515 3300044842 Bacteria 1295
272 Ga0466957_0221160 3300044842 Bacteria 1250
273 Ga0466957_0996579 3300044842 Bacteria 602
274 Ga0466957_1003719 3300044842 Bacteria 599
275 Ga0466960_0121087 3300044901 Bacteria 1370
276 Ga0466960_0151254 3300044901 Bacteria 1240
277 Ga0466960_0507779 3300044901 Bacteria 707
278 Ga0466959_0003363 3300045049 Bacteria 10451
279 Ga0466959_0922397 3300045049 Unclassified 582
280 Ga0466958_0095111 3300045836 Bacteria 1846
281 Ga0466958_0132417 3300045836 Bacteria 1566
282 Ga0466967_0052759 3300045976 Bacteria 3571
283 Ga0466967_0108297 3300045976 Bacteria 2549
284 Ga0466967_0143729 3300045976 Bacteria 2224
285 Ga0466967_0174885 3300045976 Bacteria 2022
286 Ga0466967_0192631 3300045976 Bacteria 1927
287 Ga0466967_0212446 3300045976 Bacteria 1835
288 Ga0466967_0307766 3300045976 Bacteria 1525
289 Ga0466967_0440992 3300045976 Bacteria 1271
290 Ga0466967_0524071 3300045976 Bacteria 1165
291 Ga0466967_2195384 3300045976 Bacteria 548
292 Ga0466967_2224499 3300045976 Bacteria 544
293 Ga0495592_0000574 3300046454 Bacteria 26037
294 Ga0495592_0047991 3300046454 Bacteria 3178
295 Ga0495603_0004257 3300046455 Bacteria 8525
296 Ga0495603_0274076 3300046455 Bacteria 970
297 Ga0495603_0442957 3300046455 Bacteria 744
298 Ga0495603_0757155 3300046455 Bacteria 555
299 Ga0495590_0038675 3300046457 Bacteria 1664
300 Ga0495629_0002819 3300046459 Bacteria 13265
301 Ga0495629_0013612 3300046459 Bacteria 5869
302 Ga0495629_0023271 3300046459 Bacteria 4415
303 Ga0495629_0089361 3300046459 Bacteria 2149
304 Ga0495629_0107957 3300046459 Bacteria 1941
305 Ga0495629_0110270 3300046459 Bacteria 1918
306 Ga0495629_0146572 3300046459 Bacteria 1641
307 Ga0495629_0444279 3300046459 Bacteria 878
308 Ga0495638_0112665 3300046460 Bacteria 1614
309 Ga0495638_0269807 3300046460 Bacteria 929
310 Ga0495641_0173672 3300046461 Bacteria 964
311 Ga0495651_0017031 3300046462 Bacteria 5630
312 Ga0495651_0079211 3300046462 Bacteria 2483
313 Ga0495651_0102999 3300046462 Bacteria 2121
314 Ga0495651_0177354 3300046462 Bacteria 1511
315 Ga0495653_0090901 3300046463 Bacteria 2232
316 Ga0495653_0377002 3300046463 Bacteria 907
317 Ga0495653_0641302 3300046463 Bacteria 649
318 Ga0495580_0253921 3300046472 Bacteria 1203
319 Ga0495582_0100885 3300046473 Bacteria 1616
320 Ga0495605_0005349 3300046474 Bacteria 7481
321 Ga0495639_0075647 3300046475 Bacteria 1561
322 Ga0495662_0013250 3300046476 Bacteria 4013
323 Ga0495662_0018848 3300046476 Bacteria 3339
324 Ga0495662_0039237 3300046476 Bacteria 2287
325 Ga0495662_0101601 3300046476 Bacteria 1406
326 Ga0495662_0181113 3300046476 Bacteria 1038
327 Ga0495662_0559855 3300046476 Bacteria 560
328 Ga0495664_0007790 3300046477 Bacteria 5961
329 Ga0495664_0031093 3300046477 Bacteria 3128
330 Ga0495664_0037883 3300046477 Bacteria 2847
331 Ga0495664_0063719 3300046477 Bacteria 2197
332 Ga0495664_0085909 3300046477 Bacteria 1889
333 Ga0495664_0713314 3300046477 Bacteria 592
334 Ga0495584_0282451 3300046491 Bacteria 843
335 Ga0495584_0567137 3300046491 Bacteria 579
336 Ga0495585_0007795 3300046492 Bacteria 6523
337 Ga0495585_0058979 3300046492 Bacteria 2116
338 Ga0495594_0001816 3300046499 Bacteria 11101
339 Ga0495594_0081634 3300046499 Bacteria 1805
340 Ga0495594_0116525 3300046499 Bacteria 1508
341 Ga0495594_0157211 3300046499 Bacteria 1291
342 Ga0495594_0486532 3300046499 Bacteria 701
343 Ga0495596_0125752 3300046500 Bacteria 995
344 Ga0495596_0234521 3300046500 Bacteria 712
345 Ga0495607_0081677 3300046501 Bacteria 1775
346 Ga0495607_0096676 3300046501 Bacteria 1589
347 Ga0495583_0042610 3300046506 Bacteria 2118
348 Ga0495606_0013622 3300046507 Bacteria 6411
349 Ga0495608_0344690 3300046511 Bacteria 917
350 Ga0495608_0838235 3300046511 Bacteria 541
351 Ga0495610_0121162 3300046512 Bacteria 1146
352 Ga0495610_0146435 3300046512 Bacteria 1012
353 Ga0495610_0215045 3300046512 Bacteria 779
354 Ga0495616_0037258 3300046513 Bacteria 2503
355 Ga0495618_0062044 3300046514 Bacteria 2371
356 Ga0495618_0319690 3300046514 Bacteria 961
357 Ga0495620_0034741 3300046515 Bacteria 2274
358 Ga0495620_0088812 3300046515 Bacteria 1241
359 Ga0495620_0277766 3300046515 Bacteria 637
360 Ga0495628_0046823 3300046516 Bacteria 3433
361 Ga0495628_0080884 3300046516 Bacteria 2524
362 Ga0495628_0149536 3300046516 Bacteria 1779
363 Ga0495628_0178311 3300046516 Bacteria 1608
364 Ga0495628_0443471 3300046516 Bacteria 943
365 Ga0495630_0033011 3300046517 Bacteria 3860
366 Ga0495630_0162453 3300046517 Bacteria 1700
367 Ga0495630_0473812 3300046517 Bacteria 960
368 Ga0495630_0568209 3300046517 Bacteria 870
369 Ga0495631_0028031 3300046518 Bacteria 2571
370 Ga0495631_0069413 3300046518 Bacteria 1524
371 Ga0495637_0064870 3300046520 Bacteria 1488
372 Ga0495643_0005567 3300046522 Bacteria 8478
373 Ga0495644_0297976 3300046523 Bacteria 631
374 Ga0495648_0050550 3300046524 Bacteria 2538
375 Ga0495648_0193895 3300046524 Bacteria 1023
376 Ga0495648_0389007 3300046524 Bacteria 626
377 Ga0495666_0014863 3300046526 Bacteria 3873
378 Ga0495666_0123221 3300046526 Bacteria 1213
379 Ga0495642_0015555 3300046528 Bacteria 2959
380 Ga0495652_0028911 3300046529 Bacteria 4872
381 Ga0495652_0030071 3300046529 Bacteria 4766
382 Ga0495652_0139100 3300046529 Bacteria 1911
383 Ga0495652_0182024 3300046529 Bacteria 1611
384 Ga0495654_0026495 3300046530 Bacteria 2979
385 Ga0495665_0137705 3300046531 Bacteria 1276
386 Ga0495640_0010846 3300046533 Bacteria 7030
387 Ga0495640_0021884 3300046533 Bacteria 4683
388 Ga0495640_0035770 3300046533 Bacteria 3513
389 Ga0495640_0144317 3300046533 Bacteria 1532
390 Ga0495586_0092894 3300046535 Bacteria 1668
391 Ga0495586_0289667 3300046535 Bacteria 937
392 Ga0495587_0001011 3300046536 Bacteria 18494
393 Ga0495587_0003221 3300046536 Bacteria 10913
394 Ga0495587_0278099 3300046536 Bacteria 938
395 Ga0495609_0073982 3300046538 Bacteria 1494
396 Ga0495597_0023855 3300046542 Bacteria 2828
397 Ga0495645_0032240 3300046543 Bacteria 3821
398 Ga0495645_0049580 3300046543 Bacteria 3057
399 Ga0495645_0482447 3300046543 Bacteria 777
400 Ga0495622_0019957 3300046557 Bacteria 3119
401 Ga0495622_0027908 3300046557 Bacteria 2634
402 Ga0495622_0101327 3300046557 Bacteria 1320
403 Ga0495622_0192528 3300046557 Bacteria 911
404 Ga0495633_0037682 3300046558 Bacteria 2312
405 Ga0495633_0200017 3300046558 Bacteria 917
406 Ga0495667_0030504 3300046559 Bacteria 3622
407 Ga0495667_0195928 3300046559 Bacteria 1294
408 Ga0495667_0296114 3300046559 Bacteria 1025
409 Ga0495667_0320136 3300046559 Bacteria 981
410 Ga0495667_0988724 3300046559 Bacteria 513
411 Ga0495668_0017827 3300046616 Bacteria 4113
412 Ga0495668_0076764 3300046616 Bacteria 1834
413 Ga0495668_0099213 3300046616 Bacteria 1593
414 Ga0495634_0005531 3300046642 Bacteria 9699
415 Ga0495634_0017386 3300046642 Bacteria 5132
416 Ga0495634_0274406 3300046642 Bacteria 1025
417 Ga0495634_0586886 3300046642 Bacteria 647
418 Ga0495611_0145263 3300046648 Bacteria 1107
419 Ga0495611_0145976 3300046648 Bacteria 1104
420 Ga0495611_0207546 3300046648 Bacteria 913
421 Ga0495625_0164477 3300046660 Bacteria 1484
422 Ga0495625_0295332 3300046660 Bacteria 1038
423 Ga0495635_0098181 3300046663 Bacteria 2002
424 Ga0495635_0165153 3300046663 Bacteria 1506
425 Ga0495635_0201024 3300046663 Bacteria 1351
426 Ga0495635_0921331 3300046663 Bacteria 559
427 Ga0495661_0036094 3300046665 Bacteria 3097
428 Ga0495661_0262342 3300046665 Bacteria 877
429 Ga0495661_0439445 3300046665 Bacteria 629
430 Ga0495588_0001268 3300046674 Bacteria 10834
431 Ga0495588_0012467 3300046674 Bacteria 4019
432 Ga0495588_0263876 3300046674 Bacteria 907
433 Ga0495657_0001214 3300046675 Bacteria 22612
434 Ga0495657_0020442 3300046675 Bacteria 4757
435 Ga0495657_0030679 3300046675 Bacteria 3762
436 Ga0495657_0033179 3300046675 Bacteria 3596
437 Ga0495599_0005311 3300046678 Bacteria 7685
438 Ga0495599_0090794 3300046678 Bacteria 1906
439 Ga0495599_0194168 3300046678 Bacteria 1248
440 Ga0495646_0014451 3300046680 Bacteria 5020
441 Ga0495646_0283485 3300046680 Bacteria 880
442 Ga0495658_0116688 3300046683 Bacteria 1610
443 Ga0495658_0144361 3300046683 Bacteria 1457
444 Ga0495613_0003059 3300046689 Bacteria 12502
445 Ga0495613_0010395 3300046689 Bacteria 6912
446 Ga0495613_0012117 3300046689 Bacteria 6408
447 Ga0495613_0109870 3300046689 Bacteria 1987
448 Ga0495613_0135378 3300046689 Bacteria 1763
449 Ga0495613_0179258 3300046689 Bacteria 1501
450 Ga0495613_0229586 3300046689 Bacteria 1300
451 Ga0495613_0530936 3300046689 Bacteria 789
452 Ga0495613_0680743 3300046689 Bacteria 678
453 Ga0495624_0014389 3300046690 Bacteria 5370
454 Ga0495624_0110705 3300046690 Bacteria 1689
455 Ga0495624_0271689 3300046690 Bacteria 1024
456 Ga0495624_0480763 3300046690 Bacteria 743
457 Ga0495624_0559763 3300046690 Bacteria 682
458 Ga0495670_0379824 3300046691 Bacteria 762
459 Ga0495670_0508837 3300046691 Bacteria 654
460 Ga0495671_0022519 3300046692 Bacteria 3300
461 Ga0495671_0153702 3300046692 Bacteria 1120
462 Ga0495671_0173739 3300046692 Bacteria 1047
463 Ga0495649_0080389 3300046694 Bacteria 1743
464 Ga0495649_0154922 3300046694 Bacteria 1203
465 Ga0495649_0167813 3300046694 Bacteria 1149
466 Ga0495589_0014905 3300046794 Bacteria 4000
467 Ga0495589_0276114 3300046794 Bacteria 782
468 Ga0495600_0007018 3300046809 Bacteria 6879
469 Ga0495600_0019938 3300046809 Bacteria 4286
470 Ga0495600_0051201 3300046809 Bacteria 2695
471 Ga0495600_0383097 3300046809 Bacteria 877
472 Ga0495581_0005237 3300047315 Bacteria 7500
473 Ga0495581_0065540 3300047315 Bacteria 2100
474 Ga0495581_0248433 3300047315 Bacteria 1040
475 Ga0495581_0503292 3300047315 Bacteria 704
476 Ga0495604_0022719 3300047317 Bacteria 5008
477 Ga0495604_0056268 3300047317 Bacteria 3028
478 Ga0495604_0113627 3300047317 Bacteria 1970
479 Ga0495604_0129049 3300047317 Bacteria 1819
480 Ga0495604_0603621 3300047317 Bacteria 703
481 Ga0495636_0027201 3300047318 Bacteria 2330
482 Ga0495636_0036339 3300047318 Bacteria 2031
483 Ga0495636_0045783 3300047318 Bacteria 1824
484 Ga0495636_0049775 3300047318 Bacteria 1753
485 Ga0495674_0194508 3300047319 Bacteria 1684
486 Ga0495674_0213282 3300047319 Bacteria 1598
487 Ga0495674_0616145 3300047319 Bacteria 859
488 Ga0495674_1043863 3300047319 Bacteria 624
489 Ga0495672_0083211 3300047320 Bacteria 1778
490 Ga0495676_0002047 3300047321 Bacteria 17746
491 Ga0495676_0005451 3300047321 Bacteria 11667
492 Ga0495676_0012902 3300047321 Bacteria 7516
493 Ga0495676_0030974 3300047321 Bacteria 4530
494 Ga0495676_0073343 3300047321 Bacteria 2624
495 Ga0495676_0146274 3300047321 Bacteria 1687
496 Ga0495676_0151528 3300047321 Bacteria 1649
497 Ga0495676_0201737 3300047321 Bacteria 1382
498 Ga0495676_0926524 3300047321 Bacteria 557
499 Ga0495676_1044284 3300047321 Bacteria 520
500 Ga0495680_0010669 3300047322 Bacteria 8192
501 Ga0495680_0093253 3300047322 Bacteria 2254
502 Ga0495680_0417508 3300047322 Bacteria 923
503 Ga0495683_0273178 3300047323 Bacteria 734
504 Ga0495687_006392 3300047443 Bacteria 7232
505 Ga0495687_020416 3300047443 Bacteria 3227
506 Ga0495687_171719 3300047443 Bacteria 717
507 Ga0495675_0014147 3300047444 Bacteria 5045
508 Ga0495675_0142712 3300047444 Bacteria 1483
509 Ga0495675_0160163 3300047444 Bacteria 1386
510 Ga0495675_0228593 3300047444 Bacteria 1123
511 Ga0495677_0026186 3300047445 Bacteria 2116
512 Ga0495685_005303 3300047447 Bacteria 4203
513 Ga0495685_006989 3300047447 Bacteria 3714
514 Ga0495685_018741 3300047447 Bacteria 2376
515 Ga0495685_162261 3300047447 Bacteria 723
516 Ga0495673_0198446 3300047469 Bacteria 752
517 Ga0495681_0000567 3300047470 Bacteria 28271
518 Ga0495681_0302764 3300047470 Bacteria 618
519 Ga0495684_0000710 3300047471 Bacteria 26766
520 Ga0495684_0095811 3300047471 Bacteria 2246
521 Ga0495686_0015791 3300047472 Bacteria 5140
522 Ga0495686_0028044 3300047472 Bacteria 3669
523 Ga0495686_0084897 3300047472 Bacteria 1929
524 Ga0495593_0000488 3300047673 Bacteria 22326
525 Ga0495593_0023676 3300047673 Bacteria 3410
526 Ga0495593_0027313 3300047673 Bacteria 3142
527 Ga0495593_0651560 3300047673 Bacteria 529
528 Ga0495602_0018574 3300048088 Bacteria 6936
529 Ga0495602_0077375 3300048088 Bacteria 2815
530 Ga0495614_0001937 3300048089 Bacteria 9093
531 Ga0495614_0006857 3300048089 Bacteria 5094
532 Ga0495614_0007664 3300048089 Bacteria 4799
533 Ga0495614_0041221 3300048089 Bacteria 1980
534 Ga0495614_0119543 3300048089 Bacteria 1161
535 Ga0495614_0222866 3300048089 Bacteria 857
536 Ga0495626_0024655 3300048091 Bacteria 2947
537 Ga0496104_0555074 3300048907 Bacteria 1059
538 Ga0496105_0038560 3300048908 Bacteria 3936
539 Ga0496105_0522338 3300048908 Bacteria 930
540 Ga0496106_0214524 3300048909 Bacteria 1534
541 Ga0496107_0883835 3300048910 Bacteria 652
542 Ga0496108_0009740 3300048911 Bacteria 7784
543 Ga0496108_1097077 3300048911 Bacteria 676
544 Ga0496110_0010424 3300048913 Bacteria 7557
545 Ga0496110_1044945 3300048913 Bacteria 725
546 Ga0496112_0043029 3300048915 Bacteria 4421
547 Ga0496112_0208625 3300048915 Bacteria 1911
548 Ga0496113_0010985 3300048916 Bacteria 6017
549 Ga0496113_0635352 3300048916 Bacteria 854
550 Ga0496114_0430438 3300048917 Bacteria 1169
551 Ga0496119_0503949 3300048922 Bacteria 563
552 Ga0501306_041572 3300049127 Bacteria 715
553 Ga0501306_069041 3300049127 Bacteria 594
554 Ga0501308_032020 3300049128 Bacteria 709
555 Ga0501308_060874 3300049128 Bacteria 570
556 Ga0501310_034095 3300049130 Bacteria 687
557 Ga0495678_019245 3300049459 Bacteria 3050
558 Ga0495682_0231453 3300049460 Bacteria 654
559 Ga0501313_048544 3300049529 Bacteria 583
560 Ga0501314_043024 3300049530 Bacteria 531
561 Ga0501031_0174821 3300049568 Bacteria 1403
562 Ga0501032_0041778 3300049569 Bacteria 3112
563 Ga0501032_0161676 3300049569 Bacteria 1470
564 Ga0501032_0164657 3300049569 Bacteria 1455
565 Ga0501032_0242617 3300049569 Bacteria 1170
566 Ga0501033_0003519 3300049570 Bacteria 12825
567 Ga0501033_0053149 3300049570 Bacteria 3000
568 Ga0501033_0165927 3300049570 Bacteria 1587
569 Ga0501034_0746442 3300049571 Bacteria 874
570 Ga0501034_0785875 3300049571 Bacteria 845
571 Ga0501036_0112831 3300049572 Bacteria 2297
572 Ga0501036_0302546 3300049572 Bacteria 1337
573 Ga0501037_0194265 3300049573 Bacteria 1436
574 Ga0501037_0210513 3300049573 Bacteria 1371
575 Ga0501037_0240410 3300049573 Bacteria 1269
576 Ga0501037_0268436 3300049573 Bacteria 1191
577 Ga0501038_0311018 3300049574 Bacteria 1234
578 Ga0501039_0055212 3300049575 Bacteria 3075
579 Ga0501043_0031845 3300049579 Bacteria 4145
580 Ga0501043_0058599 3300049579 Bacteria 3023
581 Ga0501043_0108548 3300049579 Bacteria 2179
582 Ga0501043_0956633 3300049579 Bacteria 611
583 Ga0501047_0009843 3300049581 Bacteria 9033
584 Ga0501047_0081903 3300049581 Bacteria 3102
585 Ga0501047_0215681 3300049581 Bacteria 1776
586 Ga0501047_0297330 3300049581 Bacteria 1457
587 Ga0501048_0088148 3300049582 Bacteria 2189
588 Ga0501070_0169212 3300049586 Bacteria 1800
589 Ga0501070_0194908 3300049586 Bacteria 1664
590 Ga0501070_0335980 3300049586 Bacteria 1227
591 Ga0501257_251696 3300049686 Bacteria 524
592 Ga0501080_0025292 3300049742 Bacteria 5509
593 Ga0501035_0026105 3300049822 Bacteria 5349
594 Ga0501035_0101021 3300049822 Bacteria 2531
595 Ga0501035_0129751 3300049822 Bacteria 2198
596 Ga0501035_0150580 3300049822 Bacteria 2019
597 Ga0501035_1020781 3300049822 Bacteria 649
598 Ga0501044_0004420 3300049823 Bacteria 15724
599 Ga0501044_0020637 3300049823 Bacteria 7035
600 Ga0501044_0166315 3300049823 Bacteria 2179
601 Ga0501044_0172461 3300049823 Bacteria 2133
602 Ga0501044_0229901 3300049823 Bacteria 1803
603 Ga0501044_0237938 3300049823 Bacteria 1765
604 Ga0501044_1286194 3300049823 Bacteria 598
605 nmdc:mga03n38_218115_c1 3300050490 Bacteria 994
606 nmdc:mga06z11_1987_c1 3300050494 Bacteria 7736
607 nmdc:mga07m45_192230_c1 3300050496 Bacteria 1187
608 nmdc:mga06r32_1310712_c1 3300050510 Bacteria 668
609 nmdc:mga08x19_353497_c1 3300050514 Bacteria 1026
610 nmdc:mga08x19_935557_c1 3300050514 Bacteria 616
611 nmdc:mga0a205_542486_c1 3300050515 Bacteria 1018
612 Ga0495655_0196384 3300053083 Bacteria 658
613 Ga0495595_0085330 3300053084 Bacteria 1509
614 Ga0495595_0119330 3300053084 Bacteria 1284
615 Ga0495619_0015501 3300053085 Bacteria 4822
616 Ga0495619_0184798 3300053085 Bacteria 1442
617 Ga0500578_0746835 3300053086 Bacteria 522
618 Ga0500644_0028242 3300053088 Bacteria 1753
619 Ga0500640_015759 3300053095 Bacteria 3174
620 Ga0500660_155744 3300053100 Bacteria 876
621 Ga0500660_208455 3300053100 Bacteria 661
622 Ga0500553_180986 3300053101 Bacteria 756
623 Ga0500553_227331 3300053101 Bacteria 599
624 Ga0500560_001736 3300053107 Bacteria 3912
625 Ga0500560_152651 3300053107 Bacteria 766
626 Ga0500572_013583 3300053111 Bacteria 2018
627 Ga0500608_137041 3300053122 Bacteria 1090
628 Ga0500614_135620 3300053123 Bacteria 733
629 Ga0500642_0364987 3300053130 Bacteria 638
630 Ga0500655_112385 3300053133 Bacteria 575
631 Ga0500658_0394177 3300053134 Bacteria 634
632 Ga0500559_0294829 3300053136 Bacteria 762
633 Ga0500573_0199793 3300053140 Bacteria 1062
634 Ga0500573_0352528 3300053140 Bacteria 714
635 Ga0500586_176739 3300053145 Bacteria 715
636 Ga0500600_0037488 3300053149 Bacteria 2810
637 Ga0500624_013244 3300053157 Bacteria 1231
638 Ga0500634_0148320 3300053161 Bacteria 1100
639 Ga0500636_0150474 3300053177 Bacteria 1279
640 Ga0500599_020103 3300053736 Bacteria 943
641 Ga0587084_020241 3300059477 Bacteria 988
642 Ga0587066_046314 3300059490 Bacteria 839
643 Ga0587073_0109166 3300059492 Bacteria 730
644 Ga0587082_032635 3300059504 Bacteria 916
645 Ga0587083_0228452 3300059505 Bacteria 545
646 Ga0587085_040716 3300059506 Bacteria 808
647 Ga0587088_196680 3300059508 Bacteria 513
648 Ga0587089_107393 3300059509 Bacteria 512
649 Ga0587092_045216 3300059512 Bacteria 780
650 Ga0587092_105560 3300059512 Bacteria 586
651 Ga0587106_069618 3300059605 Bacteria 664
652 Ga0587106_143660 3300059605 Bacteria 525
653 Ga0587106_156557 3300059605 Bacteria 511
654 Ga0587109_094313 3300059624 Bacteria 679
655 Ga0587122_018406 3300059628 Bacteria 739
656 Ga0587122_050572 3300059628 Bacteria 538
657 Ga0587062_102097 3300059639 Bacteria 560
658 Ga0587067_175027 3300059640 Bacteria 555
659 Ga0587072_033100 3300059643 Bacteria 974
660 Ga0587100_029492 3300059648 Bacteria 576
661 Ga0587105_026240 3300059651 Bacteria 536
662 Ga0587107_151481 3300059652 Bacteria 504
663 Ga0587114_030091 3300059655 Bacteria 825
664 Ga0587120_030803 3300059659 Bacteria 547
665 Ga0587071_033775 3300060344 Bacteria 997
666 Ga0587111_0039359 3300060346 Bacteria 1002
667 Ga0466962_0004079 3300061719 Bacteria 6994
668 Ga0466962_0038489 3300061719 Bacteria 2290
669 Ga0466962_0040152 3300061719 Bacteria 2241
670 Ga0466962_0082227 3300061719 Bacteria 1540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10080830 rootH1_100808302 118
2 3300003320 rootH2_10040067 rootH2_1004006710 118
3 3300003323 rootH1_10017685 rootH1_100176853 119
4 iso_pu_bacteria 2862382967 2862388622 120
5 3300044842 Ga0466957_0996579 Ga0466957_0996579_183_587 121
6 3300046516 Ga0495628_0046823 Ga0495628_0046823_15_383 121
7 3300046517 Ga0495630_0568209 Ga0495630_0568209_484_852 121
8 3300046543 Ga0495645_0482447 Ga0495645_0482447_360_728 121
9 3300050514 nmdc:mga08x19_935557_c1 nmdc:mga08x19_935557_c1_57_425 121
10 iso_pu_bacteria 2918501144 2918506327 121
11 3300006175 Ga0070712_101336267 Ga0070712_1013362672 122
12 3300006844 Ga0075428_101693119 Ga0075428_1016931192 122
13 3300025915 Ga0207693_10918745 Ga0207693_109187451 122
14 3300035116 Ga0373945_0166859 Ga0373945_0166859_167_550 122
15 3300037068 Ga0373925_0443148 Ga0373925_0443148_517_900 122
16 3300046511 Ga0495608_0838235 Ga0495608_0838235_153_527 122
17 3300047315 Ga0495581_0248433 Ga0495581_0248433_54_437 122
18 3300047319 Ga0495674_0616145 Ga0495674_0616145_105_488 122
19 3300048907 Ga0496104_0555074 Ga0496104_0555074_231_623 122
20 3300048908 Ga0496105_0522338 Ga0496105_0522338_487_879 122
21 3300050510 nmdc:mga06r32_1310712_c1 nmdc:mga06r32_1310712_c1_84_473 122
22 3300053084 Ga0495595_0119330 Ga0495595_0119330_157_540 122
23 iso_pu_bacteria 2643221587 2643945505 122
24 iso_pu_bacteria 2643221670 2644386743 122
25 iso_pu_bacteria 2643221677 2644431168 122
26 3300005535 Ga0070684_100174499 Ga0070684_1001744994 124
27 3300005544 Ga0070686_101224166 Ga0070686_1012241662 124
28 3300005618 Ga0068864_101707311 Ga0068864_1017073111 124
29 3300005718 Ga0068866_10079829 Ga0068866_100798293 124
30 3300006881 Ga0068865_101039796 Ga0068865_1010397962 124
31 3300009098 Ga0105245_10134622 Ga0105245_101346223 124
32 3300009553 Ga0105249_10650002 Ga0105249_106500021 124
33 3300011119 Ga0105246_10667927 Ga0105246_106679272 124
34 3300013308 Ga0157375_10085836 Ga0157375_100858361 124
35 3300015688 Ga0183367_1002 Ga0183367_1002212 124
36 3300042128 Ga0450897_009761 Ga0450897_009761_487_903 124
37 3300042136 Ga0450900_004670 Ga0450900_004670_931_1305 124
38 3300049530 Ga0501314_043024 Ga0501314_043024_16_390 124
39 iso_pu_bacteria 2862290372 2862295220 124
40 iso_pu_bacteria 8025478263 8025482528 124
41 3300045976 Ga0466967_2224499 Ga0466967_2224499_131_532 125
42 iso_pu_bacteria 2643221578 2643902429 125
43 iso_pu_bacteria 2643221673 2644404000 125
44 iso_pu_bacteria 2862178590 2862179128 125
45 iso_pu_bacteria 2946045630 2946048028 125
46 3300047318 Ga0495636_0049775 Ga0495636_0049775_925_1314 126
47 iso_pu_bacteria 2547132111 2547408540 126
48 iso_pu_bacteria 2554235005 2554256365 126
49 iso_pu_bacteria 2582581312 2585296441 126
50 iso_pu_bacteria 2582581313 2585306964 126
51 iso_pu_bacteria 2582581314 2585318639 126
52 iso_pu_bacteria 2616644814 2616697140 126
53 iso_pu_bacteria 2616644941 2616900069 126
54 iso_pu_bacteria 2643221548 2643763847 126
55 iso_pu_bacteria 2643221647 2644265971 126
56 iso_pu_bacteria 2643221678 2644439869 126
57 iso_pu_bacteria 2643221682 2644461719 126
58 iso_pu_bacteria 2643221714 2644632800 126
59 iso_pu_bacteria 2784746763 2785341366 126
60 iso_pu_bacteria 2784746768 2785371318 126
61 iso_pu_bacteria 2786546132 2786672505 126
62 iso_pu_bacteria 2808606359 2808843877 126
63 iso_pu_bacteria 2808606375 2808913417 126
64 iso_pu_bacteria 2808606982 2811844588 126
65 iso_pu_bacteria 2811994879 2812356165 126
66 iso_pu_bacteria 2811994917 2812478918 126
67 iso_pu_bacteria 2818991463 2819694771 126
68 iso_pu_bacteria 2862281513 2862284925 126
69 iso_pu_bacteria 2862574272 2862577682 126
70 iso_pu_bacteria 2863404153 2863408443 126
71 iso_pu_bacteria 2867428634 2867434539 126
72 iso_pu_bacteria 2873151551 2873154206 126
73 iso_pu_bacteria 2875391855 2875396526 126
74 iso_pu_bacteria 2877676314 2877679287 126
75 iso_pu_bacteria 2912715099 2912717884 126
76 iso_pu_bacteria 2912757875 2912762591 126
77 iso_pu_bacteria 2919468124 2919471557 126
78 iso_pu_bacteria 2946064051 2946069691 126
79 iso_pu_bacteria 2946072368 2946077583 126
80 iso_pu_bacteria 2947224130 2947227118 126
81 iso_pu_bacteria 2954002825 2954005292 126
82 iso_pu_bacteria 2954380949 2954384172 126
83 iso_pu_bacteria 2954673503 2954678777 126
84 iso_pu_bacteria 2954682443 2954685376 126
85 iso_pu_bacteria 2954691527 2954694994 126
86 iso_pu_bacteria 2954701450 2954710168 126
87 iso_pu_bacteria 2954711539 2954714487 126
88 iso_pu_bacteria 2954721474 2954724433 126
89 iso_pu_bacteria 2954731030 2954737385 126
90 iso_pu_bacteria 2954740390 2954743355 126
91 iso_pu_bacteria 2954749733 2954756238 126
92 iso_pu_bacteria 2954759201 2954762312 126
93 iso_pu_bacteria 2966598605 2966601006 126
94 iso_pu_bacteria 3006393351 3006397090 126
95 iso_pu_bacteria 3006425503 3006430039 126
96 iso_pu_bacteria 3006486233 3006489033 126
97 iso_pu_bacteria 3006493962 3006498094 126
98 iso_pu_bacteria 8008558824 8008562613 126
99 iso_pu_bacteria 8025530807 8025537062 126
100 iso_pu_bacteria 8033684223 8033686867 126
101 iso_pu_bacteria 8048406513 8048406624 126
102 iso_pu_bacteria 8056667051 8056671489 126
103 iso_pu_bacteria 8056829672 8056831990 126
104 3300005337 Ga0070682_100046806 Ga0070682_1000468063 127
105 3300005338 Ga0068868_100005573 Ga0068868_1000055736 127
106 3300005341 Ga0070691_10076958 Ga0070691_100769582 127
107 3300005366 Ga0070659_101902934 Ga0070659_1019029341 127
108 3300005434 Ga0070709_10892199 Ga0070709_108921991 127
109 3300005435 Ga0070714_100461616 Ga0070714_1004616162 127
110 3300005436 Ga0070713_101037832 Ga0070713_1010378322 127
111 3300005439 Ga0070711_100036179 Ga0070711_1000361793 127
112 3300005440 Ga0070705_100474532 Ga0070705_1004745322 127
113 3300005445 Ga0070708_100469459 Ga0070708_1004694592 127
114 3300005458 Ga0070681_10091417 Ga0070681_100914173 127
115 3300005468 Ga0070707_100062789 Ga0070707_1000627893 127
116 3300005544 Ga0070686_100555896 Ga0070686_1005558961 127
117 3300005548 Ga0070665_100167946 Ga0070665_1001679463 127
118 3300005549 Ga0070704_100171955 Ga0070704_1001719551 127
119 3300005563 Ga0068855_100213914 Ga0068855_1002139143 127
120 3300005577 Ga0068857_100522691 Ga0068857_1005226912 127
121 3300005614 Ga0068856_100057484 Ga0068856_1000574843 127
122 3300005614 Ga0068856_100126077 Ga0068856_1001260773 127
123 3300005618 Ga0068864_100058542 Ga0068864_1000585423 127
124 3300005841 Ga0068863_101470662 Ga0068863_1014706621 127
125 3300005842 Ga0068858_100142698 Ga0068858_1001426982 127
126 3300005843 Ga0068860_100156734 Ga0068860_1001567341 127
127 3300006173 Ga0070716_100073556 Ga0070716_1000735561 127
128 3300006175 Ga0070712_100758843 Ga0070712_1007588432 127
129 3300006175 Ga0070712_100821183 Ga0070712_1008211832 127
130 3300006175 Ga0070712_100825366 Ga0070712_1008253662 127
131 3300006852 Ga0075433_10675322 Ga0075433_106753221 127
132 3300007076 Ga0075435_100070671 Ga0075435_1000706713 127
133 3300009098 Ga0105245_10098489 Ga0105245_100984892 127
134 3300009174 Ga0105241_10615957 Ga0105241_106159571 127
135 3300009177 Ga0105248_10365069 Ga0105248_103650692 127
136 3300009545 Ga0105237_10191741 Ga0105237_101917413 127
137 3300009551 Ga0105238_10118711 Ga0105238_101187111 127
138 3300010375 Ga0105239_10082718 Ga0105239_100827182 127
139 3300013104 Ga0157370_10144068 Ga0157370_101440681 127
140 3300013105 Ga0157369_10592981 Ga0157369_105929811 127
141 3300013296 Ga0157374_10070724 Ga0157374_100707242 127
142 3300013297 Ga0157378_10717988 Ga0157378_107179882 127
143 3300013306 Ga0163162_10031791 Ga0163162_100317913 127
144 3300013308 Ga0157375_10176735 Ga0157375_101767352 127
145 3300014325 Ga0163163_10006307 Ga0163163_100063076 127
146 3300014968 Ga0157379_10028186 Ga0157379_100281864 127
147 3300014969 Ga0157376_10097190 Ga0157376_100971903 127
148 3300020070 Ga0206356_10995431 Ga0206356_109954311 127
149 3300020081 Ga0206354_10196881 Ga0206354_101968811 127
150 3300025905 Ga0207685_10234473 Ga0207685_102344732 127
151 3300025911 Ga0207654_10578735 Ga0207654_105787352 127
152 3300025912 Ga0207707_11159889 Ga0207707_111598891 127
153 3300025914 Ga0207671_10281426 Ga0207671_102814261 127
154 3300025916 Ga0207663_10637261 Ga0207663_106372612 127
155 3300025916 Ga0207663_11216645 Ga0207663_112166451 127
156 3300025921 Ga0207652_11647249 Ga0207652_116472491 127
157 3300025922 Ga0207646_10580955 Ga0207646_105809551 127
158 3300025924 Ga0207694_10104344 Ga0207694_101043442 127
159 3300025927 Ga0207687_10059664 Ga0207687_100596642 127
160 3300025929 Ga0207664_10608710 Ga0207664_106087101 127
161 3300025939 Ga0207665_10036601 Ga0207665_100366013 127
162 3300025941 Ga0207711_10296652 Ga0207711_102966522 127
163 3300025944 Ga0207661_11886983 Ga0207661_118869831 127
164 3300025949 Ga0207667_10499254 Ga0207667_104992542 127
165 3300026023 Ga0207677_10006535 Ga0207677_100065355 127
166 3300026078 Ga0207702_11461414 Ga0207702_114614141 127
167 3300026078 Ga0207702_12164519 Ga0207702_121645191 127
168 3300026095 Ga0207676_10026782 Ga0207676_100267822 127
169 3300028379 Ga0268266_10439512 Ga0268266_104395122 127
170 3300028381 Ga0268264_10817089 Ga0268264_108170892 127
171 3300031649 Ga0307514_10126484 Ga0307514_101264841 127
172 3300031730 Ga0307516_10516121 Ga0307516_105161212 127
173 3300035086 Ga0373934_0294083 Ga0373934_0294083_102_536 127
174 3300035116 Ga0373945_0098141 Ga0373945_0098141_332_766 127
175 3300035118 Ga0373954_0056855 Ga0373954_0056855_270_704 127
176 3300035119 Ga0373956_0192362 Ga0373956_0192362_443_877 127
177 3300035170 Ga0373943_0164675 Ga0373943_0164675_332_766 127
178 3300035171 Ga0373946_0433400 Ga0373946_0433400_55_489 127
179 3300035691 Ga0373931_0769697 Ga0373931_0769697_166_600 127
180 3300036401 Ga0373937_0039588 Ga0373937_0039588_2819_3253 127
181 3300038443 Ga0395901_0244404 Ga0395901_0244404_515_916 127
182 3300044683 Ga0466965_0361990 Ga0466965_0361990_303_731 127
183 3300044693 Ga0466961_0724040 Ga0466961_0724040_149_574 127
184 3300044694 Ga0466963_0031993 Ga0466963_0031993_2017_2439 127
185 3300044694 Ga0466963_0072827 Ga0466963_0072827_16_438 127
186 3300044694 Ga0466963_0168700 Ga0466963_0168700_954_1376 127
187 3300044694 Ga0466963_0686842 Ga0466963_0686842_199_621 127
188 3300044706 Ga0466964_0102966 Ga0466964_0102966_133_555 127
189 3300044719 Ga0466971_0038665 Ga0466971_0038665_1487_1909 127
190 3300044719 Ga0466971_0647823 Ga0466971_0647823_73_495 127
191 3300044842 Ga0466957_0221160 Ga0466957_0221160_179_601 127
192 3300044901 Ga0466960_0507779 Ga0466960_0507779_76_468 127
193 3300045049 Ga0466959_0922397 Ga0466959_0922397_59_481 127
194 3300045836 Ga0466958_0132417 Ga0466958_0132417_92_514 127
195 3300045976 Ga0466967_0108297 Ga0466967_0108297_44_466 127
196 3300045976 Ga0466967_0143729 Ga0466967_0143729_1751_2158 127
197 3300045976 Ga0466967_0174885 Ga0466967_0174885_1193_1633 127
198 3300045976 Ga0466967_0307766 Ga0466967_0307766_358_780 127
199 3300045976 Ga0466967_0440992 Ga0466967_0440992_492_914 127
200 3300045976 Ga0466967_0524071 Ga0466967_0524071_705_1139 127
201 3300045976 Ga0466967_2195384 Ga0466967_2195384_15_437 127
202 3300046454 Ga0495592_0047991 Ga0495592_0047991_1056_1490 127
203 3300046455 Ga0495603_0274076 Ga0495603_0274076_349_783 127
204 3300046459 Ga0495629_0089361 Ga0495629_0089361_1573_2007 127
205 3300046462 Ga0495651_0079211 Ga0495651_0079211_1738_2172 127
206 3300046463 Ga0495653_0090901 Ga0495653_0090901_1548_1982 127
207 3300046463 Ga0495653_0641302 Ga0495653_0641302_48_482 127
208 3300046475 Ga0495639_0075647 Ga0495639_0075647_1028_1462 127
209 3300046476 Ga0495662_0181113 Ga0495662_0181113_208_642 127
210 3300046477 Ga0495664_0007790 Ga0495664_0007790_136_570 127
211 3300046477 Ga0495664_0085909 Ga0495664_0085909_22_408 127
212 3300046511 Ga0495608_0344690 Ga0495608_0344690_171_605 127
213 3300046514 Ga0495618_0062044 Ga0495618_0062044_1860_2294 127
214 3300046516 Ga0495628_0443471 Ga0495628_0443471_198_632 127
215 3300046517 Ga0495630_0162453 Ga0495630_0162453_290_724 127
216 3300046529 Ga0495652_0182024 Ga0495652_0182024_218_652 127
217 3300046533 Ga0495640_0010846 Ga0495640_0010846_1241_1675 127
218 3300046535 Ga0495586_0289667 Ga0495586_0289667_344_778 127
219 3300046536 Ga0495587_0001011 Ga0495587_0001011_2789_3223 127
220 3300046543 Ga0495645_0049580 Ga0495645_0049580_2172_2606 127
221 3300046559 Ga0495667_0296114 Ga0495667_0296114_27_413 127
222 3300046559 Ga0495667_0988724 Ga0495667_0988724_27_413 127
223 3300046642 Ga0495634_0017386 Ga0495634_0017386_3933_4367 127
224 3300046663 Ga0495635_0098181 Ga0495635_0098181_1357_1791 127
225 3300046675 Ga0495657_0030679 Ga0495657_0030679_3053_3487 127
226 3300046678 Ga0495599_0005311 Ga0495599_0005311_83_517 127
227 3300046809 Ga0495600_0051201 Ga0495600_0051201_2150_2584 127
228 3300047317 Ga0495604_0603621 Ga0495604_0603621_22_456 127
229 3300047319 Ga0495674_0194508 Ga0495674_0194508_27_413 127
230 3300047319 Ga0495674_1043863 Ga0495674_1043863_212_598 127
231 3300047321 Ga0495676_0201737 Ga0495676_0201737_467_901 127
232 3300047322 Ga0495680_0010669 Ga0495680_0010669_3791_4225 127
233 3300047322 Ga0495680_0417508 Ga0495680_0417508_177_611 127
234 3300047444 Ga0495675_0228593 Ga0495675_0228593_18_452 127
235 3300047471 Ga0495684_0000710 Ga0495684_0000710_26012_26446 127
236 3300047673 Ga0495593_0651560 Ga0495593_0651560_21_455 127
237 3300048088 Ga0495602_0018574 Ga0495602_0018574_672_1106 127
238 3300048908 Ga0496105_0038560 Ga0496105_0038560_497_883 127
239 3300048909 Ga0496106_0214524 Ga0496106_0214524_144_578 127
240 3300048910 Ga0496107_0883835 Ga0496107_0883835_68_502 127
241 3300048911 Ga0496108_0009740 Ga0496108_0009740_5370_5804 127
242 3300048913 Ga0496110_0010424 Ga0496110_0010424_3426_3860 127
243 3300048915 Ga0496112_0043029 Ga0496112_0043029_3269_3691 127
244 3300048915 Ga0496112_0208625 Ga0496112_0208625_186_620 127
245 3300048916 Ga0496113_0010985 Ga0496113_0010985_2559_2993 127
246 3300048917 Ga0496114_0430438 Ga0496114_0430438_568_1002 127
247 3300050514 nmdc:mga08x19_353497_c1 nmdc:mga08x19_353497_c1_399_833 127
248 3300050515 nmdc:mga0a205_542486_c1 nmdc:mga0a205_542486_c1_573_1007 127
249 3300053084 Ga0495595_0085330 Ga0495595_0085330_194_628 127
250 3300053085 Ga0495619_0015501 Ga0495619_0015501_1138_1572 127
251 3300061719 Ga0466962_0082227 Ga0466962_0082227_1014_1436 127
252 iso_pu_bacteria 2935390628 2935394519 127
253 iso_pu_bacteria 2990088156 2990092149 127
254 iso_pu_bacteria 8047893842 8047896303 127
255 iso_pu_bacteria 8048127548 8048128083 127
256 iso_pu_bacteria 8048356638 8048362633 127
257 iso_pu_bacteria 8048369669 8048373312 127
258 iso_pu_bacteria 8048379754 8048384930 127
259 3300004799 Ga0058863_11226352 Ga0058863_112263521 128
260 3300005466 Ga0070685_10052437 Ga0070685_100524372 128
261 3300005539 Ga0068853_100093609 Ga0068853_1000936094 128
262 3300005578 Ga0068854_102144232 Ga0068854_1021442321 128
263 3300009551 Ga0105238_10522624 Ga0105238_105226241 128
264 3300046455 Ga0495603_0442957 Ga0495603_0442957_327_719 128
265 3300046459 Ga0495629_0110270 Ga0495629_0110270_217_609 128
266 3300046462 Ga0495651_0177354 Ga0495651_0177354_64_456 128
267 3300046476 Ga0495662_0559855 Ga0495662_0559855_131_523 128
268 3300046477 Ga0495664_0037883 Ga0495664_0037883_1881_2273 128
269 3300046492 Ga0495585_0007795 Ga0495585_0007795_945_1337 128
270 3300046516 Ga0495628_0080884 Ga0495628_0080884_913_1305 128
271 3300046529 Ga0495652_0139100 Ga0495652_0139100_1396_1788 128
272 3300046533 Ga0495640_0035770 Ga0495640_0035770_500_892 128
273 3300046557 Ga0495622_0101327 Ga0495622_0101327_408_800 128
274 3300046557 Ga0495622_0192528 Ga0495622_0192528_491_886 128
275 3300046559 Ga0495667_0195928 Ga0495667_0195928_641_1033 128
276 3300046642 Ga0495634_0586886 Ga0495634_0586886_183_575 128
277 3300046663 Ga0495635_0921331 Ga0495635_0921331_68_475 128
278 3300046675 Ga0495657_0020442 Ga0495657_0020442_667_1059 128
279 3300046683 Ga0495658_0116688 Ga0495658_0116688_459_854 128
280 3300046689 Ga0495613_0010395 Ga0495613_0010395_1473_1865 128
281 3300046689 Ga0495613_0179258 Ga0495613_0179258_1034_1429 128
282 3300046689 Ga0495613_0530936 Ga0495613_0530936_42_449 128
283 3300046690 Ga0495624_0014389 Ga0495624_0014389_458_850 128
284 3300046690 Ga0495624_0110705 Ga0495624_0110705_42_434 128
285 3300046694 Ga0495649_0080389 Ga0495649_0080389_323_715 128
286 3300047315 Ga0495581_0065540 Ga0495581_0065540_1120_1512 128
287 3300047315 Ga0495581_0503292 Ga0495581_0503292_214_606 128
288 3300047317 Ga0495604_0022719 Ga0495604_0022719_63_455 128
289 3300047317 Ga0495604_0056268 Ga0495604_0056268_1851_2243 128
290 3300047321 Ga0495676_0012902 Ga0495676_0012902_177_569 128
291 3300047443 Ga0495687_171719 Ga0495687_171719_156_548 128
292 3300047444 Ga0495675_0160163 Ga0495675_0160163_128_520 128
293 3300049568 Ga0501031_0174821 Ga0501031_0174821_211_603 128
294 3300049569 Ga0501032_0041778 Ga0501032_0041778_769_1158 128
295 3300049569 Ga0501032_0161676 Ga0501032_0161676_248_640 128
296 3300049570 Ga0501033_0053149 Ga0501033_0053149_1079_1468 128
297 3300049570 Ga0501033_0165927 Ga0501033_0165927_512_904 128
298 3300049571 Ga0501034_0746442 Ga0501034_0746442_215_604 128
299 3300049571 Ga0501034_0785875 Ga0501034_0785875_369_761 128
300 3300049572 Ga0501036_0302546 Ga0501036_0302546_352_741 128
301 3300049573 Ga0501037_0194265 Ga0501037_0194265_230_619 128
302 3300049573 Ga0501037_0240410 Ga0501037_0240410_163_555 128
303 3300049573 Ga0501037_0268436 Ga0501037_0268436_304_696 128
304 3300049575 Ga0501039_0055212 Ga0501039_0055212_1928_2317 128
305 3300049579 Ga0501043_0031845 Ga0501043_0031845_1132_1524 128
306 3300049579 Ga0501043_0058599 Ga0501043_0058599_2396_2788 128
307 3300049581 Ga0501047_0009843 Ga0501047_0009843_3000_3392 128
308 3300049581 Ga0501047_0215681 Ga0501047_0215681_1261_1653 128
309 3300049581 Ga0501047_0297330 Ga0501047_0297330_1030_1422 128
310 3300049586 Ga0501070_0335980 Ga0501070_0335980_224_613 128
311 3300049822 Ga0501035_0026105 Ga0501035_0026105_3899_4291 128
312 3300049822 Ga0501035_0101021 Ga0501035_0101021_1009_1398 128
313 3300049822 Ga0501035_0129751 Ga0501035_0129751_1030_1422 128
314 3300049822 Ga0501035_0150580 Ga0501035_0150580_1568_1960 128
315 3300049823 Ga0501044_0166315 Ga0501044_0166315_1030_1422 128
316 3300049823 Ga0501044_0172461 Ga0501044_0172461_597_989 128
317 3300049823 Ga0501044_0237938 Ga0501044_0237938_1009_1398 128
318 3300049823 Ga0501044_1286194 Ga0501044_1286194_54_440 128
319 3300053100 Ga0500660_155744 Ga0500660_155744_253_648 128
320 3300053101 Ga0500553_180986 Ga0500553_180986_299_694 128
321 3300053107 Ga0500560_001736 Ga0500560_001736_3409_3801 128
322 3300053140 Ga0500573_0352528 Ga0500573_0352528_226_618 128
323 3300059640 Ga0587067_175027 Ga0587067_175027_100_492 128
324 iso_pu_bacteria 2867369537 2867373705 128
325 iso_pu_bacteria 2867475112 2867477657 128
326 3300025302 Ga0207426_1100418 Ga0207426_11004182 129
327 3300031616 Ga0307508_10006837 Ga0307508_100068378 129
328 3300031730 Ga0307516_10417422 Ga0307516_104174222 129
329 3300032002 Ga0307416_103424366 Ga0307416_1034243661 129
330 3300001990 JGI24737J22298_10021826 JGI24737J22298_100218261 130
331 3300003316 rootH1_10019195 rootH1_100191955 130
332 3300003320 rootH2_10217107 rootH2_102171071 130
333 3300003323 rootH1_10091162 rootH1_100911622 130
334 3300003323 rootH1_10178559 rootH1_101785593 130
335 3300003354 JGI25160J50197_1033513 JGI25160J50197_10335132 130
336 3300003354 JGI25160J50197_1035808 JGI25160J50197_10358081 130
337 3300003354 JGI25160J50197_1036056 JGI25160J50197_10360561 130
338 3300003578 Ga0006562J51391_1044019 Ga0006562J51391_10440191 130
339 3300003578 Ga0006562J51391_1130510 Ga0006562J51391_11305103 130
340 3300003578 Ga0006562J51391_1130511 Ga0006562J51391_11305111 130
341 3300004803 Ga0058862_12670130 Ga0058862_126701301 130
342 3300005563 Ga0068855_100132732 Ga0068855_1001327324 130
343 3300005564 Ga0070664_100377792 Ga0070664_1003777922 130
344 3300005578 Ga0068854_100412849 Ga0068854_1004128491 130
345 3300005614 Ga0068856_100484683 Ga0068856_1004846833 130
346 3300005937 Ga0081455_10195754 Ga0081455_101957542 130
347 3300006048 Ga0075363_100560356 Ga0075363_1005603561 130
348 3300006178 Ga0075367_10003746 Ga0075367_100037466 130
349 3300006353 Ga0075370_10076640 Ga0075370_100766402 130
350 3300006358 Ga0068871_102039528 Ga0068871_1020395281 130
351 3300006948 Ga0099826_10067827 Ga0099826_100678273 130
352 3300009011 Ga0105251_10060354 Ga0105251_100603541 130
353 3300009036 Ga0105244_10122288 Ga0105244_101222882 130
354 3300009092 Ga0105250_10059204 Ga0105250_100592041 130
355 3300009098 Ga0105245_10142376 Ga0105245_101423762 130
356 3300009148 Ga0105243_10646484 Ga0105243_106464841 130
357 3300011119 Ga0105246_10249858 Ga0105246_102498583 130
358 3300011119 Ga0105246_11748045 Ga0105246_117480451 130
359 3300013105 Ga0157369_10087579 Ga0157369_100875794 130
360 3300013307 Ga0157372_10137947 Ga0157372_101379474 130
361 3300014497 Ga0182008_10001423 Ga0182008_1000142316 130
362 3300015262 Ga0182007_10002422 Ga0182007_100024228 130
363 3300020069 Ga0197907_10381786 Ga0197907_103817861 130
364 3300020070 Ga0206356_11206245 Ga0206356_112062452 130
365 3300020070 Ga0206356_11219520 Ga0206356_112195202 130
366 3300020076 Ga0206355_1208892 Ga0206355_12088922 130
367 3300020078 Ga0206352_10401905 Ga0206352_104019052 130
368 3300020078 Ga0206352_11348545 Ga0206352_113485451 130
369 3300020081 Ga0206354_10216677 Ga0206354_102166771 130
370 3300022467 Ga0224712_10531268 Ga0224712_105312681 130
371 3300025297 Ga0209758_1013617 Ga0209758_10136173 130
372 3300025302 Ga0207426_1001513 Ga0207426_100151310 130
373 3300025302 Ga0207426_1003399 Ga0207426_10033992 130
374 3300025302 Ga0207426_1006696 Ga0207426_10066966 130
375 3300025302 Ga0207426_1025201 Ga0207426_10252012 130
376 3300025904 Ga0207647_10005240 Ga0207647_100052407 130
377 3300025927 Ga0207687_10060309 Ga0207687_100603094 130
378 3300025935 Ga0207709_10168473 Ga0207709_101684732 130
379 3300025949 Ga0207667_10408358 Ga0207667_104083582 130
380 3300025981 Ga0207640_10069392 Ga0207640_100693924 130
381 3300026078 Ga0207702_10116605 Ga0207702_101166053 130
382 3300027312 Ga0209371_1021986 Ga0209371_10219862 130
383 3300027666 Ga0209282_1100910 Ga0209282_11009102 130
384 3300028786 Ga0307517_10004597 Ga0307517_1000459721 130
385 3300028794 Ga0307515_10000699 Ga0307515_100006998 130
386 3300028794 Ga0307515_10088843 Ga0307515_100888432 130
387 3300028794 Ga0307515_10672081 Ga0307515_106720811 130
388 3300030500 Ga0268256_1018141 Ga0268256_10181412 130
389 3300030521 Ga0307511_10000438 Ga0307511_1000043840 130
390 3300030521 Ga0307511_10064014 Ga0307511_100640142 130
391 3300030522 Ga0307512_10004518 Ga0307512_100045187 130
392 3300030522 Ga0307512_10099826 Ga0307512_100998262 130
393 3300031456 Ga0307513_10009135 Ga0307513_100091353 130
394 3300031456 Ga0307513_10174813 Ga0307513_101748132 130
395 3300031456 Ga0307513_10974988 Ga0307513_109749881 130
396 3300031507 Ga0307509_10039154 Ga0307509_100391545 130
397 3300031616 Ga0307508_10006908 Ga0307508_1000690813 130
398 3300031616 Ga0307508_10007827 Ga0307508_100078277 130
399 3300031616 Ga0307508_10050424 Ga0307508_100504242 130
400 3300031616 Ga0307508_10190740 Ga0307508_101907402 130
401 3300031649 Ga0307514_10049324 Ga0307514_100493245 130
402 3300031649 Ga0307514_10050574 Ga0307514_100505745 130
403 3300031649 Ga0307514_10059521 Ga0307514_100595212 130
404 3300031730 Ga0307516_10002231 Ga0307516_100022319 130
405 3300031730 Ga0307516_10588871 Ga0307516_105888711 130
406 3300031838 Ga0307518_10063769 Ga0307518_100637693 130
407 3300031838 Ga0307518_10336111 Ga0307518_103361111 130
408 3300031838 Ga0307518_10621871 Ga0307518_106218711 130
409 3300032002 Ga0307416_100849287 Ga0307416_1008492872 130
410 3300032002 Ga0307416_101486896 Ga0307416_1014868961 130
411 3300033179 Ga0307507_10045296 Ga0307507_100452963 130
412 3300033179 Ga0307507_10079103 Ga0307507_100791032 130
413 3300033179 Ga0307507_10115847 Ga0307507_101158473 130
414 3300033179 Ga0307507_10539758 Ga0307507_105397582 130
415 3300033180 Ga0307510_10011458 Ga0307510_100114585 130
416 3300033180 Ga0307510_10023835 Ga0307510_100238357 130
417 3300033180 Ga0307510_10240025 Ga0307510_102400252 130
418 3300037418 Ga0395900_0193003 Ga0395900_0193003_799_1194 130
419 3300037466 Ga0395898_0003092 Ga0395898_0003092_15786_16181 130
420 3300037466 Ga0395898_0030289 Ga0395898_0030289_1257_1649 130
421 3300038443 Ga0395901_0074271 Ga0395901_0074271_2354_2749 130
422 3300041404 Ga0439436_0002729 Ga0439436_0002729_2990_3382 130
423 3300041404 Ga0439436_0003166 Ga0439436_0003166_665_1057 130
424 3300041406 Ga0439439_0007385 Ga0439439_0007385_1865_2257 130
425 3300041443 Ga0451789_0944422 Ga0451789_0944422_228_620 130
426 3300041459 Ga0451800_1114010 Ga0451800_1114010_461_853 130
427 3300041486 Ga0451807_1614476 Ga0451807_1614476_153_551 130
428 3300041486 Ga0451807_1804336 Ga0451807_1804336_83_475 130
429 3300041494 Ga0451837_0010181 Ga0451837_0010181_318_710 130
430 3300041498 Ga0451841_1407059 Ga0451841_1407059_94_486 130
431 3300041501 Ga0451845_0506071 Ga0451845_0506071_67_459 130
432 3300041503 Ga0451847_0278125 Ga0451847_0278125_94_486 130
433 3300041509 Ga0451843_1617188 Ga0451843_1617188_255_647 130
434 3300041512 Ga0451853_0301595 Ga0451853_0301595_1135_1527 130
435 3300041512 Ga0451853_0393940 Ga0451853_0393940_729_1121 130
436 3300041512 Ga0451853_1059851 Ga0451853_1059851_609_1001 130
437 3300041512 Ga0451853_2009427 Ga0451853_2009427_896_1294 130
438 3300041997 Ga0439431_0066081 Ga0439431_0066081_70_465 130
439 3300041999 Ga0439433_0012142 Ga0439433_0012142_1183_1575 130
440 3300042002 Ga0439442_001532 Ga0439442_001532_3210_3611 130
441 3300042002 Ga0439442_003644 Ga0439442_003644_636_1028 130
442 3300042005 Ga0439448_0004898 Ga0439448_0004898_1679_2077 130
443 3300042007 Ga0439449_0000358 Ga0439449_0000358_2831_3262 130
444 3300042007 Ga0439449_0041114 Ga0439449_0041114_915_1307 130
445 3300042007 Ga0439449_0089795 Ga0439449_0089795_196_597 130
446 3300042007 Ga0439449_0122340 Ga0439449_0122340_107_499 130
447 3300042008 Ga0439450_155205 Ga0439450_155205_75_473 130
448 3300042011 Ga0439454_016112 Ga0439454_016112_53_451 130
449 3300042014 Ga0439457_002398 Ga0439457_002398_3386_3778 130
450 3300042014 Ga0439457_004233 Ga0439457_004233_722_1114 130
451 3300042014 Ga0439457_061953 Ga0439457_061953_245_679 130
452 3300042015 Ga0439462_0010822 Ga0439462_0010822_1368_1760 130
453 3300042016 Ga0439463_142957 Ga0439463_142957_52_450 130
454 3300042131 Ga0450894_000136 Ga0450894_000136_5656_6090 130
455 3300042134 Ga0450898_000424 Ga0450898_000424_917_1351 130
456 3300042135 Ga0450899_018844 Ga0450899_018844_197_631 130
457 3300042137 Ga0450902_008532 Ga0450902_008532_664_1062 130
458 3300042138 Ga0450903_000233 Ga0450903_000233_10542_10940 130
459 3300042145 Ga0450906_018467 Ga0450906_018467_638_1072 130
460 3300042157 Ga0439458_0018008 Ga0439458_0018008_579_977 130
461 3300042157 Ga0439458_0020162 Ga0439458_0020162_671_1069 130
462 3300042184 Ga0450908_010768 Ga0450908_010768_99_533 130
463 3300044656 Ga0466969_0083017 Ga0466969_0083017_18_419 130
464 3300044656 Ga0466969_0135318 Ga0466969_0135318_254_655 130
465 3300044658 Ga0466972_0004540 Ga0466972_0004540_5388_5780 130
466 3300044658 Ga0466972_0056941 Ga0466972_0056941_65_466 130
467 3300044658 Ga0466972_0067178 Ga0466972_0067178_716_1111 130
468 3300044658 Ga0466972_0172952 Ga0466972_0172952_506_907 130
469 3300044683 Ga0466965_0031059 Ga0466965_0031059_1324_1725 130
470 3300044683 Ga0466965_0297837 Ga0466965_0297837_424_816 130
471 3300044683 Ga0466965_0912746 Ga0466965_0912746_65_457 130
472 3300044684 Ga0466966_0191081 Ga0466966_0191081_35_436 130
473 3300044693 Ga0466961_0017066 Ga0466961_0017066_3100_3501 130
474 3300044693 Ga0466961_0080676 Ga0466961_0080676_1599_2000 130
475 3300044693 Ga0466961_0190965 Ga0466961_0190965_804_1196 130
476 3300044694 Ga0466963_0000213 Ga0466963_0000213_1180_1581 130
477 3300044706 Ga0466964_0518622 Ga0466964_0518622_178_579 130
478 3300044719 Ga0466971_0000575 Ga0466971_0000575_3099_3500 130
479 3300044735 Ga0466968_0169956 Ga0466968_0169956_130_546 130
480 3300044765 Ga0466970_0001274 Ga0466970_0001274_1317_1718 130
481 3300044765 Ga0466970_0006583 Ga0466970_0006583_2446_2838 130
482 3300044765 Ga0466970_0680531 Ga0466970_0680531_126_527 130
483 3300044842 Ga0466957_0023199 Ga0466957_0023199_3230_3631 130
484 3300044842 Ga0466957_0205515 Ga0466957_0205515_334_735 130
485 3300044842 Ga0466957_1003719 Ga0466957_1003719_163_564 130
486 3300044901 Ga0466960_0121087 Ga0466960_0121087_48_440 130
487 3300044901 Ga0466960_0151254 Ga0466960_0151254_176_577 130
488 3300045049 Ga0466959_0003363 Ga0466959_0003363_9068_9469 130
489 3300045836 Ga0466958_0095111 Ga0466958_0095111_177_578 130
490 3300045976 Ga0466967_0052759 Ga0466967_0052759_2631_3026 130
491 3300045976 Ga0466967_0192631 Ga0466967_0192631_765_1166 130
492 3300045976 Ga0466967_0212446 Ga0466967_0212446_1417_1815 130
493 3300046454 Ga0495592_0000574 Ga0495592_0000574_6461_6853 130
494 3300046455 Ga0495603_0004257 Ga0495603_0004257_790_1182 130
495 3300046455 Ga0495603_0757155 Ga0495603_0757155_21_413 130
496 3300046457 Ga0495590_0038675 Ga0495590_0038675_520_912 130
497 3300046459 Ga0495629_0002819 Ga0495629_0002819_8066_8467 130
498 3300046459 Ga0495629_0013612 Ga0495629_0013612_3826_4218 130
499 3300046459 Ga0495629_0023271 Ga0495629_0023271_2247_2648 130
500 3300046459 Ga0495629_0107957 Ga0495629_0107957_535_927 130
501 3300046459 Ga0495629_0146572 Ga0495629_0146572_901_1293 130
502 3300046459 Ga0495629_0444279 Ga0495629_0444279_414_806 130
503 3300046460 Ga0495638_0112665 Ga0495638_0112665_154_546 130
504 3300046460 Ga0495638_0269807 Ga0495638_0269807_321_722 130
505 3300046461 Ga0495641_0173672 Ga0495641_0173672_227_619 130
506 3300046462 Ga0495651_0017031 Ga0495651_0017031_2084_2476 130
507 3300046462 Ga0495651_0102999 Ga0495651_0102999_354_746 130
508 3300046463 Ga0495653_0377002 Ga0495653_0377002_43_435 130
509 3300046472 Ga0495580_0253921 Ga0495580_0253921_229_621 130
510 3300046473 Ga0495582_0100885 Ga0495582_0100885_989_1381 130
511 3300046474 Ga0495605_0005349 Ga0495605_0005349_2489_2881 130
512 3300046476 Ga0495662_0013250 Ga0495662_0013250_2941_3333 130
513 3300046476 Ga0495662_0018848 Ga0495662_0018848_127_519 130
514 3300046476 Ga0495662_0039237 Ga0495662_0039237_1017_1409 130
515 3300046476 Ga0495662_0101601 Ga0495662_0101601_963_1355 130
516 3300046477 Ga0495664_0031093 Ga0495664_0031093_1272_1664 130
517 3300046477 Ga0495664_0063719 Ga0495664_0063719_228_620 130
518 3300046477 Ga0495664_0713314 Ga0495664_0713314_50_442 130
519 3300046491 Ga0495584_0282451 Ga0495584_0282451_258_650 130
520 3300046491 Ga0495584_0567137 Ga0495584_0567137_104_505 130
521 3300046492 Ga0495585_0058979 Ga0495585_0058979_1351_1752 130
522 3300046499 Ga0495594_0001816 Ga0495594_0001816_4290_4691 130
523 3300046499 Ga0495594_0081634 Ga0495594_0081634_180_572 130
524 3300046499 Ga0495594_0116525 Ga0495594_0116525_477_869 130
525 3300046499 Ga0495594_0157211 Ga0495594_0157211_642_1034 130
526 3300046499 Ga0495594_0486532 Ga0495594_0486532_165_566 130
527 3300046500 Ga0495596_0125752 Ga0495596_0125752_260_652 130
528 3300046500 Ga0495596_0234521 Ga0495596_0234521_246_638 130
529 3300046501 Ga0495607_0081677 Ga0495607_0081677_77_478 130
530 3300046501 Ga0495607_0096676 Ga0495607_0096676_449_841 130
531 3300046506 Ga0495583_0042610 Ga0495583_0042610_435_827 130
532 3300046507 Ga0495606_0013622 Ga0495606_0013622_3271_3663 130
533 3300046512 Ga0495610_0121162 Ga0495610_0121162_241_633 130
534 3300046512 Ga0495610_0146435 Ga0495610_0146435_546_944 130
535 3300046512 Ga0495610_0215045 Ga0495610_0215045_251_643 130
536 3300046513 Ga0495616_0037258 Ga0495616_0037258_1724_2116 130
537 3300046514 Ga0495618_0319690 Ga0495618_0319690_281_673 130
538 3300046515 Ga0495620_0034741 Ga0495620_0034741_1254_1646 130
539 3300046515 Ga0495620_0088812 Ga0495620_0088812_590_982 130
540 3300046515 Ga0495620_0277766 Ga0495620_0277766_49_450 130
541 3300046516 Ga0495628_0149536 Ga0495628_0149536_44_436 130
542 3300046516 Ga0495628_0178311 Ga0495628_0178311_415_807 130
543 3300046517 Ga0495630_0033011 Ga0495630_0033011_2558_2950 130
544 3300046517 Ga0495630_0473812 Ga0495630_0473812_158_550 130
545 3300046518 Ga0495631_0028031 Ga0495631_0028031_467_859 130
546 3300046518 Ga0495631_0069413 Ga0495631_0069413_638_1039 130
547 3300046520 Ga0495637_0064870 Ga0495637_0064870_1076_1468 130
548 3300046522 Ga0495643_0005567 Ga0495643_0005567_3782_4174 130
549 3300046523 Ga0495644_0297976 Ga0495644_0297976_50_451 130
550 3300046524 Ga0495648_0050550 Ga0495648_0050550_1388_1780 130
551 3300046524 Ga0495648_0193895 Ga0495648_0193895_128_544 130
552 3300046524 Ga0495648_0389007 Ga0495648_0389007_55_447 130
553 3300046526 Ga0495666_0014863 Ga0495666_0014863_375_767 130
554 3300046526 Ga0495666_0123221 Ga0495666_0123221_492_884 130
555 3300046528 Ga0495642_0015555 Ga0495642_0015555_678_1070 130
556 3300046529 Ga0495652_0028911 Ga0495652_0028911_2158_2550 130
557 3300046529 Ga0495652_0030071 Ga0495652_0030071_3308_3700 130
558 3300046530 Ga0495654_0026495 Ga0495654_0026495_1880_2272 130
559 3300046531 Ga0495665_0137705 Ga0495665_0137705_558_950 130
560 3300046533 Ga0495640_0021884 Ga0495640_0021884_3689_4081 130
561 3300046533 Ga0495640_0144317 Ga0495640_0144317_766_1158 130
562 3300046535 Ga0495586_0092894 Ga0495586_0092894_847_1239 130
563 3300046536 Ga0495587_0003221 Ga0495587_0003221_2025_2417 130
564 3300046536 Ga0495587_0278099 Ga0495587_0278099_151_543 130
565 3300046538 Ga0495609_0073982 Ga0495609_0073982_922_1314 130
566 3300046542 Ga0495597_0023855 Ga0495597_0023855_590_982 130
567 3300046543 Ga0495645_0032240 Ga0495645_0032240_698_1090 130
568 3300046557 Ga0495622_0019957 Ga0495622_0019957_2098_2490 130
569 3300046557 Ga0495622_0027908 Ga0495622_0027908_974_1375 130
570 3300046558 Ga0495633_0037682 Ga0495633_0037682_1658_2050 130
571 3300046558 Ga0495633_0200017 Ga0495633_0200017_100_492 130
572 3300046559 Ga0495667_0030504 Ga0495667_0030504_1394_1786 130
573 3300046559 Ga0495667_0320136 Ga0495667_0320136_55_447 130
574 3300046616 Ga0495668_0017827 Ga0495668_0017827_2570_2962 130
575 3300046616 Ga0495668_0076764 Ga0495668_0076764_548_949 130
576 3300046616 Ga0495668_0099213 Ga0495668_0099213_612_1004 130
577 3300046642 Ga0495634_0005531 Ga0495634_0005531_878_1270 130
578 3300046642 Ga0495634_0274406 Ga0495634_0274406_273_665 130
579 3300046648 Ga0495611_0145263 Ga0495611_0145263_576_968 130
580 3300046648 Ga0495611_0145976 Ga0495611_0145976_623_1024 130
581 3300046648 Ga0495611_0207546 Ga0495611_0207546_373_774 130
582 3300046660 Ga0495625_0164477 Ga0495625_0164477_731_1123 130
583 3300046660 Ga0495625_0295332 Ga0495625_0295332_401_802 130
584 3300046663 Ga0495635_0165153 Ga0495635_0165153_636_1028 130
585 3300046663 Ga0495635_0201024 Ga0495635_0201024_687_1079 130
586 3300046665 Ga0495661_0036094 Ga0495661_0036094_2465_2857 130
587 3300046665 Ga0495661_0262342 Ga0495661_0262342_181_582 130
588 3300046665 Ga0495661_0439445 Ga0495661_0439445_150_542 130
589 3300046674 Ga0495588_0001268 Ga0495588_0001268_2489_2881 130
590 3300046674 Ga0495588_0012467 Ga0495588_0012467_2303_2704 130
591 3300046674 Ga0495588_0263876 Ga0495588_0263876_463_855 130
592 3300046675 Ga0495657_0001214 Ga0495657_0001214_6498_6890 130
593 3300046675 Ga0495657_0033179 Ga0495657_0033179_3112_3504 130
594 3300046678 Ga0495599_0090794 Ga0495599_0090794_23_415 130
595 3300046678 Ga0495599_0194168 Ga0495599_0194168_99_491 130
596 3300046680 Ga0495646_0014451 Ga0495646_0014451_972_1364 130
597 3300046680 Ga0495646_0283485 Ga0495646_0283485_466_858 130
598 3300046683 Ga0495658_0144361 Ga0495658_0144361_697_1089 130
599 3300046689 Ga0495613_0003059 Ga0495613_0003059_1905_2306 130
600 3300046689 Ga0495613_0012117 Ga0495613_0012117_3199_3591 130
601 3300046689 Ga0495613_0109870 Ga0495613_0109870_664_1056 130
602 3300046689 Ga0495613_0135378 Ga0495613_0135378_64_456 130
603 3300046689 Ga0495613_0229586 Ga0495613_0229586_93_485 130
604 3300046689 Ga0495613_0680743 Ga0495613_0680743_221_613 130
605 3300046690 Ga0495624_0271689 Ga0495624_0271689_548_940 130
606 3300046690 Ga0495624_0480763 Ga0495624_0480763_178_570 130
607 3300046690 Ga0495624_0559763 Ga0495624_0559763_66_458 130
608 3300046691 Ga0495670_0379824 Ga0495670_0379824_89_481 130
609 3300046691 Ga0495670_0508837 Ga0495670_0508837_215_607 130
610 3300046692 Ga0495671_0022519 Ga0495671_0022519_962_1354 130
611 3300046692 Ga0495671_0153702 Ga0495671_0153702_55_456 130
612 3300046692 Ga0495671_0173739 Ga0495671_0173739_80_472 130
613 3300046694 Ga0495649_0154922 Ga0495649_0154922_594_995 130
614 3300046694 Ga0495649_0167813 Ga0495649_0167813_168_560 130
615 3300046794 Ga0495589_0014905 Ga0495589_0014905_3256_3648 130
616 3300046794 Ga0495589_0276114 Ga0495589_0276114_21_422 130
617 3300046809 Ga0495600_0007018 Ga0495600_0007018_1248_1640 130
618 3300046809 Ga0495600_0019938 Ga0495600_0019938_2791_3183 130
619 3300046809 Ga0495600_0383097 Ga0495600_0383097_441_833 130
620 3300047315 Ga0495581_0005237 Ga0495581_0005237_5796_6188 130
621 3300047317 Ga0495604_0113627 Ga0495604_0113627_945_1337 130
622 3300047317 Ga0495604_0129049 Ga0495604_0129049_1020_1412 130
623 3300047318 Ga0495636_0027201 Ga0495636_0027201_76_468 130
624 3300047318 Ga0495636_0036339 Ga0495636_0036339_816_1217 130
625 3300047318 Ga0495636_0045783 Ga0495636_0045783_895_1287 130
626 3300047319 Ga0495674_0213282 Ga0495674_0213282_666_1058 130
627 3300047320 Ga0495672_0083211 Ga0495672_0083211_1255_1647 130
628 3300047321 Ga0495676_0002047 Ga0495676_0002047_56_457 130
629 3300047321 Ga0495676_0005451 Ga0495676_0005451_750_1142 130
630 3300047321 Ga0495676_0030974 Ga0495676_0030974_1991_2392 130
631 3300047321 Ga0495676_0073343 Ga0495676_0073343_1968_2369 130
632 3300047321 Ga0495676_0146274 Ga0495676_0146274_72_464 130
633 3300047321 Ga0495676_0151528 Ga0495676_0151528_72_464 130
634 3300047321 Ga0495676_0926524 Ga0495676_0926524_80_472 130
635 3300047321 Ga0495676_1044284 Ga0495676_1044284_53_454 130
636 3300047322 Ga0495680_0093253 Ga0495680_0093253_1228_1620 130
637 3300047323 Ga0495683_0273178 Ga0495683_0273178_208_609 130
638 3300047443 Ga0495687_006392 Ga0495687_006392_3286_3678 130
639 3300047443 Ga0495687_020416 Ga0495687_020416_769_1161 130
640 3300047444 Ga0495675_0014147 Ga0495675_0014147_4392_4784 130
641 3300047444 Ga0495675_0142712 Ga0495675_0142712_644_1036 130
642 3300047445 Ga0495677_0026186 Ga0495677_0026186_1073_1465 130
643 3300047447 Ga0495685_005303 Ga0495685_005303_909_1310 130
644 3300047447 Ga0495685_006989 Ga0495685_006989_3093_3485 130
645 3300047447 Ga0495685_018741 Ga0495685_018741_551_949 130
646 3300047447 Ga0495685_162261 Ga0495685_162261_118_510 130
647 3300047469 Ga0495673_0198446 Ga0495673_0198446_92_484 130
648 3300047470 Ga0495681_0000567 Ga0495681_0000567_11694_12086 130
649 3300047470 Ga0495681_0302764 Ga0495681_0302764_189_581 130
650 3300047471 Ga0495684_0095811 Ga0495684_0095811_899_1291 130
651 3300047472 Ga0495686_0015791 Ga0495686_0015791_962_1354 130
652 3300047472 Ga0495686_0028044 Ga0495686_0028044_459_851 130
653 3300047472 Ga0495686_0084897 Ga0495686_0084897_923_1315 130
654 3300047673 Ga0495593_0000488 Ga0495593_0000488_15248_15640 130
655 3300047673 Ga0495593_0023676 Ga0495593_0023676_596_988 130
656 3300047673 Ga0495593_0027313 Ga0495593_0027313_1961_2353 130
657 3300048088 Ga0495602_0077375 Ga0495602_0077375_938_1330 130
658 3300048089 Ga0495614_0001937 Ga0495614_0001937_48_449 130
659 3300048089 Ga0495614_0006857 Ga0495614_0006857_350_742 130
660 3300048089 Ga0495614_0007664 Ga0495614_0007664_2639_3031 130
661 3300048089 Ga0495614_0041221 Ga0495614_0041221_831_1223 130
662 3300048089 Ga0495614_0119543 Ga0495614_0119543_59_460 130
663 3300048089 Ga0495614_0222866 Ga0495614_0222866_223_615 130
664 3300048091 Ga0495626_0024655 Ga0495626_0024655_2438_2830 130
665 3300048911 Ga0496108_1097077 Ga0496108_1097077_272_664 130
666 3300048913 Ga0496110_1044945 Ga0496110_1044945_40_438 130
667 3300048916 Ga0496113_0635352 Ga0496113_0635352_446_838 130
668 3300048922 Ga0496119_0503949 Ga0496119_0503949_65_457 130
669 3300049127 Ga0501306_041572 Ga0501306_041572_165_560 130
670 3300049127 Ga0501306_069041 Ga0501306_069041_85_477 130
671 3300049128 Ga0501308_032020 Ga0501308_032020_84_476 130
672 3300049128 Ga0501308_060874 Ga0501308_060874_51_446 130
673 3300049130 Ga0501310_034095 Ga0501310_034095_81_473 130
674 3300049459 Ga0495678_019245 Ga0495678_019245_2384_2776 130
675 3300049460 Ga0495682_0231453 Ga0495682_0231453_245_637 130
676 3300049529 Ga0501313_048544 Ga0501313_048544_109_501 130
677 3300049569 Ga0501032_0164657 Ga0501032_0164657_672_1064 130
678 3300049569 Ga0501032_0242617 Ga0501032_0242617_112_513 130
679 3300049570 Ga0501033_0003519 Ga0501033_0003519_6539_6934 130
680 3300049572 Ga0501036_0112831 Ga0501036_0112831_332_724 130
681 3300049573 Ga0501037_0210513 Ga0501037_0210513_168_560 130
682 3300049574 Ga0501038_0311018 Ga0501038_0311018_507_899 130
683 3300049579 Ga0501043_0108548 Ga0501043_0108548_393_785 130
684 3300049579 Ga0501043_0956633 Ga0501043_0956633_44_436 130
685 3300049581 Ga0501047_0081903 Ga0501047_0081903_323_715 130
686 3300049582 Ga0501048_0088148 Ga0501048_0088148_1406_1798 130
687 3300049586 Ga0501070_0169212 Ga0501070_0169212_35_445 130
688 3300049586 Ga0501070_0194908 Ga0501070_0194908_1118_1510 130
689 3300049686 Ga0501257_251696 Ga0501257_251696_95_490 130
690 3300049742 Ga0501080_0025292 Ga0501080_0025292_2119_2511 130
691 3300049822 Ga0501035_1020781 Ga0501035_1020781_121_513 130
692 3300049823 Ga0501044_0004420 Ga0501044_0004420_11053_11445 130
693 3300049823 Ga0501044_0020637 Ga0501044_0020637_6022_6423 130
694 3300049823 Ga0501044_0229901 Ga0501044_0229901_1342_1737 130
695 3300050490 nmdc:mga03n38_218115_c1 nmdc:mga03n38_218115_c1_82_534 130
696 3300050494 nmdc:mga06z11_1987_c1 nmdc:mga06z11_1987_c1_4745_5143 130
697 3300050496 nmdc:mga07m45_192230_c1 nmdc:mga07m45_192230_c1_462_914 130
698 3300053083 Ga0495655_0196384 Ga0495655_0196384_75_467 130
699 3300053085 Ga0495619_0184798 Ga0495619_0184798_643_1035 130
700 3300053086 Ga0500578_0746835 Ga0500578_0746835_28_420 130
701 3300053088 Ga0500644_0028242 Ga0500644_0028242_661_1077 130
702 3300053095 Ga0500640_015759 Ga0500640_015759_890_1282 130
703 3300053100 Ga0500660_208455 Ga0500660_208455_141_557 130
704 3300053101 Ga0500553_227331 Ga0500553_227331_87_479 130
705 3300053107 Ga0500560_152651 Ga0500560_152651_230_622 130
706 3300053111 Ga0500572_013583 Ga0500572_013583_875_1267 130
707 3300053122 Ga0500608_137041 Ga0500608_137041_58_450 130
708 3300053123 Ga0500614_135620 Ga0500614_135620_272_664 130
709 3300053130 Ga0500642_0364987 Ga0500642_0364987_202_618 130
710 3300053133 Ga0500655_112385 Ga0500655_112385_93_485 130
711 3300053134 Ga0500658_0394177 Ga0500658_0394177_158_550 130
712 3300053136 Ga0500559_0294829 Ga0500559_0294829_272_664 130
713 3300053140 Ga0500573_0199793 Ga0500573_0199793_203_595 130
714 3300053145 Ga0500586_176739 Ga0500586_176739_237_629 130
715 3300053149 Ga0500600_0037488 Ga0500600_0037488_2402_2800 130
716 3300053157 Ga0500624_013244 Ga0500624_013244_618_1010 130
717 3300053161 Ga0500634_0148320 Ga0500634_0148320_60_476 130
718 3300053177 Ga0500636_0150474 Ga0500636_0150474_502_894 130
719 3300053736 Ga0500599_020103 Ga0500599_020103_43_459 130
720 3300059477 Ga0587084_020241 Ga0587084_020241_48_440 130
721 3300059490 Ga0587066_046314 Ga0587066_046314_75_467 130
722 3300059492 Ga0587073_0109166 Ga0587073_0109166_80_472 130
723 3300059504 Ga0587082_032635 Ga0587082_032635_426_836 130
724 3300059505 Ga0587083_0228452 Ga0587083_0228452_49_441 130
725 3300059506 Ga0587085_040716 Ga0587085_040716_56_448 130
726 3300059508 Ga0587088_196680 Ga0587088_196680_36_434 130
727 3300059509 Ga0587089_107393 Ga0587089_107393_72_464 130
728 3300059512 Ga0587092_045216 Ga0587092_045216_54_446 130
729 3300059512 Ga0587092_105560 Ga0587092_105560_114_506 130
730 3300059605 Ga0587106_069618 Ga0587106_069618_192_584 130
731 3300059605 Ga0587106_143660 Ga0587106_143660_57_449 130
732 3300059605 Ga0587106_156557 Ga0587106_156557_46_456 130
733 3300059624 Ga0587109_094313 Ga0587109_094313_71_463 130
734 3300059628 Ga0587122_018406 Ga0587122_018406_268_660 130
735 3300059628 Ga0587122_050572 Ga0587122_050572_40_435 130
736 3300059639 Ga0587062_102097 Ga0587062_102097_113_505 130
737 3300059643 Ga0587072_033100 Ga0587072_033100_529_921 130
738 3300059648 Ga0587100_029492 Ga0587100_029492_80_472 130
739 3300059651 Ga0587105_026240 Ga0587105_026240_63_455 130
740 3300059652 Ga0587107_151481 Ga0587107_151481_64_456 130
741 3300059655 Ga0587114_030091 Ga0587114_030091_57_467 130
742 3300059659 Ga0587120_030803 Ga0587120_030803_84_476 130
743 3300060344 Ga0587071_033775 Ga0587071_033775_50_442 130
744 3300060346 Ga0587111_0039359 Ga0587111_0039359_59_496 130
745 3300061719 Ga0466962_0004079 Ga0466962_0004079_5483_5884 130
746 3300061719 Ga0466962_0038489 Ga0466962_0038489_562_957 130
747 3300061719 Ga0466962_0040152 Ga0466962_0040152_1204_1602 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

17

72

0.93

PF00571

CBS

CBS domain

82

136

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npl-assembly1.cif.gz_A crystal structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria, yb-derivative at 2.8 a resolution 0.9226 1 118
5nmu-assembly1.cif.gz_B-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.9221 1 118
5nmu-assembly1.cif.gz_C-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.8714 1 127
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.866 8 123
3kpd-assembly2.cif.gz_C crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine. 0.8631 1 121
ID Description Score Start End Superfamily
af_Q5A3N2_197_353_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.905 1 119 3.10.580.10
af_Q57892_7_176_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8882 3 121 3.10.580.10
af_O13965_64_218_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8843 3 119 3.10.580.10
af_C0PHI9_226_352_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8838 3 121 3.10.580.10
af_A0A0R0JYS7_265_405_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8814 2 121 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A176LEH7-F1-model_v4 deleted 0.9479 1 129
AF-A0A533ZTU6-F1-model_v4 CBS domain-containing protein 0.9469 1 118 GO:0035438
AF-A0A286EIS5-F1-model_v4 CBS domain-containing protein 0.9451 1 130
AF-A0A6H0CSI7-F1-model_v4 CBS domain-containing protein 0.9441 1 130
AF-A0A2K8PCY1-F1-model_v4 Hypoxic response protein 1 0.942 1 121

Feature Viewer

pLDDT pTM Quality
91.56 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map