F478934
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 747 | 425 | 670 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300050490|nmdc:mga03n38_218115_c1|nmdc:mga03n38_218115_c1_82_534 |
| Length | 150 |
| Sequence | MNELIGSTGGDCEPMLVRDAMSTVVLTIGPAHTLRQAAALMSARRVGAAVVLDPDGTGTGILTERDILNSVGLGQSPDTEYAHAHTTTDVVFATPTWTLEEAAQAMAHGGFRHLIVLDHGEPTGIVSVRDIIRCWAPAPRRVPATTGSPH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 8 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 9 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 10 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 11 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 12 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 13 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 14 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 15 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 16 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 17 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 18 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 19 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 20 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 21 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 22 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 23 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 24 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 25 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 26 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 27 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 28 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 29 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 30 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 31 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 32 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 33 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 34 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 35 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 36 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 37 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 38 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 39 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 40 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 41 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 42 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 43 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 44 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 45 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 46 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 47 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 48 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 49 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 50 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 51 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 52 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 53 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 54 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 55 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 56 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 57 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 58 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 59 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 60 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 61 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 62 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 63 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 64 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 65 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 66 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 67 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 68 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 69 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 70 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 71 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 72 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 180 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 199 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 200 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 204 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 205 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 206 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 207 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 210 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 211 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 214 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 215 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 216 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 217 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 218 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 219 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 220 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 221 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 222 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 223 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 224 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 225 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 226 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 227 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 228 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 339 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 372 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 375 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 376 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 377 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 380 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 381 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 385 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 386 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 387 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 388 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 389 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 391 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 414 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 415 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 416 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 417 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 418 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 419 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 420 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 421 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 422 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 423 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 424 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 425 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.27 |
| Metatranscriptomes | 6.43 |
| Isolates | 10.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.22 |
| Nodule | 0.67 |
| Rhizoplane | 2.54 |
| Rhizosphere | 80.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10021826 | 3300001990 | Bacteria | 2036 |
| 2 | rootH1_10019195 | 3300003316 | Bacteria | 3884 |
| 3 | rootH1_10080830 | 3300003316 | Bacteria | 1532 |
| 4 | rootH2_10040067 | 3300003320 | Bacteria | 8912 |
| 5 | rootH2_10217107 | 3300003320 | Bacteria | 1021 |
| 6 | rootH1_10017685 | 3300003323 | Bacteria | 1843 |
| 7 | rootH1_10091162 | 3300003323 | Bacteria | 1685 |
| 8 | rootH1_10178559 | 3300003323 | Bacteria | 1842 |
| 9 | JGI25160J50197_1033513 | 3300003354 | Bacteria | 1290 |
| 10 | JGI25160J50197_1035808 | 3300003354 | Bacteria | 1213 |
| 11 | JGI25160J50197_1036056 | 3300003354 | Bacteria | 1205 |
| 12 | Ga0006562J51391_1044019 | 3300003578 | Bacteria | 810 |
| 13 | Ga0006562J51391_1130510 | 3300003578 | Bacteria | 1670 |
| 14 | Ga0006562J51391_1130511 | 3300003578 | Bacteria | 1656 |
| 15 | Ga0058863_11226352 | 3300004799 | Bacteria | 600 |
| 16 | Ga0058862_12670130 | 3300004803 | Bacteria | 519 |
| 17 | Ga0070682_100046806 | 3300005337 | Bacteria | 2686 |
| 18 | Ga0068868_100005573 | 3300005338 | Bacteria | 8854 |
| 19 | Ga0070691_10076958 | 3300005341 | Bacteria | 1628 |
| 20 | Ga0070659_101902934 | 3300005366 | Bacteria | 533 |
| 21 | Ga0070709_10892199 | 3300005434 | Bacteria | 703 |
| 22 | Ga0070714_100461616 | 3300005435 | Bacteria | 1207 |
| 23 | Ga0070713_101037832 | 3300005436 | Bacteria | 791 |
| 24 | Ga0070711_100036179 | 3300005439 | Bacteria | 3307 |
| 25 | Ga0070705_100474532 | 3300005440 | Bacteria | 944 |
| 26 | Ga0070708_100469459 | 3300005445 | Bacteria | 1187 |
| 27 | Ga0070681_10091417 | 3300005458 | Bacteria | 2994 |
| 28 | Ga0070685_10052437 | 3300005466 | Bacteria | 2360 |
| 29 | Ga0070707_100062789 | 3300005468 | Bacteria | 3564 |
| 30 | Ga0070684_100174499 | 3300005535 | Bacteria | 1953 |
| 31 | Ga0068853_100093609 | 3300005539 | Bacteria | 2646 |
| 32 | Ga0070686_100555896 | 3300005544 | Bacteria | 898 |
| 33 | Ga0070686_101224166 | 3300005544 | Bacteria | 624 |
| 34 | Ga0070665_100167946 | 3300005548 | Bacteria | 2196 |
| 35 | Ga0070704_100171955 | 3300005549 | Bacteria | 1724 |
| 36 | Ga0068855_100132732 | 3300005563 | Bacteria | 2843 |
| 37 | Ga0068855_100213914 | 3300005563 | Bacteria | 2165 |
| 38 | Ga0070664_100377792 | 3300005564 | Bacteria | 1293 |
| 39 | Ga0068857_100522691 | 3300005577 | Bacteria | 1115 |
| 40 | Ga0068854_100412849 | 3300005578 | Bacteria | 1120 |
| 41 | Ga0068854_102144232 | 3300005578 | Bacteria | 516 |
| 42 | Ga0068856_100057484 | 3300005614 | Bacteria | 3840 |
| 43 | Ga0068856_100126077 | 3300005614 | Bacteria | 2563 |
| 44 | Ga0068856_100484683 | 3300005614 | Bacteria | 1258 |
| 45 | Ga0068864_100058542 | 3300005618 | Bacteria | 3331 |
| 46 | Ga0068864_101707311 | 3300005618 | Bacteria | 634 |
| 47 | Ga0068866_10079829 | 3300005718 | Unclassified | 1754 |
| 48 | Ga0068863_101470662 | 3300005841 | Bacteria | 690 |
| 49 | Ga0068858_100142698 | 3300005842 | Bacteria | 2249 |
| 50 | Ga0068860_100156734 | 3300005843 | Bacteria | 2195 |
| 51 | Ga0081455_10195754 | 3300005937 | Bacteria | 1518 |
| 52 | Ga0075363_100560356 | 3300006048 | Bacteria | 682 |
| 53 | Ga0070716_100073556 | 3300006173 | Bacteria | 2016 |
| 54 | Ga0070712_100758843 | 3300006175 | Bacteria | 830 |
| 55 | Ga0070712_100821183 | 3300006175 | Bacteria | 798 |
| 56 | Ga0070712_100825366 | 3300006175 | Bacteria | 796 |
| 57 | Ga0070712_101336267 | 3300006175 | Bacteria | 625 |
| 58 | Ga0075367_10003746 | 3300006178 | Bacteria | 7319 |
| 59 | Ga0075370_10076640 | 3300006353 | Bacteria | 1918 |
| 60 | Ga0068871_102039528 | 3300006358 | Bacteria | 546 |
| 61 | Ga0075428_101693119 | 3300006844 | Bacteria | 660 |
| 62 | Ga0075433_10675322 | 3300006852 | Bacteria | 905 |
| 63 | Ga0068865_101039796 | 3300006881 | Bacteria | 719 |
| 64 | Ga0099826_10067827 | 3300006948 | Bacteria | 2281 |
| 65 | Ga0075435_100070671 | 3300007076 | Bacteria | 2849 |
| 66 | Ga0105251_10060354 | 3300009011 | Bacteria | 1785 |
| 67 | Ga0105244_10122288 | 3300009036 | Bacteria | 1260 |
| 68 | Ga0105250_10059204 | 3300009092 | Bacteria | 1538 |
| 69 | Ga0105245_10098489 | 3300009098 | Bacteria | 2702 |
| 70 | Ga0105245_10134622 | 3300009098 | Bacteria | 2321 |
| 71 | Ga0105245_10142376 | 3300009098 | Bacteria | 2260 |
| 72 | Ga0105243_10646484 | 3300009148 | Bacteria | 1024 |
| 73 | Ga0105241_10615957 | 3300009174 | Bacteria | 982 |
| 74 | Ga0105248_10365069 | 3300009177 | Bacteria | 1625 |
| 75 | Ga0105237_10191741 | 3300009545 | Bacteria | 2044 |
| 76 | Ga0105238_10118711 | 3300009551 | Bacteria | 2625 |
| 77 | Ga0105238_10522624 | 3300009551 | Bacteria | 1189 |
| 78 | Ga0105249_10650002 | 3300009553 | Unclassified | 1112 |
| 79 | Ga0105239_10082718 | 3300010375 | Bacteria | 3535 |
| 80 | Ga0105246_10249858 | 3300011119 | Bacteria | 1407 |
| 81 | Ga0105246_10667927 | 3300011119 | Unclassified | 907 |
| 82 | Ga0105246_11748045 | 3300011119 | Bacteria | 592 |
| 83 | Ga0157370_10144068 | 3300013104 | Bacteria | 2219 |
| 84 | Ga0157369_10087579 | 3300013105 | Bacteria | 3325 |
| 85 | Ga0157369_10592981 | 3300013105 | Bacteria | 1144 |
| 86 | Ga0157374_10070724 | 3300013296 | Bacteria | 3289 |
| 87 | Ga0157378_10717988 | 3300013297 | Bacteria | 1020 |
| 88 | Ga0163162_10031791 | 3300013306 | Bacteria | 5237 |
| 89 | Ga0157372_10137947 | 3300013307 | Bacteria | 2809 |
| 90 | Ga0157375_10085836 | 3300013308 | Bacteria | 3198 |
| 91 | Ga0157375_10176735 | 3300013308 | Bacteria | 2285 |
| 92 | Ga0163163_10006307 | 3300014325 | Bacteria | 10356 |
| 93 | Ga0182008_10001423 | 3300014497 | Bacteria | 16047 |
| 94 | Ga0157379_10028186 | 3300014968 | Bacteria | 4999 |
| 95 | Ga0157376_10097190 | 3300014969 | Bacteria | 2565 |
| 96 | Ga0182007_10002422 | 3300015262 | Bacteria | 9315 |
| 97 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 98 | Ga0197907_10381786 | 3300020069 | Bacteria | 530 |
| 99 | Ga0206356_10995431 | 3300020070 | Bacteria | 771 |
| 100 | Ga0206356_11206245 | 3300020070 | Bacteria | 932 |
| 101 | Ga0206356_11219520 | 3300020070 | Bacteria | 1002 |
| 102 | Ga0206355_1208892 | 3300020076 | Bacteria | 1013 |
| 103 | Ga0206352_10401905 | 3300020078 | Bacteria | 934 |
| 104 | Ga0206352_11348545 | 3300020078 | Bacteria | 596 |
| 105 | Ga0206354_10196881 | 3300020081 | Bacteria | 606 |
| 106 | Ga0206354_10216677 | 3300020081 | Bacteria | 557 |
| 107 | Ga0224712_10531268 | 3300022467 | Bacteria | 570 |
| 108 | Ga0209758_1013617 | 3300025297 | Bacteria | 4413 |
| 109 | Ga0207426_1001513 | 3300025302 | Bacteria | 18969 |
| 110 | Ga0207426_1003399 | 3300025302 | Bacteria | 8709 |
| 111 | Ga0207426_1006696 | 3300025302 | Bacteria | 4946 |
| 112 | Ga0207426_1025201 | 3300025302 | Bacteria | 2006 |
| 113 | Ga0207426_1100418 | 3300025302 | Bacteria | 748 |
| 114 | Ga0207647_10005240 | 3300025904 | Bacteria | 9543 |
| 115 | Ga0207685_10234473 | 3300025905 | Bacteria | 880 |
| 116 | Ga0207654_10578735 | 3300025911 | Bacteria | 800 |
| 117 | Ga0207707_11159889 | 3300025912 | Bacteria | 627 |
| 118 | Ga0207671_10281426 | 3300025914 | Bacteria | 1312 |
| 119 | Ga0207693_10918745 | 3300025915 | Bacteria | 671 |
| 120 | Ga0207663_10637261 | 3300025916 | Bacteria | 840 |
| 121 | Ga0207663_11216645 | 3300025916 | Bacteria | 606 |
| 122 | Ga0207652_11647249 | 3300025921 | Bacteria | 546 |
| 123 | Ga0207646_10580955 | 3300025922 | Bacteria | 1006 |
| 124 | Ga0207694_10104344 | 3300025924 | Bacteria | 2249 |
| 125 | Ga0207687_10059664 | 3300025927 | Bacteria | 2688 |
| 126 | Ga0207687_10060309 | 3300025927 | Bacteria | 2675 |
| 127 | Ga0207664_10608710 | 3300025929 | Bacteria | 981 |
| 128 | Ga0207709_10168473 | 3300025935 | Bacteria | 1535 |
| 129 | Ga0207665_10036601 | 3300025939 | Bacteria | 3265 |
| 130 | Ga0207711_10296652 | 3300025941 | Bacteria | 1490 |
| 131 | Ga0207661_11886983 | 3300025944 | Bacteria | 543 |
| 132 | Ga0207667_10408358 | 3300025949 | Bacteria | 1382 |
| 133 | Ga0207667_10499254 | 3300025949 | Bacteria | 1234 |
| 134 | Ga0207640_10069392 | 3300025981 | Bacteria | 2366 |
| 135 | Ga0207677_10006535 | 3300026023 | Bacteria | 6402 |
| 136 | Ga0207702_10116605 | 3300026078 | Bacteria | 2383 |
| 137 | Ga0207702_11461414 | 3300026078 | Bacteria | 677 |
| 138 | Ga0207702_12164519 | 3300026078 | Bacteria | 545 |
| 139 | Ga0207676_10026782 | 3300026095 | Bacteria | 4289 |
| 140 | Ga0209371_1021986 | 3300027312 | Bacteria | 1534 |
| 141 | Ga0209282_1100910 | 3300027666 | Bacteria | 1486 |
| 142 | Ga0268266_10439512 | 3300028379 | Bacteria | 1239 |
| 143 | Ga0268264_10817089 | 3300028381 | Bacteria | 932 |
| 144 | Ga0307517_10004597 | 3300028786 | Bacteria | 21141 |
| 145 | Ga0307515_10000699 | 3300028794 | Bacteria | 77489 |
| 146 | Ga0307515_10088843 | 3300028794 | Bacteria | 3899 |
| 147 | Ga0307515_10672081 | 3300028794 | Bacteria | 649 |
| 148 | Ga0268256_1018141 | 3300030500 | Bacteria | 1963 |
| 149 | Ga0307511_10000438 | 3300030521 | Bacteria | 44529 |
| 150 | Ga0307511_10064014 | 3300030521 | Bacteria | 2770 |
| 151 | Ga0307512_10004518 | 3300030522 | Bacteria | 15212 |
| 152 | Ga0307512_10099826 | 3300030522 | Bacteria | 1973 |
| 153 | Ga0307513_10009135 | 3300031456 | Bacteria | 12558 |
| 154 | Ga0307513_10174813 | 3300031456 | Bacteria | 2019 |
| 155 | Ga0307513_10974988 | 3300031456 | Bacteria | 557 |
| 156 | Ga0307509_10039154 | 3300031507 | Bacteria | 5166 |
| 157 | Ga0307508_10006837 | 3300031616 | Bacteria | 10669 |
| 158 | Ga0307508_10006908 | 3300031616 | Bacteria | 10607 |
| 159 | Ga0307508_10007827 | 3300031616 | Bacteria | 9923 |
| 160 | Ga0307508_10050424 | 3300031616 | Bacteria | 3705 |
| 161 | Ga0307508_10190740 | 3300031616 | Bacteria | 1651 |
| 162 | Ga0307514_10049324 | 3300031649 | Bacteria | 3274 |
| 163 | Ga0307514_10050574 | 3300031649 | Bacteria | 3224 |
| 164 | Ga0307514_10059521 | 3300031649 | Bacteria | 2918 |
| 165 | Ga0307514_10126484 | 3300031649 | Bacteria | 1770 |
| 166 | Ga0307516_10002231 | 3300031730 | Bacteria | 26212 |
| 167 | Ga0307516_10417422 | 3300031730 | Bacteria | 1000 |
| 168 | Ga0307516_10516121 | 3300031730 | Bacteria | 849 |
| 169 | Ga0307516_10588871 | 3300031730 | Bacteria | 766 |
| 170 | Ga0307518_10063769 | 3300031838 | Bacteria | 2674 |
| 171 | Ga0307518_10336111 | 3300031838 | Bacteria | 890 |
| 172 | Ga0307518_10621871 | 3300031838 | Bacteria | 508 |
| 173 | Ga0307416_100849287 | 3300032002 | Bacteria | 1011 |
| 174 | Ga0307416_101486896 | 3300032002 | Bacteria | 783 |
| 175 | Ga0307416_103424366 | 3300032002 | Bacteria | 531 |
| 176 | Ga0307507_10045296 | 3300033179 | Bacteria | 4330 |
| 177 | Ga0307507_10079103 | 3300033179 | Bacteria | 2909 |
| 178 | Ga0307507_10115847 | 3300033179 | Bacteria | 2166 |
| 179 | Ga0307507_10539758 | 3300033179 | Bacteria | 618 |
| 180 | Ga0307510_10011458 | 3300033180 | Bacteria | 10534 |
| 181 | Ga0307510_10023835 | 3300033180 | Bacteria | 7085 |
| 182 | Ga0307510_10240025 | 3300033180 | Bacteria | 1307 |
| 183 | Ga0373934_0294083 | 3300035086 | Bacteria | 673 |
| 184 | Ga0373945_0098141 | 3300035116 | Bacteria | 1143 |
| 185 | Ga0373945_0166859 | 3300035116 | Bacteria | 900 |
| 186 | Ga0373954_0056855 | 3300035118 | Bacteria | 1842 |
| 187 | Ga0373956_0192362 | 3300035119 | Bacteria | 966 |
| 188 | Ga0373943_0164675 | 3300035170 | Bacteria | 1209 |
| 189 | Ga0373946_0433400 | 3300035171 | Bacteria | 667 |
| 190 | Ga0373931_0769697 | 3300035691 | Bacteria | 640 |
| 191 | Ga0373937_0039588 | 3300036401 | Bacteria | 4295 |
| 192 | Ga0373925_0443148 | 3300037068 | Bacteria | 1063 |
| 193 | Ga0395900_0193003 | 3300037418 | Bacteria | 2065 |
| 194 | Ga0395898_0003092 | 3300037466 | Bacteria | 18832 |
| 195 | Ga0395898_0030289 | 3300037466 | Bacteria | 5416 |
| 196 | Ga0395901_0074271 | 3300038443 | Bacteria | 3547 |
| 197 | Ga0395901_0244404 | 3300038443 | Bacteria | 1871 |
| 198 | Ga0439436_0002729 | 3300041404 | Bacteria | 5333 |
| 199 | Ga0439436_0003166 | 3300041404 | Bacteria | 4989 |
| 200 | Ga0439439_0007385 | 3300041406 | Bacteria | 2569 |
| 201 | Ga0451789_0944422 | 3300041443 | Bacteria | 723 |
| 202 | Ga0451800_1114010 | 3300041459 | Bacteria | 1389 |
| 203 | Ga0451807_1614476 | 3300041486 | Bacteria | 895 |
| 204 | Ga0451807_1804336 | 3300041486 | Bacteria | 708 |
| 205 | Ga0451837_0010181 | 3300041494 | Bacteria | 2844 |
| 206 | Ga0451841_1407059 | 3300041498 | Bacteria | 605 |
| 207 | Ga0451845_0506071 | 3300041501 | Bacteria | 751 |
| 208 | Ga0451847_0278125 | 3300041503 | Bacteria | 547 |
| 209 | Ga0451843_1617188 | 3300041509 | Bacteria | 663 |
| 210 | Ga0451853_0301595 | 3300041512 | Bacteria | 2221 |
| 211 | Ga0451853_0393940 | 3300041512 | Bacteria | 1824 |
| 212 | Ga0451853_1059851 | 3300041512 | Bacteria | 1060 |
| 213 | Ga0451853_2009427 | 3300041512 | Bacteria | 2464 |
| 214 | Ga0439431_0066081 | 3300041997 | Bacteria | 958 |
| 215 | Ga0439433_0012142 | 3300041999 | Bacteria | 1887 |
| 216 | Ga0439442_001532 | 3300042002 | Bacteria | 4535 |
| 217 | Ga0439442_003644 | 3300042002 | Bacteria | 3051 |
| 218 | Ga0439448_0004898 | 3300042005 | Bacteria | 3799 |
| 219 | Ga0439449_0000358 | 3300042007 | Bacteria | 16753 |
| 220 | Ga0439449_0041114 | 3300042007 | Bacteria | 1718 |
| 221 | Ga0439449_0089795 | 3300042007 | Bacteria | 1134 |
| 222 | Ga0439449_0122340 | 3300042007 | Bacteria | 966 |
| 223 | Ga0439450_155205 | 3300042008 | Bacteria | 601 |
| 224 | Ga0439454_016112 | 3300042011 | Bacteria | 1053 |
| 225 | Ga0439457_002398 | 3300042014 | Bacteria | 5357 |
| 226 | Ga0439457_004233 | 3300042014 | Bacteria | 3778 |
| 227 | Ga0439457_061953 | 3300042014 | Bacteria | 848 |
| 228 | Ga0439462_0010822 | 3300042015 | Bacteria | 2315 |
| 229 | Ga0439463_142957 | 3300042016 | Bacteria | 620 |
| 230 | Ga0450897_009761 | 3300042128 | Bacteria | 913 |
| 231 | Ga0450894_000136 | 3300042131 | Bacteria | 12932 |
| 232 | Ga0450898_000424 | 3300042134 | Bacteria | 4906 |
| 233 | Ga0450899_018844 | 3300042135 | Bacteria | 799 |
| 234 | Ga0450900_004670 | 3300042136 | Bacteria | 1585 |
| 235 | Ga0450902_008532 | 3300042137 | Bacteria | 1602 |
| 236 | Ga0450903_000233 | 3300042138 | Bacteria | 12380 |
| 237 | Ga0450906_018467 | 3300042145 | Bacteria | 1251 |
| 238 | Ga0439458_0018008 | 3300042157 | Bacteria | 1615 |
| 239 | Ga0439458_0020162 | 3300042157 | Bacteria | 1539 |
| 240 | Ga0450908_010768 | 3300042184 | Bacteria | 1683 |
| 241 | Ga0466969_0083017 | 3300044656 | Bacteria | 1526 |
| 242 | Ga0466969_0135318 | 3300044656 | Bacteria | 1141 |
| 243 | Ga0466972_0004540 | 3300044658 | Bacteria | 6952 |
| 244 | Ga0466972_0056941 | 3300044658 | Bacteria | 1878 |
| 245 | Ga0466972_0067178 | 3300044658 | Bacteria | 1713 |
| 246 | Ga0466972_0172952 | 3300044658 | Bacteria | 1013 |
| 247 | Ga0466965_0031059 | 3300044683 | Bacteria | 2603 |
| 248 | Ga0466965_0297837 | 3300044683 | Bacteria | 874 |
| 249 | Ga0466965_0361990 | 3300044683 | Bacteria | 796 |
| 250 | Ga0466965_0912746 | 3300044683 | Bacteria | 513 |
| 251 | Ga0466966_0191081 | 3300044684 | Bacteria | 1240 |
| 252 | Ga0466961_0017066 | 3300044693 | Bacteria | 4662 |
| 253 | Ga0466961_0080676 | 3300044693 | Bacteria | 2059 |
| 254 | Ga0466961_0190965 | 3300044693 | Bacteria | 1269 |
| 255 | Ga0466961_0724040 | 3300044693 | Bacteria | 595 |
| 256 | Ga0466963_0000213 | 3300044694 | Bacteria | 24764 |
| 257 | Ga0466963_0031993 | 3300044694 | Bacteria | 3403 |
| 258 | Ga0466963_0072827 | 3300044694 | Bacteria | 2315 |
| 259 | Ga0466963_0168700 | 3300044694 | Bacteria | 1525 |
| 260 | Ga0466963_0686842 | 3300044694 | Bacteria | 722 |
| 261 | Ga0466964_0102966 | 3300044706 | Bacteria | 1261 |
| 262 | Ga0466964_0518622 | 3300044706 | Bacteria | 642 |
| 263 | Ga0466971_0000575 | 3300044719 | Bacteria | 14492 |
| 264 | Ga0466971_0038665 | 3300044719 | Bacteria | 2141 |
| 265 | Ga0466971_0647823 | 3300044719 | Bacteria | 529 |
| 266 | Ga0466968_0169956 | 3300044735 | Bacteria | 1010 |
| 267 | Ga0466970_0001274 | 3300044765 | Bacteria | 12183 |
| 268 | Ga0466970_0006583 | 3300044765 | Bacteria | 5810 |
| 269 | Ga0466970_0680531 | 3300044765 | Bacteria | 599 |
| 270 | Ga0466957_0023199 | 3300044842 | Bacteria | 3666 |
| 271 | Ga0466957_0205515 | 3300044842 | Bacteria | 1295 |
| 272 | Ga0466957_0221160 | 3300044842 | Bacteria | 1250 |
| 273 | Ga0466957_0996579 | 3300044842 | Bacteria | 602 |
| 274 | Ga0466957_1003719 | 3300044842 | Bacteria | 599 |
| 275 | Ga0466960_0121087 | 3300044901 | Bacteria | 1370 |
| 276 | Ga0466960_0151254 | 3300044901 | Bacteria | 1240 |
| 277 | Ga0466960_0507779 | 3300044901 | Bacteria | 707 |
| 278 | Ga0466959_0003363 | 3300045049 | Bacteria | 10451 |
| 279 | Ga0466959_0922397 | 3300045049 | Unclassified | 582 |
| 280 | Ga0466958_0095111 | 3300045836 | Bacteria | 1846 |
| 281 | Ga0466958_0132417 | 3300045836 | Bacteria | 1566 |
| 282 | Ga0466967_0052759 | 3300045976 | Bacteria | 3571 |
| 283 | Ga0466967_0108297 | 3300045976 | Bacteria | 2549 |
| 284 | Ga0466967_0143729 | 3300045976 | Bacteria | 2224 |
| 285 | Ga0466967_0174885 | 3300045976 | Bacteria | 2022 |
| 286 | Ga0466967_0192631 | 3300045976 | Bacteria | 1927 |
| 287 | Ga0466967_0212446 | 3300045976 | Bacteria | 1835 |
| 288 | Ga0466967_0307766 | 3300045976 | Bacteria | 1525 |
| 289 | Ga0466967_0440992 | 3300045976 | Bacteria | 1271 |
| 290 | Ga0466967_0524071 | 3300045976 | Bacteria | 1165 |
| 291 | Ga0466967_2195384 | 3300045976 | Bacteria | 548 |
| 292 | Ga0466967_2224499 | 3300045976 | Bacteria | 544 |
| 293 | Ga0495592_0000574 | 3300046454 | Bacteria | 26037 |
| 294 | Ga0495592_0047991 | 3300046454 | Bacteria | 3178 |
| 295 | Ga0495603_0004257 | 3300046455 | Bacteria | 8525 |
| 296 | Ga0495603_0274076 | 3300046455 | Bacteria | 970 |
| 297 | Ga0495603_0442957 | 3300046455 | Bacteria | 744 |
| 298 | Ga0495603_0757155 | 3300046455 | Bacteria | 555 |
| 299 | Ga0495590_0038675 | 3300046457 | Bacteria | 1664 |
| 300 | Ga0495629_0002819 | 3300046459 | Bacteria | 13265 |
| 301 | Ga0495629_0013612 | 3300046459 | Bacteria | 5869 |
| 302 | Ga0495629_0023271 | 3300046459 | Bacteria | 4415 |
| 303 | Ga0495629_0089361 | 3300046459 | Bacteria | 2149 |
| 304 | Ga0495629_0107957 | 3300046459 | Bacteria | 1941 |
| 305 | Ga0495629_0110270 | 3300046459 | Bacteria | 1918 |
| 306 | Ga0495629_0146572 | 3300046459 | Bacteria | 1641 |
| 307 | Ga0495629_0444279 | 3300046459 | Bacteria | 878 |
| 308 | Ga0495638_0112665 | 3300046460 | Bacteria | 1614 |
| 309 | Ga0495638_0269807 | 3300046460 | Bacteria | 929 |
| 310 | Ga0495641_0173672 | 3300046461 | Bacteria | 964 |
| 311 | Ga0495651_0017031 | 3300046462 | Bacteria | 5630 |
| 312 | Ga0495651_0079211 | 3300046462 | Bacteria | 2483 |
| 313 | Ga0495651_0102999 | 3300046462 | Bacteria | 2121 |
| 314 | Ga0495651_0177354 | 3300046462 | Bacteria | 1511 |
| 315 | Ga0495653_0090901 | 3300046463 | Bacteria | 2232 |
| 316 | Ga0495653_0377002 | 3300046463 | Bacteria | 907 |
| 317 | Ga0495653_0641302 | 3300046463 | Bacteria | 649 |
| 318 | Ga0495580_0253921 | 3300046472 | Bacteria | 1203 |
| 319 | Ga0495582_0100885 | 3300046473 | Bacteria | 1616 |
| 320 | Ga0495605_0005349 | 3300046474 | Bacteria | 7481 |
| 321 | Ga0495639_0075647 | 3300046475 | Bacteria | 1561 |
| 322 | Ga0495662_0013250 | 3300046476 | Bacteria | 4013 |
| 323 | Ga0495662_0018848 | 3300046476 | Bacteria | 3339 |
| 324 | Ga0495662_0039237 | 3300046476 | Bacteria | 2287 |
| 325 | Ga0495662_0101601 | 3300046476 | Bacteria | 1406 |
| 326 | Ga0495662_0181113 | 3300046476 | Bacteria | 1038 |
| 327 | Ga0495662_0559855 | 3300046476 | Bacteria | 560 |
| 328 | Ga0495664_0007790 | 3300046477 | Bacteria | 5961 |
| 329 | Ga0495664_0031093 | 3300046477 | Bacteria | 3128 |
| 330 | Ga0495664_0037883 | 3300046477 | Bacteria | 2847 |
| 331 | Ga0495664_0063719 | 3300046477 | Bacteria | 2197 |
| 332 | Ga0495664_0085909 | 3300046477 | Bacteria | 1889 |
| 333 | Ga0495664_0713314 | 3300046477 | Bacteria | 592 |
| 334 | Ga0495584_0282451 | 3300046491 | Bacteria | 843 |
| 335 | Ga0495584_0567137 | 3300046491 | Bacteria | 579 |
| 336 | Ga0495585_0007795 | 3300046492 | Bacteria | 6523 |
| 337 | Ga0495585_0058979 | 3300046492 | Bacteria | 2116 |
| 338 | Ga0495594_0001816 | 3300046499 | Bacteria | 11101 |
| 339 | Ga0495594_0081634 | 3300046499 | Bacteria | 1805 |
| 340 | Ga0495594_0116525 | 3300046499 | Bacteria | 1508 |
| 341 | Ga0495594_0157211 | 3300046499 | Bacteria | 1291 |
| 342 | Ga0495594_0486532 | 3300046499 | Bacteria | 701 |
| 343 | Ga0495596_0125752 | 3300046500 | Bacteria | 995 |
| 344 | Ga0495596_0234521 | 3300046500 | Bacteria | 712 |
| 345 | Ga0495607_0081677 | 3300046501 | Bacteria | 1775 |
| 346 | Ga0495607_0096676 | 3300046501 | Bacteria | 1589 |
| 347 | Ga0495583_0042610 | 3300046506 | Bacteria | 2118 |
| 348 | Ga0495606_0013622 | 3300046507 | Bacteria | 6411 |
| 349 | Ga0495608_0344690 | 3300046511 | Bacteria | 917 |
| 350 | Ga0495608_0838235 | 3300046511 | Bacteria | 541 |
| 351 | Ga0495610_0121162 | 3300046512 | Bacteria | 1146 |
| 352 | Ga0495610_0146435 | 3300046512 | Bacteria | 1012 |
| 353 | Ga0495610_0215045 | 3300046512 | Bacteria | 779 |
| 354 | Ga0495616_0037258 | 3300046513 | Bacteria | 2503 |
| 355 | Ga0495618_0062044 | 3300046514 | Bacteria | 2371 |
| 356 | Ga0495618_0319690 | 3300046514 | Bacteria | 961 |
| 357 | Ga0495620_0034741 | 3300046515 | Bacteria | 2274 |
| 358 | Ga0495620_0088812 | 3300046515 | Bacteria | 1241 |
| 359 | Ga0495620_0277766 | 3300046515 | Bacteria | 637 |
| 360 | Ga0495628_0046823 | 3300046516 | Bacteria | 3433 |
| 361 | Ga0495628_0080884 | 3300046516 | Bacteria | 2524 |
| 362 | Ga0495628_0149536 | 3300046516 | Bacteria | 1779 |
| 363 | Ga0495628_0178311 | 3300046516 | Bacteria | 1608 |
| 364 | Ga0495628_0443471 | 3300046516 | Bacteria | 943 |
| 365 | Ga0495630_0033011 | 3300046517 | Bacteria | 3860 |
| 366 | Ga0495630_0162453 | 3300046517 | Bacteria | 1700 |
| 367 | Ga0495630_0473812 | 3300046517 | Bacteria | 960 |
| 368 | Ga0495630_0568209 | 3300046517 | Bacteria | 870 |
| 369 | Ga0495631_0028031 | 3300046518 | Bacteria | 2571 |
| 370 | Ga0495631_0069413 | 3300046518 | Bacteria | 1524 |
| 371 | Ga0495637_0064870 | 3300046520 | Bacteria | 1488 |
| 372 | Ga0495643_0005567 | 3300046522 | Bacteria | 8478 |
| 373 | Ga0495644_0297976 | 3300046523 | Bacteria | 631 |
| 374 | Ga0495648_0050550 | 3300046524 | Bacteria | 2538 |
| 375 | Ga0495648_0193895 | 3300046524 | Bacteria | 1023 |
| 376 | Ga0495648_0389007 | 3300046524 | Bacteria | 626 |
| 377 | Ga0495666_0014863 | 3300046526 | Bacteria | 3873 |
| 378 | Ga0495666_0123221 | 3300046526 | Bacteria | 1213 |
| 379 | Ga0495642_0015555 | 3300046528 | Bacteria | 2959 |
| 380 | Ga0495652_0028911 | 3300046529 | Bacteria | 4872 |
| 381 | Ga0495652_0030071 | 3300046529 | Bacteria | 4766 |
| 382 | Ga0495652_0139100 | 3300046529 | Bacteria | 1911 |
| 383 | Ga0495652_0182024 | 3300046529 | Bacteria | 1611 |
| 384 | Ga0495654_0026495 | 3300046530 | Bacteria | 2979 |
| 385 | Ga0495665_0137705 | 3300046531 | Bacteria | 1276 |
| 386 | Ga0495640_0010846 | 3300046533 | Bacteria | 7030 |
| 387 | Ga0495640_0021884 | 3300046533 | Bacteria | 4683 |
| 388 | Ga0495640_0035770 | 3300046533 | Bacteria | 3513 |
| 389 | Ga0495640_0144317 | 3300046533 | Bacteria | 1532 |
| 390 | Ga0495586_0092894 | 3300046535 | Bacteria | 1668 |
| 391 | Ga0495586_0289667 | 3300046535 | Bacteria | 937 |
| 392 | Ga0495587_0001011 | 3300046536 | Bacteria | 18494 |
| 393 | Ga0495587_0003221 | 3300046536 | Bacteria | 10913 |
| 394 | Ga0495587_0278099 | 3300046536 | Bacteria | 938 |
| 395 | Ga0495609_0073982 | 3300046538 | Bacteria | 1494 |
| 396 | Ga0495597_0023855 | 3300046542 | Bacteria | 2828 |
| 397 | Ga0495645_0032240 | 3300046543 | Bacteria | 3821 |
| 398 | Ga0495645_0049580 | 3300046543 | Bacteria | 3057 |
| 399 | Ga0495645_0482447 | 3300046543 | Bacteria | 777 |
| 400 | Ga0495622_0019957 | 3300046557 | Bacteria | 3119 |
| 401 | Ga0495622_0027908 | 3300046557 | Bacteria | 2634 |
| 402 | Ga0495622_0101327 | 3300046557 | Bacteria | 1320 |
| 403 | Ga0495622_0192528 | 3300046557 | Bacteria | 911 |
| 404 | Ga0495633_0037682 | 3300046558 | Bacteria | 2312 |
| 405 | Ga0495633_0200017 | 3300046558 | Bacteria | 917 |
| 406 | Ga0495667_0030504 | 3300046559 | Bacteria | 3622 |
| 407 | Ga0495667_0195928 | 3300046559 | Bacteria | 1294 |
| 408 | Ga0495667_0296114 | 3300046559 | Bacteria | 1025 |
| 409 | Ga0495667_0320136 | 3300046559 | Bacteria | 981 |
| 410 | Ga0495667_0988724 | 3300046559 | Bacteria | 513 |
| 411 | Ga0495668_0017827 | 3300046616 | Bacteria | 4113 |
| 412 | Ga0495668_0076764 | 3300046616 | Bacteria | 1834 |
| 413 | Ga0495668_0099213 | 3300046616 | Bacteria | 1593 |
| 414 | Ga0495634_0005531 | 3300046642 | Bacteria | 9699 |
| 415 | Ga0495634_0017386 | 3300046642 | Bacteria | 5132 |
| 416 | Ga0495634_0274406 | 3300046642 | Bacteria | 1025 |
| 417 | Ga0495634_0586886 | 3300046642 | Bacteria | 647 |
| 418 | Ga0495611_0145263 | 3300046648 | Bacteria | 1107 |
| 419 | Ga0495611_0145976 | 3300046648 | Bacteria | 1104 |
| 420 | Ga0495611_0207546 | 3300046648 | Bacteria | 913 |
| 421 | Ga0495625_0164477 | 3300046660 | Bacteria | 1484 |
| 422 | Ga0495625_0295332 | 3300046660 | Bacteria | 1038 |
| 423 | Ga0495635_0098181 | 3300046663 | Bacteria | 2002 |
| 424 | Ga0495635_0165153 | 3300046663 | Bacteria | 1506 |
| 425 | Ga0495635_0201024 | 3300046663 | Bacteria | 1351 |
| 426 | Ga0495635_0921331 | 3300046663 | Bacteria | 559 |
| 427 | Ga0495661_0036094 | 3300046665 | Bacteria | 3097 |
| 428 | Ga0495661_0262342 | 3300046665 | Bacteria | 877 |
| 429 | Ga0495661_0439445 | 3300046665 | Bacteria | 629 |
| 430 | Ga0495588_0001268 | 3300046674 | Bacteria | 10834 |
| 431 | Ga0495588_0012467 | 3300046674 | Bacteria | 4019 |
| 432 | Ga0495588_0263876 | 3300046674 | Bacteria | 907 |
| 433 | Ga0495657_0001214 | 3300046675 | Bacteria | 22612 |
| 434 | Ga0495657_0020442 | 3300046675 | Bacteria | 4757 |
| 435 | Ga0495657_0030679 | 3300046675 | Bacteria | 3762 |
| 436 | Ga0495657_0033179 | 3300046675 | Bacteria | 3596 |
| 437 | Ga0495599_0005311 | 3300046678 | Bacteria | 7685 |
| 438 | Ga0495599_0090794 | 3300046678 | Bacteria | 1906 |
| 439 | Ga0495599_0194168 | 3300046678 | Bacteria | 1248 |
| 440 | Ga0495646_0014451 | 3300046680 | Bacteria | 5020 |
| 441 | Ga0495646_0283485 | 3300046680 | Bacteria | 880 |
| 442 | Ga0495658_0116688 | 3300046683 | Bacteria | 1610 |
| 443 | Ga0495658_0144361 | 3300046683 | Bacteria | 1457 |
| 444 | Ga0495613_0003059 | 3300046689 | Bacteria | 12502 |
| 445 | Ga0495613_0010395 | 3300046689 | Bacteria | 6912 |
| 446 | Ga0495613_0012117 | 3300046689 | Bacteria | 6408 |
| 447 | Ga0495613_0109870 | 3300046689 | Bacteria | 1987 |
| 448 | Ga0495613_0135378 | 3300046689 | Bacteria | 1763 |
| 449 | Ga0495613_0179258 | 3300046689 | Bacteria | 1501 |
| 450 | Ga0495613_0229586 | 3300046689 | Bacteria | 1300 |
| 451 | Ga0495613_0530936 | 3300046689 | Bacteria | 789 |
| 452 | Ga0495613_0680743 | 3300046689 | Bacteria | 678 |
| 453 | Ga0495624_0014389 | 3300046690 | Bacteria | 5370 |
| 454 | Ga0495624_0110705 | 3300046690 | Bacteria | 1689 |
| 455 | Ga0495624_0271689 | 3300046690 | Bacteria | 1024 |
| 456 | Ga0495624_0480763 | 3300046690 | Bacteria | 743 |
| 457 | Ga0495624_0559763 | 3300046690 | Bacteria | 682 |
| 458 | Ga0495670_0379824 | 3300046691 | Bacteria | 762 |
| 459 | Ga0495670_0508837 | 3300046691 | Bacteria | 654 |
| 460 | Ga0495671_0022519 | 3300046692 | Bacteria | 3300 |
| 461 | Ga0495671_0153702 | 3300046692 | Bacteria | 1120 |
| 462 | Ga0495671_0173739 | 3300046692 | Bacteria | 1047 |
| 463 | Ga0495649_0080389 | 3300046694 | Bacteria | 1743 |
| 464 | Ga0495649_0154922 | 3300046694 | Bacteria | 1203 |
| 465 | Ga0495649_0167813 | 3300046694 | Bacteria | 1149 |
| 466 | Ga0495589_0014905 | 3300046794 | Bacteria | 4000 |
| 467 | Ga0495589_0276114 | 3300046794 | Bacteria | 782 |
| 468 | Ga0495600_0007018 | 3300046809 | Bacteria | 6879 |
| 469 | Ga0495600_0019938 | 3300046809 | Bacteria | 4286 |
| 470 | Ga0495600_0051201 | 3300046809 | Bacteria | 2695 |
| 471 | Ga0495600_0383097 | 3300046809 | Bacteria | 877 |
| 472 | Ga0495581_0005237 | 3300047315 | Bacteria | 7500 |
| 473 | Ga0495581_0065540 | 3300047315 | Bacteria | 2100 |
| 474 | Ga0495581_0248433 | 3300047315 | Bacteria | 1040 |
| 475 | Ga0495581_0503292 | 3300047315 | Bacteria | 704 |
| 476 | Ga0495604_0022719 | 3300047317 | Bacteria | 5008 |
| 477 | Ga0495604_0056268 | 3300047317 | Bacteria | 3028 |
| 478 | Ga0495604_0113627 | 3300047317 | Bacteria | 1970 |
| 479 | Ga0495604_0129049 | 3300047317 | Bacteria | 1819 |
| 480 | Ga0495604_0603621 | 3300047317 | Bacteria | 703 |
| 481 | Ga0495636_0027201 | 3300047318 | Bacteria | 2330 |
| 482 | Ga0495636_0036339 | 3300047318 | Bacteria | 2031 |
| 483 | Ga0495636_0045783 | 3300047318 | Bacteria | 1824 |
| 484 | Ga0495636_0049775 | 3300047318 | Bacteria | 1753 |
| 485 | Ga0495674_0194508 | 3300047319 | Bacteria | 1684 |
| 486 | Ga0495674_0213282 | 3300047319 | Bacteria | 1598 |
| 487 | Ga0495674_0616145 | 3300047319 | Bacteria | 859 |
| 488 | Ga0495674_1043863 | 3300047319 | Bacteria | 624 |
| 489 | Ga0495672_0083211 | 3300047320 | Bacteria | 1778 |
| 490 | Ga0495676_0002047 | 3300047321 | Bacteria | 17746 |
| 491 | Ga0495676_0005451 | 3300047321 | Bacteria | 11667 |
| 492 | Ga0495676_0012902 | 3300047321 | Bacteria | 7516 |
| 493 | Ga0495676_0030974 | 3300047321 | Bacteria | 4530 |
| 494 | Ga0495676_0073343 | 3300047321 | Bacteria | 2624 |
| 495 | Ga0495676_0146274 | 3300047321 | Bacteria | 1687 |
| 496 | Ga0495676_0151528 | 3300047321 | Bacteria | 1649 |
| 497 | Ga0495676_0201737 | 3300047321 | Bacteria | 1382 |
| 498 | Ga0495676_0926524 | 3300047321 | Bacteria | 557 |
| 499 | Ga0495676_1044284 | 3300047321 | Bacteria | 520 |
| 500 | Ga0495680_0010669 | 3300047322 | Bacteria | 8192 |
| 501 | Ga0495680_0093253 | 3300047322 | Bacteria | 2254 |
| 502 | Ga0495680_0417508 | 3300047322 | Bacteria | 923 |
| 503 | Ga0495683_0273178 | 3300047323 | Bacteria | 734 |
| 504 | Ga0495687_006392 | 3300047443 | Bacteria | 7232 |
| 505 | Ga0495687_020416 | 3300047443 | Bacteria | 3227 |
| 506 | Ga0495687_171719 | 3300047443 | Bacteria | 717 |
| 507 | Ga0495675_0014147 | 3300047444 | Bacteria | 5045 |
| 508 | Ga0495675_0142712 | 3300047444 | Bacteria | 1483 |
| 509 | Ga0495675_0160163 | 3300047444 | Bacteria | 1386 |
| 510 | Ga0495675_0228593 | 3300047444 | Bacteria | 1123 |
| 511 | Ga0495677_0026186 | 3300047445 | Bacteria | 2116 |
| 512 | Ga0495685_005303 | 3300047447 | Bacteria | 4203 |
| 513 | Ga0495685_006989 | 3300047447 | Bacteria | 3714 |
| 514 | Ga0495685_018741 | 3300047447 | Bacteria | 2376 |
| 515 | Ga0495685_162261 | 3300047447 | Bacteria | 723 |
| 516 | Ga0495673_0198446 | 3300047469 | Bacteria | 752 |
| 517 | Ga0495681_0000567 | 3300047470 | Bacteria | 28271 |
| 518 | Ga0495681_0302764 | 3300047470 | Bacteria | 618 |
| 519 | Ga0495684_0000710 | 3300047471 | Bacteria | 26766 |
| 520 | Ga0495684_0095811 | 3300047471 | Bacteria | 2246 |
| 521 | Ga0495686_0015791 | 3300047472 | Bacteria | 5140 |
| 522 | Ga0495686_0028044 | 3300047472 | Bacteria | 3669 |
| 523 | Ga0495686_0084897 | 3300047472 | Bacteria | 1929 |
| 524 | Ga0495593_0000488 | 3300047673 | Bacteria | 22326 |
| 525 | Ga0495593_0023676 | 3300047673 | Bacteria | 3410 |
| 526 | Ga0495593_0027313 | 3300047673 | Bacteria | 3142 |
| 527 | Ga0495593_0651560 | 3300047673 | Bacteria | 529 |
| 528 | Ga0495602_0018574 | 3300048088 | Bacteria | 6936 |
| 529 | Ga0495602_0077375 | 3300048088 | Bacteria | 2815 |
| 530 | Ga0495614_0001937 | 3300048089 | Bacteria | 9093 |
| 531 | Ga0495614_0006857 | 3300048089 | Bacteria | 5094 |
| 532 | Ga0495614_0007664 | 3300048089 | Bacteria | 4799 |
| 533 | Ga0495614_0041221 | 3300048089 | Bacteria | 1980 |
| 534 | Ga0495614_0119543 | 3300048089 | Bacteria | 1161 |
| 535 | Ga0495614_0222866 | 3300048089 | Bacteria | 857 |
| 536 | Ga0495626_0024655 | 3300048091 | Bacteria | 2947 |
| 537 | Ga0496104_0555074 | 3300048907 | Bacteria | 1059 |
| 538 | Ga0496105_0038560 | 3300048908 | Bacteria | 3936 |
| 539 | Ga0496105_0522338 | 3300048908 | Bacteria | 930 |
| 540 | Ga0496106_0214524 | 3300048909 | Bacteria | 1534 |
| 541 | Ga0496107_0883835 | 3300048910 | Bacteria | 652 |
| 542 | Ga0496108_0009740 | 3300048911 | Bacteria | 7784 |
| 543 | Ga0496108_1097077 | 3300048911 | Bacteria | 676 |
| 544 | Ga0496110_0010424 | 3300048913 | Bacteria | 7557 |
| 545 | Ga0496110_1044945 | 3300048913 | Bacteria | 725 |
| 546 | Ga0496112_0043029 | 3300048915 | Bacteria | 4421 |
| 547 | Ga0496112_0208625 | 3300048915 | Bacteria | 1911 |
| 548 | Ga0496113_0010985 | 3300048916 | Bacteria | 6017 |
| 549 | Ga0496113_0635352 | 3300048916 | Bacteria | 854 |
| 550 | Ga0496114_0430438 | 3300048917 | Bacteria | 1169 |
| 551 | Ga0496119_0503949 | 3300048922 | Bacteria | 563 |
| 552 | Ga0501306_041572 | 3300049127 | Bacteria | 715 |
| 553 | Ga0501306_069041 | 3300049127 | Bacteria | 594 |
| 554 | Ga0501308_032020 | 3300049128 | Bacteria | 709 |
| 555 | Ga0501308_060874 | 3300049128 | Bacteria | 570 |
| 556 | Ga0501310_034095 | 3300049130 | Bacteria | 687 |
| 557 | Ga0495678_019245 | 3300049459 | Bacteria | 3050 |
| 558 | Ga0495682_0231453 | 3300049460 | Bacteria | 654 |
| 559 | Ga0501313_048544 | 3300049529 | Bacteria | 583 |
| 560 | Ga0501314_043024 | 3300049530 | Bacteria | 531 |
| 561 | Ga0501031_0174821 | 3300049568 | Bacteria | 1403 |
| 562 | Ga0501032_0041778 | 3300049569 | Bacteria | 3112 |
| 563 | Ga0501032_0161676 | 3300049569 | Bacteria | 1470 |
| 564 | Ga0501032_0164657 | 3300049569 | Bacteria | 1455 |
| 565 | Ga0501032_0242617 | 3300049569 | Bacteria | 1170 |
| 566 | Ga0501033_0003519 | 3300049570 | Bacteria | 12825 |
| 567 | Ga0501033_0053149 | 3300049570 | Bacteria | 3000 |
| 568 | Ga0501033_0165927 | 3300049570 | Bacteria | 1587 |
| 569 | Ga0501034_0746442 | 3300049571 | Bacteria | 874 |
| 570 | Ga0501034_0785875 | 3300049571 | Bacteria | 845 |
| 571 | Ga0501036_0112831 | 3300049572 | Bacteria | 2297 |
| 572 | Ga0501036_0302546 | 3300049572 | Bacteria | 1337 |
| 573 | Ga0501037_0194265 | 3300049573 | Bacteria | 1436 |
| 574 | Ga0501037_0210513 | 3300049573 | Bacteria | 1371 |
| 575 | Ga0501037_0240410 | 3300049573 | Bacteria | 1269 |
| 576 | Ga0501037_0268436 | 3300049573 | Bacteria | 1191 |
| 577 | Ga0501038_0311018 | 3300049574 | Bacteria | 1234 |
| 578 | Ga0501039_0055212 | 3300049575 | Bacteria | 3075 |
| 579 | Ga0501043_0031845 | 3300049579 | Bacteria | 4145 |
| 580 | Ga0501043_0058599 | 3300049579 | Bacteria | 3023 |
| 581 | Ga0501043_0108548 | 3300049579 | Bacteria | 2179 |
| 582 | Ga0501043_0956633 | 3300049579 | Bacteria | 611 |
| 583 | Ga0501047_0009843 | 3300049581 | Bacteria | 9033 |
| 584 | Ga0501047_0081903 | 3300049581 | Bacteria | 3102 |
| 585 | Ga0501047_0215681 | 3300049581 | Bacteria | 1776 |
| 586 | Ga0501047_0297330 | 3300049581 | Bacteria | 1457 |
| 587 | Ga0501048_0088148 | 3300049582 | Bacteria | 2189 |
| 588 | Ga0501070_0169212 | 3300049586 | Bacteria | 1800 |
| 589 | Ga0501070_0194908 | 3300049586 | Bacteria | 1664 |
| 590 | Ga0501070_0335980 | 3300049586 | Bacteria | 1227 |
| 591 | Ga0501257_251696 | 3300049686 | Bacteria | 524 |
| 592 | Ga0501080_0025292 | 3300049742 | Bacteria | 5509 |
| 593 | Ga0501035_0026105 | 3300049822 | Bacteria | 5349 |
| 594 | Ga0501035_0101021 | 3300049822 | Bacteria | 2531 |
| 595 | Ga0501035_0129751 | 3300049822 | Bacteria | 2198 |
| 596 | Ga0501035_0150580 | 3300049822 | Bacteria | 2019 |
| 597 | Ga0501035_1020781 | 3300049822 | Bacteria | 649 |
| 598 | Ga0501044_0004420 | 3300049823 | Bacteria | 15724 |
| 599 | Ga0501044_0020637 | 3300049823 | Bacteria | 7035 |
| 600 | Ga0501044_0166315 | 3300049823 | Bacteria | 2179 |
| 601 | Ga0501044_0172461 | 3300049823 | Bacteria | 2133 |
| 602 | Ga0501044_0229901 | 3300049823 | Bacteria | 1803 |
| 603 | Ga0501044_0237938 | 3300049823 | Bacteria | 1765 |
| 604 | Ga0501044_1286194 | 3300049823 | Bacteria | 598 |
| 605 | nmdc:mga03n38_218115_c1 | 3300050490 | Bacteria | 994 |
| 606 | nmdc:mga06z11_1987_c1 | 3300050494 | Bacteria | 7736 |
| 607 | nmdc:mga07m45_192230_c1 | 3300050496 | Bacteria | 1187 |
| 608 | nmdc:mga06r32_1310712_c1 | 3300050510 | Bacteria | 668 |
| 609 | nmdc:mga08x19_353497_c1 | 3300050514 | Bacteria | 1026 |
| 610 | nmdc:mga08x19_935557_c1 | 3300050514 | Bacteria | 616 |
| 611 | nmdc:mga0a205_542486_c1 | 3300050515 | Bacteria | 1018 |
| 612 | Ga0495655_0196384 | 3300053083 | Bacteria | 658 |
| 613 | Ga0495595_0085330 | 3300053084 | Bacteria | 1509 |
| 614 | Ga0495595_0119330 | 3300053084 | Bacteria | 1284 |
| 615 | Ga0495619_0015501 | 3300053085 | Bacteria | 4822 |
| 616 | Ga0495619_0184798 | 3300053085 | Bacteria | 1442 |
| 617 | Ga0500578_0746835 | 3300053086 | Bacteria | 522 |
| 618 | Ga0500644_0028242 | 3300053088 | Bacteria | 1753 |
| 619 | Ga0500640_015759 | 3300053095 | Bacteria | 3174 |
| 620 | Ga0500660_155744 | 3300053100 | Bacteria | 876 |
| 621 | Ga0500660_208455 | 3300053100 | Bacteria | 661 |
| 622 | Ga0500553_180986 | 3300053101 | Bacteria | 756 |
| 623 | Ga0500553_227331 | 3300053101 | Bacteria | 599 |
| 624 | Ga0500560_001736 | 3300053107 | Bacteria | 3912 |
| 625 | Ga0500560_152651 | 3300053107 | Bacteria | 766 |
| 626 | Ga0500572_013583 | 3300053111 | Bacteria | 2018 |
| 627 | Ga0500608_137041 | 3300053122 | Bacteria | 1090 |
| 628 | Ga0500614_135620 | 3300053123 | Bacteria | 733 |
| 629 | Ga0500642_0364987 | 3300053130 | Bacteria | 638 |
| 630 | Ga0500655_112385 | 3300053133 | Bacteria | 575 |
| 631 | Ga0500658_0394177 | 3300053134 | Bacteria | 634 |
| 632 | Ga0500559_0294829 | 3300053136 | Bacteria | 762 |
| 633 | Ga0500573_0199793 | 3300053140 | Bacteria | 1062 |
| 634 | Ga0500573_0352528 | 3300053140 | Bacteria | 714 |
| 635 | Ga0500586_176739 | 3300053145 | Bacteria | 715 |
| 636 | Ga0500600_0037488 | 3300053149 | Bacteria | 2810 |
| 637 | Ga0500624_013244 | 3300053157 | Bacteria | 1231 |
| 638 | Ga0500634_0148320 | 3300053161 | Bacteria | 1100 |
| 639 | Ga0500636_0150474 | 3300053177 | Bacteria | 1279 |
| 640 | Ga0500599_020103 | 3300053736 | Bacteria | 943 |
| 641 | Ga0587084_020241 | 3300059477 | Bacteria | 988 |
| 642 | Ga0587066_046314 | 3300059490 | Bacteria | 839 |
| 643 | Ga0587073_0109166 | 3300059492 | Bacteria | 730 |
| 644 | Ga0587082_032635 | 3300059504 | Bacteria | 916 |
| 645 | Ga0587083_0228452 | 3300059505 | Bacteria | 545 |
| 646 | Ga0587085_040716 | 3300059506 | Bacteria | 808 |
| 647 | Ga0587088_196680 | 3300059508 | Bacteria | 513 |
| 648 | Ga0587089_107393 | 3300059509 | Bacteria | 512 |
| 649 | Ga0587092_045216 | 3300059512 | Bacteria | 780 |
| 650 | Ga0587092_105560 | 3300059512 | Bacteria | 586 |
| 651 | Ga0587106_069618 | 3300059605 | Bacteria | 664 |
| 652 | Ga0587106_143660 | 3300059605 | Bacteria | 525 |
| 653 | Ga0587106_156557 | 3300059605 | Bacteria | 511 |
| 654 | Ga0587109_094313 | 3300059624 | Bacteria | 679 |
| 655 | Ga0587122_018406 | 3300059628 | Bacteria | 739 |
| 656 | Ga0587122_050572 | 3300059628 | Bacteria | 538 |
| 657 | Ga0587062_102097 | 3300059639 | Bacteria | 560 |
| 658 | Ga0587067_175027 | 3300059640 | Bacteria | 555 |
| 659 | Ga0587072_033100 | 3300059643 | Bacteria | 974 |
| 660 | Ga0587100_029492 | 3300059648 | Bacteria | 576 |
| 661 | Ga0587105_026240 | 3300059651 | Bacteria | 536 |
| 662 | Ga0587107_151481 | 3300059652 | Bacteria | 504 |
| 663 | Ga0587114_030091 | 3300059655 | Bacteria | 825 |
| 664 | Ga0587120_030803 | 3300059659 | Bacteria | 547 |
| 665 | Ga0587071_033775 | 3300060344 | Bacteria | 997 |
| 666 | Ga0587111_0039359 | 3300060346 | Bacteria | 1002 |
| 667 | Ga0466962_0004079 | 3300061719 | Bacteria | 6994 |
| 668 | Ga0466962_0038489 | 3300061719 | Bacteria | 2290 |
| 669 | Ga0466962_0040152 | 3300061719 | Bacteria | 2241 |
| 670 | Ga0466962_0082227 | 3300061719 | Bacteria | 1540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003316 | rootH1_10080830 | rootH1_100808302 | 118 |
| 2 | 3300003320 | rootH2_10040067 | rootH2_1004006710 | 118 |
| 3 | 3300003323 | rootH1_10017685 | rootH1_100176853 | 119 |
| 4 | iso_pu_bacteria | 2862382967 | 2862388622 | 120 |
| 5 | 3300044842 | Ga0466957_0996579 | Ga0466957_0996579_183_587 | 121 |
| 6 | 3300046516 | Ga0495628_0046823 | Ga0495628_0046823_15_383 | 121 |
| 7 | 3300046517 | Ga0495630_0568209 | Ga0495630_0568209_484_852 | 121 |
| 8 | 3300046543 | Ga0495645_0482447 | Ga0495645_0482447_360_728 | 121 |
| 9 | 3300050514 | nmdc:mga08x19_935557_c1 | nmdc:mga08x19_935557_c1_57_425 | 121 |
| 10 | iso_pu_bacteria | 2918501144 | 2918506327 | 121 |
| 11 | 3300006175 | Ga0070712_101336267 | Ga0070712_1013362672 | 122 |
| 12 | 3300006844 | Ga0075428_101693119 | Ga0075428_1016931192 | 122 |
| 13 | 3300025915 | Ga0207693_10918745 | Ga0207693_109187451 | 122 |
| 14 | 3300035116 | Ga0373945_0166859 | Ga0373945_0166859_167_550 | 122 |
| 15 | 3300037068 | Ga0373925_0443148 | Ga0373925_0443148_517_900 | 122 |
| 16 | 3300046511 | Ga0495608_0838235 | Ga0495608_0838235_153_527 | 122 |
| 17 | 3300047315 | Ga0495581_0248433 | Ga0495581_0248433_54_437 | 122 |
| 18 | 3300047319 | Ga0495674_0616145 | Ga0495674_0616145_105_488 | 122 |
| 19 | 3300048907 | Ga0496104_0555074 | Ga0496104_0555074_231_623 | 122 |
| 20 | 3300048908 | Ga0496105_0522338 | Ga0496105_0522338_487_879 | 122 |
| 21 | 3300050510 | nmdc:mga06r32_1310712_c1 | nmdc:mga06r32_1310712_c1_84_473 | 122 |
| 22 | 3300053084 | Ga0495595_0119330 | Ga0495595_0119330_157_540 | 122 |
| 23 | iso_pu_bacteria | 2643221587 | 2643945505 | 122 |
| 24 | iso_pu_bacteria | 2643221670 | 2644386743 | 122 |
| 25 | iso_pu_bacteria | 2643221677 | 2644431168 | 122 |
| 26 | 3300005535 | Ga0070684_100174499 | Ga0070684_1001744994 | 124 |
| 27 | 3300005544 | Ga0070686_101224166 | Ga0070686_1012241662 | 124 |
| 28 | 3300005618 | Ga0068864_101707311 | Ga0068864_1017073111 | 124 |
| 29 | 3300005718 | Ga0068866_10079829 | Ga0068866_100798293 | 124 |
| 30 | 3300006881 | Ga0068865_101039796 | Ga0068865_1010397962 | 124 |
| 31 | 3300009098 | Ga0105245_10134622 | Ga0105245_101346223 | 124 |
| 32 | 3300009553 | Ga0105249_10650002 | Ga0105249_106500021 | 124 |
| 33 | 3300011119 | Ga0105246_10667927 | Ga0105246_106679272 | 124 |
| 34 | 3300013308 | Ga0157375_10085836 | Ga0157375_100858361 | 124 |
| 35 | 3300015688 | Ga0183367_1002 | Ga0183367_1002212 | 124 |
| 36 | 3300042128 | Ga0450897_009761 | Ga0450897_009761_487_903 | 124 |
| 37 | 3300042136 | Ga0450900_004670 | Ga0450900_004670_931_1305 | 124 |
| 38 | 3300049530 | Ga0501314_043024 | Ga0501314_043024_16_390 | 124 |
| 39 | iso_pu_bacteria | 2862290372 | 2862295220 | 124 |
| 40 | iso_pu_bacteria | 8025478263 | 8025482528 | 124 |
| 41 | 3300045976 | Ga0466967_2224499 | Ga0466967_2224499_131_532 | 125 |
| 42 | iso_pu_bacteria | 2643221578 | 2643902429 | 125 |
| 43 | iso_pu_bacteria | 2643221673 | 2644404000 | 125 |
| 44 | iso_pu_bacteria | 2862178590 | 2862179128 | 125 |
| 45 | iso_pu_bacteria | 2946045630 | 2946048028 | 125 |
| 46 | 3300047318 | Ga0495636_0049775 | Ga0495636_0049775_925_1314 | 126 |
| 47 | iso_pu_bacteria | 2547132111 | 2547408540 | 126 |
| 48 | iso_pu_bacteria | 2554235005 | 2554256365 | 126 |
| 49 | iso_pu_bacteria | 2582581312 | 2585296441 | 126 |
| 50 | iso_pu_bacteria | 2582581313 | 2585306964 | 126 |
| 51 | iso_pu_bacteria | 2582581314 | 2585318639 | 126 |
| 52 | iso_pu_bacteria | 2616644814 | 2616697140 | 126 |
| 53 | iso_pu_bacteria | 2616644941 | 2616900069 | 126 |
| 54 | iso_pu_bacteria | 2643221548 | 2643763847 | 126 |
| 55 | iso_pu_bacteria | 2643221647 | 2644265971 | 126 |
| 56 | iso_pu_bacteria | 2643221678 | 2644439869 | 126 |
| 57 | iso_pu_bacteria | 2643221682 | 2644461719 | 126 |
| 58 | iso_pu_bacteria | 2643221714 | 2644632800 | 126 |
| 59 | iso_pu_bacteria | 2784746763 | 2785341366 | 126 |
| 60 | iso_pu_bacteria | 2784746768 | 2785371318 | 126 |
| 61 | iso_pu_bacteria | 2786546132 | 2786672505 | 126 |
| 62 | iso_pu_bacteria | 2808606359 | 2808843877 | 126 |
| 63 | iso_pu_bacteria | 2808606375 | 2808913417 | 126 |
| 64 | iso_pu_bacteria | 2808606982 | 2811844588 | 126 |
| 65 | iso_pu_bacteria | 2811994879 | 2812356165 | 126 |
| 66 | iso_pu_bacteria | 2811994917 | 2812478918 | 126 |
| 67 | iso_pu_bacteria | 2818991463 | 2819694771 | 126 |
| 68 | iso_pu_bacteria | 2862281513 | 2862284925 | 126 |
| 69 | iso_pu_bacteria | 2862574272 | 2862577682 | 126 |
| 70 | iso_pu_bacteria | 2863404153 | 2863408443 | 126 |
| 71 | iso_pu_bacteria | 2867428634 | 2867434539 | 126 |
| 72 | iso_pu_bacteria | 2873151551 | 2873154206 | 126 |
| 73 | iso_pu_bacteria | 2875391855 | 2875396526 | 126 |
| 74 | iso_pu_bacteria | 2877676314 | 2877679287 | 126 |
| 75 | iso_pu_bacteria | 2912715099 | 2912717884 | 126 |
| 76 | iso_pu_bacteria | 2912757875 | 2912762591 | 126 |
| 77 | iso_pu_bacteria | 2919468124 | 2919471557 | 126 |
| 78 | iso_pu_bacteria | 2946064051 | 2946069691 | 126 |
| 79 | iso_pu_bacteria | 2946072368 | 2946077583 | 126 |
| 80 | iso_pu_bacteria | 2947224130 | 2947227118 | 126 |
| 81 | iso_pu_bacteria | 2954002825 | 2954005292 | 126 |
| 82 | iso_pu_bacteria | 2954380949 | 2954384172 | 126 |
| 83 | iso_pu_bacteria | 2954673503 | 2954678777 | 126 |
| 84 | iso_pu_bacteria | 2954682443 | 2954685376 | 126 |
| 85 | iso_pu_bacteria | 2954691527 | 2954694994 | 126 |
| 86 | iso_pu_bacteria | 2954701450 | 2954710168 | 126 |
| 87 | iso_pu_bacteria | 2954711539 | 2954714487 | 126 |
| 88 | iso_pu_bacteria | 2954721474 | 2954724433 | 126 |
| 89 | iso_pu_bacteria | 2954731030 | 2954737385 | 126 |
| 90 | iso_pu_bacteria | 2954740390 | 2954743355 | 126 |
| 91 | iso_pu_bacteria | 2954749733 | 2954756238 | 126 |
| 92 | iso_pu_bacteria | 2954759201 | 2954762312 | 126 |
| 93 | iso_pu_bacteria | 2966598605 | 2966601006 | 126 |
| 94 | iso_pu_bacteria | 3006393351 | 3006397090 | 126 |
| 95 | iso_pu_bacteria | 3006425503 | 3006430039 | 126 |
| 96 | iso_pu_bacteria | 3006486233 | 3006489033 | 126 |
| 97 | iso_pu_bacteria | 3006493962 | 3006498094 | 126 |
| 98 | iso_pu_bacteria | 8008558824 | 8008562613 | 126 |
| 99 | iso_pu_bacteria | 8025530807 | 8025537062 | 126 |
| 100 | iso_pu_bacteria | 8033684223 | 8033686867 | 126 |
| 101 | iso_pu_bacteria | 8048406513 | 8048406624 | 126 |
| 102 | iso_pu_bacteria | 8056667051 | 8056671489 | 126 |
| 103 | iso_pu_bacteria | 8056829672 | 8056831990 | 126 |
| 104 | 3300005337 | Ga0070682_100046806 | Ga0070682_1000468063 | 127 |
| 105 | 3300005338 | Ga0068868_100005573 | Ga0068868_1000055736 | 127 |
| 106 | 3300005341 | Ga0070691_10076958 | Ga0070691_100769582 | 127 |
| 107 | 3300005366 | Ga0070659_101902934 | Ga0070659_1019029341 | 127 |
| 108 | 3300005434 | Ga0070709_10892199 | Ga0070709_108921991 | 127 |
| 109 | 3300005435 | Ga0070714_100461616 | Ga0070714_1004616162 | 127 |
| 110 | 3300005436 | Ga0070713_101037832 | Ga0070713_1010378322 | 127 |
| 111 | 3300005439 | Ga0070711_100036179 | Ga0070711_1000361793 | 127 |
| 112 | 3300005440 | Ga0070705_100474532 | Ga0070705_1004745322 | 127 |
| 113 | 3300005445 | Ga0070708_100469459 | Ga0070708_1004694592 | 127 |
| 114 | 3300005458 | Ga0070681_10091417 | Ga0070681_100914173 | 127 |
| 115 | 3300005468 | Ga0070707_100062789 | Ga0070707_1000627893 | 127 |
| 116 | 3300005544 | Ga0070686_100555896 | Ga0070686_1005558961 | 127 |
| 117 | 3300005548 | Ga0070665_100167946 | Ga0070665_1001679463 | 127 |
| 118 | 3300005549 | Ga0070704_100171955 | Ga0070704_1001719551 | 127 |
| 119 | 3300005563 | Ga0068855_100213914 | Ga0068855_1002139143 | 127 |
| 120 | 3300005577 | Ga0068857_100522691 | Ga0068857_1005226912 | 127 |
| 121 | 3300005614 | Ga0068856_100057484 | Ga0068856_1000574843 | 127 |
| 122 | 3300005614 | Ga0068856_100126077 | Ga0068856_1001260773 | 127 |
| 123 | 3300005618 | Ga0068864_100058542 | Ga0068864_1000585423 | 127 |
| 124 | 3300005841 | Ga0068863_101470662 | Ga0068863_1014706621 | 127 |
| 125 | 3300005842 | Ga0068858_100142698 | Ga0068858_1001426982 | 127 |
| 126 | 3300005843 | Ga0068860_100156734 | Ga0068860_1001567341 | 127 |
| 127 | 3300006173 | Ga0070716_100073556 | Ga0070716_1000735561 | 127 |
| 128 | 3300006175 | Ga0070712_100758843 | Ga0070712_1007588432 | 127 |
| 129 | 3300006175 | Ga0070712_100821183 | Ga0070712_1008211832 | 127 |
| 130 | 3300006175 | Ga0070712_100825366 | Ga0070712_1008253662 | 127 |
| 131 | 3300006852 | Ga0075433_10675322 | Ga0075433_106753221 | 127 |
| 132 | 3300007076 | Ga0075435_100070671 | Ga0075435_1000706713 | 127 |
| 133 | 3300009098 | Ga0105245_10098489 | Ga0105245_100984892 | 127 |
| 134 | 3300009174 | Ga0105241_10615957 | Ga0105241_106159571 | 127 |
| 135 | 3300009177 | Ga0105248_10365069 | Ga0105248_103650692 | 127 |
| 136 | 3300009545 | Ga0105237_10191741 | Ga0105237_101917413 | 127 |
| 137 | 3300009551 | Ga0105238_10118711 | Ga0105238_101187111 | 127 |
| 138 | 3300010375 | Ga0105239_10082718 | Ga0105239_100827182 | 127 |
| 139 | 3300013104 | Ga0157370_10144068 | Ga0157370_101440681 | 127 |
| 140 | 3300013105 | Ga0157369_10592981 | Ga0157369_105929811 | 127 |
| 141 | 3300013296 | Ga0157374_10070724 | Ga0157374_100707242 | 127 |
| 142 | 3300013297 | Ga0157378_10717988 | Ga0157378_107179882 | 127 |
| 143 | 3300013306 | Ga0163162_10031791 | Ga0163162_100317913 | 127 |
| 144 | 3300013308 | Ga0157375_10176735 | Ga0157375_101767352 | 127 |
| 145 | 3300014325 | Ga0163163_10006307 | Ga0163163_100063076 | 127 |
| 146 | 3300014968 | Ga0157379_10028186 | Ga0157379_100281864 | 127 |
| 147 | 3300014969 | Ga0157376_10097190 | Ga0157376_100971903 | 127 |
| 148 | 3300020070 | Ga0206356_10995431 | Ga0206356_109954311 | 127 |
| 149 | 3300020081 | Ga0206354_10196881 | Ga0206354_101968811 | 127 |
| 150 | 3300025905 | Ga0207685_10234473 | Ga0207685_102344732 | 127 |
| 151 | 3300025911 | Ga0207654_10578735 | Ga0207654_105787352 | 127 |
| 152 | 3300025912 | Ga0207707_11159889 | Ga0207707_111598891 | 127 |
| 153 | 3300025914 | Ga0207671_10281426 | Ga0207671_102814261 | 127 |
| 154 | 3300025916 | Ga0207663_10637261 | Ga0207663_106372612 | 127 |
| 155 | 3300025916 | Ga0207663_11216645 | Ga0207663_112166451 | 127 |
| 156 | 3300025921 | Ga0207652_11647249 | Ga0207652_116472491 | 127 |
| 157 | 3300025922 | Ga0207646_10580955 | Ga0207646_105809551 | 127 |
| 158 | 3300025924 | Ga0207694_10104344 | Ga0207694_101043442 | 127 |
| 159 | 3300025927 | Ga0207687_10059664 | Ga0207687_100596642 | 127 |
| 160 | 3300025929 | Ga0207664_10608710 | Ga0207664_106087101 | 127 |
| 161 | 3300025939 | Ga0207665_10036601 | Ga0207665_100366013 | 127 |
| 162 | 3300025941 | Ga0207711_10296652 | Ga0207711_102966522 | 127 |
| 163 | 3300025944 | Ga0207661_11886983 | Ga0207661_118869831 | 127 |
| 164 | 3300025949 | Ga0207667_10499254 | Ga0207667_104992542 | 127 |
| 165 | 3300026023 | Ga0207677_10006535 | Ga0207677_100065355 | 127 |
| 166 | 3300026078 | Ga0207702_11461414 | Ga0207702_114614141 | 127 |
| 167 | 3300026078 | Ga0207702_12164519 | Ga0207702_121645191 | 127 |
| 168 | 3300026095 | Ga0207676_10026782 | Ga0207676_100267822 | 127 |
| 169 | 3300028379 | Ga0268266_10439512 | Ga0268266_104395122 | 127 |
| 170 | 3300028381 | Ga0268264_10817089 | Ga0268264_108170892 | 127 |
| 171 | 3300031649 | Ga0307514_10126484 | Ga0307514_101264841 | 127 |
| 172 | 3300031730 | Ga0307516_10516121 | Ga0307516_105161212 | 127 |
| 173 | 3300035086 | Ga0373934_0294083 | Ga0373934_0294083_102_536 | 127 |
| 174 | 3300035116 | Ga0373945_0098141 | Ga0373945_0098141_332_766 | 127 |
| 175 | 3300035118 | Ga0373954_0056855 | Ga0373954_0056855_270_704 | 127 |
| 176 | 3300035119 | Ga0373956_0192362 | Ga0373956_0192362_443_877 | 127 |
| 177 | 3300035170 | Ga0373943_0164675 | Ga0373943_0164675_332_766 | 127 |
| 178 | 3300035171 | Ga0373946_0433400 | Ga0373946_0433400_55_489 | 127 |
| 179 | 3300035691 | Ga0373931_0769697 | Ga0373931_0769697_166_600 | 127 |
| 180 | 3300036401 | Ga0373937_0039588 | Ga0373937_0039588_2819_3253 | 127 |
| 181 | 3300038443 | Ga0395901_0244404 | Ga0395901_0244404_515_916 | 127 |
| 182 | 3300044683 | Ga0466965_0361990 | Ga0466965_0361990_303_731 | 127 |
| 183 | 3300044693 | Ga0466961_0724040 | Ga0466961_0724040_149_574 | 127 |
| 184 | 3300044694 | Ga0466963_0031993 | Ga0466963_0031993_2017_2439 | 127 |
| 185 | 3300044694 | Ga0466963_0072827 | Ga0466963_0072827_16_438 | 127 |
| 186 | 3300044694 | Ga0466963_0168700 | Ga0466963_0168700_954_1376 | 127 |
| 187 | 3300044694 | Ga0466963_0686842 | Ga0466963_0686842_199_621 | 127 |
| 188 | 3300044706 | Ga0466964_0102966 | Ga0466964_0102966_133_555 | 127 |
| 189 | 3300044719 | Ga0466971_0038665 | Ga0466971_0038665_1487_1909 | 127 |
| 190 | 3300044719 | Ga0466971_0647823 | Ga0466971_0647823_73_495 | 127 |
| 191 | 3300044842 | Ga0466957_0221160 | Ga0466957_0221160_179_601 | 127 |
| 192 | 3300044901 | Ga0466960_0507779 | Ga0466960_0507779_76_468 | 127 |
| 193 | 3300045049 | Ga0466959_0922397 | Ga0466959_0922397_59_481 | 127 |
| 194 | 3300045836 | Ga0466958_0132417 | Ga0466958_0132417_92_514 | 127 |
| 195 | 3300045976 | Ga0466967_0108297 | Ga0466967_0108297_44_466 | 127 |
| 196 | 3300045976 | Ga0466967_0143729 | Ga0466967_0143729_1751_2158 | 127 |
| 197 | 3300045976 | Ga0466967_0174885 | Ga0466967_0174885_1193_1633 | 127 |
| 198 | 3300045976 | Ga0466967_0307766 | Ga0466967_0307766_358_780 | 127 |
| 199 | 3300045976 | Ga0466967_0440992 | Ga0466967_0440992_492_914 | 127 |
| 200 | 3300045976 | Ga0466967_0524071 | Ga0466967_0524071_705_1139 | 127 |
| 201 | 3300045976 | Ga0466967_2195384 | Ga0466967_2195384_15_437 | 127 |
| 202 | 3300046454 | Ga0495592_0047991 | Ga0495592_0047991_1056_1490 | 127 |
| 203 | 3300046455 | Ga0495603_0274076 | Ga0495603_0274076_349_783 | 127 |
| 204 | 3300046459 | Ga0495629_0089361 | Ga0495629_0089361_1573_2007 | 127 |
| 205 | 3300046462 | Ga0495651_0079211 | Ga0495651_0079211_1738_2172 | 127 |
| 206 | 3300046463 | Ga0495653_0090901 | Ga0495653_0090901_1548_1982 | 127 |
| 207 | 3300046463 | Ga0495653_0641302 | Ga0495653_0641302_48_482 | 127 |
| 208 | 3300046475 | Ga0495639_0075647 | Ga0495639_0075647_1028_1462 | 127 |
| 209 | 3300046476 | Ga0495662_0181113 | Ga0495662_0181113_208_642 | 127 |
| 210 | 3300046477 | Ga0495664_0007790 | Ga0495664_0007790_136_570 | 127 |
| 211 | 3300046477 | Ga0495664_0085909 | Ga0495664_0085909_22_408 | 127 |
| 212 | 3300046511 | Ga0495608_0344690 | Ga0495608_0344690_171_605 | 127 |
| 213 | 3300046514 | Ga0495618_0062044 | Ga0495618_0062044_1860_2294 | 127 |
| 214 | 3300046516 | Ga0495628_0443471 | Ga0495628_0443471_198_632 | 127 |
| 215 | 3300046517 | Ga0495630_0162453 | Ga0495630_0162453_290_724 | 127 |
| 216 | 3300046529 | Ga0495652_0182024 | Ga0495652_0182024_218_652 | 127 |
| 217 | 3300046533 | Ga0495640_0010846 | Ga0495640_0010846_1241_1675 | 127 |
| 218 | 3300046535 | Ga0495586_0289667 | Ga0495586_0289667_344_778 | 127 |
| 219 | 3300046536 | Ga0495587_0001011 | Ga0495587_0001011_2789_3223 | 127 |
| 220 | 3300046543 | Ga0495645_0049580 | Ga0495645_0049580_2172_2606 | 127 |
| 221 | 3300046559 | Ga0495667_0296114 | Ga0495667_0296114_27_413 | 127 |
| 222 | 3300046559 | Ga0495667_0988724 | Ga0495667_0988724_27_413 | 127 |
| 223 | 3300046642 | Ga0495634_0017386 | Ga0495634_0017386_3933_4367 | 127 |
| 224 | 3300046663 | Ga0495635_0098181 | Ga0495635_0098181_1357_1791 | 127 |
| 225 | 3300046675 | Ga0495657_0030679 | Ga0495657_0030679_3053_3487 | 127 |
| 226 | 3300046678 | Ga0495599_0005311 | Ga0495599_0005311_83_517 | 127 |
| 227 | 3300046809 | Ga0495600_0051201 | Ga0495600_0051201_2150_2584 | 127 |
| 228 | 3300047317 | Ga0495604_0603621 | Ga0495604_0603621_22_456 | 127 |
| 229 | 3300047319 | Ga0495674_0194508 | Ga0495674_0194508_27_413 | 127 |
| 230 | 3300047319 | Ga0495674_1043863 | Ga0495674_1043863_212_598 | 127 |
| 231 | 3300047321 | Ga0495676_0201737 | Ga0495676_0201737_467_901 | 127 |
| 232 | 3300047322 | Ga0495680_0010669 | Ga0495680_0010669_3791_4225 | 127 |
| 233 | 3300047322 | Ga0495680_0417508 | Ga0495680_0417508_177_611 | 127 |
| 234 | 3300047444 | Ga0495675_0228593 | Ga0495675_0228593_18_452 | 127 |
| 235 | 3300047471 | Ga0495684_0000710 | Ga0495684_0000710_26012_26446 | 127 |
| 236 | 3300047673 | Ga0495593_0651560 | Ga0495593_0651560_21_455 | 127 |
| 237 | 3300048088 | Ga0495602_0018574 | Ga0495602_0018574_672_1106 | 127 |
| 238 | 3300048908 | Ga0496105_0038560 | Ga0496105_0038560_497_883 | 127 |
| 239 | 3300048909 | Ga0496106_0214524 | Ga0496106_0214524_144_578 | 127 |
| 240 | 3300048910 | Ga0496107_0883835 | Ga0496107_0883835_68_502 | 127 |
| 241 | 3300048911 | Ga0496108_0009740 | Ga0496108_0009740_5370_5804 | 127 |
| 242 | 3300048913 | Ga0496110_0010424 | Ga0496110_0010424_3426_3860 | 127 |
| 243 | 3300048915 | Ga0496112_0043029 | Ga0496112_0043029_3269_3691 | 127 |
| 244 | 3300048915 | Ga0496112_0208625 | Ga0496112_0208625_186_620 | 127 |
| 245 | 3300048916 | Ga0496113_0010985 | Ga0496113_0010985_2559_2993 | 127 |
| 246 | 3300048917 | Ga0496114_0430438 | Ga0496114_0430438_568_1002 | 127 |
| 247 | 3300050514 | nmdc:mga08x19_353497_c1 | nmdc:mga08x19_353497_c1_399_833 | 127 |
| 248 | 3300050515 | nmdc:mga0a205_542486_c1 | nmdc:mga0a205_542486_c1_573_1007 | 127 |
| 249 | 3300053084 | Ga0495595_0085330 | Ga0495595_0085330_194_628 | 127 |
| 250 | 3300053085 | Ga0495619_0015501 | Ga0495619_0015501_1138_1572 | 127 |
| 251 | 3300061719 | Ga0466962_0082227 | Ga0466962_0082227_1014_1436 | 127 |
| 252 | iso_pu_bacteria | 2935390628 | 2935394519 | 127 |
| 253 | iso_pu_bacteria | 2990088156 | 2990092149 | 127 |
| 254 | iso_pu_bacteria | 8047893842 | 8047896303 | 127 |
| 255 | iso_pu_bacteria | 8048127548 | 8048128083 | 127 |
| 256 | iso_pu_bacteria | 8048356638 | 8048362633 | 127 |
| 257 | iso_pu_bacteria | 8048369669 | 8048373312 | 127 |
| 258 | iso_pu_bacteria | 8048379754 | 8048384930 | 127 |
| 259 | 3300004799 | Ga0058863_11226352 | Ga0058863_112263521 | 128 |
| 260 | 3300005466 | Ga0070685_10052437 | Ga0070685_100524372 | 128 |
| 261 | 3300005539 | Ga0068853_100093609 | Ga0068853_1000936094 | 128 |
| 262 | 3300005578 | Ga0068854_102144232 | Ga0068854_1021442321 | 128 |
| 263 | 3300009551 | Ga0105238_10522624 | Ga0105238_105226241 | 128 |
| 264 | 3300046455 | Ga0495603_0442957 | Ga0495603_0442957_327_719 | 128 |
| 265 | 3300046459 | Ga0495629_0110270 | Ga0495629_0110270_217_609 | 128 |
| 266 | 3300046462 | Ga0495651_0177354 | Ga0495651_0177354_64_456 | 128 |
| 267 | 3300046476 | Ga0495662_0559855 | Ga0495662_0559855_131_523 | 128 |
| 268 | 3300046477 | Ga0495664_0037883 | Ga0495664_0037883_1881_2273 | 128 |
| 269 | 3300046492 | Ga0495585_0007795 | Ga0495585_0007795_945_1337 | 128 |
| 270 | 3300046516 | Ga0495628_0080884 | Ga0495628_0080884_913_1305 | 128 |
| 271 | 3300046529 | Ga0495652_0139100 | Ga0495652_0139100_1396_1788 | 128 |
| 272 | 3300046533 | Ga0495640_0035770 | Ga0495640_0035770_500_892 | 128 |
| 273 | 3300046557 | Ga0495622_0101327 | Ga0495622_0101327_408_800 | 128 |
| 274 | 3300046557 | Ga0495622_0192528 | Ga0495622_0192528_491_886 | 128 |
| 275 | 3300046559 | Ga0495667_0195928 | Ga0495667_0195928_641_1033 | 128 |
| 276 | 3300046642 | Ga0495634_0586886 | Ga0495634_0586886_183_575 | 128 |
| 277 | 3300046663 | Ga0495635_0921331 | Ga0495635_0921331_68_475 | 128 |
| 278 | 3300046675 | Ga0495657_0020442 | Ga0495657_0020442_667_1059 | 128 |
| 279 | 3300046683 | Ga0495658_0116688 | Ga0495658_0116688_459_854 | 128 |
| 280 | 3300046689 | Ga0495613_0010395 | Ga0495613_0010395_1473_1865 | 128 |
| 281 | 3300046689 | Ga0495613_0179258 | Ga0495613_0179258_1034_1429 | 128 |
| 282 | 3300046689 | Ga0495613_0530936 | Ga0495613_0530936_42_449 | 128 |
| 283 | 3300046690 | Ga0495624_0014389 | Ga0495624_0014389_458_850 | 128 |
| 284 | 3300046690 | Ga0495624_0110705 | Ga0495624_0110705_42_434 | 128 |
| 285 | 3300046694 | Ga0495649_0080389 | Ga0495649_0080389_323_715 | 128 |
| 286 | 3300047315 | Ga0495581_0065540 | Ga0495581_0065540_1120_1512 | 128 |
| 287 | 3300047315 | Ga0495581_0503292 | Ga0495581_0503292_214_606 | 128 |
| 288 | 3300047317 | Ga0495604_0022719 | Ga0495604_0022719_63_455 | 128 |
| 289 | 3300047317 | Ga0495604_0056268 | Ga0495604_0056268_1851_2243 | 128 |
| 290 | 3300047321 | Ga0495676_0012902 | Ga0495676_0012902_177_569 | 128 |
| 291 | 3300047443 | Ga0495687_171719 | Ga0495687_171719_156_548 | 128 |
| 292 | 3300047444 | Ga0495675_0160163 | Ga0495675_0160163_128_520 | 128 |
| 293 | 3300049568 | Ga0501031_0174821 | Ga0501031_0174821_211_603 | 128 |
| 294 | 3300049569 | Ga0501032_0041778 | Ga0501032_0041778_769_1158 | 128 |
| 295 | 3300049569 | Ga0501032_0161676 | Ga0501032_0161676_248_640 | 128 |
| 296 | 3300049570 | Ga0501033_0053149 | Ga0501033_0053149_1079_1468 | 128 |
| 297 | 3300049570 | Ga0501033_0165927 | Ga0501033_0165927_512_904 | 128 |
| 298 | 3300049571 | Ga0501034_0746442 | Ga0501034_0746442_215_604 | 128 |
| 299 | 3300049571 | Ga0501034_0785875 | Ga0501034_0785875_369_761 | 128 |
| 300 | 3300049572 | Ga0501036_0302546 | Ga0501036_0302546_352_741 | 128 |
| 301 | 3300049573 | Ga0501037_0194265 | Ga0501037_0194265_230_619 | 128 |
| 302 | 3300049573 | Ga0501037_0240410 | Ga0501037_0240410_163_555 | 128 |
| 303 | 3300049573 | Ga0501037_0268436 | Ga0501037_0268436_304_696 | 128 |
| 304 | 3300049575 | Ga0501039_0055212 | Ga0501039_0055212_1928_2317 | 128 |
| 305 | 3300049579 | Ga0501043_0031845 | Ga0501043_0031845_1132_1524 | 128 |
| 306 | 3300049579 | Ga0501043_0058599 | Ga0501043_0058599_2396_2788 | 128 |
| 307 | 3300049581 | Ga0501047_0009843 | Ga0501047_0009843_3000_3392 | 128 |
| 308 | 3300049581 | Ga0501047_0215681 | Ga0501047_0215681_1261_1653 | 128 |
| 309 | 3300049581 | Ga0501047_0297330 | Ga0501047_0297330_1030_1422 | 128 |
| 310 | 3300049586 | Ga0501070_0335980 | Ga0501070_0335980_224_613 | 128 |
| 311 | 3300049822 | Ga0501035_0026105 | Ga0501035_0026105_3899_4291 | 128 |
| 312 | 3300049822 | Ga0501035_0101021 | Ga0501035_0101021_1009_1398 | 128 |
| 313 | 3300049822 | Ga0501035_0129751 | Ga0501035_0129751_1030_1422 | 128 |
| 314 | 3300049822 | Ga0501035_0150580 | Ga0501035_0150580_1568_1960 | 128 |
| 315 | 3300049823 | Ga0501044_0166315 | Ga0501044_0166315_1030_1422 | 128 |
| 316 | 3300049823 | Ga0501044_0172461 | Ga0501044_0172461_597_989 | 128 |
| 317 | 3300049823 | Ga0501044_0237938 | Ga0501044_0237938_1009_1398 | 128 |
| 318 | 3300049823 | Ga0501044_1286194 | Ga0501044_1286194_54_440 | 128 |
| 319 | 3300053100 | Ga0500660_155744 | Ga0500660_155744_253_648 | 128 |
| 320 | 3300053101 | Ga0500553_180986 | Ga0500553_180986_299_694 | 128 |
| 321 | 3300053107 | Ga0500560_001736 | Ga0500560_001736_3409_3801 | 128 |
| 322 | 3300053140 | Ga0500573_0352528 | Ga0500573_0352528_226_618 | 128 |
| 323 | 3300059640 | Ga0587067_175027 | Ga0587067_175027_100_492 | 128 |
| 324 | iso_pu_bacteria | 2867369537 | 2867373705 | 128 |
| 325 | iso_pu_bacteria | 2867475112 | 2867477657 | 128 |
| 326 | 3300025302 | Ga0207426_1100418 | Ga0207426_11004182 | 129 |
| 327 | 3300031616 | Ga0307508_10006837 | Ga0307508_100068378 | 129 |
| 328 | 3300031730 | Ga0307516_10417422 | Ga0307516_104174222 | 129 |
| 329 | 3300032002 | Ga0307416_103424366 | Ga0307416_1034243661 | 129 |
| 330 | 3300001990 | JGI24737J22298_10021826 | JGI24737J22298_100218261 | 130 |
| 331 | 3300003316 | rootH1_10019195 | rootH1_100191955 | 130 |
| 332 | 3300003320 | rootH2_10217107 | rootH2_102171071 | 130 |
| 333 | 3300003323 | rootH1_10091162 | rootH1_100911622 | 130 |
| 334 | 3300003323 | rootH1_10178559 | rootH1_101785593 | 130 |
| 335 | 3300003354 | JGI25160J50197_1033513 | JGI25160J50197_10335132 | 130 |
| 336 | 3300003354 | JGI25160J50197_1035808 | JGI25160J50197_10358081 | 130 |
| 337 | 3300003354 | JGI25160J50197_1036056 | JGI25160J50197_10360561 | 130 |
| 338 | 3300003578 | Ga0006562J51391_1044019 | Ga0006562J51391_10440191 | 130 |
| 339 | 3300003578 | Ga0006562J51391_1130510 | Ga0006562J51391_11305103 | 130 |
| 340 | 3300003578 | Ga0006562J51391_1130511 | Ga0006562J51391_11305111 | 130 |
| 341 | 3300004803 | Ga0058862_12670130 | Ga0058862_126701301 | 130 |
| 342 | 3300005563 | Ga0068855_100132732 | Ga0068855_1001327324 | 130 |
| 343 | 3300005564 | Ga0070664_100377792 | Ga0070664_1003777922 | 130 |
| 344 | 3300005578 | Ga0068854_100412849 | Ga0068854_1004128491 | 130 |
| 345 | 3300005614 | Ga0068856_100484683 | Ga0068856_1004846833 | 130 |
| 346 | 3300005937 | Ga0081455_10195754 | Ga0081455_101957542 | 130 |
| 347 | 3300006048 | Ga0075363_100560356 | Ga0075363_1005603561 | 130 |
| 348 | 3300006178 | Ga0075367_10003746 | Ga0075367_100037466 | 130 |
| 349 | 3300006353 | Ga0075370_10076640 | Ga0075370_100766402 | 130 |
| 350 | 3300006358 | Ga0068871_102039528 | Ga0068871_1020395281 | 130 |
| 351 | 3300006948 | Ga0099826_10067827 | Ga0099826_100678273 | 130 |
| 352 | 3300009011 | Ga0105251_10060354 | Ga0105251_100603541 | 130 |
| 353 | 3300009036 | Ga0105244_10122288 | Ga0105244_101222882 | 130 |
| 354 | 3300009092 | Ga0105250_10059204 | Ga0105250_100592041 | 130 |
| 355 | 3300009098 | Ga0105245_10142376 | Ga0105245_101423762 | 130 |
| 356 | 3300009148 | Ga0105243_10646484 | Ga0105243_106464841 | 130 |
| 357 | 3300011119 | Ga0105246_10249858 | Ga0105246_102498583 | 130 |
| 358 | 3300011119 | Ga0105246_11748045 | Ga0105246_117480451 | 130 |
| 359 | 3300013105 | Ga0157369_10087579 | Ga0157369_100875794 | 130 |
| 360 | 3300013307 | Ga0157372_10137947 | Ga0157372_101379474 | 130 |
| 361 | 3300014497 | Ga0182008_10001423 | Ga0182008_1000142316 | 130 |
| 362 | 3300015262 | Ga0182007_10002422 | Ga0182007_100024228 | 130 |
| 363 | 3300020069 | Ga0197907_10381786 | Ga0197907_103817861 | 130 |
| 364 | 3300020070 | Ga0206356_11206245 | Ga0206356_112062452 | 130 |
| 365 | 3300020070 | Ga0206356_11219520 | Ga0206356_112195202 | 130 |
| 366 | 3300020076 | Ga0206355_1208892 | Ga0206355_12088922 | 130 |
| 367 | 3300020078 | Ga0206352_10401905 | Ga0206352_104019052 | 130 |
| 368 | 3300020078 | Ga0206352_11348545 | Ga0206352_113485451 | 130 |
| 369 | 3300020081 | Ga0206354_10216677 | Ga0206354_102166771 | 130 |
| 370 | 3300022467 | Ga0224712_10531268 | Ga0224712_105312681 | 130 |
| 371 | 3300025297 | Ga0209758_1013617 | Ga0209758_10136173 | 130 |
| 372 | 3300025302 | Ga0207426_1001513 | Ga0207426_100151310 | 130 |
| 373 | 3300025302 | Ga0207426_1003399 | Ga0207426_10033992 | 130 |
| 374 | 3300025302 | Ga0207426_1006696 | Ga0207426_10066966 | 130 |
| 375 | 3300025302 | Ga0207426_1025201 | Ga0207426_10252012 | 130 |
| 376 | 3300025904 | Ga0207647_10005240 | Ga0207647_100052407 | 130 |
| 377 | 3300025927 | Ga0207687_10060309 | Ga0207687_100603094 | 130 |
| 378 | 3300025935 | Ga0207709_10168473 | Ga0207709_101684732 | 130 |
| 379 | 3300025949 | Ga0207667_10408358 | Ga0207667_104083582 | 130 |
| 380 | 3300025981 | Ga0207640_10069392 | Ga0207640_100693924 | 130 |
| 381 | 3300026078 | Ga0207702_10116605 | Ga0207702_101166053 | 130 |
| 382 | 3300027312 | Ga0209371_1021986 | Ga0209371_10219862 | 130 |
| 383 | 3300027666 | Ga0209282_1100910 | Ga0209282_11009102 | 130 |
| 384 | 3300028786 | Ga0307517_10004597 | Ga0307517_1000459721 | 130 |
| 385 | 3300028794 | Ga0307515_10000699 | Ga0307515_100006998 | 130 |
| 386 | 3300028794 | Ga0307515_10088843 | Ga0307515_100888432 | 130 |
| 387 | 3300028794 | Ga0307515_10672081 | Ga0307515_106720811 | 130 |
| 388 | 3300030500 | Ga0268256_1018141 | Ga0268256_10181412 | 130 |
| 389 | 3300030521 | Ga0307511_10000438 | Ga0307511_1000043840 | 130 |
| 390 | 3300030521 | Ga0307511_10064014 | Ga0307511_100640142 | 130 |
| 391 | 3300030522 | Ga0307512_10004518 | Ga0307512_100045187 | 130 |
| 392 | 3300030522 | Ga0307512_10099826 | Ga0307512_100998262 | 130 |
| 393 | 3300031456 | Ga0307513_10009135 | Ga0307513_100091353 | 130 |
| 394 | 3300031456 | Ga0307513_10174813 | Ga0307513_101748132 | 130 |
| 395 | 3300031456 | Ga0307513_10974988 | Ga0307513_109749881 | 130 |
| 396 | 3300031507 | Ga0307509_10039154 | Ga0307509_100391545 | 130 |
| 397 | 3300031616 | Ga0307508_10006908 | Ga0307508_1000690813 | 130 |
| 398 | 3300031616 | Ga0307508_10007827 | Ga0307508_100078277 | 130 |
| 399 | 3300031616 | Ga0307508_10050424 | Ga0307508_100504242 | 130 |
| 400 | 3300031616 | Ga0307508_10190740 | Ga0307508_101907402 | 130 |
| 401 | 3300031649 | Ga0307514_10049324 | Ga0307514_100493245 | 130 |
| 402 | 3300031649 | Ga0307514_10050574 | Ga0307514_100505745 | 130 |
| 403 | 3300031649 | Ga0307514_10059521 | Ga0307514_100595212 | 130 |
| 404 | 3300031730 | Ga0307516_10002231 | Ga0307516_100022319 | 130 |
| 405 | 3300031730 | Ga0307516_10588871 | Ga0307516_105888711 | 130 |
| 406 | 3300031838 | Ga0307518_10063769 | Ga0307518_100637693 | 130 |
| 407 | 3300031838 | Ga0307518_10336111 | Ga0307518_103361111 | 130 |
| 408 | 3300031838 | Ga0307518_10621871 | Ga0307518_106218711 | 130 |
| 409 | 3300032002 | Ga0307416_100849287 | Ga0307416_1008492872 | 130 |
| 410 | 3300032002 | Ga0307416_101486896 | Ga0307416_1014868961 | 130 |
| 411 | 3300033179 | Ga0307507_10045296 | Ga0307507_100452963 | 130 |
| 412 | 3300033179 | Ga0307507_10079103 | Ga0307507_100791032 | 130 |
| 413 | 3300033179 | Ga0307507_10115847 | Ga0307507_101158473 | 130 |
| 414 | 3300033179 | Ga0307507_10539758 | Ga0307507_105397582 | 130 |
| 415 | 3300033180 | Ga0307510_10011458 | Ga0307510_100114585 | 130 |
| 416 | 3300033180 | Ga0307510_10023835 | Ga0307510_100238357 | 130 |
| 417 | 3300033180 | Ga0307510_10240025 | Ga0307510_102400252 | 130 |
| 418 | 3300037418 | Ga0395900_0193003 | Ga0395900_0193003_799_1194 | 130 |
| 419 | 3300037466 | Ga0395898_0003092 | Ga0395898_0003092_15786_16181 | 130 |
| 420 | 3300037466 | Ga0395898_0030289 | Ga0395898_0030289_1257_1649 | 130 |
| 421 | 3300038443 | Ga0395901_0074271 | Ga0395901_0074271_2354_2749 | 130 |
| 422 | 3300041404 | Ga0439436_0002729 | Ga0439436_0002729_2990_3382 | 130 |
| 423 | 3300041404 | Ga0439436_0003166 | Ga0439436_0003166_665_1057 | 130 |
| 424 | 3300041406 | Ga0439439_0007385 | Ga0439439_0007385_1865_2257 | 130 |
| 425 | 3300041443 | Ga0451789_0944422 | Ga0451789_0944422_228_620 | 130 |
| 426 | 3300041459 | Ga0451800_1114010 | Ga0451800_1114010_461_853 | 130 |
| 427 | 3300041486 | Ga0451807_1614476 | Ga0451807_1614476_153_551 | 130 |
| 428 | 3300041486 | Ga0451807_1804336 | Ga0451807_1804336_83_475 | 130 |
| 429 | 3300041494 | Ga0451837_0010181 | Ga0451837_0010181_318_710 | 130 |
| 430 | 3300041498 | Ga0451841_1407059 | Ga0451841_1407059_94_486 | 130 |
| 431 | 3300041501 | Ga0451845_0506071 | Ga0451845_0506071_67_459 | 130 |
| 432 | 3300041503 | Ga0451847_0278125 | Ga0451847_0278125_94_486 | 130 |
| 433 | 3300041509 | Ga0451843_1617188 | Ga0451843_1617188_255_647 | 130 |
| 434 | 3300041512 | Ga0451853_0301595 | Ga0451853_0301595_1135_1527 | 130 |
| 435 | 3300041512 | Ga0451853_0393940 | Ga0451853_0393940_729_1121 | 130 |
| 436 | 3300041512 | Ga0451853_1059851 | Ga0451853_1059851_609_1001 | 130 |
| 437 | 3300041512 | Ga0451853_2009427 | Ga0451853_2009427_896_1294 | 130 |
| 438 | 3300041997 | Ga0439431_0066081 | Ga0439431_0066081_70_465 | 130 |
| 439 | 3300041999 | Ga0439433_0012142 | Ga0439433_0012142_1183_1575 | 130 |
| 440 | 3300042002 | Ga0439442_001532 | Ga0439442_001532_3210_3611 | 130 |
| 441 | 3300042002 | Ga0439442_003644 | Ga0439442_003644_636_1028 | 130 |
| 442 | 3300042005 | Ga0439448_0004898 | Ga0439448_0004898_1679_2077 | 130 |
| 443 | 3300042007 | Ga0439449_0000358 | Ga0439449_0000358_2831_3262 | 130 |
| 444 | 3300042007 | Ga0439449_0041114 | Ga0439449_0041114_915_1307 | 130 |
| 445 | 3300042007 | Ga0439449_0089795 | Ga0439449_0089795_196_597 | 130 |
| 446 | 3300042007 | Ga0439449_0122340 | Ga0439449_0122340_107_499 | 130 |
| 447 | 3300042008 | Ga0439450_155205 | Ga0439450_155205_75_473 | 130 |
| 448 | 3300042011 | Ga0439454_016112 | Ga0439454_016112_53_451 | 130 |
| 449 | 3300042014 | Ga0439457_002398 | Ga0439457_002398_3386_3778 | 130 |
| 450 | 3300042014 | Ga0439457_004233 | Ga0439457_004233_722_1114 | 130 |
| 451 | 3300042014 | Ga0439457_061953 | Ga0439457_061953_245_679 | 130 |
| 452 | 3300042015 | Ga0439462_0010822 | Ga0439462_0010822_1368_1760 | 130 |
| 453 | 3300042016 | Ga0439463_142957 | Ga0439463_142957_52_450 | 130 |
| 454 | 3300042131 | Ga0450894_000136 | Ga0450894_000136_5656_6090 | 130 |
| 455 | 3300042134 | Ga0450898_000424 | Ga0450898_000424_917_1351 | 130 |
| 456 | 3300042135 | Ga0450899_018844 | Ga0450899_018844_197_631 | 130 |
| 457 | 3300042137 | Ga0450902_008532 | Ga0450902_008532_664_1062 | 130 |
| 458 | 3300042138 | Ga0450903_000233 | Ga0450903_000233_10542_10940 | 130 |
| 459 | 3300042145 | Ga0450906_018467 | Ga0450906_018467_638_1072 | 130 |
| 460 | 3300042157 | Ga0439458_0018008 | Ga0439458_0018008_579_977 | 130 |
| 461 | 3300042157 | Ga0439458_0020162 | Ga0439458_0020162_671_1069 | 130 |
| 462 | 3300042184 | Ga0450908_010768 | Ga0450908_010768_99_533 | 130 |
| 463 | 3300044656 | Ga0466969_0083017 | Ga0466969_0083017_18_419 | 130 |
| 464 | 3300044656 | Ga0466969_0135318 | Ga0466969_0135318_254_655 | 130 |
| 465 | 3300044658 | Ga0466972_0004540 | Ga0466972_0004540_5388_5780 | 130 |
| 466 | 3300044658 | Ga0466972_0056941 | Ga0466972_0056941_65_466 | 130 |
| 467 | 3300044658 | Ga0466972_0067178 | Ga0466972_0067178_716_1111 | 130 |
| 468 | 3300044658 | Ga0466972_0172952 | Ga0466972_0172952_506_907 | 130 |
| 469 | 3300044683 | Ga0466965_0031059 | Ga0466965_0031059_1324_1725 | 130 |
| 470 | 3300044683 | Ga0466965_0297837 | Ga0466965_0297837_424_816 | 130 |
| 471 | 3300044683 | Ga0466965_0912746 | Ga0466965_0912746_65_457 | 130 |
| 472 | 3300044684 | Ga0466966_0191081 | Ga0466966_0191081_35_436 | 130 |
| 473 | 3300044693 | Ga0466961_0017066 | Ga0466961_0017066_3100_3501 | 130 |
| 474 | 3300044693 | Ga0466961_0080676 | Ga0466961_0080676_1599_2000 | 130 |
| 475 | 3300044693 | Ga0466961_0190965 | Ga0466961_0190965_804_1196 | 130 |
| 476 | 3300044694 | Ga0466963_0000213 | Ga0466963_0000213_1180_1581 | 130 |
| 477 | 3300044706 | Ga0466964_0518622 | Ga0466964_0518622_178_579 | 130 |
| 478 | 3300044719 | Ga0466971_0000575 | Ga0466971_0000575_3099_3500 | 130 |
| 479 | 3300044735 | Ga0466968_0169956 | Ga0466968_0169956_130_546 | 130 |
| 480 | 3300044765 | Ga0466970_0001274 | Ga0466970_0001274_1317_1718 | 130 |
| 481 | 3300044765 | Ga0466970_0006583 | Ga0466970_0006583_2446_2838 | 130 |
| 482 | 3300044765 | Ga0466970_0680531 | Ga0466970_0680531_126_527 | 130 |
| 483 | 3300044842 | Ga0466957_0023199 | Ga0466957_0023199_3230_3631 | 130 |
| 484 | 3300044842 | Ga0466957_0205515 | Ga0466957_0205515_334_735 | 130 |
| 485 | 3300044842 | Ga0466957_1003719 | Ga0466957_1003719_163_564 | 130 |
| 486 | 3300044901 | Ga0466960_0121087 | Ga0466960_0121087_48_440 | 130 |
| 487 | 3300044901 | Ga0466960_0151254 | Ga0466960_0151254_176_577 | 130 |
| 488 | 3300045049 | Ga0466959_0003363 | Ga0466959_0003363_9068_9469 | 130 |
| 489 | 3300045836 | Ga0466958_0095111 | Ga0466958_0095111_177_578 | 130 |
| 490 | 3300045976 | Ga0466967_0052759 | Ga0466967_0052759_2631_3026 | 130 |
| 491 | 3300045976 | Ga0466967_0192631 | Ga0466967_0192631_765_1166 | 130 |
| 492 | 3300045976 | Ga0466967_0212446 | Ga0466967_0212446_1417_1815 | 130 |
| 493 | 3300046454 | Ga0495592_0000574 | Ga0495592_0000574_6461_6853 | 130 |
| 494 | 3300046455 | Ga0495603_0004257 | Ga0495603_0004257_790_1182 | 130 |
| 495 | 3300046455 | Ga0495603_0757155 | Ga0495603_0757155_21_413 | 130 |
| 496 | 3300046457 | Ga0495590_0038675 | Ga0495590_0038675_520_912 | 130 |
| 497 | 3300046459 | Ga0495629_0002819 | Ga0495629_0002819_8066_8467 | 130 |
| 498 | 3300046459 | Ga0495629_0013612 | Ga0495629_0013612_3826_4218 | 130 |
| 499 | 3300046459 | Ga0495629_0023271 | Ga0495629_0023271_2247_2648 | 130 |
| 500 | 3300046459 | Ga0495629_0107957 | Ga0495629_0107957_535_927 | 130 |
| 501 | 3300046459 | Ga0495629_0146572 | Ga0495629_0146572_901_1293 | 130 |
| 502 | 3300046459 | Ga0495629_0444279 | Ga0495629_0444279_414_806 | 130 |
| 503 | 3300046460 | Ga0495638_0112665 | Ga0495638_0112665_154_546 | 130 |
| 504 | 3300046460 | Ga0495638_0269807 | Ga0495638_0269807_321_722 | 130 |
| 505 | 3300046461 | Ga0495641_0173672 | Ga0495641_0173672_227_619 | 130 |
| 506 | 3300046462 | Ga0495651_0017031 | Ga0495651_0017031_2084_2476 | 130 |
| 507 | 3300046462 | Ga0495651_0102999 | Ga0495651_0102999_354_746 | 130 |
| 508 | 3300046463 | Ga0495653_0377002 | Ga0495653_0377002_43_435 | 130 |
| 509 | 3300046472 | Ga0495580_0253921 | Ga0495580_0253921_229_621 | 130 |
| 510 | 3300046473 | Ga0495582_0100885 | Ga0495582_0100885_989_1381 | 130 |
| 511 | 3300046474 | Ga0495605_0005349 | Ga0495605_0005349_2489_2881 | 130 |
| 512 | 3300046476 | Ga0495662_0013250 | Ga0495662_0013250_2941_3333 | 130 |
| 513 | 3300046476 | Ga0495662_0018848 | Ga0495662_0018848_127_519 | 130 |
| 514 | 3300046476 | Ga0495662_0039237 | Ga0495662_0039237_1017_1409 | 130 |
| 515 | 3300046476 | Ga0495662_0101601 | Ga0495662_0101601_963_1355 | 130 |
| 516 | 3300046477 | Ga0495664_0031093 | Ga0495664_0031093_1272_1664 | 130 |
| 517 | 3300046477 | Ga0495664_0063719 | Ga0495664_0063719_228_620 | 130 |
| 518 | 3300046477 | Ga0495664_0713314 | Ga0495664_0713314_50_442 | 130 |
| 519 | 3300046491 | Ga0495584_0282451 | Ga0495584_0282451_258_650 | 130 |
| 520 | 3300046491 | Ga0495584_0567137 | Ga0495584_0567137_104_505 | 130 |
| 521 | 3300046492 | Ga0495585_0058979 | Ga0495585_0058979_1351_1752 | 130 |
| 522 | 3300046499 | Ga0495594_0001816 | Ga0495594_0001816_4290_4691 | 130 |
| 523 | 3300046499 | Ga0495594_0081634 | Ga0495594_0081634_180_572 | 130 |
| 524 | 3300046499 | Ga0495594_0116525 | Ga0495594_0116525_477_869 | 130 |
| 525 | 3300046499 | Ga0495594_0157211 | Ga0495594_0157211_642_1034 | 130 |
| 526 | 3300046499 | Ga0495594_0486532 | Ga0495594_0486532_165_566 | 130 |
| 527 | 3300046500 | Ga0495596_0125752 | Ga0495596_0125752_260_652 | 130 |
| 528 | 3300046500 | Ga0495596_0234521 | Ga0495596_0234521_246_638 | 130 |
| 529 | 3300046501 | Ga0495607_0081677 | Ga0495607_0081677_77_478 | 130 |
| 530 | 3300046501 | Ga0495607_0096676 | Ga0495607_0096676_449_841 | 130 |
| 531 | 3300046506 | Ga0495583_0042610 | Ga0495583_0042610_435_827 | 130 |
| 532 | 3300046507 | Ga0495606_0013622 | Ga0495606_0013622_3271_3663 | 130 |
| 533 | 3300046512 | Ga0495610_0121162 | Ga0495610_0121162_241_633 | 130 |
| 534 | 3300046512 | Ga0495610_0146435 | Ga0495610_0146435_546_944 | 130 |
| 535 | 3300046512 | Ga0495610_0215045 | Ga0495610_0215045_251_643 | 130 |
| 536 | 3300046513 | Ga0495616_0037258 | Ga0495616_0037258_1724_2116 | 130 |
| 537 | 3300046514 | Ga0495618_0319690 | Ga0495618_0319690_281_673 | 130 |
| 538 | 3300046515 | Ga0495620_0034741 | Ga0495620_0034741_1254_1646 | 130 |
| 539 | 3300046515 | Ga0495620_0088812 | Ga0495620_0088812_590_982 | 130 |
| 540 | 3300046515 | Ga0495620_0277766 | Ga0495620_0277766_49_450 | 130 |
| 541 | 3300046516 | Ga0495628_0149536 | Ga0495628_0149536_44_436 | 130 |
| 542 | 3300046516 | Ga0495628_0178311 | Ga0495628_0178311_415_807 | 130 |
| 543 | 3300046517 | Ga0495630_0033011 | Ga0495630_0033011_2558_2950 | 130 |
| 544 | 3300046517 | Ga0495630_0473812 | Ga0495630_0473812_158_550 | 130 |
| 545 | 3300046518 | Ga0495631_0028031 | Ga0495631_0028031_467_859 | 130 |
| 546 | 3300046518 | Ga0495631_0069413 | Ga0495631_0069413_638_1039 | 130 |
| 547 | 3300046520 | Ga0495637_0064870 | Ga0495637_0064870_1076_1468 | 130 |
| 548 | 3300046522 | Ga0495643_0005567 | Ga0495643_0005567_3782_4174 | 130 |
| 549 | 3300046523 | Ga0495644_0297976 | Ga0495644_0297976_50_451 | 130 |
| 550 | 3300046524 | Ga0495648_0050550 | Ga0495648_0050550_1388_1780 | 130 |
| 551 | 3300046524 | Ga0495648_0193895 | Ga0495648_0193895_128_544 | 130 |
| 552 | 3300046524 | Ga0495648_0389007 | Ga0495648_0389007_55_447 | 130 |
| 553 | 3300046526 | Ga0495666_0014863 | Ga0495666_0014863_375_767 | 130 |
| 554 | 3300046526 | Ga0495666_0123221 | Ga0495666_0123221_492_884 | 130 |
| 555 | 3300046528 | Ga0495642_0015555 | Ga0495642_0015555_678_1070 | 130 |
| 556 | 3300046529 | Ga0495652_0028911 | Ga0495652_0028911_2158_2550 | 130 |
| 557 | 3300046529 | Ga0495652_0030071 | Ga0495652_0030071_3308_3700 | 130 |
| 558 | 3300046530 | Ga0495654_0026495 | Ga0495654_0026495_1880_2272 | 130 |
| 559 | 3300046531 | Ga0495665_0137705 | Ga0495665_0137705_558_950 | 130 |
| 560 | 3300046533 | Ga0495640_0021884 | Ga0495640_0021884_3689_4081 | 130 |
| 561 | 3300046533 | Ga0495640_0144317 | Ga0495640_0144317_766_1158 | 130 |
| 562 | 3300046535 | Ga0495586_0092894 | Ga0495586_0092894_847_1239 | 130 |
| 563 | 3300046536 | Ga0495587_0003221 | Ga0495587_0003221_2025_2417 | 130 |
| 564 | 3300046536 | Ga0495587_0278099 | Ga0495587_0278099_151_543 | 130 |
| 565 | 3300046538 | Ga0495609_0073982 | Ga0495609_0073982_922_1314 | 130 |
| 566 | 3300046542 | Ga0495597_0023855 | Ga0495597_0023855_590_982 | 130 |
| 567 | 3300046543 | Ga0495645_0032240 | Ga0495645_0032240_698_1090 | 130 |
| 568 | 3300046557 | Ga0495622_0019957 | Ga0495622_0019957_2098_2490 | 130 |
| 569 | 3300046557 | Ga0495622_0027908 | Ga0495622_0027908_974_1375 | 130 |
| 570 | 3300046558 | Ga0495633_0037682 | Ga0495633_0037682_1658_2050 | 130 |
| 571 | 3300046558 | Ga0495633_0200017 | Ga0495633_0200017_100_492 | 130 |
| 572 | 3300046559 | Ga0495667_0030504 | Ga0495667_0030504_1394_1786 | 130 |
| 573 | 3300046559 | Ga0495667_0320136 | Ga0495667_0320136_55_447 | 130 |
| 574 | 3300046616 | Ga0495668_0017827 | Ga0495668_0017827_2570_2962 | 130 |
| 575 | 3300046616 | Ga0495668_0076764 | Ga0495668_0076764_548_949 | 130 |
| 576 | 3300046616 | Ga0495668_0099213 | Ga0495668_0099213_612_1004 | 130 |
| 577 | 3300046642 | Ga0495634_0005531 | Ga0495634_0005531_878_1270 | 130 |
| 578 | 3300046642 | Ga0495634_0274406 | Ga0495634_0274406_273_665 | 130 |
| 579 | 3300046648 | Ga0495611_0145263 | Ga0495611_0145263_576_968 | 130 |
| 580 | 3300046648 | Ga0495611_0145976 | Ga0495611_0145976_623_1024 | 130 |
| 581 | 3300046648 | Ga0495611_0207546 | Ga0495611_0207546_373_774 | 130 |
| 582 | 3300046660 | Ga0495625_0164477 | Ga0495625_0164477_731_1123 | 130 |
| 583 | 3300046660 | Ga0495625_0295332 | Ga0495625_0295332_401_802 | 130 |
| 584 | 3300046663 | Ga0495635_0165153 | Ga0495635_0165153_636_1028 | 130 |
| 585 | 3300046663 | Ga0495635_0201024 | Ga0495635_0201024_687_1079 | 130 |
| 586 | 3300046665 | Ga0495661_0036094 | Ga0495661_0036094_2465_2857 | 130 |
| 587 | 3300046665 | Ga0495661_0262342 | Ga0495661_0262342_181_582 | 130 |
| 588 | 3300046665 | Ga0495661_0439445 | Ga0495661_0439445_150_542 | 130 |
| 589 | 3300046674 | Ga0495588_0001268 | Ga0495588_0001268_2489_2881 | 130 |
| 590 | 3300046674 | Ga0495588_0012467 | Ga0495588_0012467_2303_2704 | 130 |
| 591 | 3300046674 | Ga0495588_0263876 | Ga0495588_0263876_463_855 | 130 |
| 592 | 3300046675 | Ga0495657_0001214 | Ga0495657_0001214_6498_6890 | 130 |
| 593 | 3300046675 | Ga0495657_0033179 | Ga0495657_0033179_3112_3504 | 130 |
| 594 | 3300046678 | Ga0495599_0090794 | Ga0495599_0090794_23_415 | 130 |
| 595 | 3300046678 | Ga0495599_0194168 | Ga0495599_0194168_99_491 | 130 |
| 596 | 3300046680 | Ga0495646_0014451 | Ga0495646_0014451_972_1364 | 130 |
| 597 | 3300046680 | Ga0495646_0283485 | Ga0495646_0283485_466_858 | 130 |
| 598 | 3300046683 | Ga0495658_0144361 | Ga0495658_0144361_697_1089 | 130 |
| 599 | 3300046689 | Ga0495613_0003059 | Ga0495613_0003059_1905_2306 | 130 |
| 600 | 3300046689 | Ga0495613_0012117 | Ga0495613_0012117_3199_3591 | 130 |
| 601 | 3300046689 | Ga0495613_0109870 | Ga0495613_0109870_664_1056 | 130 |
| 602 | 3300046689 | Ga0495613_0135378 | Ga0495613_0135378_64_456 | 130 |
| 603 | 3300046689 | Ga0495613_0229586 | Ga0495613_0229586_93_485 | 130 |
| 604 | 3300046689 | Ga0495613_0680743 | Ga0495613_0680743_221_613 | 130 |
| 605 | 3300046690 | Ga0495624_0271689 | Ga0495624_0271689_548_940 | 130 |
| 606 | 3300046690 | Ga0495624_0480763 | Ga0495624_0480763_178_570 | 130 |
| 607 | 3300046690 | Ga0495624_0559763 | Ga0495624_0559763_66_458 | 130 |
| 608 | 3300046691 | Ga0495670_0379824 | Ga0495670_0379824_89_481 | 130 |
| 609 | 3300046691 | Ga0495670_0508837 | Ga0495670_0508837_215_607 | 130 |
| 610 | 3300046692 | Ga0495671_0022519 | Ga0495671_0022519_962_1354 | 130 |
| 611 | 3300046692 | Ga0495671_0153702 | Ga0495671_0153702_55_456 | 130 |
| 612 | 3300046692 | Ga0495671_0173739 | Ga0495671_0173739_80_472 | 130 |
| 613 | 3300046694 | Ga0495649_0154922 | Ga0495649_0154922_594_995 | 130 |
| 614 | 3300046694 | Ga0495649_0167813 | Ga0495649_0167813_168_560 | 130 |
| 615 | 3300046794 | Ga0495589_0014905 | Ga0495589_0014905_3256_3648 | 130 |
| 616 | 3300046794 | Ga0495589_0276114 | Ga0495589_0276114_21_422 | 130 |
| 617 | 3300046809 | Ga0495600_0007018 | Ga0495600_0007018_1248_1640 | 130 |
| 618 | 3300046809 | Ga0495600_0019938 | Ga0495600_0019938_2791_3183 | 130 |
| 619 | 3300046809 | Ga0495600_0383097 | Ga0495600_0383097_441_833 | 130 |
| 620 | 3300047315 | Ga0495581_0005237 | Ga0495581_0005237_5796_6188 | 130 |
| 621 | 3300047317 | Ga0495604_0113627 | Ga0495604_0113627_945_1337 | 130 |
| 622 | 3300047317 | Ga0495604_0129049 | Ga0495604_0129049_1020_1412 | 130 |
| 623 | 3300047318 | Ga0495636_0027201 | Ga0495636_0027201_76_468 | 130 |
| 624 | 3300047318 | Ga0495636_0036339 | Ga0495636_0036339_816_1217 | 130 |
| 625 | 3300047318 | Ga0495636_0045783 | Ga0495636_0045783_895_1287 | 130 |
| 626 | 3300047319 | Ga0495674_0213282 | Ga0495674_0213282_666_1058 | 130 |
| 627 | 3300047320 | Ga0495672_0083211 | Ga0495672_0083211_1255_1647 | 130 |
| 628 | 3300047321 | Ga0495676_0002047 | Ga0495676_0002047_56_457 | 130 |
| 629 | 3300047321 | Ga0495676_0005451 | Ga0495676_0005451_750_1142 | 130 |
| 630 | 3300047321 | Ga0495676_0030974 | Ga0495676_0030974_1991_2392 | 130 |
| 631 | 3300047321 | Ga0495676_0073343 | Ga0495676_0073343_1968_2369 | 130 |
| 632 | 3300047321 | Ga0495676_0146274 | Ga0495676_0146274_72_464 | 130 |
| 633 | 3300047321 | Ga0495676_0151528 | Ga0495676_0151528_72_464 | 130 |
| 634 | 3300047321 | Ga0495676_0926524 | Ga0495676_0926524_80_472 | 130 |
| 635 | 3300047321 | Ga0495676_1044284 | Ga0495676_1044284_53_454 | 130 |
| 636 | 3300047322 | Ga0495680_0093253 | Ga0495680_0093253_1228_1620 | 130 |
| 637 | 3300047323 | Ga0495683_0273178 | Ga0495683_0273178_208_609 | 130 |
| 638 | 3300047443 | Ga0495687_006392 | Ga0495687_006392_3286_3678 | 130 |
| 639 | 3300047443 | Ga0495687_020416 | Ga0495687_020416_769_1161 | 130 |
| 640 | 3300047444 | Ga0495675_0014147 | Ga0495675_0014147_4392_4784 | 130 |
| 641 | 3300047444 | Ga0495675_0142712 | Ga0495675_0142712_644_1036 | 130 |
| 642 | 3300047445 | Ga0495677_0026186 | Ga0495677_0026186_1073_1465 | 130 |
| 643 | 3300047447 | Ga0495685_005303 | Ga0495685_005303_909_1310 | 130 |
| 644 | 3300047447 | Ga0495685_006989 | Ga0495685_006989_3093_3485 | 130 |
| 645 | 3300047447 | Ga0495685_018741 | Ga0495685_018741_551_949 | 130 |
| 646 | 3300047447 | Ga0495685_162261 | Ga0495685_162261_118_510 | 130 |
| 647 | 3300047469 | Ga0495673_0198446 | Ga0495673_0198446_92_484 | 130 |
| 648 | 3300047470 | Ga0495681_0000567 | Ga0495681_0000567_11694_12086 | 130 |
| 649 | 3300047470 | Ga0495681_0302764 | Ga0495681_0302764_189_581 | 130 |
| 650 | 3300047471 | Ga0495684_0095811 | Ga0495684_0095811_899_1291 | 130 |
| 651 | 3300047472 | Ga0495686_0015791 | Ga0495686_0015791_962_1354 | 130 |
| 652 | 3300047472 | Ga0495686_0028044 | Ga0495686_0028044_459_851 | 130 |
| 653 | 3300047472 | Ga0495686_0084897 | Ga0495686_0084897_923_1315 | 130 |
| 654 | 3300047673 | Ga0495593_0000488 | Ga0495593_0000488_15248_15640 | 130 |
| 655 | 3300047673 | Ga0495593_0023676 | Ga0495593_0023676_596_988 | 130 |
| 656 | 3300047673 | Ga0495593_0027313 | Ga0495593_0027313_1961_2353 | 130 |
| 657 | 3300048088 | Ga0495602_0077375 | Ga0495602_0077375_938_1330 | 130 |
| 658 | 3300048089 | Ga0495614_0001937 | Ga0495614_0001937_48_449 | 130 |
| 659 | 3300048089 | Ga0495614_0006857 | Ga0495614_0006857_350_742 | 130 |
| 660 | 3300048089 | Ga0495614_0007664 | Ga0495614_0007664_2639_3031 | 130 |
| 661 | 3300048089 | Ga0495614_0041221 | Ga0495614_0041221_831_1223 | 130 |
| 662 | 3300048089 | Ga0495614_0119543 | Ga0495614_0119543_59_460 | 130 |
| 663 | 3300048089 | Ga0495614_0222866 | Ga0495614_0222866_223_615 | 130 |
| 664 | 3300048091 | Ga0495626_0024655 | Ga0495626_0024655_2438_2830 | 130 |
| 665 | 3300048911 | Ga0496108_1097077 | Ga0496108_1097077_272_664 | 130 |
| 666 | 3300048913 | Ga0496110_1044945 | Ga0496110_1044945_40_438 | 130 |
| 667 | 3300048916 | Ga0496113_0635352 | Ga0496113_0635352_446_838 | 130 |
| 668 | 3300048922 | Ga0496119_0503949 | Ga0496119_0503949_65_457 | 130 |
| 669 | 3300049127 | Ga0501306_041572 | Ga0501306_041572_165_560 | 130 |
| 670 | 3300049127 | Ga0501306_069041 | Ga0501306_069041_85_477 | 130 |
| 671 | 3300049128 | Ga0501308_032020 | Ga0501308_032020_84_476 | 130 |
| 672 | 3300049128 | Ga0501308_060874 | Ga0501308_060874_51_446 | 130 |
| 673 | 3300049130 | Ga0501310_034095 | Ga0501310_034095_81_473 | 130 |
| 674 | 3300049459 | Ga0495678_019245 | Ga0495678_019245_2384_2776 | 130 |
| 675 | 3300049460 | Ga0495682_0231453 | Ga0495682_0231453_245_637 | 130 |
| 676 | 3300049529 | Ga0501313_048544 | Ga0501313_048544_109_501 | 130 |
| 677 | 3300049569 | Ga0501032_0164657 | Ga0501032_0164657_672_1064 | 130 |
| 678 | 3300049569 | Ga0501032_0242617 | Ga0501032_0242617_112_513 | 130 |
| 679 | 3300049570 | Ga0501033_0003519 | Ga0501033_0003519_6539_6934 | 130 |
| 680 | 3300049572 | Ga0501036_0112831 | Ga0501036_0112831_332_724 | 130 |
| 681 | 3300049573 | Ga0501037_0210513 | Ga0501037_0210513_168_560 | 130 |
| 682 | 3300049574 | Ga0501038_0311018 | Ga0501038_0311018_507_899 | 130 |
| 683 | 3300049579 | Ga0501043_0108548 | Ga0501043_0108548_393_785 | 130 |
| 684 | 3300049579 | Ga0501043_0956633 | Ga0501043_0956633_44_436 | 130 |
| 685 | 3300049581 | Ga0501047_0081903 | Ga0501047_0081903_323_715 | 130 |
| 686 | 3300049582 | Ga0501048_0088148 | Ga0501048_0088148_1406_1798 | 130 |
| 687 | 3300049586 | Ga0501070_0169212 | Ga0501070_0169212_35_445 | 130 |
| 688 | 3300049586 | Ga0501070_0194908 | Ga0501070_0194908_1118_1510 | 130 |
| 689 | 3300049686 | Ga0501257_251696 | Ga0501257_251696_95_490 | 130 |
| 690 | 3300049742 | Ga0501080_0025292 | Ga0501080_0025292_2119_2511 | 130 |
| 691 | 3300049822 | Ga0501035_1020781 | Ga0501035_1020781_121_513 | 130 |
| 692 | 3300049823 | Ga0501044_0004420 | Ga0501044_0004420_11053_11445 | 130 |
| 693 | 3300049823 | Ga0501044_0020637 | Ga0501044_0020637_6022_6423 | 130 |
| 694 | 3300049823 | Ga0501044_0229901 | Ga0501044_0229901_1342_1737 | 130 |
| 695 | 3300050490 | nmdc:mga03n38_218115_c1 | nmdc:mga03n38_218115_c1_82_534 | 130 |
| 696 | 3300050494 | nmdc:mga06z11_1987_c1 | nmdc:mga06z11_1987_c1_4745_5143 | 130 |
| 697 | 3300050496 | nmdc:mga07m45_192230_c1 | nmdc:mga07m45_192230_c1_462_914 | 130 |
| 698 | 3300053083 | Ga0495655_0196384 | Ga0495655_0196384_75_467 | 130 |
| 699 | 3300053085 | Ga0495619_0184798 | Ga0495619_0184798_643_1035 | 130 |
| 700 | 3300053086 | Ga0500578_0746835 | Ga0500578_0746835_28_420 | 130 |
| 701 | 3300053088 | Ga0500644_0028242 | Ga0500644_0028242_661_1077 | 130 |
| 702 | 3300053095 | Ga0500640_015759 | Ga0500640_015759_890_1282 | 130 |
| 703 | 3300053100 | Ga0500660_208455 | Ga0500660_208455_141_557 | 130 |
| 704 | 3300053101 | Ga0500553_227331 | Ga0500553_227331_87_479 | 130 |
| 705 | 3300053107 | Ga0500560_152651 | Ga0500560_152651_230_622 | 130 |
| 706 | 3300053111 | Ga0500572_013583 | Ga0500572_013583_875_1267 | 130 |
| 707 | 3300053122 | Ga0500608_137041 | Ga0500608_137041_58_450 | 130 |
| 708 | 3300053123 | Ga0500614_135620 | Ga0500614_135620_272_664 | 130 |
| 709 | 3300053130 | Ga0500642_0364987 | Ga0500642_0364987_202_618 | 130 |
| 710 | 3300053133 | Ga0500655_112385 | Ga0500655_112385_93_485 | 130 |
| 711 | 3300053134 | Ga0500658_0394177 | Ga0500658_0394177_158_550 | 130 |
| 712 | 3300053136 | Ga0500559_0294829 | Ga0500559_0294829_272_664 | 130 |
| 713 | 3300053140 | Ga0500573_0199793 | Ga0500573_0199793_203_595 | 130 |
| 714 | 3300053145 | Ga0500586_176739 | Ga0500586_176739_237_629 | 130 |
| 715 | 3300053149 | Ga0500600_0037488 | Ga0500600_0037488_2402_2800 | 130 |
| 716 | 3300053157 | Ga0500624_013244 | Ga0500624_013244_618_1010 | 130 |
| 717 | 3300053161 | Ga0500634_0148320 | Ga0500634_0148320_60_476 | 130 |
| 718 | 3300053177 | Ga0500636_0150474 | Ga0500636_0150474_502_894 | 130 |
| 719 | 3300053736 | Ga0500599_020103 | Ga0500599_020103_43_459 | 130 |
| 720 | 3300059477 | Ga0587084_020241 | Ga0587084_020241_48_440 | 130 |
| 721 | 3300059490 | Ga0587066_046314 | Ga0587066_046314_75_467 | 130 |
| 722 | 3300059492 | Ga0587073_0109166 | Ga0587073_0109166_80_472 | 130 |
| 723 | 3300059504 | Ga0587082_032635 | Ga0587082_032635_426_836 | 130 |
| 724 | 3300059505 | Ga0587083_0228452 | Ga0587083_0228452_49_441 | 130 |
| 725 | 3300059506 | Ga0587085_040716 | Ga0587085_040716_56_448 | 130 |
| 726 | 3300059508 | Ga0587088_196680 | Ga0587088_196680_36_434 | 130 |
| 727 | 3300059509 | Ga0587089_107393 | Ga0587089_107393_72_464 | 130 |
| 728 | 3300059512 | Ga0587092_045216 | Ga0587092_045216_54_446 | 130 |
| 729 | 3300059512 | Ga0587092_105560 | Ga0587092_105560_114_506 | 130 |
| 730 | 3300059605 | Ga0587106_069618 | Ga0587106_069618_192_584 | 130 |
| 731 | 3300059605 | Ga0587106_143660 | Ga0587106_143660_57_449 | 130 |
| 732 | 3300059605 | Ga0587106_156557 | Ga0587106_156557_46_456 | 130 |
| 733 | 3300059624 | Ga0587109_094313 | Ga0587109_094313_71_463 | 130 |
| 734 | 3300059628 | Ga0587122_018406 | Ga0587122_018406_268_660 | 130 |
| 735 | 3300059628 | Ga0587122_050572 | Ga0587122_050572_40_435 | 130 |
| 736 | 3300059639 | Ga0587062_102097 | Ga0587062_102097_113_505 | 130 |
| 737 | 3300059643 | Ga0587072_033100 | Ga0587072_033100_529_921 | 130 |
| 738 | 3300059648 | Ga0587100_029492 | Ga0587100_029492_80_472 | 130 |
| 739 | 3300059651 | Ga0587105_026240 | Ga0587105_026240_63_455 | 130 |
| 740 | 3300059652 | Ga0587107_151481 | Ga0587107_151481_64_456 | 130 |
| 741 | 3300059655 | Ga0587114_030091 | Ga0587114_030091_57_467 | 130 |
| 742 | 3300059659 | Ga0587120_030803 | Ga0587120_030803_84_476 | 130 |
| 743 | 3300060344 | Ga0587071_033775 | Ga0587071_033775_50_442 | 130 |
| 744 | 3300060346 | Ga0587111_0039359 | Ga0587111_0039359_59_496 | 130 |
| 745 | 3300061719 | Ga0466962_0004079 | Ga0466962_0004079_5483_5884 | 130 |
| 746 | 3300061719 | Ga0466962_0038489 | Ga0466962_0038489_562_957 | 130 |
| 747 | 3300061719 | Ga0466962_0040152 | Ga0466962_0040152_1204_1602 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5npl-assembly1.cif.gz_A | crystal structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria, yb-derivative at 2.8 a resolution | 0.9226 | 1 | 118 |
| 5nmu-assembly1.cif.gz_B-2 | structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria | 0.9221 | 1 | 118 |
| 5nmu-assembly1.cif.gz_C-2 | structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria | 0.8714 | 1 | 127 |
| 2rc3-assembly2.cif.gz_B | crystal structure of cbs domain, ne2398 | 0.866 | 8 | 123 |
| 3kpd-assembly2.cif.gz_C | crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine. | 0.8631 | 1 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A3N2_197_353_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.905 | 1 | 119 | 3.10.580.10 |
| af_Q57892_7_176_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.8882 | 3 | 121 | 3.10.580.10 |
| af_O13965_64_218_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.8843 | 3 | 119 | 3.10.580.10 |
| af_C0PHI9_226_352_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.8838 | 3 | 121 | 3.10.580.10 |
| af_A0A0R0JYS7_265_405_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.8814 | 2 | 121 | 3.10.580.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A176LEH7-F1-model_v4 | deleted | 0.9479 | 1 | 129 |
|
| AF-A0A533ZTU6-F1-model_v4 | CBS domain-containing protein | 0.9469 | 1 | 118 |
GO:0035438
|
| AF-A0A286EIS5-F1-model_v4 | CBS domain-containing protein | 0.9451 | 1 | 130 |
|
| AF-A0A6H0CSI7-F1-model_v4 | CBS domain-containing protein | 0.9441 | 1 | 130 |
|
| AF-A0A2K8PCY1-F1-model_v4 | Hypoxic response protein 1 | 0.942 | 1 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar