F478957
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 748 | 283 | 748 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10909075|Ga0207708_109090751 |
| Length | 186 |
| Sequence | MSEKDVIKETRPRMEGAVDDFKRKITTIRTGRAAVSILDTVVVDYYGTPTPLNQMASVHAPEPQMLTVQPWDQTQIGAVEKAIRAADLGLNPSNDGKLVRVPIPPLTEERRRQLAKQIHDVAEDHRTAVRNVRRDANDRLKKMLKDKTISEDAERDSLAEVQKLTDGHIKQIDELAKSKEQEILSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 183 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 185 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 209 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 210 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.21 |
| Rhizosphere | 94.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3181706 | 2162886007 | Bacteria | 950 |
| 2 | MRS1b_contig_7392549 | 2162886011 | Bacteria | 882 |
| 3 | JGI24751J29686_10001906 | 3300002459 | Bacteria | 4264 |
| 4 | Ga0058862_12374949 | 3300004803 | Unclassified | 780 |
| 5 | Ga0065704_10025299 | 3300005289 | Bacteria | 1466 |
| 6 | Ga0065712_10032885 | 3300005290 | Bacteria | 1285 |
| 7 | Ga0065712_10086516 | 3300005290 | Bacteria | 2631 |
| 8 | Ga0065712_10155174 | 3300005290 | Bacteria | 1333 |
| 9 | Ga0065715_10089447 | 3300005293 | Bacteria | 10128 |
| 10 | Ga0065715_10173661 | 3300005293 | Bacteria | 1528 |
| 11 | Ga0065715_10189832 | 3300005293 | Bacteria | 1422 |
| 12 | Ga0065707_10083745 | 3300005295 | Bacteria | 8334 |
| 13 | Ga0065707_10101877 | 3300005295 | Bacteria | 2841 |
| 14 | Ga0065707_10272809 | 3300005295 | Bacteria | 1067 |
| 15 | Ga0065707_10373122 | 3300005295 | Bacteria | 887 |
| 16 | Ga0070658_10575796 | 3300005327 | Bacteria | 975 |
| 17 | Ga0070676_10109671 | 3300005328 | Bacteria | 1717 |
| 18 | Ga0070683_100214025 | 3300005329 | Bacteria | 1831 |
| 19 | Ga0070683_100422151 | 3300005329 | Bacteria | 1272 |
| 20 | Ga0070683_100491740 | 3300005329 | Unclassified | 1172 |
| 21 | Ga0070690_100023302 | 3300005330 | Bacteria | 3796 |
| 22 | Ga0070690_100571123 | 3300005330 | Bacteria | 855 |
| 23 | Ga0070670_100002347 | 3300005331 | Bacteria | 15589 |
| 24 | Ga0070670_100034706 | 3300005331 | Bacteria | 4341 |
| 25 | Ga0070670_100418034 | 3300005331 | Bacteria | 1185 |
| 26 | Ga0070670_100424196 | 3300005331 | Bacteria | 1176 |
| 27 | Ga0070670_100804841 | 3300005331 | Bacteria | 849 |
| 28 | Ga0070677_10028118 | 3300005333 | Bacteria | 2122 |
| 29 | Ga0068869_100491312 | 3300005334 | Bacteria | 1023 |
| 30 | Ga0070666_10009157 | 3300005335 | Bacteria | 6172 |
| 31 | Ga0070666_10135228 | 3300005335 | Bacteria | 1715 |
| 32 | Ga0070666_10175809 | 3300005335 | Bacteria | 1501 |
| 33 | Ga0070680_100079394 | 3300005336 | Bacteria | 2705 |
| 34 | Ga0070682_100148856 | 3300005337 | Bacteria | 1604 |
| 35 | Ga0070682_101241778 | 3300005337 | Bacteria | 631 |
| 36 | Ga0068868_100561835 | 3300005338 | Bacteria | 1007 |
| 37 | Ga0070660_100012244 | 3300005339 | Bacteria | 6122 |
| 38 | Ga0070660_100130489 | 3300005339 | Bacteria | 2011 |
| 39 | Ga0070660_100567599 | 3300005339 | Bacteria | 947 |
| 40 | Ga0070660_100723930 | 3300005339 | Bacteria | 835 |
| 41 | Ga0070689_100153008 | 3300005340 | Bacteria | 1861 |
| 42 | Ga0070687_100326773 | 3300005343 | Bacteria | 982 |
| 43 | Ga0070687_100436072 | 3300005343 | Bacteria | 868 |
| 44 | Ga0070668_100104422 | 3300005347 | Bacteria | 2249 |
| 45 | Ga0070669_100001373 | 3300005353 | Bacteria | 17563 |
| 46 | Ga0070669_100040264 | 3300005353 | Bacteria | 3397 |
| 47 | Ga0070669_100045667 | 3300005353 | Bacteria | 3193 |
| 48 | Ga0070669_100076099 | 3300005353 | Bacteria | 2490 |
| 49 | Ga0070669_100079821 | 3300005353 | Bacteria | 2434 |
| 50 | Ga0070675_100113009 | 3300005354 | Bacteria | 2300 |
| 51 | Ga0070675_100140434 | 3300005354 | Bacteria | 2064 |
| 52 | Ga0070675_100270944 | 3300005354 | Bacteria | 1490 |
| 53 | Ga0070675_100522728 | 3300005354 | Bacteria | 1071 |
| 54 | Ga0070675_100750312 | 3300005354 | Bacteria | 891 |
| 55 | Ga0070675_101321027 | 3300005354 | Unclassified | 665 |
| 56 | Ga0070671_100005643 | 3300005355 | Bacteria | 9957 |
| 57 | Ga0070671_100064404 | 3300005355 | Bacteria | 3053 |
| 58 | Ga0070671_100414103 | 3300005355 | Bacteria | 1154 |
| 59 | Ga0070674_100078066 | 3300005356 | Bacteria | 2359 |
| 60 | Ga0070674_100318598 | 3300005356 | Bacteria | 1246 |
| 61 | Ga0070674_100358954 | 3300005356 | Bacteria | 1179 |
| 62 | Ga0070674_100427674 | 3300005356 | Bacteria | 1088 |
| 63 | Ga0070674_100678257 | 3300005356 | Bacteria | 879 |
| 64 | Ga0070673_100067482 | 3300005364 | Bacteria | 2860 |
| 65 | Ga0070673_100102553 | 3300005364 | Bacteria | 2359 |
| 66 | Ga0070673_100315794 | 3300005364 | Bacteria | 1379 |
| 67 | Ga0070673_100607733 | 3300005364 | Bacteria | 998 |
| 68 | Ga0070673_101069890 | 3300005364 | Bacteria | 753 |
| 69 | Ga0070688_100002960 | 3300005365 | Bacteria | 8657 |
| 70 | Ga0070688_100016655 | 3300005365 | Bacteria | 4205 |
| 71 | Ga0070688_100227841 | 3300005365 | Bacteria | 1317 |
| 72 | Ga0070688_100303170 | 3300005365 | Bacteria | 1155 |
| 73 | Ga0070659_100169086 | 3300005366 | Bacteria | 1790 |
| 74 | Ga0070659_100305224 | 3300005366 | Bacteria | 1328 |
| 75 | Ga0070667_100235121 | 3300005367 | Bacteria | 1635 |
| 76 | Ga0070711_100084742 | 3300005439 | Bacteria | 2268 |
| 77 | Ga0070705_100067347 | 3300005440 | Bacteria | 2151 |
| 78 | Ga0070705_100200800 | 3300005440 | Bacteria | 1367 |
| 79 | Ga0070705_100794924 | 3300005440 | Bacteria | 752 |
| 80 | Ga0070700_100165270 | 3300005441 | Bacteria | 1527 |
| 81 | Ga0070694_100026503 | 3300005444 | Bacteria | 3757 |
| 82 | Ga0070694_100464340 | 3300005444 | Bacteria | 1002 |
| 83 | Ga0070694_100766151 | 3300005444 | Bacteria | 789 |
| 84 | Ga0070708_100043579 | 3300005445 | Bacteria | 3943 |
| 85 | Ga0070708_100189798 | 3300005445 | Bacteria | 1922 |
| 86 | Ga0070708_100305319 | 3300005445 | Bacteria | 1499 |
| 87 | Ga0070708_100621696 | 3300005445 | Unclassified | 1018 |
| 88 | Ga0070708_100924291 | 3300005445 | Bacteria | 819 |
| 89 | Ga0070663_100299404 | 3300005455 | Bacteria | 1287 |
| 90 | Ga0070663_100530915 | 3300005455 | Bacteria | 981 |
| 91 | Ga0070678_100019556 | 3300005456 | Bacteria | 4420 |
| 92 | Ga0070678_100042628 | 3300005456 | Bacteria | 3227 |
| 93 | Ga0070678_100086206 | 3300005456 | Bacteria | 2395 |
| 94 | Ga0070662_100053417 | 3300005457 | Bacteria | 2924 |
| 95 | Ga0070662_100292551 | 3300005457 | Bacteria | 1321 |
| 96 | Ga0070662_100611760 | 3300005457 | Bacteria | 917 |
| 97 | Ga0070681_10022019 | 3300005458 | Bacteria | 6395 |
| 98 | Ga0070681_10076512 | 3300005458 | Bacteria | 3305 |
| 99 | Ga0070681_10252986 | 3300005458 | Bacteria | 1674 |
| 100 | Ga0070681_10541639 | 3300005458 | Bacteria | 1077 |
| 101 | Ga0068867_100032508 | 3300005459 | Bacteria | 3774 |
| 102 | Ga0068867_100240852 | 3300005459 | Bacteria | 1467 |
| 103 | Ga0068867_100316304 | 3300005459 | Bacteria | 1292 |
| 104 | Ga0068867_100400168 | 3300005459 | Bacteria | 1158 |
| 105 | Ga0070685_10020352 | 3300005466 | Bacteria | 3590 |
| 106 | Ga0070685_10057586 | 3300005466 | Bacteria | 2262 |
| 107 | Ga0070685_10552915 | 3300005466 | Bacteria | 822 |
| 108 | Ga0070706_100656173 | 3300005467 | Bacteria | 974 |
| 109 | Ga0070707_100094736 | 3300005468 | Bacteria | 2891 |
| 110 | Ga0070707_100103003 | 3300005468 | Bacteria | 2766 |
| 111 | Ga0070707_100199746 | 3300005468 | Bacteria | 1949 |
| 112 | Ga0070707_100708928 | 3300005468 | Bacteria | 969 |
| 113 | Ga0070698_100098715 | 3300005471 | Bacteria | 2894 |
| 114 | Ga0070698_100168353 | 3300005471 | Bacteria | 2133 |
| 115 | Ga0070698_100447627 | 3300005471 | Bacteria | 1227 |
| 116 | Ga0070698_100708319 | 3300005471 | Bacteria | 949 |
| 117 | Ga0070698_101090346 | 3300005471 | Bacteria | 747 |
| 118 | Ga0070699_100011351 | 3300005518 | Bacteria | 7691 |
| 119 | Ga0070699_100048831 | 3300005518 | Bacteria | 3663 |
| 120 | Ga0070699_100145338 | 3300005518 | Bacteria | 2095 |
| 121 | Ga0070679_100165560 | 3300005530 | Bacteria | 2184 |
| 122 | Ga0070684_100000085 | 3300005535 | Bacteria | 61530 |
| 123 | Ga0068853_100117095 | 3300005539 | Bacteria | 2373 |
| 124 | Ga0068853_100257842 | 3300005539 | Bacteria | 1602 |
| 125 | Ga0068853_100607363 | 3300005539 | Bacteria | 1039 |
| 126 | Ga0070672_100021287 | 3300005543 | Bacteria | 4743 |
| 127 | Ga0070672_100090097 | 3300005543 | Bacteria | 2473 |
| 128 | Ga0070672_100183130 | 3300005543 | Bacteria | 1746 |
| 129 | Ga0070672_100440212 | 3300005543 | Bacteria | 1121 |
| 130 | Ga0070672_100550322 | 3300005543 | Bacteria | 1002 |
| 131 | Ga0070672_100550943 | 3300005543 | Unclassified | 1001 |
| 132 | Ga0070686_100025139 | 3300005544 | Bacteria | 3579 |
| 133 | Ga0070686_100795604 | 3300005544 | Bacteria | 762 |
| 134 | Ga0070695_100019190 | 3300005545 | Bacteria | 4160 |
| 135 | Ga0070695_100461502 | 3300005545 | Bacteria | 975 |
| 136 | Ga0070696_100061896 | 3300005546 | Bacteria | 2619 |
| 137 | Ga0070696_100105885 | 3300005546 | Bacteria | 2021 |
| 138 | Ga0070696_100203222 | 3300005546 | Bacteria | 1480 |
| 139 | Ga0070693_100537506 | 3300005547 | Bacteria | 835 |
| 140 | Ga0070665_100009152 | 3300005548 | Bacteria | 10029 |
| 141 | Ga0070665_100107181 | 3300005548 | Bacteria | 2796 |
| 142 | Ga0070665_100173101 | 3300005548 | Bacteria | 2160 |
| 143 | Ga0070665_100305967 | 3300005548 | Bacteria | 1593 |
| 144 | Ga0070665_100818989 | 3300005548 | Bacteria | 944 |
| 145 | Ga0070665_101241110 | 3300005548 | Bacteria | 756 |
| 146 | Ga0070704_100270366 | 3300005549 | Bacteria | 1404 |
| 147 | Ga0070704_101189696 | 3300005549 | Bacteria | 695 |
| 148 | Ga0068855_100024107 | 3300005563 | Bacteria | 7283 |
| 149 | Ga0070664_100000442 | 3300005564 | Bacteria | 31212 |
| 150 | Ga0070664_100111623 | 3300005564 | Bacteria | 2386 |
| 151 | Ga0070664_100368763 | 3300005564 | Bacteria | 1309 |
| 152 | Ga0070664_101449005 | 3300005564 | Bacteria | 649 |
| 153 | Ga0068857_100460418 | 3300005577 | Bacteria | 1190 |
| 154 | Ga0068854_100050186 | 3300005578 | Bacteria | 2984 |
| 155 | Ga0068854_100639830 | 3300005578 | Bacteria | 912 |
| 156 | Ga0068856_100012203 | 3300005614 | Bacteria | 8324 |
| 157 | Ga0068852_100436547 | 3300005616 | Bacteria | 1294 |
| 158 | Ga0068859_100091550 | 3300005617 | Bacteria | 3092 |
| 159 | Ga0068859_100145708 | 3300005617 | Bacteria | 2443 |
| 160 | Ga0068859_100253435 | 3300005617 | Bacteria | 1850 |
| 161 | Ga0068859_100303550 | 3300005617 | Bacteria | 1690 |
| 162 | Ga0068859_100536005 | 3300005617 | Bacteria | 1265 |
| 163 | Ga0068859_100609161 | 3300005617 | Bacteria | 1185 |
| 164 | Ga0068859_101385408 | 3300005617 | Bacteria | 775 |
| 165 | Ga0068864_100004401 | 3300005618 | Bacteria | 11567 |
| 166 | Ga0068864_100014824 | 3300005618 | Bacteria | 6475 |
| 167 | Ga0068864_100037415 | 3300005618 | Bacteria | 4141 |
| 168 | Ga0068864_100404962 | 3300005618 | Bacteria | 1297 |
| 169 | Ga0068866_10042614 | 3300005718 | Bacteria | 2260 |
| 170 | Ga0068866_10069885 | 3300005718 | Bacteria | 1851 |
| 171 | Ga0068866_10633127 | 3300005718 | Bacteria | 726 |
| 172 | Ga0068866_10639602 | 3300005718 | Bacteria | 723 |
| 173 | Ga0068861_100131328 | 3300005719 | Bacteria | 2033 |
| 174 | Ga0068861_100367482 | 3300005719 | Bacteria | 1267 |
| 175 | Ga0068861_100793964 | 3300005719 | Bacteria | 888 |
| 176 | Ga0068870_10150032 | 3300005840 | Bacteria | 1372 |
| 177 | Ga0068863_100012648 | 3300005841 | Bacteria | 8141 |
| 178 | Ga0068863_100048499 | 3300005841 | Bacteria | 4027 |
| 179 | Ga0068863_100112640 | 3300005841 | Bacteria | 2591 |
| 180 | Ga0068858_100013804 | 3300005842 | Bacteria | 7625 |
| 181 | Ga0068858_100162878 | 3300005842 | Bacteria | 2100 |
| 182 | Ga0068858_100202811 | 3300005842 | Bacteria | 1876 |
| 183 | Ga0068858_100424946 | 3300005842 | Unclassified | 1278 |
| 184 | Ga0068858_100788367 | 3300005842 | Bacteria | 927 |
| 185 | Ga0068860_100313743 | 3300005843 | Bacteria | 1538 |
| 186 | Ga0068862_100004280 | 3300005844 | Bacteria | 12078 |
| 187 | Ga0068862_100025823 | 3300005844 | Bacteria | 4933 |
| 188 | Ga0068862_100127539 | 3300005844 | Bacteria | 2248 |
| 189 | Ga0068862_100152636 | 3300005844 | Bacteria | 2057 |
| 190 | Ga0068862_100168491 | 3300005844 | Bacteria | 1959 |
| 191 | Ga0068862_100225703 | 3300005844 | Bacteria | 1697 |
| 192 | Ga0068862_101008608 | 3300005844 | Bacteria | 824 |
| 193 | Ga0081455_10058018 | 3300005937 | Bacteria | 3278 |
| 194 | Ga0081455_10187169 | 3300005937 | Bacteria | 1563 |
| 195 | Ga0081455_10338177 | 3300005937 | Bacteria | 1066 |
| 196 | Ga0081539_10009375 | 3300005985 | Bacteria | 8199 |
| 197 | Ga0075432_10069884 | 3300006058 | Bacteria | 1260 |
| 198 | Ga0070716_100041817 | 3300006173 | Bacteria | 2556 |
| 199 | Ga0070712_100306496 | 3300006175 | Bacteria | 1287 |
| 200 | Ga0097621_100000066 | 3300006237 | Bacteria | 54619 |
| 201 | Ga0097621_100004862 | 3300006237 | Bacteria | 9415 |
| 202 | Ga0097621_100081888 | 3300006237 | Bacteria | 2687 |
| 203 | Ga0097621_100200610 | 3300006237 | Bacteria | 1732 |
| 204 | Ga0097621_100272309 | 3300006237 | Bacteria | 1488 |
| 205 | Ga0097621_100427467 | 3300006237 | Bacteria | 1190 |
| 206 | Ga0097621_100453499 | 3300006237 | Bacteria | 1156 |
| 207 | Ga0068871_100000170 | 3300006358 | Bacteria | 43522 |
| 208 | Ga0068871_100015954 | 3300006358 | Bacteria | 5643 |
| 209 | Ga0068871_100337008 | 3300006358 | Bacteria | 1331 |
| 210 | Ga0068871_100530007 | 3300006358 | Bacteria | 1065 |
| 211 | Ga0068871_100853584 | 3300006358 | Bacteria | 842 |
| 212 | Ga0075428_100000003 | 3300006844 | Bacteria | 365483 |
| 213 | Ga0075428_100001358 | 3300006844 | Bacteria | 25978 |
| 214 | Ga0075428_100223106 | 3300006844 | Bacteria | 2035 |
| 215 | Ga0075428_100948243 | 3300006844 | Unclassified | 912 |
| 216 | Ga0075430_101024709 | 3300006846 | Bacteria | 680 |
| 217 | Ga0075431_100009235 | 3300006847 | Bacteria | 9896 |
| 218 | Ga0075431_100046411 | 3300006847 | Bacteria | 4480 |
| 219 | Ga0075431_100225036 | 3300006847 | Bacteria | 1913 |
| 220 | Ga0075431_100601125 | 3300006847 | Bacteria | 1084 |
| 221 | Ga0075431_101049007 | 3300006847 | Bacteria | 781 |
| 222 | Ga0075433_10012184 | 3300006852 | Bacteria | 6933 |
| 223 | Ga0075433_10101463 | 3300006852 | Bacteria | 2548 |
| 224 | Ga0075433_10288384 | 3300006852 | Bacteria | 1454 |
| 225 | Ga0075433_10540358 | 3300006852 | Bacteria | 1025 |
| 226 | Ga0075433_10742730 | 3300006852 | Bacteria | 858 |
| 227 | Ga0075433_10911636 | 3300006852 | Bacteria | 766 |
| 228 | Ga0075434_100000260 | 3300006871 | Bacteria | 37408 |
| 229 | Ga0075434_100049926 | 3300006871 | Bacteria | 4155 |
| 230 | Ga0075434_100119221 | 3300006871 | Bacteria | 2653 |
| 231 | Ga0075434_100201344 | 3300006871 | Bacteria | 2011 |
| 232 | Ga0075434_100221818 | 3300006871 | Bacteria | 1910 |
| 233 | Ga0075434_100645727 | 3300006871 | Bacteria | 1077 |
| 234 | Ga0075434_100734992 | 3300006871 | Bacteria | 1004 |
| 235 | Ga0075429_100095845 | 3300006880 | Bacteria | 2588 |
| 236 | Ga0075429_100416474 | 3300006880 | Bacteria | 1177 |
| 237 | Ga0075429_100913907 | 3300006880 | Bacteria | 768 |
| 238 | Ga0068865_100021831 | 3300006881 | Bacteria | 4167 |
| 239 | Ga0068865_100032362 | 3300006881 | Bacteria | 3492 |
| 240 | Ga0068865_100163612 | 3300006881 | Bacteria | 1699 |
| 241 | Ga0075436_100036450 | 3300006914 | Bacteria | 3394 |
| 242 | Ga0075436_100104702 | 3300006914 | Bacteria | 1972 |
| 243 | Ga0075436_100388785 | 3300006914 | Bacteria | 1009 |
| 244 | Ga0075436_100531818 | 3300006914 | Bacteria | 862 |
| 245 | Ga0097620_100091552 | 3300006931 | Bacteria | 3092 |
| 246 | Ga0097620_100145711 | 3300006931 | Bacteria | 2443 |
| 247 | Ga0097620_100253429 | 3300006931 | Bacteria | 1850 |
| 248 | Ga0097620_100303565 | 3300006931 | Bacteria | 1690 |
| 249 | Ga0097620_100536020 | 3300006931 | Bacteria | 1265 |
| 250 | Ga0097620_100609196 | 3300006931 | Bacteria | 1185 |
| 251 | Ga0097620_101385411 | 3300006931 | Bacteria | 775 |
| 252 | Ga0075435_100000064 | 3300007076 | Bacteria | 54706 |
| 253 | Ga0075435_100000956 | 3300007076 | Bacteria | 18244 |
| 254 | Ga0075435_100001486 | 3300007076 | Bacteria | 15064 |
| 255 | Ga0075435_100009317 | 3300007076 | Bacteria | 7100 |
| 256 | Ga0075435_100030037 | 3300007076 | Bacteria | 4270 |
| 257 | Ga0075435_100080563 | 3300007076 | Bacteria | 2673 |
| 258 | Ga0075435_100198882 | 3300007076 | Bacteria | 1698 |
| 259 | Ga0075435_100235627 | 3300007076 | Bacteria | 1556 |
| 260 | Ga0075435_100263137 | 3300007076 | Bacteria | 1470 |
| 261 | Ga0075435_100775402 | 3300007076 | Bacteria | 834 |
| 262 | Ga0105251_10208200 | 3300009011 | Unclassified | 881 |
| 263 | Ga0105240_10043908 | 3300009093 | Bacteria | 5684 |
| 264 | Ga0105240_10199012 | 3300009093 | Bacteria | 2350 |
| 265 | Ga0105240_10276151 | 3300009093 | Bacteria | 1933 |
| 266 | Ga0105240_10450925 | 3300009093 | Bacteria | 1439 |
| 267 | Ga0105240_10864923 | 3300009093 | Bacteria | 975 |
| 268 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 269 | Ga0111539_10002104 | 3300009094 | Bacteria | 26607 |
| 270 | Ga0111539_10024645 | 3300009094 | Bacteria | 7379 |
| 271 | Ga0111539_10074840 | 3300009094 | Bacteria | 3990 |
| 272 | Ga0111539_10098674 | 3300009094 | Bacteria | 3430 |
| 273 | Ga0111539_10442227 | 3300009094 | Bacteria | 1514 |
| 274 | Ga0105245_10068047 | 3300009098 | Bacteria | 3226 |
| 275 | Ga0105245_11132201 | 3300009098 | Bacteria | 829 |
| 276 | Ga0105247_10055248 | 3300009101 | Bacteria | 2451 |
| 277 | Ga0114129_10006049 | 3300009147 | Bacteria | 17157 |
| 278 | Ga0114129_10007288 | 3300009147 | Bacteria | 15747 |
| 279 | Ga0114129_10028743 | 3300009147 | Bacteria | 7877 |
| 280 | Ga0114129_10032021 | 3300009147 | Bacteria | 7433 |
| 281 | Ga0114129_10041259 | 3300009147 | Bacteria | 6503 |
| 282 | Ga0114129_10048371 | 3300009147 | Bacteria | 5975 |
| 283 | Ga0114129_10065109 | 3300009147 | Bacteria | 5087 |
| 284 | Ga0114129_10072782 | 3300009147 | Bacteria | 4790 |
| 285 | Ga0114129_10085215 | 3300009147 | Bacteria | 4384 |
| 286 | Ga0114129_10865377 | 3300009147 | Bacteria | 1148 |
| 287 | Ga0114129_10878379 | 3300009147 | Bacteria | 1138 |
| 288 | Ga0105243_10006872 | 3300009148 | Bacteria | 8771 |
| 289 | Ga0105241_10551432 | 3300009174 | Bacteria | 1035 |
| 290 | Ga0105242_10001351 | 3300009176 | Bacteria | 19349 |
| 291 | Ga0105242_10031995 | 3300009176 | Bacteria | 4205 |
| 292 | Ga0105242_10137415 | 3300009176 | Bacteria | 2117 |
| 293 | Ga0105242_10172432 | 3300009176 | Bacteria | 1902 |
| 294 | Ga0105242_10223217 | 3300009176 | Bacteria | 1685 |
| 295 | Ga0105248_10019171 | 3300009177 | Bacteria | 7568 |
| 296 | Ga0105248_10022784 | 3300009177 | Bacteria | 6951 |
| 297 | Ga0105248_10077836 | 3300009177 | Bacteria | 3729 |
| 298 | Ga0105248_10087056 | 3300009177 | Bacteria | 3515 |
| 299 | Ga0105248_10099091 | 3300009177 | Bacteria | 3284 |
| 300 | Ga0105248_10203570 | 3300009177 | Bacteria | 2230 |
| 301 | Ga0105248_10215838 | 3300009177 | Bacteria | 2161 |
| 302 | Ga0105248_10224887 | 3300009177 | Bacteria | 2112 |
| 303 | Ga0105248_10333938 | 3300009177 | Bacteria | 1707 |
| 304 | Ga0105248_10447650 | 3300009177 | Bacteria | 1455 |
| 305 | Ga0105248_10530127 | 3300009177 | Bacteria | 1328 |
| 306 | Ga0105248_10593224 | 3300009177 | Bacteria | 1250 |
| 307 | Ga0105238_10207226 | 3300009551 | Bacteria | 1937 |
| 308 | Ga0105238_10367596 | 3300009551 | Bacteria | 1428 |
| 309 | Ga0105238_10377020 | 3300009551 | Bacteria | 1410 |
| 310 | Ga0105238_10387080 | 3300009551 | Bacteria | 1390 |
| 311 | Ga0105249_10000688 | 3300009553 | Bacteria | 30761 |
| 312 | Ga0105249_10059463 | 3300009553 | Bacteria | 3505 |
| 313 | Ga0105249_10393036 | 3300009553 | Bacteria | 1415 |
| 314 | Ga0105249_10749306 | 3300009553 | Bacteria | 1039 |
| 315 | Ga0105249_11116655 | 3300009553 | Bacteria | 859 |
| 316 | Ga0105249_11647101 | 3300009553 | Bacteria | 714 |
| 317 | Ga0105239_10288919 | 3300010375 | Bacteria | 1847 |
| 318 | Ga0105239_10434181 | 3300010375 | Bacteria | 1489 |
| 319 | Ga0105246_10167694 | 3300011119 | Bacteria | 1679 |
| 320 | Ga0105246_10391354 | 3300011119 | Bacteria | 1151 |
| 321 | Ga0105246_10419679 | 3300011119 | Bacteria | 1116 |
| 322 | Ga0157374_10048498 | 3300013296 | Bacteria | 3940 |
| 323 | Ga0157378_10115031 | 3300013297 | Bacteria | 2472 |
| 324 | Ga0157378_10982756 | 3300013297 | Bacteria | 878 |
| 325 | Ga0163162_10285217 | 3300013306 | Bacteria | 1783 |
| 326 | Ga0163162_10427928 | 3300013306 | Bacteria | 1456 |
| 327 | Ga0163162_10479723 | 3300013306 | Bacteria | 1375 |
| 328 | Ga0163162_11746668 | 3300013306 | Bacteria | 711 |
| 329 | Ga0157372_10644399 | 3300013307 | Bacteria | 1234 |
| 330 | Ga0157372_10844899 | 3300013307 | Bacteria | 1063 |
| 331 | Ga0157375_10119756 | 3300013308 | Bacteria | 2740 |
| 332 | Ga0157375_10425541 | 3300013308 | Bacteria | 1494 |
| 333 | Ga0157375_10725113 | 3300013308 | Bacteria | 1147 |
| 334 | Ga0163163_10006749 | 3300014325 | Bacteria | 10061 |
| 335 | Ga0163163_10063166 | 3300014325 | Bacteria | 3671 |
| 336 | Ga0163163_10142721 | 3300014325 | Bacteria | 2437 |
| 337 | Ga0163163_10881232 | 3300014325 | Bacteria | 958 |
| 338 | Ga0157380_10034047 | 3300014326 | Bacteria | 3928 |
| 339 | Ga0157380_10189471 | 3300014326 | Bacteria | 1814 |
| 340 | Ga0157380_10859429 | 3300014326 | Bacteria | 930 |
| 341 | Ga0157380_11168831 | 3300014326 | Bacteria | 812 |
| 342 | Ga0157377_10190314 | 3300014745 | Bacteria | 1296 |
| 343 | Ga0157377_10204807 | 3300014745 | Bacteria | 1255 |
| 344 | Ga0157379_10049621 | 3300014968 | Bacteria | 3748 |
| 345 | Ga0157379_10070958 | 3300014968 | Bacteria | 3117 |
| 346 | Ga0157379_10211338 | 3300014968 | Bacteria | 1756 |
| 347 | Ga0157379_10418094 | 3300014968 | Bacteria | 1234 |
| 348 | Ga0157376_10021091 | 3300014969 | Bacteria | 5056 |
| 349 | Ga0157376_10120872 | 3300014969 | Bacteria | 2321 |
| 350 | Ga0157376_10210051 | 3300014969 | Bacteria | 1796 |
| 351 | Ga0157376_10482257 | 3300014969 | Bacteria | 1215 |
| 352 | Ga0157376_10623461 | 3300014969 | Bacteria | 1076 |
| 353 | Ga0163161_10074971 | 3300017792 | Bacteria | 2482 |
| 354 | Ga0207697_10183488 | 3300025315 | Unclassified | 918 |
| 355 | Ga0207682_10025795 | 3300025893 | Bacteria | 2332 |
| 356 | Ga0207642_10027711 | 3300025899 | Bacteria | 2322 |
| 357 | Ga0207642_10439120 | 3300025899 | Bacteria | 788 |
| 358 | Ga0207710_10069529 | 3300025900 | Bacteria | 1612 |
| 359 | Ga0207710_10105268 | 3300025900 | Bacteria | 1335 |
| 360 | Ga0207688_10330346 | 3300025901 | Bacteria | 937 |
| 361 | Ga0207680_10014285 | 3300025903 | Bacteria | 4104 |
| 362 | Ga0207680_10112271 | 3300025903 | Bacteria | 1770 |
| 363 | Ga0207680_10170713 | 3300025903 | Bacteria | 1465 |
| 364 | Ga0207699_10529356 | 3300025906 | Unclassified | 853 |
| 365 | Ga0207645_10005968 | 3300025907 | Bacteria | 8770 |
| 366 | Ga0207645_10276405 | 3300025907 | Bacteria | 1114 |
| 367 | Ga0207643_10066487 | 3300025908 | Bacteria | 2067 |
| 368 | Ga0207705_10373323 | 3300025909 | Bacteria | 1101 |
| 369 | Ga0207654_10633046 | 3300025911 | Bacteria | 765 |
| 370 | Ga0207707_10063397 | 3300025912 | Bacteria | 3217 |
| 371 | Ga0207707_10222517 | 3300025912 | Bacteria | 1643 |
| 372 | Ga0207707_10460636 | 3300025912 | Bacteria | 1087 |
| 373 | Ga0207707_10746528 | 3300025912 | Bacteria | 819 |
| 374 | Ga0207695_10451887 | 3300025913 | Bacteria | 1168 |
| 375 | Ga0207663_10067550 | 3300025916 | Bacteria | 2293 |
| 376 | Ga0207660_10201874 | 3300025917 | Bacteria | 1553 |
| 377 | Ga0207662_10035840 | 3300025918 | Bacteria | 2899 |
| 378 | Ga0207662_10076398 | 3300025918 | Bacteria | 2036 |
| 379 | Ga0207662_10570760 | 3300025918 | Bacteria | 785 |
| 380 | Ga0207657_10127678 | 3300025919 | Bacteria | 2087 |
| 381 | Ga0207652_10061240 | 3300025921 | Bacteria | 3249 |
| 382 | Ga0207652_10072372 | 3300025921 | Bacteria | 2998 |
| 383 | Ga0207646_10042536 | 3300025922 | Bacteria | 4081 |
| 384 | Ga0207646_10066661 | 3300025922 | Bacteria | 3214 |
| 385 | Ga0207646_10234644 | 3300025922 | Bacteria | 1657 |
| 386 | Ga0207681_10023583 | 3300025923 | Bacteria | 3938 |
| 387 | Ga0207681_10030491 | 3300025923 | Bacteria | 3516 |
| 388 | Ga0207681_10238130 | 3300025923 | Bacteria | 1415 |
| 389 | Ga0207681_10514216 | 3300025923 | Bacteria | 982 |
| 390 | Ga0207681_10596736 | 3300025923 | Bacteria | 912 |
| 391 | Ga0207694_10217945 | 3300025924 | Bacteria | 1556 |
| 392 | Ga0207694_10320097 | 3300025924 | Bacteria | 1280 |
| 393 | Ga0207650_10019273 | 3300025925 | Bacteria | 4791 |
| 394 | Ga0207650_10022579 | 3300025925 | Bacteria | 4454 |
| 395 | Ga0207650_10100187 | 3300025925 | Bacteria | 2229 |
| 396 | Ga0207650_10114336 | 3300025925 | Bacteria | 2093 |
| 397 | Ga0207650_10187307 | 3300025925 | Bacteria | 1652 |
| 398 | Ga0207650_11116792 | 3300025925 | Bacteria | 671 |
| 399 | Ga0207659_10078119 | 3300025926 | Bacteria | 2438 |
| 400 | Ga0207659_10150489 | 3300025926 | Bacteria | 1817 |
| 401 | Ga0207659_10212040 | 3300025926 | Bacteria | 1553 |
| 402 | Ga0207659_10289199 | 3300025926 | Bacteria | 1342 |
| 403 | Ga0207659_10299750 | 3300025926 | Bacteria | 1320 |
| 404 | Ga0207659_11005346 | 3300025926 | Unclassified | 717 |
| 405 | Ga0207687_10072618 | 3300025927 | Bacteria | 2462 |
| 406 | Ga0207664_10064359 | 3300025929 | Bacteria | 2933 |
| 407 | Ga0207644_10026930 | 3300025931 | Bacteria | 3969 |
| 408 | Ga0207644_10031768 | 3300025931 | Bacteria | 3681 |
| 409 | Ga0207644_10107080 | 3300025931 | Bacteria | 2109 |
| 410 | Ga0207644_10195169 | 3300025931 | Bacteria | 1594 |
| 411 | Ga0207644_10329599 | 3300025931 | Bacteria | 1236 |
| 412 | Ga0207690_10172692 | 3300025932 | Bacteria | 1621 |
| 413 | Ga0207706_10124461 | 3300025933 | Bacteria | 2268 |
| 414 | Ga0207706_10142262 | 3300025933 | Bacteria | 2110 |
| 415 | Ga0207706_10271943 | 3300025933 | Bacteria | 1478 |
| 416 | Ga0207706_10348297 | 3300025933 | Bacteria | 1288 |
| 417 | Ga0207706_10545605 | 3300025933 | Bacteria | 998 |
| 418 | Ga0207686_10206673 | 3300025934 | Bacteria | 1409 |
| 419 | Ga0207686_10278301 | 3300025934 | Bacteria | 1234 |
| 420 | Ga0207686_10560960 | 3300025934 | Bacteria | 894 |
| 421 | Ga0207709_10056811 | 3300025935 | Bacteria | 2424 |
| 422 | Ga0207709_10677679 | 3300025935 | Bacteria | 823 |
| 423 | Ga0207670_10101565 | 3300025936 | Bacteria | 2055 |
| 424 | Ga0207669_10086810 | 3300025937 | Bacteria | 2024 |
| 425 | Ga0207669_10584577 | 3300025937 | Bacteria | 905 |
| 426 | Ga0207669_10681147 | 3300025937 | Bacteria | 843 |
| 427 | Ga0207669_10704385 | 3300025937 | Bacteria | 830 |
| 428 | Ga0207669_10779612 | 3300025937 | Unclassified | 791 |
| 429 | Ga0207704_10014059 | 3300025938 | Bacteria | 4031 |
| 430 | Ga0207704_10075926 | 3300025938 | Bacteria | 2151 |
| 431 | Ga0207704_10101818 | 3300025938 | Bacteria | 1917 |
| 432 | Ga0207704_10688735 | 3300025938 | Bacteria | 845 |
| 433 | Ga0207704_10714562 | 3300025938 | Bacteria | 831 |
| 434 | Ga0207665_10012342 | 3300025939 | Bacteria | 5612 |
| 435 | Ga0207691_10020300 | 3300025940 | Bacteria | 6283 |
| 436 | Ga0207691_10196469 | 3300025940 | Unclassified | 1757 |
| 437 | Ga0207691_10205126 | 3300025940 | Bacteria | 1715 |
| 438 | Ga0207711_10008875 | 3300025941 | Bacteria | 8407 |
| 439 | Ga0207711_10012469 | 3300025941 | Bacteria | 7064 |
| 440 | Ga0207711_10036340 | 3300025941 | Bacteria | 4180 |
| 441 | Ga0207711_10215803 | 3300025941 | Bacteria | 1753 |
| 442 | Ga0207711_10268562 | 3300025941 | Bacteria | 1569 |
| 443 | Ga0207711_10291277 | 3300025941 | Bacteria | 1505 |
| 444 | Ga0207711_10322740 | 3300025941 | Bacteria | 1427 |
| 445 | Ga0207711_10730992 | 3300025941 | Bacteria | 923 |
| 446 | Ga0207711_10808736 | 3300025941 | Bacteria | 873 |
| 447 | Ga0207711_10933818 | 3300025941 | Bacteria | 806 |
| 448 | Ga0207711_10994333 | 3300025941 | Bacteria | 778 |
| 449 | Ga0207689_10226837 | 3300025942 | Bacteria | 1544 |
| 450 | Ga0207689_10446730 | 3300025942 | Bacteria | 1080 |
| 451 | Ga0207661_10003551 | 3300025944 | Bacteria | 10836 |
| 452 | Ga0207661_10266390 | 3300025944 | Bacteria | 1528 |
| 453 | Ga0207661_10378100 | 3300025944 | Bacteria | 1282 |
| 454 | Ga0207679_10005303 | 3300025945 | Bacteria | 8086 |
| 455 | Ga0207679_10105085 | 3300025945 | Bacteria | 2217 |
| 456 | Ga0207679_10205448 | 3300025945 | Bacteria | 1648 |
| 457 | Ga0207679_10868746 | 3300025945 | Unclassified | 824 |
| 458 | Ga0207651_10074198 | 3300025960 | Bacteria | 2422 |
| 459 | Ga0207651_10077248 | 3300025960 | Bacteria | 2383 |
| 460 | Ga0207651_10243306 | 3300025960 | Bacteria | 1468 |
| 461 | Ga0207712_10298995 | 3300025961 | Bacteria | 1320 |
| 462 | Ga0207712_10813594 | 3300025961 | Bacteria | 822 |
| 463 | Ga0207668_10124869 | 3300025972 | Bacteria | 1955 |
| 464 | Ga0207668_10244030 | 3300025972 | Bacteria | 1455 |
| 465 | Ga0207640_10091380 | 3300025981 | Bacteria | 2109 |
| 466 | Ga0207640_10308322 | 3300025981 | Bacteria | 1255 |
| 467 | Ga0207658_10156413 | 3300025986 | Bacteria | 1863 |
| 468 | Ga0207658_10334916 | 3300025986 | Bacteria | 1314 |
| 469 | Ga0207658_10446924 | 3300025986 | Bacteria | 1144 |
| 470 | Ga0207658_10738898 | 3300025986 | Bacteria | 891 |
| 471 | Ga0207677_10092868 | 3300026023 | Bacteria | 2198 |
| 472 | Ga0207703_10023951 | 3300026035 | Bacteria | 4802 |
| 473 | Ga0207703_10039756 | 3300026035 | Bacteria | 3760 |
| 474 | Ga0207703_10125566 | 3300026035 | Bacteria | 2209 |
| 475 | Ga0207703_10728641 | 3300026035 | Bacteria | 944 |
| 476 | Ga0207639_10102694 | 3300026041 | Bacteria | 2315 |
| 477 | Ga0207639_10320339 | 3300026041 | Bacteria | 1376 |
| 478 | Ga0207678_10191875 | 3300026067 | Bacteria | 1746 |
| 479 | Ga0207678_10443220 | 3300026067 | Bacteria | 1128 |
| 480 | Ga0207678_10712885 | 3300026067 | Bacteria | 883 |
| 481 | Ga0207708_10032701 | 3300026075 | Bacteria | 3949 |
| 482 | Ga0207708_10318845 | 3300026075 | Bacteria | 1268 |
| 483 | Ga0207708_10352005 | 3300026075 | Bacteria | 1208 |
| 484 | Ga0207708_10406892 | 3300026075 | Bacteria | 1126 |
| 485 | Ga0207708_10909075 | 3300026075 | Unclassified | 762 |
| 486 | Ga0207702_10008469 | 3300026078 | Bacteria | 8674 |
| 487 | Ga0207641_10004712 | 3300026088 | Bacteria | 11761 |
| 488 | Ga0207641_10163865 | 3300026088 | Bacteria | 2023 |
| 489 | Ga0207641_10204106 | 3300026088 | Bacteria | 1824 |
| 490 | Ga0207648_10032669 | 3300026089 | Bacteria | 4592 |
| 491 | Ga0207648_10190712 | 3300026089 | Bacteria | 1816 |
| 492 | Ga0207648_10395064 | 3300026089 | Bacteria | 1252 |
| 493 | Ga0207676_10050187 | 3300026095 | Bacteria | 3251 |
| 494 | Ga0207676_10181287 | 3300026095 | Bacteria | 1844 |
| 495 | Ga0207674_10202922 | 3300026116 | Bacteria | 1932 |
| 496 | Ga0207674_10446163 | 3300026116 | Bacteria | 1251 |
| 497 | Ga0207675_100022197 | 3300026118 | Bacteria | 5909 |
| 498 | Ga0207675_100226283 | 3300026118 | Bacteria | 1803 |
| 499 | Ga0207675_100282159 | 3300026118 | Bacteria | 1614 |
| 500 | Ga0207675_100328310 | 3300026118 | Bacteria | 1495 |
| 501 | Ga0207675_100354391 | 3300026118 | Bacteria | 1438 |
| 502 | Ga0207675_100451397 | 3300026118 | Bacteria | 1274 |
| 503 | Ga0207675_100452166 | 3300026118 | Bacteria | 1273 |
| 504 | Ga0207675_100500226 | 3300026118 | Bacteria | 1210 |
| 505 | Ga0207675_100540223 | 3300026118 | Bacteria | 1164 |
| 506 | Ga0207683_10018509 | 3300026121 | Bacteria | 5944 |
| 507 | Ga0207683_10025896 | 3300026121 | Bacteria | 5062 |
| 508 | Ga0207683_10081095 | 3300026121 | Bacteria | 2879 |
| 509 | Ga0207683_10152909 | 3300026121 | Bacteria | 2083 |
| 510 | Ga0207683_10214370 | 3300026121 | Bacteria | 1753 |
| 511 | Ga0207683_10359937 | 3300026121 | Bacteria | 1336 |
| 512 | Ga0207683_10640777 | 3300026121 | Bacteria | 984 |
| 513 | Ga0207698_10764689 | 3300026142 | Unclassified | 966 |
| 514 | Ga0207698_10818695 | 3300026142 | Bacteria | 934 |
| 515 | Ga0209971_1005801 | 3300027682 | Bacteria | 2926 |
| 516 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 517 | Ga0207428_10046677 | 3300027907 | Bacteria | 3483 |
| 518 | Ga0207428_10078208 | 3300027907 | Bacteria | 2588 |
| 519 | Ga0207428_10088773 | 3300027907 | Bacteria | 2404 |
| 520 | Ga0207428_10178434 | 3300027907 | Bacteria | 1605 |
| 521 | Ga0268266_10228936 | 3300028379 | Bacteria | 1711 |
| 522 | Ga0268266_10703705 | 3300028379 | Bacteria | 974 |
| 523 | Ga0268265_10005753 | 3300028380 | Bacteria | 8464 |
| 524 | Ga0268265_10061120 | 3300028380 | Bacteria | 2890 |
| 525 | Ga0268265_10071673 | 3300028380 | Bacteria | 2699 |
| 526 | Ga0268265_10182846 | 3300028380 | Unclassified | 1803 |
| 527 | Ga0268265_10246916 | 3300028380 | Bacteria | 1578 |
| 528 | Ga0268265_10307291 | 3300028380 | Bacteria | 1430 |
| 529 | Ga0268265_10490539 | 3300028380 | Bacteria | 1156 |
| 530 | Ga0268265_11527338 | 3300028380 | Bacteria | 672 |
| 531 | Ga0268264_10134387 | 3300028381 | Bacteria | 2197 |
| 532 | Ga0268264_10252644 | 3300028381 | Bacteria | 1638 |
| 533 | Ga0268264_10818894 | 3300028381 | Bacteria | 931 |
| 534 | Ga0265320_10153836 | 3300031240 | Bacteria | 1038 |
| 535 | Ga0307408_100866497 | 3300031548 | Bacteria | 824 |
| 536 | Ga0265314_10013713 | 3300031711 | Bacteria | 6534 |
| 537 | Ga0307416_100614390 | 3300032002 | Bacteria | 1168 |
| 538 | Ga0307414_10991689 | 3300032004 | Bacteria | 773 |
| 539 | Ga0307415_100326313 | 3300032126 | Bacteria | 1282 |
| 540 | Ga0373948_0032551 | 3300034817 | Bacteria | 1058 |
| 541 | Ga0373959_0003929 | 3300034820 | Bacteria | 2379 |
| 542 | Ga0373938_0012093 | 3300034957 | Bacteria | 1614 |
| 543 | Ga0373928_0001191 | 3300035084 | Bacteria | 5133 |
| 544 | Ga0373929_0000268 | 3300035085 | Bacteria | 9647 |
| 545 | Ga0373949_0003188 | 3300035090 | Bacteria | 3984 |
| 546 | Ga0373951_0001312 | 3300035091 | Bacteria | 6564 |
| 547 | Ga0373952_0000777 | 3300035092 | Bacteria | 5745 |
| 548 | Ga0373923_0179740 | 3300035111 | Bacteria | 972 |
| 549 | Ga0373932_0000945 | 3300035112 | Bacteria | 8512 |
| 550 | Ga0373939_0000488 | 3300035114 | Bacteria | 10011 |
| 551 | Ga0373939_0009737 | 3300035114 | Bacteria | 2389 |
| 552 | Ga0373941_0009542 | 3300035115 | Bacteria | 2448 |
| 553 | Ga0373945_0224724 | 3300035116 | Bacteria | 786 |
| 554 | Ga0373960_0000652 | 3300035121 | Bacteria | 7134 |
| 555 | Ga0373943_0434350 | 3300035170 | Bacteria | 761 |
| 556 | Ga0373942_0004030 | 3300035207 | Bacteria | 3429 |
| 557 | Ga0373942_0128744 | 3300035207 | Bacteria | 797 |
| 558 | Ga0373961_0001097 | 3300035241 | Bacteria | 8607 |
| 559 | Ga0373962_0000586 | 3300035242 | Bacteria | 8220 |
| 560 | Ga0373931_0000769 | 3300035691 | Bacteria | 13414 |
| 561 | Ga0373931_0267686 | 3300035691 | Bacteria | 1045 |
| 562 | Ga0373931_0422892 | 3300035691 | Bacteria | 847 |
| 563 | Ga0373935_0016157 | 3300035692 | Bacteria | 4518 |
| 564 | Ga0373947_0107141 | 3300035725 | Bacteria | 1762 |
| 565 | Ga0373937_0337926 | 3300036401 | Bacteria | 1426 |
| 566 | Ga0373937_0428246 | 3300036401 | Bacteria | 1256 |
| 567 | Ga0373937_0462021 | 3300036401 | Bacteria | 1206 |
| 568 | Ga0373937_0950372 | 3300036401 | Bacteria | 808 |
| 569 | Ga0373925_0064919 | 3300037068 | Bacteria | 2749 |
| 570 | Ga0395901_0828811 | 3300038443 | Bacteria | 912 |
| 571 | Ga0436360_0379591 | 3300039438 | Unclassified | 876 |
| 572 | Ga0436363_0340096 | 3300039450 | Bacteria | 1373 |
| 573 | Ga0450923_014261 | 3300042125 | Bacteria | 1473 |
| 574 | Ga0450896_001674 | 3300042133 | Bacteria | 2771 |
| 575 | Ga0450918_013685 | 3300042531 | Bacteria | 1411 |
| 576 | Ga0451577_0293325 | 3300042876 | Bacteria | 1474 |
| 577 | Ga0453683_0540690 | 3300044673 | Bacteria | 758 |
| 578 | Ga0451576_0079987 | 3300045051 | Bacteria | 3401 |
| 579 | Ga0451576_0419301 | 3300045051 | Bacteria | 1404 |
| 580 | Ga0451576_1800552 | 3300045051 | Bacteria | 633 |
| 581 | Ga0495592_0105109 | 3300046454 | Unclassified | 2006 |
| 582 | Ga0495603_0179976 | 3300046455 | Bacteria | 1223 |
| 583 | Ga0495629_0597008 | 3300046459 | Bacteria | 739 |
| 584 | Ga0495641_0032592 | 3300046461 | Bacteria | 2478 |
| 585 | Ga0495653_0186621 | 3300046463 | Bacteria | 1418 |
| 586 | Ga0495580_0287612 | 3300046472 | Bacteria | 1121 |
| 587 | Ga0495582_0157544 | 3300046473 | Bacteria | 1291 |
| 588 | Ga0495585_0394763 | 3300046492 | Unclassified | 667 |
| 589 | Ga0495628_0293564 | 3300046516 | Bacteria | 1204 |
| 590 | Ga0495644_0128176 | 3300046523 | Bacteria | 967 |
| 591 | Ga0495642_0090823 | 3300046528 | Bacteria | 1293 |
| 592 | Ga0495640_0113446 | 3300046533 | Bacteria | 1768 |
| 593 | Ga0495586_0405386 | 3300046535 | Bacteria | 785 |
| 594 | Ga0495645_0611104 | 3300046543 | Bacteria | 670 |
| 595 | Ga0495667_0243925 | 3300046559 | Bacteria | 1144 |
| 596 | Ga0495667_0292540 | 3300046559 | Bacteria | 1033 |
| 597 | Ga0495667_0561643 | 3300046559 | Bacteria | 713 |
| 598 | Ga0495656_0007853 | 3300046615 | Bacteria | 3791 |
| 599 | Ga0495668_0403034 | 3300046616 | Bacteria | 752 |
| 600 | Ga0495634_0028417 | 3300046642 | Bacteria | 3882 |
| 601 | Ga0495634_0558054 | 3300046642 | Bacteria | 667 |
| 602 | Ga0495635_0059317 | 3300046663 | Bacteria | 2631 |
| 603 | Ga0495659_0131930 | 3300046664 | Bacteria | 991 |
| 604 | Ga0495646_0176749 | 3300046680 | Bacteria | 1174 |
| 605 | Ga0495647_0026691 | 3300046681 | Unclassified | 2118 |
| 606 | Ga0495647_0206941 | 3300046681 | Unclassified | 862 |
| 607 | Ga0495658_0040220 | 3300046683 | Unclassified | 2599 |
| 608 | Ga0495658_0388732 | 3300046683 | Bacteria | 889 |
| 609 | Ga0495669_0169066 | 3300046684 | Bacteria | 1039 |
| 610 | Ga0495613_0126865 | 3300046689 | Bacteria | 1829 |
| 611 | Ga0495613_0572587 | 3300046689 | Unclassified | 754 |
| 612 | Ga0495674_0007981 | 3300047319 | Bacteria | 10101 |
| 613 | Ga0495674_0062170 | 3300047319 | Bacteria | 3252 |
| 614 | Ga0495674_0068429 | 3300047319 | Bacteria | 3073 |
| 615 | Ga0495680_0003636 | 3300047322 | Bacteria | 15062 |
| 616 | Ga0495684_0107881 | 3300047471 | Bacteria | 2103 |
| 617 | Ga0495602_0617355 | 3300048088 | Bacteria | 744 |
| 618 | Ga0496100_0096561 | 3300048903 | Bacteria | 2028 |
| 619 | Ga0496100_0805546 | 3300048903 | Bacteria | 736 |
| 620 | Ga0496101_0009325 | 3300048904 | Bacteria | 6447 |
| 621 | Ga0496102_0391561 | 3300048905 | Bacteria | 1307 |
| 622 | Ga0496104_0082818 | 3300048907 | Bacteria | 3060 |
| 623 | Ga0496104_0111413 | 3300048907 | Bacteria | 2624 |
| 624 | Ga0496104_0287112 | 3300048907 | Bacteria | 1558 |
| 625 | Ga0496104_0351278 | 3300048907 | Bacteria | 1387 |
| 626 | Ga0496104_0830732 | 3300048907 | Unclassified | 830 |
| 627 | Ga0496104_0923537 | 3300048907 | Unclassified | 778 |
| 628 | Ga0496105_0124319 | 3300048908 | Bacteria | 2127 |
| 629 | Ga0496105_0296437 | 3300048908 | Bacteria | 1301 |
| 630 | Ga0496106_0040814 | 3300048909 | Bacteria | 3477 |
| 631 | Ga0496106_0315408 | 3300048909 | Bacteria | 1255 |
| 632 | Ga0496107_0065627 | 3300048910 | Bacteria | 2632 |
| 633 | Ga0496108_0004831 | 3300048911 | Bacteria | 10873 |
| 634 | Ga0496108_0044963 | 3300048911 | Bacteria | 3687 |
| 635 | Ga0496108_0119376 | 3300048911 | Bacteria | 2261 |
| 636 | Ga0496108_0258864 | 3300048911 | Bacteria | 1514 |
| 637 | Ga0496109_0000242 | 3300048912 | Bacteria | 52965 |
| 638 | Ga0496109_0167629 | 3300048912 | Bacteria | 2060 |
| 639 | Ga0496109_0198657 | 3300048912 | Bacteria | 1885 |
| 640 | Ga0496109_0232488 | 3300048912 | Bacteria | 1734 |
| 641 | Ga0496109_0432126 | 3300048912 | Bacteria | 1244 |
| 642 | Ga0496109_1262175 | 3300048912 | Unclassified | 675 |
| 643 | Ga0496110_0001366 | 3300048913 | Bacteria | 17576 |
| 644 | Ga0496110_0004909 | 3300048913 | Bacteria | 10439 |
| 645 | Ga0496110_0913132 | 3300048913 | Bacteria | 784 |
| 646 | Ga0496111_0042971 | 3300048914 | Bacteria | 3247 |
| 647 | Ga0496112_0000481 | 3300048915 | Bacteria | 26754 |
| 648 | Ga0496112_0001340 | 3300048915 | Bacteria | 18727 |
| 649 | Ga0496112_0022194 | 3300048915 | Bacteria | 6049 |
| 650 | Ga0496112_0067435 | 3300048915 | Bacteria | 3532 |
| 651 | Ga0496112_1663619 | 3300048915 | Unclassified | 551 |
| 652 | Ga0496113_0041716 | 3300048916 | Bacteria | 3388 |
| 653 | Ga0496113_0113813 | 3300048916 | Bacteria | 2109 |
| 654 | Ga0496114_0181735 | 3300048917 | Bacteria | 1837 |
| 655 | Ga0496114_0402391 | 3300048917 | Bacteria | 1212 |
| 656 | Ga0496114_0428430 | 3300048917 | Bacteria | 1172 |
| 657 | Ga0501036_0354713 | 3300049572 | Bacteria | 1225 |
| 658 | Ga0501036_0421561 | 3300049572 | Bacteria | 1113 |
| 659 | Ga0501036_1013160 | 3300049572 | Bacteria | 680 |
| 660 | Ga0501040_0172021 | 3300049576 | Bacteria | 1534 |
| 661 | Ga0501040_0977537 | 3300049576 | Bacteria | 614 |
| 662 | Ga0501041_0446005 | 3300049577 | Unclassified | 821 |
| 663 | Ga0501043_0602214 | 3300049579 | Bacteria | 812 |
| 664 | Ga0501048_0072954 | 3300049582 | Bacteria | 2423 |
| 665 | Ga0501069_0170407 | 3300049585 | Bacteria | 1256 |
| 666 | Ga0501072_0301372 | 3300049588 | Bacteria | 1274 |
| 667 | Ga0501073_0001250 | 3300049589 | Bacteria | 18592 |
| 668 | Ga0501074_0069537 | 3300049590 | Bacteria | 2532 |
| 669 | Ga0501074_0384213 | 3300049590 | Bacteria | 996 |
| 670 | Ga0501075_0073759 | 3300049591 | Bacteria | 2581 |
| 671 | Ga0501075_0152714 | 3300049591 | Bacteria | 1760 |
| 672 | Ga0501076_0151173 | 3300049592 | Bacteria | 1889 |
| 673 | Ga0501081_0033914 | 3300049743 | Bacteria | 3471 |
| 674 | Ga0501081_0183996 | 3300049743 | Bacteria | 1512 |
| 675 | Ga0501081_0207195 | 3300049743 | Bacteria | 1423 |
| 676 | Ga0501035_0085009 | 3300049822 | Bacteria | 2790 |
| 677 | Ga0501045_0042038 | 3300049824 | Bacteria | 3327 |
| 678 | Ga0501045_0925251 | 3300049824 | Bacteria | 640 |
| 679 | nmdc:mga05p37_114810_c1 | 3300050507 | Bacteria | 3310 |
| 680 | nmdc:mga05p37_11912_c3 | 3300050507 | Bacteria | 4505 |
| 681 | nmdc:mga05p37_1467_c2 | 3300050507 | Bacteria | 5862 |
| 682 | nmdc:mga05p37_18492_c1 | 3300050507 | Bacteria | 8419 |
| 683 | nmdc:mga05p37_18511_c1 | 3300050507 | Bacteria | 8415 |
| 684 | nmdc:mga05p37_194142_c1 | 3300050507 | Bacteria | 2463 |
| 685 | nmdc:mga05p37_28505_c1 | 3300050507 | Bacteria | 6808 |
| 686 | nmdc:mga05p37_56816_c1 | 3300050507 | Bacteria | 4819 |
| 687 | nmdc:mga05p37_62951_c1 | 3300050507 | Bacteria | 4565 |
| 688 | nmdc:mga05p37_7758_c1 | 3300050507 | Bacteria | 12668 |
| 689 | nmdc:mga05p37_817852_c1 | 3300050507 | Bacteria | 1017 |
| 690 | nmdc:mga09592_126020_c2 | 3300050508 | Bacteria | 1237 |
| 691 | nmdc:mga09592_164309_c1 | 3300050508 | Bacteria | 1918 |
| 692 | nmdc:mga0qj67_153853_c1 | 3300050509 | Bacteria | 1866 |
| 693 | nmdc:mga06r32_16191_c1 | 3300050510 | Bacteria | 6792 |
| 694 | nmdc:mga06r32_269789_c1 | 3300050510 | Bacteria | 1689 |
| 695 | nmdc:mga06r32_395942_c1 | 3300050510 | Bacteria | 1363 |
| 696 | nmdc:mga06r32_72373_c1 | 3300050510 | Bacteria | 3337 |
| 697 | nmdc:mga08y16_29860_c1 | 3300050511 | Bacteria | 5741 |
| 698 | nmdc:mga08y16_329085_c1 | 3300050511 | Bacteria | 1572 |
| 699 | nmdc:mga08y16_389430_c1 | 3300050511 | Bacteria | 1428 |
| 700 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 701 | nmdc:mga08y16_55360_c1 | 3300050511 | Bacteria | 4145 |
| 702 | nmdc:mga08y16_62241_c1 | 3300050511 | Bacteria | 3897 |
| 703 | nmdc:mga0n895_110200_c1 | 3300050512 | Bacteria | 2768 |
| 704 | nmdc:mga0n895_12860_c1 | 3300050512 | Bacteria | 7521 |
| 705 | nmdc:mga0n895_130_c1 | 3300050512 | Bacteria | 44769 |
| 706 | nmdc:mga0n895_151333_c1 | 3300050512 | Bacteria | 2351 |
| 707 | nmdc:mga0n895_212572_c1 | 3300050512 | Bacteria | 1964 |
| 708 | nmdc:mga0n895_235605_c1 | 3300050512 | Bacteria | 1858 |
| 709 | nmdc:mga0n895_353422_c1 | 3300050512 | Bacteria | 1488 |
| 710 | nmdc:mga0n895_42297_c1 | 3300050512 | Bacteria | 4432 |
| 711 | nmdc:mga0n895_54417_c1 | 3300050512 | Bacteria | 3936 |
| 712 | nmdc:mga0n895_622501_c1 | 3300050512 | Bacteria | 1080 |
| 713 | nmdc:mga0n895_63626_c1 | 3300050512 | Bacteria | 3648 |
| 714 | nmdc:mga0n895_676607_c1 | 3300050512 | Bacteria | 1029 |
| 715 | nmdc:mga0n895_884930_c1 | 3300050512 | Bacteria | 879 |
| 716 | nmdc:mga0rr50_152691_c1 | 3300050513 | Bacteria | 1868 |
| 717 | nmdc:mga0rr50_42032_c1 | 3300050513 | Bacteria | 3335 |
| 718 | nmdc:mga0rr50_46863_c1 | 3300050513 | Bacteria | 3185 |
| 719 | nmdc:mga0rr50_49619_c1 | 3300050513 | Bacteria | 2508 |
| 720 | nmdc:mga0rr50_5366_c1 | 3300050513 | Bacteria | 7639 |
| 721 | nmdc:mga0rr50_5415_c1 | 3300050513 | Bacteria | 7609 |
| 722 | nmdc:mga0rr50_5_c1 | 3300050513 | Bacteria | 327169 |
| 723 | nmdc:mga0rr50_9595_c1 | 3300050513 | Bacteria | 6095 |
| 724 | nmdc:mga08x19_114381_c1 | 3300050514 | Bacteria | 1803 |
| 725 | nmdc:mga08x19_17692_c1 | 3300050514 | Bacteria | 4365 |
| 726 | nmdc:mga08x19_270_c1 | 3300050514 | Bacteria | 39380 |
| 727 | nmdc:mga08x19_311261_c1 | 3300050514 | Bacteria | 1095 |
| 728 | nmdc:mga08x19_476429_c1 | 3300050514 | Bacteria | 880 |
| 729 | nmdc:mga08x19_53421_c1 | 3300050514 | Bacteria | 2600 |
| 730 | nmdc:mga0a205_172898_c1 | 3300050515 | Bacteria | 2056 |
| 731 | nmdc:mga0a205_178980_c1 | 3300050515 | Bacteria | 2015 |
| 732 | nmdc:mga0a205_209536_c1 | 3300050515 | Bacteria | 1838 |
| 733 | nmdc:mga0a205_23800_c1 | 3300050515 | Bacteria | 5812 |
| 734 | nmdc:mga0a205_370252_c1 | 3300050515 | Unclassified | 1299 |
| 735 | nmdc:mga0a205_38026_c1 | 3300050515 | Bacteria | 4629 |
| 736 | nmdc:mga0a205_441250_c1 | 3300050515 | Bacteria | 1162 |
| 737 | nmdc:mga0a205_54185_c1 | 3300050515 | Bacteria | 3872 |
| 738 | nmdc:mga0a205_544813_c1 | 3300050515 | Bacteria | 1016 |
| 739 | nmdc:mga0a205_72644_c1 | 3300050515 | Bacteria | 3324 |
| 740 | Ga0495601_0083628 | 3300053077 | Bacteria | 2050 |
| 741 | Ga0495595_0013969 | 3300053084 | Bacteria | 3400 |
| 742 | Ga0495595_0155689 | 3300053084 | Bacteria | 1126 |
| 743 | Ga0495619_0005033 | 3300053085 | Bacteria | 8396 |
| 744 | Ga0495619_0051070 | 3300053085 | Bacteria | 2732 |
| 745 | Ga0495619_0112432 | 3300053085 | Bacteria | 1862 |
| 746 | Ga0495619_0187223 | 3300053085 | Bacteria | 1433 |
| 747 | Ga0501082_0061166 | 3300060353 | Bacteria | 3242 |
| 748 | Ga0501082_0137398 | 3300060353 | Bacteria | 2121 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_100240852 | Ga0068867_1002408521 | 154 |
| 2 | 3300005468 | Ga0070707_100199746 | Ga0070707_1001997462 | 154 |
| 3 | 3300005471 | Ga0070698_101090346 | Ga0070698_1010903461 | 154 |
| 4 | 3300025908 | Ga0207643_10066487 | Ga0207643_100664872 | 154 |
| 5 | 3300025922 | Ga0207646_10234644 | Ga0207646_102346442 | 154 |
| 6 | 3300026089 | Ga0207648_10190712 | Ga0207648_101907122 | 154 |
| 7 | 3300005295 | Ga0065707_10272809 | Ga0065707_102728092 | 155 |
| 8 | 3300005353 | Ga0070669_100076099 | Ga0070669_1000760992 | 155 |
| 9 | 3300005354 | Ga0070675_100140434 | Ga0070675_1001404342 | 155 |
| 10 | 3300005364 | Ga0070673_100067482 | Ga0070673_1000674824 | 155 |
| 11 | 3300005364 | Ga0070673_100607733 | Ga0070673_1006077331 | 155 |
| 12 | 3300005441 | Ga0070700_100165270 | Ga0070700_1001652702 | 155 |
| 13 | 3300005459 | Ga0068867_100400168 | Ga0068867_1004001682 | 155 |
| 14 | 3300005543 | Ga0070672_100440212 | Ga0070672_1004402122 | 155 |
| 15 | 3300005844 | Ga0068862_100168491 | Ga0068862_1001684912 | 155 |
| 16 | 3300005844 | Ga0068862_100225703 | Ga0068862_1002257031 | 155 |
| 17 | 3300006847 | Ga0075431_100046411 | Ga0075431_1000464114 | 155 |
| 18 | 3300009147 | Ga0114129_10032021 | Ga0114129_100320214 | 155 |
| 19 | 3300009553 | Ga0105249_10749306 | Ga0105249_107493062 | 155 |
| 20 | 3300009553 | Ga0105249_11647101 | Ga0105249_116471011 | 155 |
| 21 | 3300013306 | Ga0163162_11746668 | Ga0163162_117466681 | 155 |
| 22 | 3300025901 | Ga0207688_10330346 | Ga0207688_103303462 | 155 |
| 23 | 3300025923 | Ga0207681_10238130 | Ga0207681_102381302 | 155 |
| 24 | 3300025926 | Ga0207659_10212040 | Ga0207659_102120402 | 155 |
| 25 | 3300025960 | Ga0207651_10243306 | Ga0207651_102433062 | 155 |
| 26 | 3300026075 | Ga0207708_10032701 | Ga0207708_100327013 | 155 |
| 27 | 3300026118 | Ga0207675_100451397 | Ga0207675_1004513972 | 155 |
| 28 | 3300028380 | Ga0268265_10061120 | Ga0268265_100611203 | 155 |
| 29 | 3300028380 | Ga0268265_10307291 | Ga0268265_103072912 | 155 |
| 30 | 3300050507 | nmdc:mga05p37_18492_c1 | nmdc:mga05p37_18492_c1_4742_5311 | 155 |
| 31 | 3300050510 | nmdc:mga06r32_16191_c1 | nmdc:mga06r32_16191_c1_4321_4890 | 155 |
| 32 | 3300005339 | Ga0070660_100567599 | Ga0070660_1005675992 | 156 |
| 33 | 3300005440 | Ga0070705_100794924 | Ga0070705_1007949241 | 156 |
| 34 | 3300005445 | Ga0070708_100189798 | Ga0070708_1001897982 | 156 |
| 35 | 3300005548 | Ga0070665_100173101 | Ga0070665_1001731011 | 156 |
| 36 | 3300005718 | Ga0068866_10633127 | Ga0068866_106331272 | 156 |
| 37 | 3300005937 | Ga0081455_10187169 | Ga0081455_101871691 | 156 |
| 38 | 3300006844 | Ga0075428_100223106 | Ga0075428_1002231062 | 156 |
| 39 | 3300006844 | Ga0075428_100948243 | Ga0075428_1009482432 | 156 |
| 40 | 3300006846 | Ga0075430_101024709 | Ga0075430_1010247092 | 156 |
| 41 | 3300006847 | Ga0075431_100225036 | Ga0075431_1002250362 | 156 |
| 42 | 3300006852 | Ga0075433_10012184 | Ga0075433_100121848 | 156 |
| 43 | 3300006852 | Ga0075433_10742730 | Ga0075433_107427302 | 156 |
| 44 | 3300006871 | Ga0075434_100645727 | Ga0075434_1006457272 | 156 |
| 45 | 3300007076 | Ga0075435_100080563 | Ga0075435_1000805633 | 156 |
| 46 | 3300009094 | Ga0111539_10442227 | Ga0111539_104422272 | 156 |
| 47 | 3300009147 | Ga0114129_10006049 | Ga0114129_100060494 | 156 |
| 48 | 3300009147 | Ga0114129_10065109 | Ga0114129_100651094 | 156 |
| 49 | 3300031548 | Ga0307408_100866497 | Ga0307408_1008664972 | 156 |
| 50 | 3300046616 | Ga0495668_0403034 | Ga0495668_0403034_65_634 | 156 |
| 51 | 3300048909 | Ga0496106_0040814 | Ga0496106_0040814_2840_3409 | 156 |
| 52 | 3300050507 | nmdc:mga05p37_28505_c1 | nmdc:mga05p37_28505_c1_1988_2557 | 156 |
| 53 | 3300050507 | nmdc:mga05p37_7758_c1 | nmdc:mga05p37_7758_c1_6838_7407 | 156 |
| 54 | 3300050508 | nmdc:mga09592_126020_c2 | nmdc:mga09592_126020_c2_539_1108 | 156 |
| 55 | 3300050510 | nmdc:mga06r32_395942_c1 | nmdc:mga06r32_395942_c1_450_1019 | 156 |
| 56 | 3300050512 | nmdc:mga0n895_151333_c1 | nmdc:mga0n895_151333_c1_518_1087 | 156 |
| 57 | 3300050512 | nmdc:mga0n895_676607_c1 | nmdc:mga0n895_676607_c1_182_751 | 156 |
| 58 | 3300050514 | nmdc:mga08x19_114381_c1 | nmdc:mga08x19_114381_c1_253_822 | 156 |
| 59 | 3300050515 | nmdc:mga0a205_178980_c1 | nmdc:mga0a205_178980_c1_588_1157 | 156 |
| 60 | 3300050515 | nmdc:mga0a205_370252_c1 | nmdc:mga0a205_370252_c1_129_698 | 156 |
| 61 | 3300005327 | Ga0070658_10575796 | Ga0070658_105757962 | 157 |
| 62 | 3300005336 | Ga0070680_100079394 | Ga0070680_1000793942 | 157 |
| 63 | 3300005339 | Ga0070660_100130489 | Ga0070660_1001304891 | 157 |
| 64 | 3300005347 | Ga0070668_100104422 | Ga0070668_1001044221 | 157 |
| 65 | 3300005366 | Ga0070659_100169086 | Ga0070659_1001690862 | 157 |
| 66 | 3300005457 | Ga0070662_100292551 | Ga0070662_1002925512 | 157 |
| 67 | 3300005458 | Ga0070681_10541639 | Ga0070681_105416391 | 157 |
| 68 | 3300005466 | Ga0070685_10057586 | Ga0070685_100575862 | 157 |
| 69 | 3300005518 | Ga0070699_100048831 | Ga0070699_1000488313 | 157 |
| 70 | 3300005530 | Ga0070679_100165560 | Ga0070679_1001655602 | 157 |
| 71 | 3300005539 | Ga0068853_100257842 | Ga0068853_1002578422 | 157 |
| 72 | 3300005563 | Ga0068855_100024107 | Ga0068855_10002410711 | 157 |
| 73 | 3300005617 | Ga0068859_101385408 | Ga0068859_1013854081 | 157 |
| 74 | 3300005844 | Ga0068862_100025823 | Ga0068862_1000258234 | 157 |
| 75 | 3300006058 | Ga0075432_10069884 | Ga0075432_100698842 | 157 |
| 76 | 3300006871 | Ga0075434_100221818 | Ga0075434_1002218182 | 157 |
| 77 | 3300006931 | Ga0097620_101385411 | Ga0097620_1013854111 | 157 |
| 78 | 3300007076 | Ga0075435_100000956 | Ga0075435_1000009565 | 157 |
| 79 | 3300009093 | Ga0105240_10199012 | Ga0105240_101990123 | 157 |
| 80 | 3300009093 | Ga0105240_10864923 | Ga0105240_108649232 | 157 |
| 81 | 3300009551 | Ga0105238_10377020 | Ga0105238_103770202 | 157 |
| 82 | 3300014326 | Ga0157380_10189471 | Ga0157380_101894712 | 157 |
| 83 | 3300014326 | Ga0157380_10859429 | Ga0157380_108594292 | 157 |
| 84 | 3300025909 | Ga0207705_10373323 | Ga0207705_103733231 | 157 |
| 85 | 3300025912 | Ga0207707_10460636 | Ga0207707_104606361 | 157 |
| 86 | 3300025917 | Ga0207660_10201874 | Ga0207660_102018742 | 157 |
| 87 | 3300025921 | Ga0207652_10061240 | Ga0207652_100612402 | 157 |
| 88 | 3300025922 | Ga0207646_10042536 | Ga0207646_100425365 | 157 |
| 89 | 3300025923 | Ga0207681_10023583 | Ga0207681_100235835 | 157 |
| 90 | 3300025932 | Ga0207690_10172692 | Ga0207690_101726922 | 157 |
| 91 | 3300025933 | Ga0207706_10271943 | Ga0207706_102719432 | 157 |
| 92 | 3300026075 | Ga0207708_10318845 | Ga0207708_103188452 | 157 |
| 93 | 3300027907 | Ga0207428_10046677 | Ga0207428_100466772 | 157 |
| 94 | 3300028380 | Ga0268265_10246916 | Ga0268265_102469162 | 157 |
| 95 | 3300048907 | Ga0496104_0830732 | Ga0496104_0830732_216_785 | 157 |
| 96 | 3300050511 | nmdc:mga08y16_62241_c1 | nmdc:mga08y16_62241_c1_713_1282 | 157 |
| 97 | 3300050512 | nmdc:mga0n895_63626_c1 | nmdc:mga0n895_63626_c1_817_1386 | 157 |
| 98 | 3300050513 | nmdc:mga0rr50_5366_c1 | nmdc:mga0rr50_5366_c1_6538_7107 | 157 |
| 99 | 3300050515 | nmdc:mga0a205_38026_c1 | nmdc:mga0a205_38026_c1_541_1110 | 157 |
| 100 | 3300005290 | Ga0065712_10155174 | Ga0065712_101551742 | 158 |
| 101 | 3300005293 | Ga0065715_10189832 | Ga0065715_101898321 | 158 |
| 102 | 3300005440 | Ga0070705_100067347 | Ga0070705_1000673473 | 158 |
| 103 | 3300005539 | Ga0068853_100117095 | Ga0068853_1001170952 | 158 |
| 104 | 3300005564 | Ga0070664_100368763 | Ga0070664_1003687632 | 158 |
| 105 | 3300005614 | Ga0068856_100012203 | Ga0068856_1000122039 | 158 |
| 106 | 3300005618 | Ga0068864_100014824 | Ga0068864_1000148244 | 158 |
| 107 | 3300005842 | Ga0068858_100424946 | Ga0068858_1004249462 | 158 |
| 108 | 3300006871 | Ga0075434_100000260 | Ga0075434_10000026031 | 158 |
| 109 | 3300007076 | Ga0075435_100000064 | Ga0075435_10000006439 | 158 |
| 110 | 3300009101 | Ga0105247_10055248 | Ga0105247_100552483 | 158 |
| 111 | 3300009177 | Ga0105248_10019171 | Ga0105248_100191712 | 158 |
| 112 | 3300009551 | Ga0105238_10387080 | Ga0105238_103870802 | 158 |
| 113 | 3300009553 | Ga0105249_11116655 | Ga0105249_111166551 | 158 |
| 114 | 3300011119 | Ga0105246_10167694 | Ga0105246_101676942 | 158 |
| 115 | 3300013307 | Ga0157372_10844899 | Ga0157372_108448992 | 158 |
| 116 | 3300014325 | Ga0163163_10006749 | Ga0163163_100067499 | 158 |
| 117 | 3300014325 | Ga0163163_10142721 | Ga0163163_101427212 | 158 |
| 118 | 3300014745 | Ga0157377_10190314 | Ga0157377_101903142 | 158 |
| 119 | 3300014968 | Ga0157379_10211338 | Ga0157379_102113382 | 158 |
| 120 | 3300025900 | Ga0207710_10105268 | Ga0207710_101052681 | 158 |
| 121 | 3300025924 | Ga0207694_10320097 | Ga0207694_103200972 | 158 |
| 122 | 3300025925 | Ga0207650_10114336 | Ga0207650_101143363 | 158 |
| 123 | 3300025941 | Ga0207711_10008875 | Ga0207711_1000887511 | 158 |
| 124 | 3300025945 | Ga0207679_10205448 | Ga0207679_102054482 | 158 |
| 125 | 3300026035 | Ga0207703_10039756 | Ga0207703_100397564 | 158 |
| 126 | 3300026041 | Ga0207639_10102694 | Ga0207639_101026942 | 158 |
| 127 | 3300026078 | Ga0207702_10008469 | Ga0207702_100084699 | 158 |
| 128 | 3300026118 | Ga0207675_100282159 | Ga0207675_1002821592 | 158 |
| 129 | 3300026118 | Ga0207675_100500226 | Ga0207675_1005002262 | 158 |
| 130 | 3300048909 | Ga0496106_0315408 | Ga0496106_0315408_639_1208 | 158 |
| 131 | 3300048911 | Ga0496108_0258864 | Ga0496108_0258864_148_717 | 158 |
| 132 | 3300048912 | Ga0496109_0432126 | Ga0496109_0432126_26_595 | 158 |
| 133 | 3300048915 | Ga0496112_0022194 | Ga0496112_0022194_3719_4288 | 158 |
| 134 | 3300048916 | Ga0496113_0113813 | Ga0496113_0113813_1374_1943 | 158 |
| 135 | 3300049589 | Ga0501073_0001250 | Ga0501073_0001250_10903_11472 | 158 |
| 136 | 3300049590 | Ga0501074_0069537 | Ga0501074_0069537_728_1297 | 158 |
| 137 | 3300050512 | nmdc:mga0n895_130_c1 | nmdc:mga0n895_130_c1_15931_16500 | 158 |
| 138 | 3300050512 | nmdc:mga0n895_42297_c1 | nmdc:mga0n895_42297_c1_3824_4393 | 158 |
| 139 | 3300050513 | nmdc:mga0rr50_5_c1 | nmdc:mga0rr50_5_c1_309023_309592 | 158 |
| 140 | 3300050514 | nmdc:mga08x19_270_c1 | nmdc:mga08x19_270_c1_32297_32866 | 158 |
| 141 | 3300050515 | nmdc:mga0a205_172898_c1 | nmdc:mga0a205_172898_c1_1516_2037 | 158 |
| 142 | 3300005329 | Ga0070683_100491740 | Ga0070683_1004917402 | 159 |
| 143 | 3300005330 | Ga0070690_100023302 | Ga0070690_1000233023 | 159 |
| 144 | 3300005335 | Ga0070666_10009157 | Ga0070666_100091573 | 159 |
| 145 | 3300005337 | Ga0070682_101241778 | Ga0070682_1012417781 | 159 |
| 146 | 3300005343 | Ga0070687_100326773 | Ga0070687_1003267731 | 159 |
| 147 | 3300005356 | Ga0070674_100358954 | Ga0070674_1003589542 | 159 |
| 148 | 3300005367 | Ga0070667_100235121 | Ga0070667_1002351211 | 159 |
| 149 | 3300005440 | Ga0070705_100200800 | Ga0070705_1002008002 | 159 |
| 150 | 3300005544 | Ga0070686_100025139 | Ga0070686_1000251393 | 159 |
| 151 | 3300005547 | Ga0070693_100537506 | Ga0070693_1005375062 | 159 |
| 152 | 3300005548 | Ga0070665_100305967 | Ga0070665_1003059672 | 159 |
| 153 | 3300005578 | Ga0068854_100050186 | Ga0068854_1000501862 | 159 |
| 154 | 3300005578 | Ga0068854_100639830 | Ga0068854_1006398301 | 159 |
| 155 | 3300005616 | Ga0068852_100436547 | Ga0068852_1004365471 | 159 |
| 156 | 3300005719 | Ga0068861_100793964 | Ga0068861_1007939642 | 159 |
| 157 | 3300005842 | Ga0068858_100788367 | Ga0068858_1007883672 | 159 |
| 158 | 3300007076 | Ga0075435_100001486 | Ga0075435_10000148616 | 159 |
| 159 | 3300009093 | Ga0105240_10276151 | Ga0105240_102761512 | 159 |
| 160 | 3300009093 | Ga0105240_10450925 | Ga0105240_104509252 | 159 |
| 161 | 3300009098 | Ga0105245_11132201 | Ga0105245_111322011 | 159 |
| 162 | 3300009177 | Ga0105248_10203570 | Ga0105248_102035702 | 159 |
| 163 | 3300009177 | Ga0105248_10333938 | Ga0105248_103339382 | 159 |
| 164 | 3300025903 | Ga0207680_10014285 | Ga0207680_100142854 | 159 |
| 165 | 3300025907 | Ga0207645_10005968 | Ga0207645_100059682 | 159 |
| 166 | 3300025913 | Ga0207695_10451887 | Ga0207695_104518871 | 159 |
| 167 | 3300025918 | Ga0207662_10035840 | Ga0207662_100358403 | 159 |
| 168 | 3300025918 | Ga0207662_10570760 | Ga0207662_105707601 | 159 |
| 169 | 3300025923 | Ga0207681_10596736 | Ga0207681_105967361 | 159 |
| 170 | 3300025925 | Ga0207650_10100187 | Ga0207650_101001874 | 159 |
| 171 | 3300025931 | Ga0207644_10107080 | Ga0207644_101070803 | 159 |
| 172 | 3300025937 | Ga0207669_10086810 | Ga0207669_100868102 | 159 |
| 173 | 3300025941 | Ga0207711_10268562 | Ga0207711_102685622 | 159 |
| 174 | 3300025944 | Ga0207661_10266390 | Ga0207661_102663901 | 159 |
| 175 | 3300025981 | Ga0207640_10091380 | Ga0207640_100913802 | 159 |
| 176 | 3300025981 | Ga0207640_10308322 | Ga0207640_103083221 | 159 |
| 177 | 3300026035 | Ga0207703_10728641 | Ga0207703_107286411 | 159 |
| 178 | 3300026118 | Ga0207675_100452166 | Ga0207675_1004521661 | 159 |
| 179 | 3300026142 | Ga0207698_10818695 | Ga0207698_108186951 | 159 |
| 180 | 3300028381 | Ga0268264_10818894 | Ga0268264_108188942 | 159 |
| 181 | 3300034820 | Ga0373959_0003929 | Ga0373959_0003929_1673_2242 | 159 |
| 182 | 3300034957 | Ga0373938_0012093 | Ga0373938_0012093_567_1136 | 159 |
| 183 | 3300035084 | Ga0373928_0001191 | Ga0373928_0001191_1872_2441 | 159 |
| 184 | 3300035085 | Ga0373929_0000268 | Ga0373929_0000268_1328_1897 | 159 |
| 185 | 3300035090 | Ga0373949_0003188 | Ga0373949_0003188_2163_2732 | 159 |
| 186 | 3300035091 | Ga0373951_0001312 | Ga0373951_0001312_2141_2710 | 159 |
| 187 | 3300035092 | Ga0373952_0000777 | Ga0373952_0000777_4990_5559 | 159 |
| 188 | 3300035112 | Ga0373932_0000945 | Ga0373932_0000945_7855_8424 | 159 |
| 189 | 3300035114 | Ga0373939_0000488 | Ga0373939_0000488_3253_3822 | 159 |
| 190 | 3300035115 | Ga0373941_0009542 | Ga0373941_0009542_175_744 | 159 |
| 191 | 3300035121 | Ga0373960_0000652 | Ga0373960_0000652_3951_4520 | 159 |
| 192 | 3300035207 | Ga0373942_0004030 | Ga0373942_0004030_43_612 | 159 |
| 193 | 3300035241 | Ga0373961_0001097 | Ga0373961_0001097_6556_7125 | 159 |
| 194 | 3300035242 | Ga0373962_0000586 | Ga0373962_0000586_1414_1983 | 159 |
| 195 | 3300035691 | Ga0373931_0000769 | Ga0373931_0000769_9160_9729 | 159 |
| 196 | 3300042876 | Ga0451577_0293325 | Ga0451577_0293325_710_1279 | 159 |
| 197 | 3300045051 | Ga0451576_0079987 | Ga0451576_0079987_1364_1933 | 159 |
| 198 | 3300048907 | Ga0496104_0351278 | Ga0496104_0351278_880_1359 | 159 |
| 199 | 3300048912 | Ga0496109_1262175 | Ga0496109_1262175_90_659 | 159 |
| 200 | 3300050512 | nmdc:mga0n895_622501_c1 | nmdc:mga0n895_622501_c1_100_669 | 159 |
| 201 | 3300050513 | nmdc:mga0rr50_5415_c1 | nmdc:mga0rr50_5415_c1_801_1370 | 159 |
| 202 | 3300050514 | nmdc:mga08x19_311261_c1 | nmdc:mga08x19_311261_c1_503_1072 | 159 |
| 203 | 3300004803 | Ga0058862_12374949 | Ga0058862_123749491 | 160 |
| 204 | 3300005290 | Ga0065712_10032885 | Ga0065712_100328852 | 160 |
| 205 | 3300005337 | Ga0070682_100148856 | Ga0070682_1001488562 | 160 |
| 206 | 3300005339 | Ga0070660_100012244 | Ga0070660_1000122448 | 160 |
| 207 | 3300005355 | Ga0070671_100005643 | Ga0070671_1000056438 | 160 |
| 208 | 3300005439 | Ga0070711_100084742 | Ga0070711_1000847423 | 160 |
| 209 | 3300005458 | Ga0070681_10022019 | Ga0070681_100220197 | 160 |
| 210 | 3300005459 | Ga0068867_100316304 | Ga0068867_1003163042 | 160 |
| 211 | 3300005471 | Ga0070698_100447627 | Ga0070698_1004476272 | 160 |
| 212 | 3300005539 | Ga0068853_100607363 | Ga0068853_1006073631 | 160 |
| 213 | 3300005841 | Ga0068863_100048499 | Ga0068863_1000484992 | 160 |
| 214 | 3300005842 | Ga0068858_100162878 | Ga0068858_1001628782 | 160 |
| 215 | 3300006852 | Ga0075433_10911636 | Ga0075433_109116361 | 160 |
| 216 | 3300009176 | Ga0105242_10172432 | Ga0105242_101724322 | 160 |
| 217 | 3300009177 | Ga0105248_10099091 | Ga0105248_100990912 | 160 |
| 218 | 3300009551 | Ga0105238_10207226 | Ga0105238_102072262 | 160 |
| 219 | 3300010375 | Ga0105239_10434181 | Ga0105239_104341812 | 160 |
| 220 | 3300013307 | Ga0157372_10644399 | Ga0157372_106443992 | 160 |
| 221 | 3300014325 | Ga0163163_10881232 | Ga0163163_108812321 | 160 |
| 222 | 3300014969 | Ga0157376_10120872 | Ga0157376_101208723 | 160 |
| 223 | 3300025912 | Ga0207707_10063397 | Ga0207707_100633972 | 160 |
| 224 | 3300025916 | Ga0207663_10067550 | Ga0207663_100675502 | 160 |
| 225 | 3300025919 | Ga0207657_10127678 | Ga0207657_101276782 | 160 |
| 226 | 3300025921 | Ga0207652_10072372 | Ga0207652_100723722 | 160 |
| 227 | 3300025924 | Ga0207694_10217945 | Ga0207694_102179452 | 160 |
| 228 | 3300025929 | Ga0207664_10064359 | Ga0207664_100643593 | 160 |
| 229 | 3300025945 | Ga0207679_10868746 | Ga0207679_108687461 | 160 |
| 230 | 3300026041 | Ga0207639_10320339 | Ga0207639_103203391 | 160 |
| 231 | 3300026116 | Ga0207674_10202922 | Ga0207674_102029222 | 160 |
| 232 | 3300027682 | Ga0209971_1005801 | Ga0209971_10058012 | 160 |
| 233 | 3300035692 | Ga0373935_0016157 | Ga0373935_0016157_259_828 | 160 |
| 234 | 3300035725 | Ga0373947_0107141 | Ga0373947_0107141_259_828 | 160 |
| 235 | 3300037068 | Ga0373925_0064919 | Ga0373925_0064919_1866_2435 | 160 |
| 236 | 3300046543 | Ga0495645_0611104 | Ga0495645_0611104_51_620 | 160 |
| 237 | 3300046559 | Ga0495667_0292540 | Ga0495667_0292540_434_1003 | 160 |
| 238 | 3300046684 | Ga0495669_0169066 | Ga0495669_0169066_445_1014 | 160 |
| 239 | 3300046689 | Ga0495613_0572587 | Ga0495613_0572587_35_604 | 160 |
| 240 | 3300048912 | Ga0496109_0167629 | Ga0496109_0167629_779_1348 | 160 |
| 241 | 3300048915 | Ga0496112_0067435 | Ga0496112_0067435_74_643 | 160 |
| 242 | 3300049591 | Ga0501075_0152714 | Ga0501075_0152714_88_657 | 160 |
| 243 | 3300049743 | Ga0501081_0183996 | Ga0501081_0183996_730_1299 | 160 |
| 244 | 3300053084 | Ga0495595_0155689 | Ga0495595_0155689_413_982 | 160 |
| 245 | 3300060353 | Ga0501082_0137398 | Ga0501082_0137398_1120_1689 | 160 |
| 246 | 3300002459 | JGI24751J29686_10001906 | JGI24751J29686_100019062 | 161 |
| 247 | 3300005331 | Ga0070670_100424196 | Ga0070670_1004241962 | 161 |
| 248 | 3300005338 | Ga0068868_100561835 | Ga0068868_1005618352 | 161 |
| 249 | 3300005340 | Ga0070689_100153008 | Ga0070689_1001530081 | 161 |
| 250 | 3300005455 | Ga0070663_100530915 | Ga0070663_1005309152 | 161 |
| 251 | 3300005468 | Ga0070707_100103003 | Ga0070707_1001030031 | 161 |
| 252 | 3300005617 | Ga0068859_100091550 | Ga0068859_1000915502 | 161 |
| 253 | 3300005618 | Ga0068864_100037415 | Ga0068864_1000374151 | 161 |
| 254 | 3300006871 | Ga0075434_100734992 | Ga0075434_1007349922 | 161 |
| 255 | 3300006881 | Ga0068865_100021831 | Ga0068865_1000218316 | 161 |
| 256 | 3300006931 | Ga0097620_100091552 | Ga0097620_1000915522 | 161 |
| 257 | 3300009094 | Ga0111539_10024645 | Ga0111539_100246454 | 161 |
| 258 | 3300025903 | Ga0207680_10112271 | Ga0207680_101122712 | 161 |
| 259 | 3300025922 | Ga0207646_10066661 | Ga0207646_100666613 | 161 |
| 260 | 3300025926 | Ga0207659_10299750 | Ga0207659_102997501 | 161 |
| 261 | 3300025931 | Ga0207644_10031768 | Ga0207644_100317682 | 161 |
| 262 | 3300025936 | Ga0207670_10101565 | Ga0207670_101015651 | 161 |
| 263 | 3300025938 | Ga0207704_10075926 | Ga0207704_100759262 | 161 |
| 264 | 3300025938 | Ga0207704_10688735 | Ga0207704_106887351 | 161 |
| 265 | 3300025941 | Ga0207711_10994333 | Ga0207711_109943332 | 161 |
| 266 | 3300026023 | Ga0207677_10092868 | Ga0207677_100928682 | 161 |
| 267 | 3300026035 | Ga0207703_10125566 | Ga0207703_101255662 | 161 |
| 268 | 3300026088 | Ga0207641_10004712 | Ga0207641_1000471214 | 161 |
| 269 | 3300026089 | Ga0207648_10395064 | Ga0207648_103950642 | 161 |
| 270 | 3300026095 | Ga0207676_10181287 | Ga0207676_101812873 | 161 |
| 271 | 3300026118 | Ga0207675_100022197 | Ga0207675_1000221976 | 161 |
| 272 | 3300027907 | Ga0207428_10178434 | Ga0207428_101784342 | 161 |
| 273 | 3300028380 | Ga0268265_10071673 | Ga0268265_100716734 | 161 |
| 274 | 3300034817 | Ga0373948_0032551 | Ga0373948_0032551_338_907 | 161 |
| 275 | 3300036401 | Ga0373937_0462021 | Ga0373937_0462021_268_837 | 161 |
| 276 | 3300036401 | Ga0373937_0950372 | Ga0373937_0950372_90_659 | 161 |
| 277 | 3300038443 | Ga0395901_0828811 | Ga0395901_0828811_21_590 | 161 |
| 278 | 3300046523 | Ga0495644_0128176 | Ga0495644_0128176_203_772 | 161 |
| 279 | 3300048088 | Ga0495602_0617355 | Ga0495602_0617355_65_634 | 161 |
| 280 | 3300050511 | nmdc:mga08y16_29860_c1 | nmdc:mga08y16_29860_c1_825_1394 | 161 |
| 281 | 3300050512 | nmdc:mga0n895_884930_c1 | nmdc:mga0n895_884930_c1_239_808 | 161 |
| 282 | 3300050515 | nmdc:mga0a205_544813_c1 | nmdc:mga0a205_544813_c1_127_696 | 161 |
| 283 | 3300053085 | Ga0495619_0051070 | Ga0495619_0051070_204_773 | 161 |
| 284 | 3300053085 | Ga0495619_0112432 | Ga0495619_0112432_629_1198 | 161 |
| 285 | 3300005445 | Ga0070708_100305319 | Ga0070708_1003053192 | 162 |
| 286 | 3300005546 | Ga0070696_100203222 | Ga0070696_1002032222 | 162 |
| 287 | 3300005718 | Ga0068866_10069885 | Ga0068866_100698852 | 162 |
| 288 | 3300006871 | Ga0075434_100119221 | Ga0075434_1001192213 | 162 |
| 289 | 3300007076 | Ga0075435_100030037 | Ga0075435_1000300374 | 162 |
| 290 | 3300009147 | Ga0114129_10878379 | Ga0114129_108783791 | 162 |
| 291 | 3300009148 | Ga0105243_10006872 | Ga0105243_100068727 | 162 |
| 292 | 3300009174 | Ga0105241_10551432 | Ga0105241_105514322 | 162 |
| 293 | 3300009176 | Ga0105242_10031995 | Ga0105242_100319951 | 162 |
| 294 | 3300009177 | Ga0105248_10215838 | Ga0105248_102158382 | 162 |
| 295 | 3300014326 | Ga0157380_10034047 | Ga0157380_100340471 | 162 |
| 296 | 3300025899 | Ga0207642_10439120 | Ga0207642_104391202 | 162 |
| 297 | 3300025911 | Ga0207654_10633046 | Ga0207654_106330461 | 162 |
| 298 | 3300025934 | Ga0207686_10278301 | Ga0207686_102783011 | 162 |
| 299 | 3300025935 | Ga0207709_10056811 | Ga0207709_100568114 | 162 |
| 300 | 3300025937 | Ga0207669_10584577 | Ga0207669_105845771 | 162 |
| 301 | 3300025941 | Ga0207711_10036340 | Ga0207711_100363406 | 162 |
| 302 | 3300025972 | Ga0207668_10124869 | Ga0207668_101248692 | 162 |
| 303 | 3300026118 | Ga0207675_100540223 | Ga0207675_1005402232 | 162 |
| 304 | 3300035114 | Ga0373939_0009737 | Ga0373939_0009737_1246_1815 | 162 |
| 305 | 3300046528 | Ga0495642_0090823 | Ga0495642_0090823_697_1269 | 162 |
| 306 | 3300048915 | Ga0496112_1663619 | Ga0496112_1663619_51_539 | 162 |
| 307 | 3300050507 | nmdc:mga05p37_62951_c1 | nmdc:mga05p37_62951_c1_198_767 | 162 |
| 308 | 3300050512 | nmdc:mga0n895_12860_c1 | nmdc:mga0n895_12860_c1_1131_1700 | 162 |
| 309 | 3300050513 | nmdc:mga0rr50_46863_c1 | nmdc:mga0rr50_46863_c1_1784_2353 | 162 |
| 310 | 3300050515 | nmdc:mga0a205_23800_c1 | nmdc:mga0a205_23800_c1_1528_2097 | 162 |
| 311 | 3300005364 | Ga0070673_101069890 | Ga0070673_1010698901 | 163 |
| 312 | 3300006237 | Ga0097621_100427467 | Ga0097621_1004274672 | 163 |
| 313 | 3300009177 | Ga0105248_10530127 | Ga0105248_105301272 | 163 |
| 314 | 3300013297 | Ga0157378_10115031 | Ga0157378_101150313 | 163 |
| 315 | 3300014968 | Ga0157379_10070958 | Ga0157379_100709581 | 163 |
| 316 | 3300025935 | Ga0207709_10677679 | Ga0207709_106776791 | 163 |
| 317 | 3300025941 | Ga0207711_10215803 | Ga0207711_102158032 | 163 |
| 318 | 3300025986 | Ga0207658_10156413 | Ga0207658_101564132 | 163 |
| 319 | 3300035691 | Ga0373931_0267686 | Ga0373931_0267686_76_645 | 163 |
| 320 | 3300035691 | Ga0373931_0422892 | Ga0373931_0422892_14_583 | 163 |
| 321 | 3300046472 | Ga0495580_0287612 | Ga0495580_0287612_23_592 | 163 |
| 322 | 3300046681 | Ga0495647_0026691 | Ga0495647_0026691_1373_1942 | 163 |
| 323 | 3300046683 | Ga0495658_0040220 | Ga0495658_0040220_1905_2474 | 163 |
| 324 | 3300005985 | Ga0081539_10009375 | Ga0081539_100093751 | 164 |
| 325 | 3300025933 | Ga0207706_10348297 | Ga0207706_103482972 | 164 |
| 326 | 3300048908 | Ga0496105_0296437 | Ga0496105_0296437_393_944 | 164 |
| 327 | 3300048917 | Ga0496114_0428430 | Ga0496114_0428430_59_610 | 164 |
| 328 | 3300050515 | nmdc:mga0a205_441250_c1 | nmdc:mga0a205_441250_c1_193_762 | 164 |
| 329 | 3300005445 | Ga0070708_100621696 | Ga0070708_1006216962 | 165 |
| 330 | 3300049579 | Ga0501043_0602214 | Ga0501043_0602214_22_543 | 165 |
| 331 | 3300005545 | Ga0070695_100461502 | Ga0070695_1004615022 | 166 |
| 332 | 3300006871 | Ga0075434_100049926 | Ga0075434_1000499263 | 166 |
| 333 | 3300006914 | Ga0075436_100388785 | Ga0075436_1003887852 | 166 |
| 334 | 3300007076 | Ga0075435_100009317 | Ga0075435_1000093172 | 166 |
| 335 | 3300046459 | Ga0495629_0597008 | Ga0495629_0597008_34_603 | 166 |
| 336 | 3300046533 | Ga0495640_0113446 | Ga0495640_0113446_282_851 | 166 |
| 337 | 3300046535 | Ga0495586_0405386 | Ga0495586_0405386_137_706 | 166 |
| 338 | 3300046559 | Ga0495667_0561643 | Ga0495667_0561643_97_666 | 166 |
| 339 | 3300046680 | Ga0495646_0176749 | Ga0495646_0176749_485_1054 | 166 |
| 340 | 3300050512 | nmdc:mga0n895_235605_c1 | nmdc:mga0n895_235605_c1_474_1043 | 166 |
| 341 | 3300050513 | nmdc:mga0rr50_152691_c1 | nmdc:mga0rr50_152691_c1_111_680 | 166 |
| 342 | 3300050514 | nmdc:mga08x19_17692_c1 | nmdc:mga08x19_17692_c1_2092_2661 | 166 |
| 343 | 3300005456 | Ga0070678_100086206 | Ga0070678_1000862062 | 167 |
| 344 | 3300005544 | Ga0070686_100795604 | Ga0070686_1007956042 | 167 |
| 345 | 3300005548 | Ga0070665_100009152 | Ga0070665_1000091529 | 167 |
| 346 | 3300005718 | Ga0068866_10042614 | Ga0068866_100426142 | 167 |
| 347 | 3300005844 | Ga0068862_101008608 | Ga0068862_1010086081 | 167 |
| 348 | 3300006237 | Ga0097621_100004862 | Ga0097621_1000048622 | 167 |
| 349 | 3300006358 | Ga0068871_100015954 | Ga0068871_1000159544 | 167 |
| 350 | 3300006881 | Ga0068865_100032362 | Ga0068865_1000323623 | 167 |
| 351 | 3300009098 | Ga0105245_10068047 | Ga0105245_100680474 | 167 |
| 352 | 3300009147 | Ga0114129_10028743 | Ga0114129_100287433 | 167 |
| 353 | 3300009176 | Ga0105242_10001351 | Ga0105242_100013514 | 167 |
| 354 | 3300009177 | Ga0105248_10447650 | Ga0105248_104476501 | 167 |
| 355 | 3300014969 | Ga0157376_10021091 | Ga0157376_100210913 | 167 |
| 356 | 3300025899 | Ga0207642_10027711 | Ga0207642_100277112 | 167 |
| 357 | 3300025934 | Ga0207686_10206673 | Ga0207686_102066732 | 167 |
| 358 | 3300025938 | Ga0207704_10101818 | Ga0207704_101018182 | 167 |
| 359 | 3300025938 | Ga0207704_10714562 | Ga0207704_107145622 | 167 |
| 360 | 3300025941 | Ga0207711_10933818 | Ga0207711_109338182 | 167 |
| 361 | 3300025942 | Ga0207689_10226837 | Ga0207689_102268372 | 167 |
| 362 | 3300026118 | Ga0207675_100354391 | Ga0207675_1003543912 | 167 |
| 363 | 3300026121 | Ga0207683_10152909 | Ga0207683_101529093 | 167 |
| 364 | 3300028380 | Ga0268265_11527338 | Ga0268265_115273381 | 167 |
| 365 | 3300035207 | Ga0373942_0128744 | Ga0373942_0128744_175_744 | 167 |
| 366 | 3300045051 | Ga0451576_0419301 | Ga0451576_0419301_93_662 | 167 |
| 367 | 3300048917 | Ga0496114_0402391 | Ga0496114_0402391_377_946 | 167 |
| 368 | 3300049743 | Ga0501081_0207195 | Ga0501081_0207195_78_644 | 167 |
| 369 | 3300049824 | Ga0501045_0925251 | Ga0501045_0925251_57_623 | 167 |
| 370 | 3300050507 | nmdc:mga05p37_56816_c1 | nmdc:mga05p37_56816_c1_1799_2368 | 167 |
| 371 | 3300050512 | nmdc:mga0n895_54417_c1 | nmdc:mga0n895_54417_c1_2412_2981 | 167 |
| 372 | 3300050515 | nmdc:mga0a205_209536_c1 | nmdc:mga0a205_209536_c1_1060_1629 | 167 |
| 373 | 3300005444 | Ga0070694_100766151 | Ga0070694_1007661511 | 168 |
| 374 | 3300035170 | Ga0373943_0434350 | Ga0373943_0434350_135_704 | 168 |
| 375 | 3300036401 | Ga0373937_0428246 | Ga0373937_0428246_616_1185 | 168 |
| 376 | 3300044673 | Ga0453683_0540690 | Ga0453683_0540690_166_735 | 168 |
| 377 | 3300046664 | Ga0495659_0131930 | Ga0495659_0131930_33_605 | 168 |
| 378 | 3300050512 | nmdc:mga0n895_212572_c1 | nmdc:mga0n895_212572_c1_36_605 | 168 |
| 379 | 3300050513 | nmdc:mga0rr50_42032_c1 | nmdc:mga0rr50_42032_c1_763_1332 | 168 |
| 380 | 3300005356 | Ga0070674_100427674 | Ga0070674_1004276742 | 169 |
| 381 | 3300005445 | Ga0070708_100924291 | Ga0070708_1009242911 | 169 |
| 382 | 3300005455 | Ga0070663_100299404 | Ga0070663_1002994042 | 169 |
| 383 | 3300005518 | Ga0070699_100011351 | Ga0070699_1000113517 | 169 |
| 384 | 3300006914 | Ga0075436_100036450 | Ga0075436_1000364504 | 169 |
| 385 | 3300007076 | Ga0075435_100263137 | Ga0075435_1002631372 | 169 |
| 386 | 3300007076 | Ga0075435_100775402 | Ga0075435_1007754022 | 169 |
| 387 | 3300009147 | Ga0114129_10041259 | Ga0114129_100412594 | 169 |
| 388 | 3300025937 | Ga0207669_10704385 | Ga0207669_107043852 | 169 |
| 389 | 3300026067 | Ga0207678_10191875 | Ga0207678_101918752 | 169 |
| 390 | 3300050507 | nmdc:mga05p37_114810_c1 | nmdc:mga05p37_114810_c1_2108_2677 | 169 |
| 391 | 3300050514 | nmdc:mga08x19_53421_c1 | nmdc:mga08x19_53421_c1_1228_1797 | 169 |
| 392 | 3300005445 | Ga0070708_100043579 | Ga0070708_1000435792 | 170 |
| 393 | 3300005468 | Ga0070707_100708928 | Ga0070707_1007089281 | 170 |
| 394 | 3300005471 | Ga0070698_100098715 | Ga0070698_1000987153 | 170 |
| 395 | 3300005842 | Ga0068858_100202811 | Ga0068858_1002028112 | 170 |
| 396 | 3300005471 | Ga0070698_100168353 | Ga0070698_1001683532 | 171 |
| 397 | 3300049585 | Ga0501069_0170407 | Ga0501069_0170407_377_946 | 171 |
| 398 | 3300005365 | Ga0070688_100016655 | Ga0070688_1000166555 | 172 |
| 399 | 3300005444 | Ga0070694_100026503 | Ga0070694_1000265034 | 172 |
| 400 | 3300005458 | Ga0070681_10252986 | Ga0070681_102529862 | 172 |
| 401 | 3300005468 | Ga0070707_100094736 | Ga0070707_1000947362 | 172 |
| 402 | 3300005545 | Ga0070695_100019190 | Ga0070695_1000191904 | 172 |
| 403 | 3300005546 | Ga0070696_100061896 | Ga0070696_1000618963 | 172 |
| 404 | 3300005549 | Ga0070704_101189696 | Ga0070704_1011896961 | 172 |
| 405 | 3300005617 | Ga0068859_100609161 | Ga0068859_1006091612 | 172 |
| 406 | 3300005618 | Ga0068864_100404962 | Ga0068864_1004049622 | 172 |
| 407 | 3300005937 | Ga0081455_10058018 | Ga0081455_100580183 | 172 |
| 408 | 3300006847 | Ga0075431_101049007 | Ga0075431_1010490071 | 172 |
| 409 | 3300006931 | Ga0097620_100609196 | Ga0097620_1006091962 | 172 |
| 410 | 3300009147 | Ga0114129_10007288 | Ga0114129_100072885 | 172 |
| 411 | 3300025912 | Ga0207707_10222517 | Ga0207707_102225172 | 172 |
| 412 | 3300035111 | Ga0373923_0179740 | Ga0373923_0179740_354_923 | 172 |
| 413 | 3300049576 | Ga0501040_0977537 | Ga0501040_0977537_83_601 | 172 |
| 414 | 3300050507 | nmdc:mga05p37_1467_c2 | nmdc:mga05p37_1467_c2_3211_3783 | 172 |
| 415 | 3300050515 | nmdc:mga0a205_54185_c1 | nmdc:mga0a205_54185_c1_992_1564 | 172 |
| 416 | 3300053085 | Ga0495619_0187223 | Ga0495619_0187223_689_1258 | 172 |
| 417 | 3300005467 | Ga0070706_100656173 | Ga0070706_1006561731 | 173 |
| 418 | 3300005546 | Ga0070696_100105885 | Ga0070696_1001058852 | 173 |
| 419 | 3300006852 | Ga0075433_10288384 | Ga0075433_102883842 | 173 |
| 420 | 3300009011 | Ga0105251_10208200 | Ga0105251_102082001 | 173 |
| 421 | 3300009147 | Ga0114129_10085215 | Ga0114129_100852152 | 173 |
| 422 | 3300046454 | Ga0495592_0105109 | Ga0495592_0105109_1456_1977 | 173 |
| 423 | 3300047319 | Ga0495674_0007981 | Ga0495674_0007981_9564_10085 | 173 |
| 424 | 3300049590 | Ga0501074_0384213 | Ga0501074_0384213_449_970 | 173 |
| 425 | 3300049592 | Ga0501076_0151173 | Ga0501076_0151173_1349_1870 | 173 |
| 426 | 3300050507 | nmdc:mga05p37_11912_c3 | nmdc:mga05p37_11912_c3_1007_1576 | 173 |
| 427 | 3300050513 | nmdc:mga0rr50_49619_c1 | nmdc:mga0rr50_49619_c1_1770_2291 | 173 |
| 428 | 3300005841 | Ga0068863_100112640 | Ga0068863_1001126402 | 174 |
| 429 | 3300006173 | Ga0070716_100041817 | Ga0070716_1000418172 | 174 |
| 430 | 3300006175 | Ga0070712_100306496 | Ga0070712_1003064962 | 174 |
| 431 | 3300006237 | Ga0097621_100000066 | Ga0097621_10000006644 | 174 |
| 432 | 3300006358 | Ga0068871_100000170 | Ga0068871_10000017021 | 174 |
| 433 | 3300006358 | Ga0068871_100337008 | Ga0068871_1003370081 | 174 |
| 434 | 3300006852 | Ga0075433_10540358 | Ga0075433_105403582 | 174 |
| 435 | 3300006880 | Ga0075429_100095845 | Ga0075429_1000958452 | 174 |
| 436 | 3300009147 | Ga0114129_10865377 | Ga0114129_108653771 | 174 |
| 437 | 3300009177 | Ga0105248_10224887 | Ga0105248_102248872 | 174 |
| 438 | 3300013308 | Ga0157375_10425541 | Ga0157375_104255412 | 174 |
| 439 | 3300025906 | Ga0207699_10529356 | Ga0207699_105293562 | 174 |
| 440 | 3300025939 | Ga0207665_10012342 | Ga0207665_100123424 | 174 |
| 441 | 3300026088 | Ga0207641_10163865 | Ga0207641_101638652 | 174 |
| 442 | 3300026121 | Ga0207683_10359937 | Ga0207683_103599372 | 174 |
| 443 | 3300027907 | Ga0207428_10088773 | Ga0207428_100887732 | 174 |
| 444 | 3300028380 | Ga0268265_10490539 | Ga0268265_104905392 | 174 |
| 445 | 3300032004 | Ga0307414_10991689 | Ga0307414_109916891 | 174 |
| 446 | 3300045051 | Ga0451576_1800552 | Ga0451576_1800552_26_595 | 174 |
| 447 | 3300050507 | nmdc:mga05p37_817852_c1 | nmdc:mga05p37_817852_c1_80_649 | 174 |
| 448 | 3300005471 | Ga0070698_100708319 | Ga0070698_1007083191 | 175 |
| 449 | 3300046681 | Ga0495647_0206941 | Ga0495647_0206941_203_772 | 175 |
| 450 | 3300050512 | nmdc:mga0n895_353422_c1 | nmdc:mga0n895_353422_c1_288_857 | 175 |
| 451 | 3300005458 | Ga0070681_10076512 | Ga0070681_100765121 | 176 |
| 452 | 3300005842 | Ga0068858_100013804 | Ga0068858_1000138046 | 176 |
| 453 | 3300014968 | Ga0157379_10049621 | Ga0157379_100496213 | 176 |
| 454 | 3300025912 | Ga0207707_10746528 | Ga0207707_107465281 | 176 |
| 455 | 3300026035 | Ga0207703_10023951 | Ga0207703_100239513 | 176 |
| 456 | 3300028381 | Ga0268264_10134387 | Ga0268264_101343873 | 176 |
| 457 | 3300006880 | Ga0075429_100913907 | Ga0075429_1009139071 | 177 |
| 458 | 3300009147 | Ga0114129_10048371 | Ga0114129_100483712 | 177 |
| 459 | 3300031240 | Ga0265320_10153836 | Ga0265320_101538362 | 177 |
| 460 | 3300046683 | Ga0495658_0388732 | Ga0495658_0388732_141_710 | 177 |
| 461 | 3300048907 | Ga0496104_0287112 | Ga0496104_0287112_341_910 | 177 |
| 462 | 3300049591 | Ga0501075_0073759 | Ga0501075_0073759_30_599 | 177 |
| 463 | 3300050507 | nmdc:mga05p37_194142_c1 | nmdc:mga05p37_194142_c1_1860_2429 | 177 |
| 464 | 3300006237 | Ga0097621_100200610 | Ga0097621_1002006102 | 178 |
| 465 | 3300014969 | Ga0157376_10210051 | Ga0157376_102100512 | 178 |
| 466 | 3300026075 | Ga0207708_10352005 | Ga0207708_103520052 | 178 |
| 467 | 3300042125 | Ga0450923_014261 | Ga0450923_014261_567_1136 | 179 |
| 468 | 3300042531 | Ga0450918_013685 | Ga0450918_013685_60_629 | 179 |
| 469 | 3300046492 | Ga0495585_0394763 | Ga0495585_0394763_46_615 | 179 |
| 470 | 3300046615 | Ga0495656_0007853 | Ga0495656_0007853_1772_2341 | 179 |
| 471 | 3300025907 | Ga0207645_10276405 | Ga0207645_102764052 | 180 |
| 472 | 3300032002 | Ga0307416_100614390 | Ga0307416_1006143901 | 180 |
| 473 | 3300032126 | Ga0307415_100326313 | Ga0307415_1003263132 | 180 |
| 474 | 3300005295 | Ga0065707_10101877 | Ga0065707_101018773 | 181 |
| 475 | 3300005329 | Ga0070683_100214025 | Ga0070683_1002140252 | 181 |
| 476 | 3300005330 | Ga0070690_100571123 | Ga0070690_1005711232 | 181 |
| 477 | 3300005331 | Ga0070670_100034706 | Ga0070670_1000347066 | 181 |
| 478 | 3300005335 | Ga0070666_10135228 | Ga0070666_101352281 | 181 |
| 479 | 3300005339 | Ga0070660_100723930 | Ga0070660_1007239301 | 181 |
| 480 | 3300005466 | Ga0070685_10552915 | Ga0070685_105529152 | 181 |
| 481 | 3300005535 | Ga0070684_100000085 | Ga0070684_1000000852 | 181 |
| 482 | 3300005543 | Ga0070672_100550322 | Ga0070672_1005503222 | 181 |
| 483 | 3300005548 | Ga0070665_101241110 | Ga0070665_1012411101 | 181 |
| 484 | 3300005564 | Ga0070664_100000442 | Ga0070664_1000004422 | 181 |
| 485 | 3300006358 | Ga0068871_100530007 | Ga0068871_1005300071 | 181 |
| 486 | 3300011119 | Ga0105246_10419679 | Ga0105246_104196792 | 181 |
| 487 | 3300013296 | Ga0157374_10048498 | Ga0157374_100484984 | 181 |
| 488 | 3300013306 | Ga0163162_10427928 | Ga0163162_104279282 | 181 |
| 489 | 3300014325 | Ga0163163_10063166 | Ga0163163_100631662 | 181 |
| 490 | 3300025903 | Ga0207680_10170713 | Ga0207680_101707132 | 181 |
| 491 | 3300025925 | Ga0207650_10019273 | Ga0207650_100192734 | 181 |
| 492 | 3300025931 | Ga0207644_10195169 | Ga0207644_101951691 | 181 |
| 493 | 3300025944 | Ga0207661_10003551 | Ga0207661_100035517 | 181 |
| 494 | 3300025945 | Ga0207679_10005303 | Ga0207679_100053035 | 181 |
| 495 | 3300028379 | Ga0268266_10703705 | Ga0268266_107037052 | 181 |
| 496 | 3300048907 | Ga0496104_0082818 | Ga0496104_0082818_1507_2076 | 181 |
| 497 | 3300048911 | Ga0496108_0004831 | Ga0496108_0004831_3822_4391 | 181 |
| 498 | 3300048912 | Ga0496109_0000242 | Ga0496109_0000242_11712_12281 | 181 |
| 499 | 3300048913 | Ga0496110_0001366 | Ga0496110_0001366_6386_6955 | 181 |
| 500 | 3300048914 | Ga0496111_0042971 | Ga0496111_0042971_960_1529 | 181 |
| 501 | 3300048915 | Ga0496112_0001340 | Ga0496112_0001340_5475_6044 | 181 |
| 502 | 3300005444 | Ga0070694_100464340 | Ga0070694_1004643402 | 182 |
| 503 | 3300006914 | Ga0075436_100104702 | Ga0075436_1001047022 | 182 |
| 504 | 3300025926 | Ga0207659_10150489 | Ga0207659_101504892 | 182 |
| 505 | 3300025937 | Ga0207669_10779612 | Ga0207669_107796122 | 182 |
| 506 | 3300025986 | Ga0207658_10334916 | Ga0207658_103349162 | 182 |
| 507 | 3300026121 | Ga0207683_10025896 | Ga0207683_100258963 | 182 |
| 508 | 3300005329 | Ga0070683_100422151 | Ga0070683_1004221512 | 183 |
| 509 | 3300009093 | Ga0105240_10043908 | Ga0105240_100439083 | 183 |
| 510 | 3300009551 | Ga0105238_10367596 | Ga0105238_103675962 | 183 |
| 511 | 3300025900 | Ga0207710_10069529 | Ga0207710_100695292 | 183 |
| 512 | 3300025944 | Ga0207661_10378100 | Ga0207661_103781002 | 183 |
| 513 | 3300046455 | Ga0495603_0179976 | Ga0495603_0179976_85_636 | 183 |
| 514 | 3300046461 | Ga0495641_0032592 | Ga0495641_0032592_1218_1769 | 183 |
| 515 | 3300046463 | Ga0495653_0186621 | Ga0495653_0186621_605_1156 | 183 |
| 516 | 3300046473 | Ga0495582_0157544 | Ga0495582_0157544_214_765 | 183 |
| 517 | 3300046559 | Ga0495667_0243925 | Ga0495667_0243925_43_594 | 183 |
| 518 | 3300046642 | Ga0495634_0028417 | Ga0495634_0028417_2350_2901 | 183 |
| 519 | 3300046663 | Ga0495635_0059317 | Ga0495635_0059317_32_583 | 183 |
| 520 | 3300046689 | Ga0495613_0126865 | Ga0495613_0126865_47_598 | 183 |
| 521 | 3300047319 | Ga0495674_0062170 | Ga0495674_0062170_1160_1711 | 183 |
| 522 | 3300047322 | Ga0495680_0003636 | Ga0495680_0003636_2348_2899 | 183 |
| 523 | 3300047471 | Ga0495684_0107881 | Ga0495684_0107881_1282_1833 | 183 |
| 524 | 3300048903 | Ga0496100_0805546 | Ga0496100_0805546_72_623 | 183 |
| 525 | 3300048911 | Ga0496108_0119376 | Ga0496108_0119376_596_1147 | 183 |
| 526 | 3300048912 | Ga0496109_0198657 | Ga0496109_0198657_1075_1626 | 183 |
| 527 | 3300048913 | Ga0496110_0913132 | Ga0496110_0913132_72_623 | 183 |
| 528 | 3300053084 | Ga0495595_0013969 | Ga0495595_0013969_869_1420 | 183 |
| 529 | 3300009177 | Ga0105248_10087056 | Ga0105248_100870564 | 184 |
| 530 | 3300014969 | Ga0157376_10482257 | Ga0157376_104822572 | 184 |
| 531 | 3300025941 | Ga0207711_10291277 | Ga0207711_102912772 | 184 |
| 532 | 3300050509 | nmdc:mga0qj67_153853_c1 | nmdc:mga0qj67_153853_c1_1299_1853 | 184 |
| 533 | 3300005543 | Ga0070672_100550943 | Ga0070672_1005509432 | 186 |
| 534 | 3300026075 | Ga0207708_10909075 | Ga0207708_109090751 | 186 |
| 535 | 3300026142 | Ga0207698_10764689 | Ga0207698_107646892 | 186 |
| 536 | 3300039438 | Ga0436360_0379591 | Ga0436360_0379591_227_787 | 186 |
| 537 | 3300046516 | Ga0495628_0293564 | Ga0495628_0293564_592_1155 | 187 |
| 538 | 2162886007 | SwRhRL2b_contig_3181706 | SwRhRL2b_0548.00001720 | 189 |
| 539 | 2162886011 | MRS1b_contig_7392549 | MRS1b_0869.00001680 | 189 |
| 540 | 3300005289 | Ga0065704_10025299 | Ga0065704_100252992 | 189 |
| 541 | 3300005290 | Ga0065712_10086516 | Ga0065712_100865162 | 189 |
| 542 | 3300005293 | Ga0065715_10089447 | Ga0065715_100894475 | 189 |
| 543 | 3300005293 | Ga0065715_10173661 | Ga0065715_101736612 | 189 |
| 544 | 3300005295 | Ga0065707_10083745 | Ga0065707_100837454 | 189 |
| 545 | 3300005295 | Ga0065707_10373122 | Ga0065707_103731221 | 189 |
| 546 | 3300005328 | Ga0070676_10109671 | Ga0070676_101096712 | 189 |
| 547 | 3300005331 | Ga0070670_100002347 | Ga0070670_10000234716 | 189 |
| 548 | 3300005331 | Ga0070670_100418034 | Ga0070670_1004180342 | 189 |
| 549 | 3300005331 | Ga0070670_100804841 | Ga0070670_1008048411 | 189 |
| 550 | 3300005333 | Ga0070677_10028118 | Ga0070677_100281182 | 189 |
| 551 | 3300005334 | Ga0068869_100491312 | Ga0068869_1004913122 | 189 |
| 552 | 3300005335 | Ga0070666_10175809 | Ga0070666_101758092 | 189 |
| 553 | 3300005343 | Ga0070687_100436072 | Ga0070687_1004360721 | 189 |
| 554 | 3300005353 | Ga0070669_100001373 | Ga0070669_10000137315 | 189 |
| 555 | 3300005353 | Ga0070669_100040264 | Ga0070669_1000402644 | 189 |
| 556 | 3300005353 | Ga0070669_100045667 | Ga0070669_1000456672 | 189 |
| 557 | 3300005353 | Ga0070669_100079821 | Ga0070669_1000798212 | 189 |
| 558 | 3300005354 | Ga0070675_100113009 | Ga0070675_1001130092 | 189 |
| 559 | 3300005354 | Ga0070675_100270944 | Ga0070675_1002709442 | 189 |
| 560 | 3300005354 | Ga0070675_100522728 | Ga0070675_1005227281 | 189 |
| 561 | 3300005354 | Ga0070675_100750312 | Ga0070675_1007503122 | 189 |
| 562 | 3300005354 | Ga0070675_101321027 | Ga0070675_1013210271 | 189 |
| 563 | 3300005355 | Ga0070671_100064404 | Ga0070671_1000644042 | 189 |
| 564 | 3300005355 | Ga0070671_100414103 | Ga0070671_1004141032 | 189 |
| 565 | 3300005356 | Ga0070674_100078066 | Ga0070674_1000780663 | 189 |
| 566 | 3300005356 | Ga0070674_100318598 | Ga0070674_1003185982 | 189 |
| 567 | 3300005356 | Ga0070674_100678257 | Ga0070674_1006782571 | 189 |
| 568 | 3300005364 | Ga0070673_100102553 | Ga0070673_1001025533 | 189 |
| 569 | 3300005364 | Ga0070673_100315794 | Ga0070673_1003157942 | 189 |
| 570 | 3300005365 | Ga0070688_100002960 | Ga0070688_1000029602 | 189 |
| 571 | 3300005365 | Ga0070688_100227841 | Ga0070688_1002278412 | 189 |
| 572 | 3300005365 | Ga0070688_100303170 | Ga0070688_1003031702 | 189 |
| 573 | 3300005366 | Ga0070659_100305224 | Ga0070659_1003052242 | 189 |
| 574 | 3300005456 | Ga0070678_100019556 | Ga0070678_1000195561 | 189 |
| 575 | 3300005456 | Ga0070678_100042628 | Ga0070678_1000426284 | 189 |
| 576 | 3300005457 | Ga0070662_100053417 | Ga0070662_1000534172 | 189 |
| 577 | 3300005457 | Ga0070662_100611760 | Ga0070662_1006117602 | 189 |
| 578 | 3300005459 | Ga0068867_100032508 | Ga0068867_1000325082 | 189 |
| 579 | 3300005466 | Ga0070685_10020352 | Ga0070685_100203522 | 189 |
| 580 | 3300005518 | Ga0070699_100145338 | Ga0070699_1001453382 | 189 |
| 581 | 3300005543 | Ga0070672_100021287 | Ga0070672_1000212875 | 189 |
| 582 | 3300005543 | Ga0070672_100090097 | Ga0070672_1000900974 | 189 |
| 583 | 3300005543 | Ga0070672_100183130 | Ga0070672_1001831302 | 189 |
| 584 | 3300005548 | Ga0070665_100107181 | Ga0070665_1001071813 | 189 |
| 585 | 3300005548 | Ga0070665_100818989 | Ga0070665_1008189892 | 189 |
| 586 | 3300005549 | Ga0070704_100270366 | Ga0070704_1002703662 | 189 |
| 587 | 3300005564 | Ga0070664_100111623 | Ga0070664_1001116232 | 189 |
| 588 | 3300005564 | Ga0070664_101449005 | Ga0070664_1014490051 | 189 |
| 589 | 3300005577 | Ga0068857_100460418 | Ga0068857_1004604182 | 189 |
| 590 | 3300005617 | Ga0068859_100145708 | Ga0068859_1001457083 | 189 |
| 591 | 3300005617 | Ga0068859_100253435 | Ga0068859_1002534352 | 189 |
| 592 | 3300005617 | Ga0068859_100303550 | Ga0068859_1003035502 | 189 |
| 593 | 3300005617 | Ga0068859_100536005 | Ga0068859_1005360052 | 189 |
| 594 | 3300005618 | Ga0068864_100004401 | Ga0068864_10000440111 | 189 |
| 595 | 3300005718 | Ga0068866_10639602 | Ga0068866_106396021 | 189 |
| 596 | 3300005719 | Ga0068861_100131328 | Ga0068861_1001313283 | 189 |
| 597 | 3300005719 | Ga0068861_100367482 | Ga0068861_1003674822 | 189 |
| 598 | 3300005840 | Ga0068870_10150032 | Ga0068870_101500322 | 189 |
| 599 | 3300005841 | Ga0068863_100012648 | Ga0068863_1000126487 | 189 |
| 600 | 3300005843 | Ga0068860_100313743 | Ga0068860_1003137432 | 189 |
| 601 | 3300005844 | Ga0068862_100004280 | Ga0068862_1000042804 | 189 |
| 602 | 3300005844 | Ga0068862_100127539 | Ga0068862_1001275392 | 189 |
| 603 | 3300005844 | Ga0068862_100152636 | Ga0068862_1001526362 | 189 |
| 604 | 3300005937 | Ga0081455_10338177 | Ga0081455_103381772 | 189 |
| 605 | 3300006237 | Ga0097621_100081888 | Ga0097621_1000818882 | 189 |
| 606 | 3300006237 | Ga0097621_100272309 | Ga0097621_1002723092 | 189 |
| 607 | 3300006237 | Ga0097621_100453499 | Ga0097621_1004534992 | 189 |
| 608 | 3300006358 | Ga0068871_100853584 | Ga0068871_1008535842 | 189 |
| 609 | 3300006844 | Ga0075428_100000003 | Ga0075428_10000000319 | 189 |
| 610 | 3300006844 | Ga0075428_100001358 | Ga0075428_10000135813 | 189 |
| 611 | 3300006847 | Ga0075431_100009235 | Ga0075431_1000092352 | 189 |
| 612 | 3300006847 | Ga0075431_100601125 | Ga0075431_1006011252 | 189 |
| 613 | 3300006852 | Ga0075433_10101463 | Ga0075433_101014632 | 189 |
| 614 | 3300006871 | Ga0075434_100201344 | Ga0075434_1002013443 | 189 |
| 615 | 3300006880 | Ga0075429_100416474 | Ga0075429_1004164742 | 189 |
| 616 | 3300006881 | Ga0068865_100163612 | Ga0068865_1001636122 | 189 |
| 617 | 3300006914 | Ga0075436_100531818 | Ga0075436_1005318181 | 189 |
| 618 | 3300006931 | Ga0097620_100145711 | Ga0097620_1001457112 | 189 |
| 619 | 3300006931 | Ga0097620_100253429 | Ga0097620_1002534292 | 189 |
| 620 | 3300006931 | Ga0097620_100303565 | Ga0097620_1003035652 | 189 |
| 621 | 3300006931 | Ga0097620_100536020 | Ga0097620_1005360202 | 189 |
| 622 | 3300007076 | Ga0075435_100198882 | Ga0075435_1001988822 | 189 |
| 623 | 3300007076 | Ga0075435_100235627 | Ga0075435_1002356272 | 189 |
| 624 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001277 | 189 |
| 625 | 3300009094 | Ga0111539_10002104 | Ga0111539_100021042 | 189 |
| 626 | 3300009094 | Ga0111539_10074840 | Ga0111539_100748404 | 189 |
| 627 | 3300009094 | Ga0111539_10098674 | Ga0111539_100986742 | 189 |
| 628 | 3300009147 | Ga0114129_10072782 | Ga0114129_100727822 | 189 |
| 629 | 3300009176 | Ga0105242_10137415 | Ga0105242_101374152 | 189 |
| 630 | 3300009176 | Ga0105242_10223217 | Ga0105242_102232172 | 189 |
| 631 | 3300009177 | Ga0105248_10022784 | Ga0105248_100227845 | 189 |
| 632 | 3300009177 | Ga0105248_10077836 | Ga0105248_100778362 | 189 |
| 633 | 3300009177 | Ga0105248_10593224 | Ga0105248_105932241 | 189 |
| 634 | 3300009553 | Ga0105249_10000688 | Ga0105249_1000068818 | 189 |
| 635 | 3300009553 | Ga0105249_10059463 | Ga0105249_100594631 | 189 |
| 636 | 3300009553 | Ga0105249_10393036 | Ga0105249_103930361 | 189 |
| 637 | 3300010375 | Ga0105239_10288919 | Ga0105239_102889192 | 189 |
| 638 | 3300011119 | Ga0105246_10391354 | Ga0105246_103913542 | 189 |
| 639 | 3300013297 | Ga0157378_10982756 | Ga0157378_109827562 | 189 |
| 640 | 3300013306 | Ga0163162_10285217 | Ga0163162_102852172 | 189 |
| 641 | 3300013306 | Ga0163162_10479723 | Ga0163162_104797232 | 189 |
| 642 | 3300013308 | Ga0157375_10119756 | Ga0157375_101197562 | 189 |
| 643 | 3300013308 | Ga0157375_10725113 | Ga0157375_107251132 | 189 |
| 644 | 3300014326 | Ga0157380_11168831 | Ga0157380_111688312 | 189 |
| 645 | 3300014745 | Ga0157377_10204807 | Ga0157377_102048072 | 189 |
| 646 | 3300014968 | Ga0157379_10418094 | Ga0157379_104180941 | 189 |
| 647 | 3300014969 | Ga0157376_10623461 | Ga0157376_106234612 | 189 |
| 648 | 3300017792 | Ga0163161_10074971 | Ga0163161_100749712 | 189 |
| 649 | 3300025315 | Ga0207697_10183488 | Ga0207697_101834881 | 189 |
| 650 | 3300025893 | Ga0207682_10025795 | Ga0207682_100257953 | 189 |
| 651 | 3300025918 | Ga0207662_10076398 | Ga0207662_100763981 | 189 |
| 652 | 3300025923 | Ga0207681_10030491 | Ga0207681_100304914 | 189 |
| 653 | 3300025923 | Ga0207681_10514216 | Ga0207681_105142161 | 189 |
| 654 | 3300025925 | Ga0207650_10022579 | Ga0207650_100225796 | 189 |
| 655 | 3300025925 | Ga0207650_10187307 | Ga0207650_101873072 | 189 |
| 656 | 3300025925 | Ga0207650_11116792 | Ga0207650_111167921 | 189 |
| 657 | 3300025926 | Ga0207659_10078119 | Ga0207659_100781192 | 189 |
| 658 | 3300025926 | Ga0207659_10289199 | Ga0207659_102891992 | 189 |
| 659 | 3300025926 | Ga0207659_11005346 | Ga0207659_110053461 | 189 |
| 660 | 3300025927 | Ga0207687_10072618 | Ga0207687_100726182 | 189 |
| 661 | 3300025931 | Ga0207644_10026930 | Ga0207644_100269304 | 189 |
| 662 | 3300025931 | Ga0207644_10329599 | Ga0207644_103295991 | 189 |
| 663 | 3300025933 | Ga0207706_10124461 | Ga0207706_101244611 | 189 |
| 664 | 3300025933 | Ga0207706_10142262 | Ga0207706_101422621 | 189 |
| 665 | 3300025933 | Ga0207706_10545605 | Ga0207706_105456051 | 189 |
| 666 | 3300025934 | Ga0207686_10560960 | Ga0207686_105609602 | 189 |
| 667 | 3300025937 | Ga0207669_10681147 | Ga0207669_106811472 | 189 |
| 668 | 3300025938 | Ga0207704_10014059 | Ga0207704_100140594 | 189 |
| 669 | 3300025940 | Ga0207691_10020300 | Ga0207691_100203004 | 189 |
| 670 | 3300025940 | Ga0207691_10196469 | Ga0207691_101964692 | 189 |
| 671 | 3300025940 | Ga0207691_10205126 | Ga0207691_102051262 | 189 |
| 672 | 3300025941 | Ga0207711_10012469 | Ga0207711_100124695 | 189 |
| 673 | 3300025941 | Ga0207711_10322740 | Ga0207711_103227402 | 189 |
| 674 | 3300025941 | Ga0207711_10730992 | Ga0207711_107309921 | 189 |
| 675 | 3300025941 | Ga0207711_10808736 | Ga0207711_108087362 | 189 |
| 676 | 3300025942 | Ga0207689_10446730 | Ga0207689_104467302 | 189 |
| 677 | 3300025945 | Ga0207679_10105085 | Ga0207679_101050852 | 189 |
| 678 | 3300025960 | Ga0207651_10074198 | Ga0207651_100741983 | 189 |
| 679 | 3300025960 | Ga0207651_10077248 | Ga0207651_100772482 | 189 |
| 680 | 3300025961 | Ga0207712_10298995 | Ga0207712_102989952 | 189 |
| 681 | 3300025961 | Ga0207712_10813594 | Ga0207712_108135942 | 189 |
| 682 | 3300025972 | Ga0207668_10244030 | Ga0207668_102440302 | 189 |
| 683 | 3300025986 | Ga0207658_10446924 | Ga0207658_104469241 | 189 |
| 684 | 3300025986 | Ga0207658_10738898 | Ga0207658_107388982 | 189 |
| 685 | 3300026067 | Ga0207678_10443220 | Ga0207678_104432202 | 189 |
| 686 | 3300026067 | Ga0207678_10712885 | Ga0207678_107128851 | 189 |
| 687 | 3300026075 | Ga0207708_10406892 | Ga0207708_104068922 | 189 |
| 688 | 3300026088 | Ga0207641_10204106 | Ga0207641_102041063 | 189 |
| 689 | 3300026089 | Ga0207648_10032669 | Ga0207648_100326695 | 189 |
| 690 | 3300026095 | Ga0207676_10050187 | Ga0207676_100501872 | 189 |
| 691 | 3300026116 | Ga0207674_10446163 | Ga0207674_104461632 | 189 |
| 692 | 3300026118 | Ga0207675_100226283 | Ga0207675_1002262833 | 189 |
| 693 | 3300026118 | Ga0207675_100328310 | Ga0207675_1003283103 | 189 |
| 694 | 3300026121 | Ga0207683_10018509 | Ga0207683_100185092 | 189 |
| 695 | 3300026121 | Ga0207683_10081095 | Ga0207683_100810952 | 189 |
| 696 | 3300026121 | Ga0207683_10214370 | Ga0207683_102143702 | 189 |
| 697 | 3300026121 | Ga0207683_10640777 | Ga0207683_106407772 | 189 |
| 698 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002290 | 189 |
| 699 | 3300027907 | Ga0207428_10078208 | Ga0207428_100782083 | 189 |
| 700 | 3300028379 | Ga0268266_10228936 | Ga0268266_102289362 | 189 |
| 701 | 3300028380 | Ga0268265_10005753 | Ga0268265_1000575312 | 189 |
| 702 | 3300028380 | Ga0268265_10182846 | Ga0268265_101828463 | 189 |
| 703 | 3300028381 | Ga0268264_10252644 | Ga0268264_102526442 | 189 |
| 704 | 3300031711 | Ga0265314_10013713 | Ga0265314_100137136 | 189 |
| 705 | 3300035116 | Ga0373945_0224724 | Ga0373945_0224724_132_701 | 189 |
| 706 | 3300036401 | Ga0373937_0337926 | Ga0373937_0337926_80_649 | 189 |
| 707 | 3300039450 | Ga0436363_0340096 | Ga0436363_0340096_625_1194 | 189 |
| 708 | 3300042133 | Ga0450896_001674 | Ga0450896_001674_188_757 | 189 |
| 709 | 3300046642 | Ga0495634_0558054 | Ga0495634_0558054_33_602 | 189 |
| 710 | 3300047319 | Ga0495674_0068429 | Ga0495674_0068429_1995_2564 | 189 |
| 711 | 3300048903 | Ga0496100_0096561 | Ga0496100_0096561_920_1489 | 189 |
| 712 | 3300048904 | Ga0496101_0009325 | Ga0496101_0009325_4673_5242 | 189 |
| 713 | 3300048905 | Ga0496102_0391561 | Ga0496102_0391561_162_731 | 189 |
| 714 | 3300048907 | Ga0496104_0111413 | Ga0496104_0111413_1423_1992 | 189 |
| 715 | 3300048907 | Ga0496104_0923537 | Ga0496104_0923537_122_691 | 189 |
| 716 | 3300048908 | Ga0496105_0124319 | Ga0496105_0124319_208_777 | 189 |
| 717 | 3300048910 | Ga0496107_0065627 | Ga0496107_0065627_189_758 | 189 |
| 718 | 3300048911 | Ga0496108_0044963 | Ga0496108_0044963_2304_2873 | 189 |
| 719 | 3300048912 | Ga0496109_0232488 | Ga0496109_0232488_901_1470 | 189 |
| 720 | 3300048913 | Ga0496110_0004909 | Ga0496110_0004909_7502_8071 | 189 |
| 721 | 3300048915 | Ga0496112_0000481 | Ga0496112_0000481_2935_3504 | 189 |
| 722 | 3300048916 | Ga0496113_0041716 | Ga0496113_0041716_1760_2329 | 189 |
| 723 | 3300048917 | Ga0496114_0181735 | Ga0496114_0181735_817_1386 | 189 |
| 724 | 3300049572 | Ga0501036_0354713 | Ga0501036_0354713_104_673 | 189 |
| 725 | 3300049572 | Ga0501036_0421561 | Ga0501036_0421561_443_1012 | 189 |
| 726 | 3300049572 | Ga0501036_1013160 | Ga0501036_1013160_34_603 | 189 |
| 727 | 3300049576 | Ga0501040_0172021 | Ga0501040_0172021_440_1009 | 189 |
| 728 | 3300049577 | Ga0501041_0446005 | Ga0501041_0446005_14_583 | 189 |
| 729 | 3300049582 | Ga0501048_0072954 | Ga0501048_0072954_103_672 | 189 |
| 730 | 3300049588 | Ga0501072_0301372 | Ga0501072_0301372_649_1218 | 189 |
| 731 | 3300049743 | Ga0501081_0033914 | Ga0501081_0033914_1885_2454 | 189 |
| 732 | 3300049822 | Ga0501035_0085009 | Ga0501035_0085009_1434_2003 | 189 |
| 733 | 3300049824 | Ga0501045_0042038 | Ga0501045_0042038_1058_1627 | 189 |
| 734 | 3300050507 | nmdc:mga05p37_18511_c1 | nmdc:mga05p37_18511_c1_6940_7509 | 189 |
| 735 | 3300050508 | nmdc:mga09592_164309_c1 | nmdc:mga09592_164309_c1_851_1420 | 189 |
| 736 | 3300050510 | nmdc:mga06r32_269789_c1 | nmdc:mga06r32_269789_c1_940_1509 | 189 |
| 737 | 3300050510 | nmdc:mga06r32_72373_c1 | nmdc:mga06r32_72373_c1_1184_1753 | 189 |
| 738 | 3300050511 | nmdc:mga08y16_329085_c1 | nmdc:mga08y16_329085_c1_860_1429 | 189 |
| 739 | 3300050511 | nmdc:mga08y16_389430_c1 | nmdc:mga08y16_389430_c1_118_687 | 189 |
| 740 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_308963_309532 | 189 |
| 741 | 3300050511 | nmdc:mga08y16_55360_c1 | nmdc:mga08y16_55360_c1_711_1280 | 189 |
| 742 | 3300050512 | nmdc:mga0n895_110200_c1 | nmdc:mga0n895_110200_c1_1154_1723 | 189 |
| 743 | 3300050513 | nmdc:mga0rr50_9595_c1 | nmdc:mga0rr50_9595_c1_1389_1958 | 189 |
| 744 | 3300050514 | nmdc:mga08x19_476429_c1 | nmdc:mga08x19_476429_c1_67_636 | 189 |
| 745 | 3300050515 | nmdc:mga0a205_72644_c1 | nmdc:mga0a205_72644_c1_1464_2033 | 189 |
| 746 | 3300053077 | Ga0495601_0083628 | Ga0495601_0083628_930_1499 | 189 |
| 747 | 3300053085 | Ga0495619_0005033 | Ga0495619_0005033_617_1186 | 189 |
| 748 | 3300060353 | Ga0501082_0061166 | Ga0501082_0061166_2478_3047 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lhp-assembly2.cif.gz_T | crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex | 0.9623 | 110 | 186 |
| 6vud-assembly1.cif.gz_B | crystal structure of a ribosome recycling factor from ehrlichia chaffeensis | 0.9546 | 6 | 187 |
| 3lf9-assembly1.cif.gz_A | crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c | 0.9463 | 6 | 187 |
| 6vud-assembly1.cif.gz_B | crystal structure of a ribosome recycling factor from ehrlichia chaffeensis | 0.9348 | 6 | 187 |
| 5wp3-assembly1.cif.gz_B | crystal structure of eed in complex with eb22 | 0.9316 | 7 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1is1A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9941 | 7 | 187 | 1.10.132.20 |
| 1wqhA01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9852 | 8 | 187 | 1.10.132.20 |
| 4kc6A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.982 | 7 | 182 | 1.10.132.20 |
| 1iseA01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.981 | 7 | 189 | 1.10.132.20 |
| 4kawX01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9798 | 7 | 187 | 1.10.132.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N4TFV1-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9747 | 8 | 187 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A7C6N339-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.971 | 6 | 187 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A4V1UUT9-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.968 | 6 | 186 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-P61306-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.968 | 6 | 189 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A7D7ZIN6-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9679 | 6 | 189 |
GO:0005737
GO:0006415 GO:0043023 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar