F478957

General Info

Members Datasets Scaffolds Average Seq Length
748 283 748 172

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10909075|Ga0207708_109090751
Length 186
Sequence MSEKDVIKETRPRMEGAVDDFKRKITTIRTGRAAVSILDTVVVDYYGTPTPLNQMASVHAPEPQMLTVQPWDQTQIGAVEKAIRAADLGLNPSNDGKLVRVPIPPLTEERRRQLAKQIHDVAEDHRTAVRNVRRDANDRLKKMLKDKTISEDAERDSLAEVQKLTDGHIKQIDELAKSKEQEILSV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
210 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.21
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3181706 2162886007 Bacteria 950
2 MRS1b_contig_7392549 2162886011 Bacteria 882
3 JGI24751J29686_10001906 3300002459 Bacteria 4264
4 Ga0058862_12374949 3300004803 Unclassified 780
5 Ga0065704_10025299 3300005289 Bacteria 1466
6 Ga0065712_10032885 3300005290 Bacteria 1285
7 Ga0065712_10086516 3300005290 Bacteria 2631
8 Ga0065712_10155174 3300005290 Bacteria 1333
9 Ga0065715_10089447 3300005293 Bacteria 10128
10 Ga0065715_10173661 3300005293 Bacteria 1528
11 Ga0065715_10189832 3300005293 Bacteria 1422
12 Ga0065707_10083745 3300005295 Bacteria 8334
13 Ga0065707_10101877 3300005295 Bacteria 2841
14 Ga0065707_10272809 3300005295 Bacteria 1067
15 Ga0065707_10373122 3300005295 Bacteria 887
16 Ga0070658_10575796 3300005327 Bacteria 975
17 Ga0070676_10109671 3300005328 Bacteria 1717
18 Ga0070683_100214025 3300005329 Bacteria 1831
19 Ga0070683_100422151 3300005329 Bacteria 1272
20 Ga0070683_100491740 3300005329 Unclassified 1172
21 Ga0070690_100023302 3300005330 Bacteria 3796
22 Ga0070690_100571123 3300005330 Bacteria 855
23 Ga0070670_100002347 3300005331 Bacteria 15589
24 Ga0070670_100034706 3300005331 Bacteria 4341
25 Ga0070670_100418034 3300005331 Bacteria 1185
26 Ga0070670_100424196 3300005331 Bacteria 1176
27 Ga0070670_100804841 3300005331 Bacteria 849
28 Ga0070677_10028118 3300005333 Bacteria 2122
29 Ga0068869_100491312 3300005334 Bacteria 1023
30 Ga0070666_10009157 3300005335 Bacteria 6172
31 Ga0070666_10135228 3300005335 Bacteria 1715
32 Ga0070666_10175809 3300005335 Bacteria 1501
33 Ga0070680_100079394 3300005336 Bacteria 2705
34 Ga0070682_100148856 3300005337 Bacteria 1604
35 Ga0070682_101241778 3300005337 Bacteria 631
36 Ga0068868_100561835 3300005338 Bacteria 1007
37 Ga0070660_100012244 3300005339 Bacteria 6122
38 Ga0070660_100130489 3300005339 Bacteria 2011
39 Ga0070660_100567599 3300005339 Bacteria 947
40 Ga0070660_100723930 3300005339 Bacteria 835
41 Ga0070689_100153008 3300005340 Bacteria 1861
42 Ga0070687_100326773 3300005343 Bacteria 982
43 Ga0070687_100436072 3300005343 Bacteria 868
44 Ga0070668_100104422 3300005347 Bacteria 2249
45 Ga0070669_100001373 3300005353 Bacteria 17563
46 Ga0070669_100040264 3300005353 Bacteria 3397
47 Ga0070669_100045667 3300005353 Bacteria 3193
48 Ga0070669_100076099 3300005353 Bacteria 2490
49 Ga0070669_100079821 3300005353 Bacteria 2434
50 Ga0070675_100113009 3300005354 Bacteria 2300
51 Ga0070675_100140434 3300005354 Bacteria 2064
52 Ga0070675_100270944 3300005354 Bacteria 1490
53 Ga0070675_100522728 3300005354 Bacteria 1071
54 Ga0070675_100750312 3300005354 Bacteria 891
55 Ga0070675_101321027 3300005354 Unclassified 665
56 Ga0070671_100005643 3300005355 Bacteria 9957
57 Ga0070671_100064404 3300005355 Bacteria 3053
58 Ga0070671_100414103 3300005355 Bacteria 1154
59 Ga0070674_100078066 3300005356 Bacteria 2359
60 Ga0070674_100318598 3300005356 Bacteria 1246
61 Ga0070674_100358954 3300005356 Bacteria 1179
62 Ga0070674_100427674 3300005356 Bacteria 1088
63 Ga0070674_100678257 3300005356 Bacteria 879
64 Ga0070673_100067482 3300005364 Bacteria 2860
65 Ga0070673_100102553 3300005364 Bacteria 2359
66 Ga0070673_100315794 3300005364 Bacteria 1379
67 Ga0070673_100607733 3300005364 Bacteria 998
68 Ga0070673_101069890 3300005364 Bacteria 753
69 Ga0070688_100002960 3300005365 Bacteria 8657
70 Ga0070688_100016655 3300005365 Bacteria 4205
71 Ga0070688_100227841 3300005365 Bacteria 1317
72 Ga0070688_100303170 3300005365 Bacteria 1155
73 Ga0070659_100169086 3300005366 Bacteria 1790
74 Ga0070659_100305224 3300005366 Bacteria 1328
75 Ga0070667_100235121 3300005367 Bacteria 1635
76 Ga0070711_100084742 3300005439 Bacteria 2268
77 Ga0070705_100067347 3300005440 Bacteria 2151
78 Ga0070705_100200800 3300005440 Bacteria 1367
79 Ga0070705_100794924 3300005440 Bacteria 752
80 Ga0070700_100165270 3300005441 Bacteria 1527
81 Ga0070694_100026503 3300005444 Bacteria 3757
82 Ga0070694_100464340 3300005444 Bacteria 1002
83 Ga0070694_100766151 3300005444 Bacteria 789
84 Ga0070708_100043579 3300005445 Bacteria 3943
85 Ga0070708_100189798 3300005445 Bacteria 1922
86 Ga0070708_100305319 3300005445 Bacteria 1499
87 Ga0070708_100621696 3300005445 Unclassified 1018
88 Ga0070708_100924291 3300005445 Bacteria 819
89 Ga0070663_100299404 3300005455 Bacteria 1287
90 Ga0070663_100530915 3300005455 Bacteria 981
91 Ga0070678_100019556 3300005456 Bacteria 4420
92 Ga0070678_100042628 3300005456 Bacteria 3227
93 Ga0070678_100086206 3300005456 Bacteria 2395
94 Ga0070662_100053417 3300005457 Bacteria 2924
95 Ga0070662_100292551 3300005457 Bacteria 1321
96 Ga0070662_100611760 3300005457 Bacteria 917
97 Ga0070681_10022019 3300005458 Bacteria 6395
98 Ga0070681_10076512 3300005458 Bacteria 3305
99 Ga0070681_10252986 3300005458 Bacteria 1674
100 Ga0070681_10541639 3300005458 Bacteria 1077
101 Ga0068867_100032508 3300005459 Bacteria 3774
102 Ga0068867_100240852 3300005459 Bacteria 1467
103 Ga0068867_100316304 3300005459 Bacteria 1292
104 Ga0068867_100400168 3300005459 Bacteria 1158
105 Ga0070685_10020352 3300005466 Bacteria 3590
106 Ga0070685_10057586 3300005466 Bacteria 2262
107 Ga0070685_10552915 3300005466 Bacteria 822
108 Ga0070706_100656173 3300005467 Bacteria 974
109 Ga0070707_100094736 3300005468 Bacteria 2891
110 Ga0070707_100103003 3300005468 Bacteria 2766
111 Ga0070707_100199746 3300005468 Bacteria 1949
112 Ga0070707_100708928 3300005468 Bacteria 969
113 Ga0070698_100098715 3300005471 Bacteria 2894
114 Ga0070698_100168353 3300005471 Bacteria 2133
115 Ga0070698_100447627 3300005471 Bacteria 1227
116 Ga0070698_100708319 3300005471 Bacteria 949
117 Ga0070698_101090346 3300005471 Bacteria 747
118 Ga0070699_100011351 3300005518 Bacteria 7691
119 Ga0070699_100048831 3300005518 Bacteria 3663
120 Ga0070699_100145338 3300005518 Bacteria 2095
121 Ga0070679_100165560 3300005530 Bacteria 2184
122 Ga0070684_100000085 3300005535 Bacteria 61530
123 Ga0068853_100117095 3300005539 Bacteria 2373
124 Ga0068853_100257842 3300005539 Bacteria 1602
125 Ga0068853_100607363 3300005539 Bacteria 1039
126 Ga0070672_100021287 3300005543 Bacteria 4743
127 Ga0070672_100090097 3300005543 Bacteria 2473
128 Ga0070672_100183130 3300005543 Bacteria 1746
129 Ga0070672_100440212 3300005543 Bacteria 1121
130 Ga0070672_100550322 3300005543 Bacteria 1002
131 Ga0070672_100550943 3300005543 Unclassified 1001
132 Ga0070686_100025139 3300005544 Bacteria 3579
133 Ga0070686_100795604 3300005544 Bacteria 762
134 Ga0070695_100019190 3300005545 Bacteria 4160
135 Ga0070695_100461502 3300005545 Bacteria 975
136 Ga0070696_100061896 3300005546 Bacteria 2619
137 Ga0070696_100105885 3300005546 Bacteria 2021
138 Ga0070696_100203222 3300005546 Bacteria 1480
139 Ga0070693_100537506 3300005547 Bacteria 835
140 Ga0070665_100009152 3300005548 Bacteria 10029
141 Ga0070665_100107181 3300005548 Bacteria 2796
142 Ga0070665_100173101 3300005548 Bacteria 2160
143 Ga0070665_100305967 3300005548 Bacteria 1593
144 Ga0070665_100818989 3300005548 Bacteria 944
145 Ga0070665_101241110 3300005548 Bacteria 756
146 Ga0070704_100270366 3300005549 Bacteria 1404
147 Ga0070704_101189696 3300005549 Bacteria 695
148 Ga0068855_100024107 3300005563 Bacteria 7283
149 Ga0070664_100000442 3300005564 Bacteria 31212
150 Ga0070664_100111623 3300005564 Bacteria 2386
151 Ga0070664_100368763 3300005564 Bacteria 1309
152 Ga0070664_101449005 3300005564 Bacteria 649
153 Ga0068857_100460418 3300005577 Bacteria 1190
154 Ga0068854_100050186 3300005578 Bacteria 2984
155 Ga0068854_100639830 3300005578 Bacteria 912
156 Ga0068856_100012203 3300005614 Bacteria 8324
157 Ga0068852_100436547 3300005616 Bacteria 1294
158 Ga0068859_100091550 3300005617 Bacteria 3092
159 Ga0068859_100145708 3300005617 Bacteria 2443
160 Ga0068859_100253435 3300005617 Bacteria 1850
161 Ga0068859_100303550 3300005617 Bacteria 1690
162 Ga0068859_100536005 3300005617 Bacteria 1265
163 Ga0068859_100609161 3300005617 Bacteria 1185
164 Ga0068859_101385408 3300005617 Bacteria 775
165 Ga0068864_100004401 3300005618 Bacteria 11567
166 Ga0068864_100014824 3300005618 Bacteria 6475
167 Ga0068864_100037415 3300005618 Bacteria 4141
168 Ga0068864_100404962 3300005618 Bacteria 1297
169 Ga0068866_10042614 3300005718 Bacteria 2260
170 Ga0068866_10069885 3300005718 Bacteria 1851
171 Ga0068866_10633127 3300005718 Bacteria 726
172 Ga0068866_10639602 3300005718 Bacteria 723
173 Ga0068861_100131328 3300005719 Bacteria 2033
174 Ga0068861_100367482 3300005719 Bacteria 1267
175 Ga0068861_100793964 3300005719 Bacteria 888
176 Ga0068870_10150032 3300005840 Bacteria 1372
177 Ga0068863_100012648 3300005841 Bacteria 8141
178 Ga0068863_100048499 3300005841 Bacteria 4027
179 Ga0068863_100112640 3300005841 Bacteria 2591
180 Ga0068858_100013804 3300005842 Bacteria 7625
181 Ga0068858_100162878 3300005842 Bacteria 2100
182 Ga0068858_100202811 3300005842 Bacteria 1876
183 Ga0068858_100424946 3300005842 Unclassified 1278
184 Ga0068858_100788367 3300005842 Bacteria 927
185 Ga0068860_100313743 3300005843 Bacteria 1538
186 Ga0068862_100004280 3300005844 Bacteria 12078
187 Ga0068862_100025823 3300005844 Bacteria 4933
188 Ga0068862_100127539 3300005844 Bacteria 2248
189 Ga0068862_100152636 3300005844 Bacteria 2057
190 Ga0068862_100168491 3300005844 Bacteria 1959
191 Ga0068862_100225703 3300005844 Bacteria 1697
192 Ga0068862_101008608 3300005844 Bacteria 824
193 Ga0081455_10058018 3300005937 Bacteria 3278
194 Ga0081455_10187169 3300005937 Bacteria 1563
195 Ga0081455_10338177 3300005937 Bacteria 1066
196 Ga0081539_10009375 3300005985 Bacteria 8199
197 Ga0075432_10069884 3300006058 Bacteria 1260
198 Ga0070716_100041817 3300006173 Bacteria 2556
199 Ga0070712_100306496 3300006175 Bacteria 1287
200 Ga0097621_100000066 3300006237 Bacteria 54619
201 Ga0097621_100004862 3300006237 Bacteria 9415
202 Ga0097621_100081888 3300006237 Bacteria 2687
203 Ga0097621_100200610 3300006237 Bacteria 1732
204 Ga0097621_100272309 3300006237 Bacteria 1488
205 Ga0097621_100427467 3300006237 Bacteria 1190
206 Ga0097621_100453499 3300006237 Bacteria 1156
207 Ga0068871_100000170 3300006358 Bacteria 43522
208 Ga0068871_100015954 3300006358 Bacteria 5643
209 Ga0068871_100337008 3300006358 Bacteria 1331
210 Ga0068871_100530007 3300006358 Bacteria 1065
211 Ga0068871_100853584 3300006358 Bacteria 842
212 Ga0075428_100000003 3300006844 Bacteria 365483
213 Ga0075428_100001358 3300006844 Bacteria 25978
214 Ga0075428_100223106 3300006844 Bacteria 2035
215 Ga0075428_100948243 3300006844 Unclassified 912
216 Ga0075430_101024709 3300006846 Bacteria 680
217 Ga0075431_100009235 3300006847 Bacteria 9896
218 Ga0075431_100046411 3300006847 Bacteria 4480
219 Ga0075431_100225036 3300006847 Bacteria 1913
220 Ga0075431_100601125 3300006847 Bacteria 1084
221 Ga0075431_101049007 3300006847 Bacteria 781
222 Ga0075433_10012184 3300006852 Bacteria 6933
223 Ga0075433_10101463 3300006852 Bacteria 2548
224 Ga0075433_10288384 3300006852 Bacteria 1454
225 Ga0075433_10540358 3300006852 Bacteria 1025
226 Ga0075433_10742730 3300006852 Bacteria 858
227 Ga0075433_10911636 3300006852 Bacteria 766
228 Ga0075434_100000260 3300006871 Bacteria 37408
229 Ga0075434_100049926 3300006871 Bacteria 4155
230 Ga0075434_100119221 3300006871 Bacteria 2653
231 Ga0075434_100201344 3300006871 Bacteria 2011
232 Ga0075434_100221818 3300006871 Bacteria 1910
233 Ga0075434_100645727 3300006871 Bacteria 1077
234 Ga0075434_100734992 3300006871 Bacteria 1004
235 Ga0075429_100095845 3300006880 Bacteria 2588
236 Ga0075429_100416474 3300006880 Bacteria 1177
237 Ga0075429_100913907 3300006880 Bacteria 768
238 Ga0068865_100021831 3300006881 Bacteria 4167
239 Ga0068865_100032362 3300006881 Bacteria 3492
240 Ga0068865_100163612 3300006881 Bacteria 1699
241 Ga0075436_100036450 3300006914 Bacteria 3394
242 Ga0075436_100104702 3300006914 Bacteria 1972
243 Ga0075436_100388785 3300006914 Bacteria 1009
244 Ga0075436_100531818 3300006914 Bacteria 862
245 Ga0097620_100091552 3300006931 Bacteria 3092
246 Ga0097620_100145711 3300006931 Bacteria 2443
247 Ga0097620_100253429 3300006931 Bacteria 1850
248 Ga0097620_100303565 3300006931 Bacteria 1690
249 Ga0097620_100536020 3300006931 Bacteria 1265
250 Ga0097620_100609196 3300006931 Bacteria 1185
251 Ga0097620_101385411 3300006931 Bacteria 775
252 Ga0075435_100000064 3300007076 Bacteria 54706
253 Ga0075435_100000956 3300007076 Bacteria 18244
254 Ga0075435_100001486 3300007076 Bacteria 15064
255 Ga0075435_100009317 3300007076 Bacteria 7100
256 Ga0075435_100030037 3300007076 Bacteria 4270
257 Ga0075435_100080563 3300007076 Bacteria 2673
258 Ga0075435_100198882 3300007076 Bacteria 1698
259 Ga0075435_100235627 3300007076 Bacteria 1556
260 Ga0075435_100263137 3300007076 Bacteria 1470
261 Ga0075435_100775402 3300007076 Bacteria 834
262 Ga0105251_10208200 3300009011 Unclassified 881
263 Ga0105240_10043908 3300009093 Bacteria 5684
264 Ga0105240_10199012 3300009093 Bacteria 2350
265 Ga0105240_10276151 3300009093 Bacteria 1933
266 Ga0105240_10450925 3300009093 Bacteria 1439
267 Ga0105240_10864923 3300009093 Bacteria 975
268 Ga0111539_10000001 3300009094 Bacteria 1035431
269 Ga0111539_10002104 3300009094 Bacteria 26607
270 Ga0111539_10024645 3300009094 Bacteria 7379
271 Ga0111539_10074840 3300009094 Bacteria 3990
272 Ga0111539_10098674 3300009094 Bacteria 3430
273 Ga0111539_10442227 3300009094 Bacteria 1514
274 Ga0105245_10068047 3300009098 Bacteria 3226
275 Ga0105245_11132201 3300009098 Bacteria 829
276 Ga0105247_10055248 3300009101 Bacteria 2451
277 Ga0114129_10006049 3300009147 Bacteria 17157
278 Ga0114129_10007288 3300009147 Bacteria 15747
279 Ga0114129_10028743 3300009147 Bacteria 7877
280 Ga0114129_10032021 3300009147 Bacteria 7433
281 Ga0114129_10041259 3300009147 Bacteria 6503
282 Ga0114129_10048371 3300009147 Bacteria 5975
283 Ga0114129_10065109 3300009147 Bacteria 5087
284 Ga0114129_10072782 3300009147 Bacteria 4790
285 Ga0114129_10085215 3300009147 Bacteria 4384
286 Ga0114129_10865377 3300009147 Bacteria 1148
287 Ga0114129_10878379 3300009147 Bacteria 1138
288 Ga0105243_10006872 3300009148 Bacteria 8771
289 Ga0105241_10551432 3300009174 Bacteria 1035
290 Ga0105242_10001351 3300009176 Bacteria 19349
291 Ga0105242_10031995 3300009176 Bacteria 4205
292 Ga0105242_10137415 3300009176 Bacteria 2117
293 Ga0105242_10172432 3300009176 Bacteria 1902
294 Ga0105242_10223217 3300009176 Bacteria 1685
295 Ga0105248_10019171 3300009177 Bacteria 7568
296 Ga0105248_10022784 3300009177 Bacteria 6951
297 Ga0105248_10077836 3300009177 Bacteria 3729
298 Ga0105248_10087056 3300009177 Bacteria 3515
299 Ga0105248_10099091 3300009177 Bacteria 3284
300 Ga0105248_10203570 3300009177 Bacteria 2230
301 Ga0105248_10215838 3300009177 Bacteria 2161
302 Ga0105248_10224887 3300009177 Bacteria 2112
303 Ga0105248_10333938 3300009177 Bacteria 1707
304 Ga0105248_10447650 3300009177 Bacteria 1455
305 Ga0105248_10530127 3300009177 Bacteria 1328
306 Ga0105248_10593224 3300009177 Bacteria 1250
307 Ga0105238_10207226 3300009551 Bacteria 1937
308 Ga0105238_10367596 3300009551 Bacteria 1428
309 Ga0105238_10377020 3300009551 Bacteria 1410
310 Ga0105238_10387080 3300009551 Bacteria 1390
311 Ga0105249_10000688 3300009553 Bacteria 30761
312 Ga0105249_10059463 3300009553 Bacteria 3505
313 Ga0105249_10393036 3300009553 Bacteria 1415
314 Ga0105249_10749306 3300009553 Bacteria 1039
315 Ga0105249_11116655 3300009553 Bacteria 859
316 Ga0105249_11647101 3300009553 Bacteria 714
317 Ga0105239_10288919 3300010375 Bacteria 1847
318 Ga0105239_10434181 3300010375 Bacteria 1489
319 Ga0105246_10167694 3300011119 Bacteria 1679
320 Ga0105246_10391354 3300011119 Bacteria 1151
321 Ga0105246_10419679 3300011119 Bacteria 1116
322 Ga0157374_10048498 3300013296 Bacteria 3940
323 Ga0157378_10115031 3300013297 Bacteria 2472
324 Ga0157378_10982756 3300013297 Bacteria 878
325 Ga0163162_10285217 3300013306 Bacteria 1783
326 Ga0163162_10427928 3300013306 Bacteria 1456
327 Ga0163162_10479723 3300013306 Bacteria 1375
328 Ga0163162_11746668 3300013306 Bacteria 711
329 Ga0157372_10644399 3300013307 Bacteria 1234
330 Ga0157372_10844899 3300013307 Bacteria 1063
331 Ga0157375_10119756 3300013308 Bacteria 2740
332 Ga0157375_10425541 3300013308 Bacteria 1494
333 Ga0157375_10725113 3300013308 Bacteria 1147
334 Ga0163163_10006749 3300014325 Bacteria 10061
335 Ga0163163_10063166 3300014325 Bacteria 3671
336 Ga0163163_10142721 3300014325 Bacteria 2437
337 Ga0163163_10881232 3300014325 Bacteria 958
338 Ga0157380_10034047 3300014326 Bacteria 3928
339 Ga0157380_10189471 3300014326 Bacteria 1814
340 Ga0157380_10859429 3300014326 Bacteria 930
341 Ga0157380_11168831 3300014326 Bacteria 812
342 Ga0157377_10190314 3300014745 Bacteria 1296
343 Ga0157377_10204807 3300014745 Bacteria 1255
344 Ga0157379_10049621 3300014968 Bacteria 3748
345 Ga0157379_10070958 3300014968 Bacteria 3117
346 Ga0157379_10211338 3300014968 Bacteria 1756
347 Ga0157379_10418094 3300014968 Bacteria 1234
348 Ga0157376_10021091 3300014969 Bacteria 5056
349 Ga0157376_10120872 3300014969 Bacteria 2321
350 Ga0157376_10210051 3300014969 Bacteria 1796
351 Ga0157376_10482257 3300014969 Bacteria 1215
352 Ga0157376_10623461 3300014969 Bacteria 1076
353 Ga0163161_10074971 3300017792 Bacteria 2482
354 Ga0207697_10183488 3300025315 Unclassified 918
355 Ga0207682_10025795 3300025893 Bacteria 2332
356 Ga0207642_10027711 3300025899 Bacteria 2322
357 Ga0207642_10439120 3300025899 Bacteria 788
358 Ga0207710_10069529 3300025900 Bacteria 1612
359 Ga0207710_10105268 3300025900 Bacteria 1335
360 Ga0207688_10330346 3300025901 Bacteria 937
361 Ga0207680_10014285 3300025903 Bacteria 4104
362 Ga0207680_10112271 3300025903 Bacteria 1770
363 Ga0207680_10170713 3300025903 Bacteria 1465
364 Ga0207699_10529356 3300025906 Unclassified 853
365 Ga0207645_10005968 3300025907 Bacteria 8770
366 Ga0207645_10276405 3300025907 Bacteria 1114
367 Ga0207643_10066487 3300025908 Bacteria 2067
368 Ga0207705_10373323 3300025909 Bacteria 1101
369 Ga0207654_10633046 3300025911 Bacteria 765
370 Ga0207707_10063397 3300025912 Bacteria 3217
371 Ga0207707_10222517 3300025912 Bacteria 1643
372 Ga0207707_10460636 3300025912 Bacteria 1087
373 Ga0207707_10746528 3300025912 Bacteria 819
374 Ga0207695_10451887 3300025913 Bacteria 1168
375 Ga0207663_10067550 3300025916 Bacteria 2293
376 Ga0207660_10201874 3300025917 Bacteria 1553
377 Ga0207662_10035840 3300025918 Bacteria 2899
378 Ga0207662_10076398 3300025918 Bacteria 2036
379 Ga0207662_10570760 3300025918 Bacteria 785
380 Ga0207657_10127678 3300025919 Bacteria 2087
381 Ga0207652_10061240 3300025921 Bacteria 3249
382 Ga0207652_10072372 3300025921 Bacteria 2998
383 Ga0207646_10042536 3300025922 Bacteria 4081
384 Ga0207646_10066661 3300025922 Bacteria 3214
385 Ga0207646_10234644 3300025922 Bacteria 1657
386 Ga0207681_10023583 3300025923 Bacteria 3938
387 Ga0207681_10030491 3300025923 Bacteria 3516
388 Ga0207681_10238130 3300025923 Bacteria 1415
389 Ga0207681_10514216 3300025923 Bacteria 982
390 Ga0207681_10596736 3300025923 Bacteria 912
391 Ga0207694_10217945 3300025924 Bacteria 1556
392 Ga0207694_10320097 3300025924 Bacteria 1280
393 Ga0207650_10019273 3300025925 Bacteria 4791
394 Ga0207650_10022579 3300025925 Bacteria 4454
395 Ga0207650_10100187 3300025925 Bacteria 2229
396 Ga0207650_10114336 3300025925 Bacteria 2093
397 Ga0207650_10187307 3300025925 Bacteria 1652
398 Ga0207650_11116792 3300025925 Bacteria 671
399 Ga0207659_10078119 3300025926 Bacteria 2438
400 Ga0207659_10150489 3300025926 Bacteria 1817
401 Ga0207659_10212040 3300025926 Bacteria 1553
402 Ga0207659_10289199 3300025926 Bacteria 1342
403 Ga0207659_10299750 3300025926 Bacteria 1320
404 Ga0207659_11005346 3300025926 Unclassified 717
405 Ga0207687_10072618 3300025927 Bacteria 2462
406 Ga0207664_10064359 3300025929 Bacteria 2933
407 Ga0207644_10026930 3300025931 Bacteria 3969
408 Ga0207644_10031768 3300025931 Bacteria 3681
409 Ga0207644_10107080 3300025931 Bacteria 2109
410 Ga0207644_10195169 3300025931 Bacteria 1594
411 Ga0207644_10329599 3300025931 Bacteria 1236
412 Ga0207690_10172692 3300025932 Bacteria 1621
413 Ga0207706_10124461 3300025933 Bacteria 2268
414 Ga0207706_10142262 3300025933 Bacteria 2110
415 Ga0207706_10271943 3300025933 Bacteria 1478
416 Ga0207706_10348297 3300025933 Bacteria 1288
417 Ga0207706_10545605 3300025933 Bacteria 998
418 Ga0207686_10206673 3300025934 Bacteria 1409
419 Ga0207686_10278301 3300025934 Bacteria 1234
420 Ga0207686_10560960 3300025934 Bacteria 894
421 Ga0207709_10056811 3300025935 Bacteria 2424
422 Ga0207709_10677679 3300025935 Bacteria 823
423 Ga0207670_10101565 3300025936 Bacteria 2055
424 Ga0207669_10086810 3300025937 Bacteria 2024
425 Ga0207669_10584577 3300025937 Bacteria 905
426 Ga0207669_10681147 3300025937 Bacteria 843
427 Ga0207669_10704385 3300025937 Bacteria 830
428 Ga0207669_10779612 3300025937 Unclassified 791
429 Ga0207704_10014059 3300025938 Bacteria 4031
430 Ga0207704_10075926 3300025938 Bacteria 2151
431 Ga0207704_10101818 3300025938 Bacteria 1917
432 Ga0207704_10688735 3300025938 Bacteria 845
433 Ga0207704_10714562 3300025938 Bacteria 831
434 Ga0207665_10012342 3300025939 Bacteria 5612
435 Ga0207691_10020300 3300025940 Bacteria 6283
436 Ga0207691_10196469 3300025940 Unclassified 1757
437 Ga0207691_10205126 3300025940 Bacteria 1715
438 Ga0207711_10008875 3300025941 Bacteria 8407
439 Ga0207711_10012469 3300025941 Bacteria 7064
440 Ga0207711_10036340 3300025941 Bacteria 4180
441 Ga0207711_10215803 3300025941 Bacteria 1753
442 Ga0207711_10268562 3300025941 Bacteria 1569
443 Ga0207711_10291277 3300025941 Bacteria 1505
444 Ga0207711_10322740 3300025941 Bacteria 1427
445 Ga0207711_10730992 3300025941 Bacteria 923
446 Ga0207711_10808736 3300025941 Bacteria 873
447 Ga0207711_10933818 3300025941 Bacteria 806
448 Ga0207711_10994333 3300025941 Bacteria 778
449 Ga0207689_10226837 3300025942 Bacteria 1544
450 Ga0207689_10446730 3300025942 Bacteria 1080
451 Ga0207661_10003551 3300025944 Bacteria 10836
452 Ga0207661_10266390 3300025944 Bacteria 1528
453 Ga0207661_10378100 3300025944 Bacteria 1282
454 Ga0207679_10005303 3300025945 Bacteria 8086
455 Ga0207679_10105085 3300025945 Bacteria 2217
456 Ga0207679_10205448 3300025945 Bacteria 1648
457 Ga0207679_10868746 3300025945 Unclassified 824
458 Ga0207651_10074198 3300025960 Bacteria 2422
459 Ga0207651_10077248 3300025960 Bacteria 2383
460 Ga0207651_10243306 3300025960 Bacteria 1468
461 Ga0207712_10298995 3300025961 Bacteria 1320
462 Ga0207712_10813594 3300025961 Bacteria 822
463 Ga0207668_10124869 3300025972 Bacteria 1955
464 Ga0207668_10244030 3300025972 Bacteria 1455
465 Ga0207640_10091380 3300025981 Bacteria 2109
466 Ga0207640_10308322 3300025981 Bacteria 1255
467 Ga0207658_10156413 3300025986 Bacteria 1863
468 Ga0207658_10334916 3300025986 Bacteria 1314
469 Ga0207658_10446924 3300025986 Bacteria 1144
470 Ga0207658_10738898 3300025986 Bacteria 891
471 Ga0207677_10092868 3300026023 Bacteria 2198
472 Ga0207703_10023951 3300026035 Bacteria 4802
473 Ga0207703_10039756 3300026035 Bacteria 3760
474 Ga0207703_10125566 3300026035 Bacteria 2209
475 Ga0207703_10728641 3300026035 Bacteria 944
476 Ga0207639_10102694 3300026041 Bacteria 2315
477 Ga0207639_10320339 3300026041 Bacteria 1376
478 Ga0207678_10191875 3300026067 Bacteria 1746
479 Ga0207678_10443220 3300026067 Bacteria 1128
480 Ga0207678_10712885 3300026067 Bacteria 883
481 Ga0207708_10032701 3300026075 Bacteria 3949
482 Ga0207708_10318845 3300026075 Bacteria 1268
483 Ga0207708_10352005 3300026075 Bacteria 1208
484 Ga0207708_10406892 3300026075 Bacteria 1126
485 Ga0207708_10909075 3300026075 Unclassified 762
486 Ga0207702_10008469 3300026078 Bacteria 8674
487 Ga0207641_10004712 3300026088 Bacteria 11761
488 Ga0207641_10163865 3300026088 Bacteria 2023
489 Ga0207641_10204106 3300026088 Bacteria 1824
490 Ga0207648_10032669 3300026089 Bacteria 4592
491 Ga0207648_10190712 3300026089 Bacteria 1816
492 Ga0207648_10395064 3300026089 Bacteria 1252
493 Ga0207676_10050187 3300026095 Bacteria 3251
494 Ga0207676_10181287 3300026095 Bacteria 1844
495 Ga0207674_10202922 3300026116 Bacteria 1932
496 Ga0207674_10446163 3300026116 Bacteria 1251
497 Ga0207675_100022197 3300026118 Bacteria 5909
498 Ga0207675_100226283 3300026118 Bacteria 1803
499 Ga0207675_100282159 3300026118 Bacteria 1614
500 Ga0207675_100328310 3300026118 Bacteria 1495
501 Ga0207675_100354391 3300026118 Bacteria 1438
502 Ga0207675_100451397 3300026118 Bacteria 1274
503 Ga0207675_100452166 3300026118 Bacteria 1273
504 Ga0207675_100500226 3300026118 Bacteria 1210
505 Ga0207675_100540223 3300026118 Bacteria 1164
506 Ga0207683_10018509 3300026121 Bacteria 5944
507 Ga0207683_10025896 3300026121 Bacteria 5062
508 Ga0207683_10081095 3300026121 Bacteria 2879
509 Ga0207683_10152909 3300026121 Bacteria 2083
510 Ga0207683_10214370 3300026121 Bacteria 1753
511 Ga0207683_10359937 3300026121 Bacteria 1336
512 Ga0207683_10640777 3300026121 Bacteria 984
513 Ga0207698_10764689 3300026142 Unclassified 966
514 Ga0207698_10818695 3300026142 Bacteria 934
515 Ga0209971_1005801 3300027682 Bacteria 2926
516 Ga0207428_10000002 3300027907 Bacteria 854851
517 Ga0207428_10046677 3300027907 Bacteria 3483
518 Ga0207428_10078208 3300027907 Bacteria 2588
519 Ga0207428_10088773 3300027907 Bacteria 2404
520 Ga0207428_10178434 3300027907 Bacteria 1605
521 Ga0268266_10228936 3300028379 Bacteria 1711
522 Ga0268266_10703705 3300028379 Bacteria 974
523 Ga0268265_10005753 3300028380 Bacteria 8464
524 Ga0268265_10061120 3300028380 Bacteria 2890
525 Ga0268265_10071673 3300028380 Bacteria 2699
526 Ga0268265_10182846 3300028380 Unclassified 1803
527 Ga0268265_10246916 3300028380 Bacteria 1578
528 Ga0268265_10307291 3300028380 Bacteria 1430
529 Ga0268265_10490539 3300028380 Bacteria 1156
530 Ga0268265_11527338 3300028380 Bacteria 672
531 Ga0268264_10134387 3300028381 Bacteria 2197
532 Ga0268264_10252644 3300028381 Bacteria 1638
533 Ga0268264_10818894 3300028381 Bacteria 931
534 Ga0265320_10153836 3300031240 Bacteria 1038
535 Ga0307408_100866497 3300031548 Bacteria 824
536 Ga0265314_10013713 3300031711 Bacteria 6534
537 Ga0307416_100614390 3300032002 Bacteria 1168
538 Ga0307414_10991689 3300032004 Bacteria 773
539 Ga0307415_100326313 3300032126 Bacteria 1282
540 Ga0373948_0032551 3300034817 Bacteria 1058
541 Ga0373959_0003929 3300034820 Bacteria 2379
542 Ga0373938_0012093 3300034957 Bacteria 1614
543 Ga0373928_0001191 3300035084 Bacteria 5133
544 Ga0373929_0000268 3300035085 Bacteria 9647
545 Ga0373949_0003188 3300035090 Bacteria 3984
546 Ga0373951_0001312 3300035091 Bacteria 6564
547 Ga0373952_0000777 3300035092 Bacteria 5745
548 Ga0373923_0179740 3300035111 Bacteria 972
549 Ga0373932_0000945 3300035112 Bacteria 8512
550 Ga0373939_0000488 3300035114 Bacteria 10011
551 Ga0373939_0009737 3300035114 Bacteria 2389
552 Ga0373941_0009542 3300035115 Bacteria 2448
553 Ga0373945_0224724 3300035116 Bacteria 786
554 Ga0373960_0000652 3300035121 Bacteria 7134
555 Ga0373943_0434350 3300035170 Bacteria 761
556 Ga0373942_0004030 3300035207 Bacteria 3429
557 Ga0373942_0128744 3300035207 Bacteria 797
558 Ga0373961_0001097 3300035241 Bacteria 8607
559 Ga0373962_0000586 3300035242 Bacteria 8220
560 Ga0373931_0000769 3300035691 Bacteria 13414
561 Ga0373931_0267686 3300035691 Bacteria 1045
562 Ga0373931_0422892 3300035691 Bacteria 847
563 Ga0373935_0016157 3300035692 Bacteria 4518
564 Ga0373947_0107141 3300035725 Bacteria 1762
565 Ga0373937_0337926 3300036401 Bacteria 1426
566 Ga0373937_0428246 3300036401 Bacteria 1256
567 Ga0373937_0462021 3300036401 Bacteria 1206
568 Ga0373937_0950372 3300036401 Bacteria 808
569 Ga0373925_0064919 3300037068 Bacteria 2749
570 Ga0395901_0828811 3300038443 Bacteria 912
571 Ga0436360_0379591 3300039438 Unclassified 876
572 Ga0436363_0340096 3300039450 Bacteria 1373
573 Ga0450923_014261 3300042125 Bacteria 1473
574 Ga0450896_001674 3300042133 Bacteria 2771
575 Ga0450918_013685 3300042531 Bacteria 1411
576 Ga0451577_0293325 3300042876 Bacteria 1474
577 Ga0453683_0540690 3300044673 Bacteria 758
578 Ga0451576_0079987 3300045051 Bacteria 3401
579 Ga0451576_0419301 3300045051 Bacteria 1404
580 Ga0451576_1800552 3300045051 Bacteria 633
581 Ga0495592_0105109 3300046454 Unclassified 2006
582 Ga0495603_0179976 3300046455 Bacteria 1223
583 Ga0495629_0597008 3300046459 Bacteria 739
584 Ga0495641_0032592 3300046461 Bacteria 2478
585 Ga0495653_0186621 3300046463 Bacteria 1418
586 Ga0495580_0287612 3300046472 Bacteria 1121
587 Ga0495582_0157544 3300046473 Bacteria 1291
588 Ga0495585_0394763 3300046492 Unclassified 667
589 Ga0495628_0293564 3300046516 Bacteria 1204
590 Ga0495644_0128176 3300046523 Bacteria 967
591 Ga0495642_0090823 3300046528 Bacteria 1293
592 Ga0495640_0113446 3300046533 Bacteria 1768
593 Ga0495586_0405386 3300046535 Bacteria 785
594 Ga0495645_0611104 3300046543 Bacteria 670
595 Ga0495667_0243925 3300046559 Bacteria 1144
596 Ga0495667_0292540 3300046559 Bacteria 1033
597 Ga0495667_0561643 3300046559 Bacteria 713
598 Ga0495656_0007853 3300046615 Bacteria 3791
599 Ga0495668_0403034 3300046616 Bacteria 752
600 Ga0495634_0028417 3300046642 Bacteria 3882
601 Ga0495634_0558054 3300046642 Bacteria 667
602 Ga0495635_0059317 3300046663 Bacteria 2631
603 Ga0495659_0131930 3300046664 Bacteria 991
604 Ga0495646_0176749 3300046680 Bacteria 1174
605 Ga0495647_0026691 3300046681 Unclassified 2118
606 Ga0495647_0206941 3300046681 Unclassified 862
607 Ga0495658_0040220 3300046683 Unclassified 2599
608 Ga0495658_0388732 3300046683 Bacteria 889
609 Ga0495669_0169066 3300046684 Bacteria 1039
610 Ga0495613_0126865 3300046689 Bacteria 1829
611 Ga0495613_0572587 3300046689 Unclassified 754
612 Ga0495674_0007981 3300047319 Bacteria 10101
613 Ga0495674_0062170 3300047319 Bacteria 3252
614 Ga0495674_0068429 3300047319 Bacteria 3073
615 Ga0495680_0003636 3300047322 Bacteria 15062
616 Ga0495684_0107881 3300047471 Bacteria 2103
617 Ga0495602_0617355 3300048088 Bacteria 744
618 Ga0496100_0096561 3300048903 Bacteria 2028
619 Ga0496100_0805546 3300048903 Bacteria 736
620 Ga0496101_0009325 3300048904 Bacteria 6447
621 Ga0496102_0391561 3300048905 Bacteria 1307
622 Ga0496104_0082818 3300048907 Bacteria 3060
623 Ga0496104_0111413 3300048907 Bacteria 2624
624 Ga0496104_0287112 3300048907 Bacteria 1558
625 Ga0496104_0351278 3300048907 Bacteria 1387
626 Ga0496104_0830732 3300048907 Unclassified 830
627 Ga0496104_0923537 3300048907 Unclassified 778
628 Ga0496105_0124319 3300048908 Bacteria 2127
629 Ga0496105_0296437 3300048908 Bacteria 1301
630 Ga0496106_0040814 3300048909 Bacteria 3477
631 Ga0496106_0315408 3300048909 Bacteria 1255
632 Ga0496107_0065627 3300048910 Bacteria 2632
633 Ga0496108_0004831 3300048911 Bacteria 10873
634 Ga0496108_0044963 3300048911 Bacteria 3687
635 Ga0496108_0119376 3300048911 Bacteria 2261
636 Ga0496108_0258864 3300048911 Bacteria 1514
637 Ga0496109_0000242 3300048912 Bacteria 52965
638 Ga0496109_0167629 3300048912 Bacteria 2060
639 Ga0496109_0198657 3300048912 Bacteria 1885
640 Ga0496109_0232488 3300048912 Bacteria 1734
641 Ga0496109_0432126 3300048912 Bacteria 1244
642 Ga0496109_1262175 3300048912 Unclassified 675
643 Ga0496110_0001366 3300048913 Bacteria 17576
644 Ga0496110_0004909 3300048913 Bacteria 10439
645 Ga0496110_0913132 3300048913 Bacteria 784
646 Ga0496111_0042971 3300048914 Bacteria 3247
647 Ga0496112_0000481 3300048915 Bacteria 26754
648 Ga0496112_0001340 3300048915 Bacteria 18727
649 Ga0496112_0022194 3300048915 Bacteria 6049
650 Ga0496112_0067435 3300048915 Bacteria 3532
651 Ga0496112_1663619 3300048915 Unclassified 551
652 Ga0496113_0041716 3300048916 Bacteria 3388
653 Ga0496113_0113813 3300048916 Bacteria 2109
654 Ga0496114_0181735 3300048917 Bacteria 1837
655 Ga0496114_0402391 3300048917 Bacteria 1212
656 Ga0496114_0428430 3300048917 Bacteria 1172
657 Ga0501036_0354713 3300049572 Bacteria 1225
658 Ga0501036_0421561 3300049572 Bacteria 1113
659 Ga0501036_1013160 3300049572 Bacteria 680
660 Ga0501040_0172021 3300049576 Bacteria 1534
661 Ga0501040_0977537 3300049576 Bacteria 614
662 Ga0501041_0446005 3300049577 Unclassified 821
663 Ga0501043_0602214 3300049579 Bacteria 812
664 Ga0501048_0072954 3300049582 Bacteria 2423
665 Ga0501069_0170407 3300049585 Bacteria 1256
666 Ga0501072_0301372 3300049588 Bacteria 1274
667 Ga0501073_0001250 3300049589 Bacteria 18592
668 Ga0501074_0069537 3300049590 Bacteria 2532
669 Ga0501074_0384213 3300049590 Bacteria 996
670 Ga0501075_0073759 3300049591 Bacteria 2581
671 Ga0501075_0152714 3300049591 Bacteria 1760
672 Ga0501076_0151173 3300049592 Bacteria 1889
673 Ga0501081_0033914 3300049743 Bacteria 3471
674 Ga0501081_0183996 3300049743 Bacteria 1512
675 Ga0501081_0207195 3300049743 Bacteria 1423
676 Ga0501035_0085009 3300049822 Bacteria 2790
677 Ga0501045_0042038 3300049824 Bacteria 3327
678 Ga0501045_0925251 3300049824 Bacteria 640
679 nmdc:mga05p37_114810_c1 3300050507 Bacteria 3310
680 nmdc:mga05p37_11912_c3 3300050507 Bacteria 4505
681 nmdc:mga05p37_1467_c2 3300050507 Bacteria 5862
682 nmdc:mga05p37_18492_c1 3300050507 Bacteria 8419
683 nmdc:mga05p37_18511_c1 3300050507 Bacteria 8415
684 nmdc:mga05p37_194142_c1 3300050507 Bacteria 2463
685 nmdc:mga05p37_28505_c1 3300050507 Bacteria 6808
686 nmdc:mga05p37_56816_c1 3300050507 Bacteria 4819
687 nmdc:mga05p37_62951_c1 3300050507 Bacteria 4565
688 nmdc:mga05p37_7758_c1 3300050507 Bacteria 12668
689 nmdc:mga05p37_817852_c1 3300050507 Bacteria 1017
690 nmdc:mga09592_126020_c2 3300050508 Bacteria 1237
691 nmdc:mga09592_164309_c1 3300050508 Bacteria 1918
692 nmdc:mga0qj67_153853_c1 3300050509 Bacteria 1866
693 nmdc:mga06r32_16191_c1 3300050510 Bacteria 6792
694 nmdc:mga06r32_269789_c1 3300050510 Bacteria 1689
695 nmdc:mga06r32_395942_c1 3300050510 Bacteria 1363
696 nmdc:mga06r32_72373_c1 3300050510 Bacteria 3337
697 nmdc:mga08y16_29860_c1 3300050511 Bacteria 5741
698 nmdc:mga08y16_329085_c1 3300050511 Bacteria 1572
699 nmdc:mga08y16_389430_c1 3300050511 Bacteria 1428
700 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
701 nmdc:mga08y16_55360_c1 3300050511 Bacteria 4145
702 nmdc:mga08y16_62241_c1 3300050511 Bacteria 3897
703 nmdc:mga0n895_110200_c1 3300050512 Bacteria 2768
704 nmdc:mga0n895_12860_c1 3300050512 Bacteria 7521
705 nmdc:mga0n895_130_c1 3300050512 Bacteria 44769
706 nmdc:mga0n895_151333_c1 3300050512 Bacteria 2351
707 nmdc:mga0n895_212572_c1 3300050512 Bacteria 1964
708 nmdc:mga0n895_235605_c1 3300050512 Bacteria 1858
709 nmdc:mga0n895_353422_c1 3300050512 Bacteria 1488
710 nmdc:mga0n895_42297_c1 3300050512 Bacteria 4432
711 nmdc:mga0n895_54417_c1 3300050512 Bacteria 3936
712 nmdc:mga0n895_622501_c1 3300050512 Bacteria 1080
713 nmdc:mga0n895_63626_c1 3300050512 Bacteria 3648
714 nmdc:mga0n895_676607_c1 3300050512 Bacteria 1029
715 nmdc:mga0n895_884930_c1 3300050512 Bacteria 879
716 nmdc:mga0rr50_152691_c1 3300050513 Bacteria 1868
717 nmdc:mga0rr50_42032_c1 3300050513 Bacteria 3335
718 nmdc:mga0rr50_46863_c1 3300050513 Bacteria 3185
719 nmdc:mga0rr50_49619_c1 3300050513 Bacteria 2508
720 nmdc:mga0rr50_5366_c1 3300050513 Bacteria 7639
721 nmdc:mga0rr50_5415_c1 3300050513 Bacteria 7609
722 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
723 nmdc:mga0rr50_9595_c1 3300050513 Bacteria 6095
724 nmdc:mga08x19_114381_c1 3300050514 Bacteria 1803
725 nmdc:mga08x19_17692_c1 3300050514 Bacteria 4365
726 nmdc:mga08x19_270_c1 3300050514 Bacteria 39380
727 nmdc:mga08x19_311261_c1 3300050514 Bacteria 1095
728 nmdc:mga08x19_476429_c1 3300050514 Bacteria 880
729 nmdc:mga08x19_53421_c1 3300050514 Bacteria 2600
730 nmdc:mga0a205_172898_c1 3300050515 Bacteria 2056
731 nmdc:mga0a205_178980_c1 3300050515 Bacteria 2015
732 nmdc:mga0a205_209536_c1 3300050515 Bacteria 1838
733 nmdc:mga0a205_23800_c1 3300050515 Bacteria 5812
734 nmdc:mga0a205_370252_c1 3300050515 Unclassified 1299
735 nmdc:mga0a205_38026_c1 3300050515 Bacteria 4629
736 nmdc:mga0a205_441250_c1 3300050515 Bacteria 1162
737 nmdc:mga0a205_54185_c1 3300050515 Bacteria 3872
738 nmdc:mga0a205_544813_c1 3300050515 Bacteria 1016
739 nmdc:mga0a205_72644_c1 3300050515 Bacteria 3324
740 Ga0495601_0083628 3300053077 Bacteria 2050
741 Ga0495595_0013969 3300053084 Bacteria 3400
742 Ga0495595_0155689 3300053084 Bacteria 1126
743 Ga0495619_0005033 3300053085 Bacteria 8396
744 Ga0495619_0051070 3300053085 Bacteria 2732
745 Ga0495619_0112432 3300053085 Bacteria 1862
746 Ga0495619_0187223 3300053085 Bacteria 1433
747 Ga0501082_0061166 3300060353 Bacteria 3242
748 Ga0501082_0137398 3300060353 Bacteria 2121

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100240852 Ga0068867_1002408521 154
2 3300005468 Ga0070707_100199746 Ga0070707_1001997462 154
3 3300005471 Ga0070698_101090346 Ga0070698_1010903461 154
4 3300025908 Ga0207643_10066487 Ga0207643_100664872 154
5 3300025922 Ga0207646_10234644 Ga0207646_102346442 154
6 3300026089 Ga0207648_10190712 Ga0207648_101907122 154
7 3300005295 Ga0065707_10272809 Ga0065707_102728092 155
8 3300005353 Ga0070669_100076099 Ga0070669_1000760992 155
9 3300005354 Ga0070675_100140434 Ga0070675_1001404342 155
10 3300005364 Ga0070673_100067482 Ga0070673_1000674824 155
11 3300005364 Ga0070673_100607733 Ga0070673_1006077331 155
12 3300005441 Ga0070700_100165270 Ga0070700_1001652702 155
13 3300005459 Ga0068867_100400168 Ga0068867_1004001682 155
14 3300005543 Ga0070672_100440212 Ga0070672_1004402122 155
15 3300005844 Ga0068862_100168491 Ga0068862_1001684912 155
16 3300005844 Ga0068862_100225703 Ga0068862_1002257031 155
17 3300006847 Ga0075431_100046411 Ga0075431_1000464114 155
18 3300009147 Ga0114129_10032021 Ga0114129_100320214 155
19 3300009553 Ga0105249_10749306 Ga0105249_107493062 155
20 3300009553 Ga0105249_11647101 Ga0105249_116471011 155
21 3300013306 Ga0163162_11746668 Ga0163162_117466681 155
22 3300025901 Ga0207688_10330346 Ga0207688_103303462 155
23 3300025923 Ga0207681_10238130 Ga0207681_102381302 155
24 3300025926 Ga0207659_10212040 Ga0207659_102120402 155
25 3300025960 Ga0207651_10243306 Ga0207651_102433062 155
26 3300026075 Ga0207708_10032701 Ga0207708_100327013 155
27 3300026118 Ga0207675_100451397 Ga0207675_1004513972 155
28 3300028380 Ga0268265_10061120 Ga0268265_100611203 155
29 3300028380 Ga0268265_10307291 Ga0268265_103072912 155
30 3300050507 nmdc:mga05p37_18492_c1 nmdc:mga05p37_18492_c1_4742_5311 155
31 3300050510 nmdc:mga06r32_16191_c1 nmdc:mga06r32_16191_c1_4321_4890 155
32 3300005339 Ga0070660_100567599 Ga0070660_1005675992 156
33 3300005440 Ga0070705_100794924 Ga0070705_1007949241 156
34 3300005445 Ga0070708_100189798 Ga0070708_1001897982 156
35 3300005548 Ga0070665_100173101 Ga0070665_1001731011 156
36 3300005718 Ga0068866_10633127 Ga0068866_106331272 156
37 3300005937 Ga0081455_10187169 Ga0081455_101871691 156
38 3300006844 Ga0075428_100223106 Ga0075428_1002231062 156
39 3300006844 Ga0075428_100948243 Ga0075428_1009482432 156
40 3300006846 Ga0075430_101024709 Ga0075430_1010247092 156
41 3300006847 Ga0075431_100225036 Ga0075431_1002250362 156
42 3300006852 Ga0075433_10012184 Ga0075433_100121848 156
43 3300006852 Ga0075433_10742730 Ga0075433_107427302 156
44 3300006871 Ga0075434_100645727 Ga0075434_1006457272 156
45 3300007076 Ga0075435_100080563 Ga0075435_1000805633 156
46 3300009094 Ga0111539_10442227 Ga0111539_104422272 156
47 3300009147 Ga0114129_10006049 Ga0114129_100060494 156
48 3300009147 Ga0114129_10065109 Ga0114129_100651094 156
49 3300031548 Ga0307408_100866497 Ga0307408_1008664972 156
50 3300046616 Ga0495668_0403034 Ga0495668_0403034_65_634 156
51 3300048909 Ga0496106_0040814 Ga0496106_0040814_2840_3409 156
52 3300050507 nmdc:mga05p37_28505_c1 nmdc:mga05p37_28505_c1_1988_2557 156
53 3300050507 nmdc:mga05p37_7758_c1 nmdc:mga05p37_7758_c1_6838_7407 156
54 3300050508 nmdc:mga09592_126020_c2 nmdc:mga09592_126020_c2_539_1108 156
55 3300050510 nmdc:mga06r32_395942_c1 nmdc:mga06r32_395942_c1_450_1019 156
56 3300050512 nmdc:mga0n895_151333_c1 nmdc:mga0n895_151333_c1_518_1087 156
57 3300050512 nmdc:mga0n895_676607_c1 nmdc:mga0n895_676607_c1_182_751 156
58 3300050514 nmdc:mga08x19_114381_c1 nmdc:mga08x19_114381_c1_253_822 156
59 3300050515 nmdc:mga0a205_178980_c1 nmdc:mga0a205_178980_c1_588_1157 156
60 3300050515 nmdc:mga0a205_370252_c1 nmdc:mga0a205_370252_c1_129_698 156
61 3300005327 Ga0070658_10575796 Ga0070658_105757962 157
62 3300005336 Ga0070680_100079394 Ga0070680_1000793942 157
63 3300005339 Ga0070660_100130489 Ga0070660_1001304891 157
64 3300005347 Ga0070668_100104422 Ga0070668_1001044221 157
65 3300005366 Ga0070659_100169086 Ga0070659_1001690862 157
66 3300005457 Ga0070662_100292551 Ga0070662_1002925512 157
67 3300005458 Ga0070681_10541639 Ga0070681_105416391 157
68 3300005466 Ga0070685_10057586 Ga0070685_100575862 157
69 3300005518 Ga0070699_100048831 Ga0070699_1000488313 157
70 3300005530 Ga0070679_100165560 Ga0070679_1001655602 157
71 3300005539 Ga0068853_100257842 Ga0068853_1002578422 157
72 3300005563 Ga0068855_100024107 Ga0068855_10002410711 157
73 3300005617 Ga0068859_101385408 Ga0068859_1013854081 157
74 3300005844 Ga0068862_100025823 Ga0068862_1000258234 157
75 3300006058 Ga0075432_10069884 Ga0075432_100698842 157
76 3300006871 Ga0075434_100221818 Ga0075434_1002218182 157
77 3300006931 Ga0097620_101385411 Ga0097620_1013854111 157
78 3300007076 Ga0075435_100000956 Ga0075435_1000009565 157
79 3300009093 Ga0105240_10199012 Ga0105240_101990123 157
80 3300009093 Ga0105240_10864923 Ga0105240_108649232 157
81 3300009551 Ga0105238_10377020 Ga0105238_103770202 157
82 3300014326 Ga0157380_10189471 Ga0157380_101894712 157
83 3300014326 Ga0157380_10859429 Ga0157380_108594292 157
84 3300025909 Ga0207705_10373323 Ga0207705_103733231 157
85 3300025912 Ga0207707_10460636 Ga0207707_104606361 157
86 3300025917 Ga0207660_10201874 Ga0207660_102018742 157
87 3300025921 Ga0207652_10061240 Ga0207652_100612402 157
88 3300025922 Ga0207646_10042536 Ga0207646_100425365 157
89 3300025923 Ga0207681_10023583 Ga0207681_100235835 157
90 3300025932 Ga0207690_10172692 Ga0207690_101726922 157
91 3300025933 Ga0207706_10271943 Ga0207706_102719432 157
92 3300026075 Ga0207708_10318845 Ga0207708_103188452 157
93 3300027907 Ga0207428_10046677 Ga0207428_100466772 157
94 3300028380 Ga0268265_10246916 Ga0268265_102469162 157
95 3300048907 Ga0496104_0830732 Ga0496104_0830732_216_785 157
96 3300050511 nmdc:mga08y16_62241_c1 nmdc:mga08y16_62241_c1_713_1282 157
97 3300050512 nmdc:mga0n895_63626_c1 nmdc:mga0n895_63626_c1_817_1386 157
98 3300050513 nmdc:mga0rr50_5366_c1 nmdc:mga0rr50_5366_c1_6538_7107 157
99 3300050515 nmdc:mga0a205_38026_c1 nmdc:mga0a205_38026_c1_541_1110 157
100 3300005290 Ga0065712_10155174 Ga0065712_101551742 158
101 3300005293 Ga0065715_10189832 Ga0065715_101898321 158
102 3300005440 Ga0070705_100067347 Ga0070705_1000673473 158
103 3300005539 Ga0068853_100117095 Ga0068853_1001170952 158
104 3300005564 Ga0070664_100368763 Ga0070664_1003687632 158
105 3300005614 Ga0068856_100012203 Ga0068856_1000122039 158
106 3300005618 Ga0068864_100014824 Ga0068864_1000148244 158
107 3300005842 Ga0068858_100424946 Ga0068858_1004249462 158
108 3300006871 Ga0075434_100000260 Ga0075434_10000026031 158
109 3300007076 Ga0075435_100000064 Ga0075435_10000006439 158
110 3300009101 Ga0105247_10055248 Ga0105247_100552483 158
111 3300009177 Ga0105248_10019171 Ga0105248_100191712 158
112 3300009551 Ga0105238_10387080 Ga0105238_103870802 158
113 3300009553 Ga0105249_11116655 Ga0105249_111166551 158
114 3300011119 Ga0105246_10167694 Ga0105246_101676942 158
115 3300013307 Ga0157372_10844899 Ga0157372_108448992 158
116 3300014325 Ga0163163_10006749 Ga0163163_100067499 158
117 3300014325 Ga0163163_10142721 Ga0163163_101427212 158
118 3300014745 Ga0157377_10190314 Ga0157377_101903142 158
119 3300014968 Ga0157379_10211338 Ga0157379_102113382 158
120 3300025900 Ga0207710_10105268 Ga0207710_101052681 158
121 3300025924 Ga0207694_10320097 Ga0207694_103200972 158
122 3300025925 Ga0207650_10114336 Ga0207650_101143363 158
123 3300025941 Ga0207711_10008875 Ga0207711_1000887511 158
124 3300025945 Ga0207679_10205448 Ga0207679_102054482 158
125 3300026035 Ga0207703_10039756 Ga0207703_100397564 158
126 3300026041 Ga0207639_10102694 Ga0207639_101026942 158
127 3300026078 Ga0207702_10008469 Ga0207702_100084699 158
128 3300026118 Ga0207675_100282159 Ga0207675_1002821592 158
129 3300026118 Ga0207675_100500226 Ga0207675_1005002262 158
130 3300048909 Ga0496106_0315408 Ga0496106_0315408_639_1208 158
131 3300048911 Ga0496108_0258864 Ga0496108_0258864_148_717 158
132 3300048912 Ga0496109_0432126 Ga0496109_0432126_26_595 158
133 3300048915 Ga0496112_0022194 Ga0496112_0022194_3719_4288 158
134 3300048916 Ga0496113_0113813 Ga0496113_0113813_1374_1943 158
135 3300049589 Ga0501073_0001250 Ga0501073_0001250_10903_11472 158
136 3300049590 Ga0501074_0069537 Ga0501074_0069537_728_1297 158
137 3300050512 nmdc:mga0n895_130_c1 nmdc:mga0n895_130_c1_15931_16500 158
138 3300050512 nmdc:mga0n895_42297_c1 nmdc:mga0n895_42297_c1_3824_4393 158
139 3300050513 nmdc:mga0rr50_5_c1 nmdc:mga0rr50_5_c1_309023_309592 158
140 3300050514 nmdc:mga08x19_270_c1 nmdc:mga08x19_270_c1_32297_32866 158
141 3300050515 nmdc:mga0a205_172898_c1 nmdc:mga0a205_172898_c1_1516_2037 158
142 3300005329 Ga0070683_100491740 Ga0070683_1004917402 159
143 3300005330 Ga0070690_100023302 Ga0070690_1000233023 159
144 3300005335 Ga0070666_10009157 Ga0070666_100091573 159
145 3300005337 Ga0070682_101241778 Ga0070682_1012417781 159
146 3300005343 Ga0070687_100326773 Ga0070687_1003267731 159
147 3300005356 Ga0070674_100358954 Ga0070674_1003589542 159
148 3300005367 Ga0070667_100235121 Ga0070667_1002351211 159
149 3300005440 Ga0070705_100200800 Ga0070705_1002008002 159
150 3300005544 Ga0070686_100025139 Ga0070686_1000251393 159
151 3300005547 Ga0070693_100537506 Ga0070693_1005375062 159
152 3300005548 Ga0070665_100305967 Ga0070665_1003059672 159
153 3300005578 Ga0068854_100050186 Ga0068854_1000501862 159
154 3300005578 Ga0068854_100639830 Ga0068854_1006398301 159
155 3300005616 Ga0068852_100436547 Ga0068852_1004365471 159
156 3300005719 Ga0068861_100793964 Ga0068861_1007939642 159
157 3300005842 Ga0068858_100788367 Ga0068858_1007883672 159
158 3300007076 Ga0075435_100001486 Ga0075435_10000148616 159
159 3300009093 Ga0105240_10276151 Ga0105240_102761512 159
160 3300009093 Ga0105240_10450925 Ga0105240_104509252 159
161 3300009098 Ga0105245_11132201 Ga0105245_111322011 159
162 3300009177 Ga0105248_10203570 Ga0105248_102035702 159
163 3300009177 Ga0105248_10333938 Ga0105248_103339382 159
164 3300025903 Ga0207680_10014285 Ga0207680_100142854 159
165 3300025907 Ga0207645_10005968 Ga0207645_100059682 159
166 3300025913 Ga0207695_10451887 Ga0207695_104518871 159
167 3300025918 Ga0207662_10035840 Ga0207662_100358403 159
168 3300025918 Ga0207662_10570760 Ga0207662_105707601 159
169 3300025923 Ga0207681_10596736 Ga0207681_105967361 159
170 3300025925 Ga0207650_10100187 Ga0207650_101001874 159
171 3300025931 Ga0207644_10107080 Ga0207644_101070803 159
172 3300025937 Ga0207669_10086810 Ga0207669_100868102 159
173 3300025941 Ga0207711_10268562 Ga0207711_102685622 159
174 3300025944 Ga0207661_10266390 Ga0207661_102663901 159
175 3300025981 Ga0207640_10091380 Ga0207640_100913802 159
176 3300025981 Ga0207640_10308322 Ga0207640_103083221 159
177 3300026035 Ga0207703_10728641 Ga0207703_107286411 159
178 3300026118 Ga0207675_100452166 Ga0207675_1004521661 159
179 3300026142 Ga0207698_10818695 Ga0207698_108186951 159
180 3300028381 Ga0268264_10818894 Ga0268264_108188942 159
181 3300034820 Ga0373959_0003929 Ga0373959_0003929_1673_2242 159
182 3300034957 Ga0373938_0012093 Ga0373938_0012093_567_1136 159
183 3300035084 Ga0373928_0001191 Ga0373928_0001191_1872_2441 159
184 3300035085 Ga0373929_0000268 Ga0373929_0000268_1328_1897 159
185 3300035090 Ga0373949_0003188 Ga0373949_0003188_2163_2732 159
186 3300035091 Ga0373951_0001312 Ga0373951_0001312_2141_2710 159
187 3300035092 Ga0373952_0000777 Ga0373952_0000777_4990_5559 159
188 3300035112 Ga0373932_0000945 Ga0373932_0000945_7855_8424 159
189 3300035114 Ga0373939_0000488 Ga0373939_0000488_3253_3822 159
190 3300035115 Ga0373941_0009542 Ga0373941_0009542_175_744 159
191 3300035121 Ga0373960_0000652 Ga0373960_0000652_3951_4520 159
192 3300035207 Ga0373942_0004030 Ga0373942_0004030_43_612 159
193 3300035241 Ga0373961_0001097 Ga0373961_0001097_6556_7125 159
194 3300035242 Ga0373962_0000586 Ga0373962_0000586_1414_1983 159
195 3300035691 Ga0373931_0000769 Ga0373931_0000769_9160_9729 159
196 3300042876 Ga0451577_0293325 Ga0451577_0293325_710_1279 159
197 3300045051 Ga0451576_0079987 Ga0451576_0079987_1364_1933 159
198 3300048907 Ga0496104_0351278 Ga0496104_0351278_880_1359 159
199 3300048912 Ga0496109_1262175 Ga0496109_1262175_90_659 159
200 3300050512 nmdc:mga0n895_622501_c1 nmdc:mga0n895_622501_c1_100_669 159
201 3300050513 nmdc:mga0rr50_5415_c1 nmdc:mga0rr50_5415_c1_801_1370 159
202 3300050514 nmdc:mga08x19_311261_c1 nmdc:mga08x19_311261_c1_503_1072 159
203 3300004803 Ga0058862_12374949 Ga0058862_123749491 160
204 3300005290 Ga0065712_10032885 Ga0065712_100328852 160
205 3300005337 Ga0070682_100148856 Ga0070682_1001488562 160
206 3300005339 Ga0070660_100012244 Ga0070660_1000122448 160
207 3300005355 Ga0070671_100005643 Ga0070671_1000056438 160
208 3300005439 Ga0070711_100084742 Ga0070711_1000847423 160
209 3300005458 Ga0070681_10022019 Ga0070681_100220197 160
210 3300005459 Ga0068867_100316304 Ga0068867_1003163042 160
211 3300005471 Ga0070698_100447627 Ga0070698_1004476272 160
212 3300005539 Ga0068853_100607363 Ga0068853_1006073631 160
213 3300005841 Ga0068863_100048499 Ga0068863_1000484992 160
214 3300005842 Ga0068858_100162878 Ga0068858_1001628782 160
215 3300006852 Ga0075433_10911636 Ga0075433_109116361 160
216 3300009176 Ga0105242_10172432 Ga0105242_101724322 160
217 3300009177 Ga0105248_10099091 Ga0105248_100990912 160
218 3300009551 Ga0105238_10207226 Ga0105238_102072262 160
219 3300010375 Ga0105239_10434181 Ga0105239_104341812 160
220 3300013307 Ga0157372_10644399 Ga0157372_106443992 160
221 3300014325 Ga0163163_10881232 Ga0163163_108812321 160
222 3300014969 Ga0157376_10120872 Ga0157376_101208723 160
223 3300025912 Ga0207707_10063397 Ga0207707_100633972 160
224 3300025916 Ga0207663_10067550 Ga0207663_100675502 160
225 3300025919 Ga0207657_10127678 Ga0207657_101276782 160
226 3300025921 Ga0207652_10072372 Ga0207652_100723722 160
227 3300025924 Ga0207694_10217945 Ga0207694_102179452 160
228 3300025929 Ga0207664_10064359 Ga0207664_100643593 160
229 3300025945 Ga0207679_10868746 Ga0207679_108687461 160
230 3300026041 Ga0207639_10320339 Ga0207639_103203391 160
231 3300026116 Ga0207674_10202922 Ga0207674_102029222 160
232 3300027682 Ga0209971_1005801 Ga0209971_10058012 160
233 3300035692 Ga0373935_0016157 Ga0373935_0016157_259_828 160
234 3300035725 Ga0373947_0107141 Ga0373947_0107141_259_828 160
235 3300037068 Ga0373925_0064919 Ga0373925_0064919_1866_2435 160
236 3300046543 Ga0495645_0611104 Ga0495645_0611104_51_620 160
237 3300046559 Ga0495667_0292540 Ga0495667_0292540_434_1003 160
238 3300046684 Ga0495669_0169066 Ga0495669_0169066_445_1014 160
239 3300046689 Ga0495613_0572587 Ga0495613_0572587_35_604 160
240 3300048912 Ga0496109_0167629 Ga0496109_0167629_779_1348 160
241 3300048915 Ga0496112_0067435 Ga0496112_0067435_74_643 160
242 3300049591 Ga0501075_0152714 Ga0501075_0152714_88_657 160
243 3300049743 Ga0501081_0183996 Ga0501081_0183996_730_1299 160
244 3300053084 Ga0495595_0155689 Ga0495595_0155689_413_982 160
245 3300060353 Ga0501082_0137398 Ga0501082_0137398_1120_1689 160
246 3300002459 JGI24751J29686_10001906 JGI24751J29686_100019062 161
247 3300005331 Ga0070670_100424196 Ga0070670_1004241962 161
248 3300005338 Ga0068868_100561835 Ga0068868_1005618352 161
249 3300005340 Ga0070689_100153008 Ga0070689_1001530081 161
250 3300005455 Ga0070663_100530915 Ga0070663_1005309152 161
251 3300005468 Ga0070707_100103003 Ga0070707_1001030031 161
252 3300005617 Ga0068859_100091550 Ga0068859_1000915502 161
253 3300005618 Ga0068864_100037415 Ga0068864_1000374151 161
254 3300006871 Ga0075434_100734992 Ga0075434_1007349922 161
255 3300006881 Ga0068865_100021831 Ga0068865_1000218316 161
256 3300006931 Ga0097620_100091552 Ga0097620_1000915522 161
257 3300009094 Ga0111539_10024645 Ga0111539_100246454 161
258 3300025903 Ga0207680_10112271 Ga0207680_101122712 161
259 3300025922 Ga0207646_10066661 Ga0207646_100666613 161
260 3300025926 Ga0207659_10299750 Ga0207659_102997501 161
261 3300025931 Ga0207644_10031768 Ga0207644_100317682 161
262 3300025936 Ga0207670_10101565 Ga0207670_101015651 161
263 3300025938 Ga0207704_10075926 Ga0207704_100759262 161
264 3300025938 Ga0207704_10688735 Ga0207704_106887351 161
265 3300025941 Ga0207711_10994333 Ga0207711_109943332 161
266 3300026023 Ga0207677_10092868 Ga0207677_100928682 161
267 3300026035 Ga0207703_10125566 Ga0207703_101255662 161
268 3300026088 Ga0207641_10004712 Ga0207641_1000471214 161
269 3300026089 Ga0207648_10395064 Ga0207648_103950642 161
270 3300026095 Ga0207676_10181287 Ga0207676_101812873 161
271 3300026118 Ga0207675_100022197 Ga0207675_1000221976 161
272 3300027907 Ga0207428_10178434 Ga0207428_101784342 161
273 3300028380 Ga0268265_10071673 Ga0268265_100716734 161
274 3300034817 Ga0373948_0032551 Ga0373948_0032551_338_907 161
275 3300036401 Ga0373937_0462021 Ga0373937_0462021_268_837 161
276 3300036401 Ga0373937_0950372 Ga0373937_0950372_90_659 161
277 3300038443 Ga0395901_0828811 Ga0395901_0828811_21_590 161
278 3300046523 Ga0495644_0128176 Ga0495644_0128176_203_772 161
279 3300048088 Ga0495602_0617355 Ga0495602_0617355_65_634 161
280 3300050511 nmdc:mga08y16_29860_c1 nmdc:mga08y16_29860_c1_825_1394 161
281 3300050512 nmdc:mga0n895_884930_c1 nmdc:mga0n895_884930_c1_239_808 161
282 3300050515 nmdc:mga0a205_544813_c1 nmdc:mga0a205_544813_c1_127_696 161
283 3300053085 Ga0495619_0051070 Ga0495619_0051070_204_773 161
284 3300053085 Ga0495619_0112432 Ga0495619_0112432_629_1198 161
285 3300005445 Ga0070708_100305319 Ga0070708_1003053192 162
286 3300005546 Ga0070696_100203222 Ga0070696_1002032222 162
287 3300005718 Ga0068866_10069885 Ga0068866_100698852 162
288 3300006871 Ga0075434_100119221 Ga0075434_1001192213 162
289 3300007076 Ga0075435_100030037 Ga0075435_1000300374 162
290 3300009147 Ga0114129_10878379 Ga0114129_108783791 162
291 3300009148 Ga0105243_10006872 Ga0105243_100068727 162
292 3300009174 Ga0105241_10551432 Ga0105241_105514322 162
293 3300009176 Ga0105242_10031995 Ga0105242_100319951 162
294 3300009177 Ga0105248_10215838 Ga0105248_102158382 162
295 3300014326 Ga0157380_10034047 Ga0157380_100340471 162
296 3300025899 Ga0207642_10439120 Ga0207642_104391202 162
297 3300025911 Ga0207654_10633046 Ga0207654_106330461 162
298 3300025934 Ga0207686_10278301 Ga0207686_102783011 162
299 3300025935 Ga0207709_10056811 Ga0207709_100568114 162
300 3300025937 Ga0207669_10584577 Ga0207669_105845771 162
301 3300025941 Ga0207711_10036340 Ga0207711_100363406 162
302 3300025972 Ga0207668_10124869 Ga0207668_101248692 162
303 3300026118 Ga0207675_100540223 Ga0207675_1005402232 162
304 3300035114 Ga0373939_0009737 Ga0373939_0009737_1246_1815 162
305 3300046528 Ga0495642_0090823 Ga0495642_0090823_697_1269 162
306 3300048915 Ga0496112_1663619 Ga0496112_1663619_51_539 162
307 3300050507 nmdc:mga05p37_62951_c1 nmdc:mga05p37_62951_c1_198_767 162
308 3300050512 nmdc:mga0n895_12860_c1 nmdc:mga0n895_12860_c1_1131_1700 162
309 3300050513 nmdc:mga0rr50_46863_c1 nmdc:mga0rr50_46863_c1_1784_2353 162
310 3300050515 nmdc:mga0a205_23800_c1 nmdc:mga0a205_23800_c1_1528_2097 162
311 3300005364 Ga0070673_101069890 Ga0070673_1010698901 163
312 3300006237 Ga0097621_100427467 Ga0097621_1004274672 163
313 3300009177 Ga0105248_10530127 Ga0105248_105301272 163
314 3300013297 Ga0157378_10115031 Ga0157378_101150313 163
315 3300014968 Ga0157379_10070958 Ga0157379_100709581 163
316 3300025935 Ga0207709_10677679 Ga0207709_106776791 163
317 3300025941 Ga0207711_10215803 Ga0207711_102158032 163
318 3300025986 Ga0207658_10156413 Ga0207658_101564132 163
319 3300035691 Ga0373931_0267686 Ga0373931_0267686_76_645 163
320 3300035691 Ga0373931_0422892 Ga0373931_0422892_14_583 163
321 3300046472 Ga0495580_0287612 Ga0495580_0287612_23_592 163
322 3300046681 Ga0495647_0026691 Ga0495647_0026691_1373_1942 163
323 3300046683 Ga0495658_0040220 Ga0495658_0040220_1905_2474 163
324 3300005985 Ga0081539_10009375 Ga0081539_100093751 164
325 3300025933 Ga0207706_10348297 Ga0207706_103482972 164
326 3300048908 Ga0496105_0296437 Ga0496105_0296437_393_944 164
327 3300048917 Ga0496114_0428430 Ga0496114_0428430_59_610 164
328 3300050515 nmdc:mga0a205_441250_c1 nmdc:mga0a205_441250_c1_193_762 164
329 3300005445 Ga0070708_100621696 Ga0070708_1006216962 165
330 3300049579 Ga0501043_0602214 Ga0501043_0602214_22_543 165
331 3300005545 Ga0070695_100461502 Ga0070695_1004615022 166
332 3300006871 Ga0075434_100049926 Ga0075434_1000499263 166
333 3300006914 Ga0075436_100388785 Ga0075436_1003887852 166
334 3300007076 Ga0075435_100009317 Ga0075435_1000093172 166
335 3300046459 Ga0495629_0597008 Ga0495629_0597008_34_603 166
336 3300046533 Ga0495640_0113446 Ga0495640_0113446_282_851 166
337 3300046535 Ga0495586_0405386 Ga0495586_0405386_137_706 166
338 3300046559 Ga0495667_0561643 Ga0495667_0561643_97_666 166
339 3300046680 Ga0495646_0176749 Ga0495646_0176749_485_1054 166
340 3300050512 nmdc:mga0n895_235605_c1 nmdc:mga0n895_235605_c1_474_1043 166
341 3300050513 nmdc:mga0rr50_152691_c1 nmdc:mga0rr50_152691_c1_111_680 166
342 3300050514 nmdc:mga08x19_17692_c1 nmdc:mga08x19_17692_c1_2092_2661 166
343 3300005456 Ga0070678_100086206 Ga0070678_1000862062 167
344 3300005544 Ga0070686_100795604 Ga0070686_1007956042 167
345 3300005548 Ga0070665_100009152 Ga0070665_1000091529 167
346 3300005718 Ga0068866_10042614 Ga0068866_100426142 167
347 3300005844 Ga0068862_101008608 Ga0068862_1010086081 167
348 3300006237 Ga0097621_100004862 Ga0097621_1000048622 167
349 3300006358 Ga0068871_100015954 Ga0068871_1000159544 167
350 3300006881 Ga0068865_100032362 Ga0068865_1000323623 167
351 3300009098 Ga0105245_10068047 Ga0105245_100680474 167
352 3300009147 Ga0114129_10028743 Ga0114129_100287433 167
353 3300009176 Ga0105242_10001351 Ga0105242_100013514 167
354 3300009177 Ga0105248_10447650 Ga0105248_104476501 167
355 3300014969 Ga0157376_10021091 Ga0157376_100210913 167
356 3300025899 Ga0207642_10027711 Ga0207642_100277112 167
357 3300025934 Ga0207686_10206673 Ga0207686_102066732 167
358 3300025938 Ga0207704_10101818 Ga0207704_101018182 167
359 3300025938 Ga0207704_10714562 Ga0207704_107145622 167
360 3300025941 Ga0207711_10933818 Ga0207711_109338182 167
361 3300025942 Ga0207689_10226837 Ga0207689_102268372 167
362 3300026118 Ga0207675_100354391 Ga0207675_1003543912 167
363 3300026121 Ga0207683_10152909 Ga0207683_101529093 167
364 3300028380 Ga0268265_11527338 Ga0268265_115273381 167
365 3300035207 Ga0373942_0128744 Ga0373942_0128744_175_744 167
366 3300045051 Ga0451576_0419301 Ga0451576_0419301_93_662 167
367 3300048917 Ga0496114_0402391 Ga0496114_0402391_377_946 167
368 3300049743 Ga0501081_0207195 Ga0501081_0207195_78_644 167
369 3300049824 Ga0501045_0925251 Ga0501045_0925251_57_623 167
370 3300050507 nmdc:mga05p37_56816_c1 nmdc:mga05p37_56816_c1_1799_2368 167
371 3300050512 nmdc:mga0n895_54417_c1 nmdc:mga0n895_54417_c1_2412_2981 167
372 3300050515 nmdc:mga0a205_209536_c1 nmdc:mga0a205_209536_c1_1060_1629 167
373 3300005444 Ga0070694_100766151 Ga0070694_1007661511 168
374 3300035170 Ga0373943_0434350 Ga0373943_0434350_135_704 168
375 3300036401 Ga0373937_0428246 Ga0373937_0428246_616_1185 168
376 3300044673 Ga0453683_0540690 Ga0453683_0540690_166_735 168
377 3300046664 Ga0495659_0131930 Ga0495659_0131930_33_605 168
378 3300050512 nmdc:mga0n895_212572_c1 nmdc:mga0n895_212572_c1_36_605 168
379 3300050513 nmdc:mga0rr50_42032_c1 nmdc:mga0rr50_42032_c1_763_1332 168
380 3300005356 Ga0070674_100427674 Ga0070674_1004276742 169
381 3300005445 Ga0070708_100924291 Ga0070708_1009242911 169
382 3300005455 Ga0070663_100299404 Ga0070663_1002994042 169
383 3300005518 Ga0070699_100011351 Ga0070699_1000113517 169
384 3300006914 Ga0075436_100036450 Ga0075436_1000364504 169
385 3300007076 Ga0075435_100263137 Ga0075435_1002631372 169
386 3300007076 Ga0075435_100775402 Ga0075435_1007754022 169
387 3300009147 Ga0114129_10041259 Ga0114129_100412594 169
388 3300025937 Ga0207669_10704385 Ga0207669_107043852 169
389 3300026067 Ga0207678_10191875 Ga0207678_101918752 169
390 3300050507 nmdc:mga05p37_114810_c1 nmdc:mga05p37_114810_c1_2108_2677 169
391 3300050514 nmdc:mga08x19_53421_c1 nmdc:mga08x19_53421_c1_1228_1797 169
392 3300005445 Ga0070708_100043579 Ga0070708_1000435792 170
393 3300005468 Ga0070707_100708928 Ga0070707_1007089281 170
394 3300005471 Ga0070698_100098715 Ga0070698_1000987153 170
395 3300005842 Ga0068858_100202811 Ga0068858_1002028112 170
396 3300005471 Ga0070698_100168353 Ga0070698_1001683532 171
397 3300049585 Ga0501069_0170407 Ga0501069_0170407_377_946 171
398 3300005365 Ga0070688_100016655 Ga0070688_1000166555 172
399 3300005444 Ga0070694_100026503 Ga0070694_1000265034 172
400 3300005458 Ga0070681_10252986 Ga0070681_102529862 172
401 3300005468 Ga0070707_100094736 Ga0070707_1000947362 172
402 3300005545 Ga0070695_100019190 Ga0070695_1000191904 172
403 3300005546 Ga0070696_100061896 Ga0070696_1000618963 172
404 3300005549 Ga0070704_101189696 Ga0070704_1011896961 172
405 3300005617 Ga0068859_100609161 Ga0068859_1006091612 172
406 3300005618 Ga0068864_100404962 Ga0068864_1004049622 172
407 3300005937 Ga0081455_10058018 Ga0081455_100580183 172
408 3300006847 Ga0075431_101049007 Ga0075431_1010490071 172
409 3300006931 Ga0097620_100609196 Ga0097620_1006091962 172
410 3300009147 Ga0114129_10007288 Ga0114129_100072885 172
411 3300025912 Ga0207707_10222517 Ga0207707_102225172 172
412 3300035111 Ga0373923_0179740 Ga0373923_0179740_354_923 172
413 3300049576 Ga0501040_0977537 Ga0501040_0977537_83_601 172
414 3300050507 nmdc:mga05p37_1467_c2 nmdc:mga05p37_1467_c2_3211_3783 172
415 3300050515 nmdc:mga0a205_54185_c1 nmdc:mga0a205_54185_c1_992_1564 172
416 3300053085 Ga0495619_0187223 Ga0495619_0187223_689_1258 172
417 3300005467 Ga0070706_100656173 Ga0070706_1006561731 173
418 3300005546 Ga0070696_100105885 Ga0070696_1001058852 173
419 3300006852 Ga0075433_10288384 Ga0075433_102883842 173
420 3300009011 Ga0105251_10208200 Ga0105251_102082001 173
421 3300009147 Ga0114129_10085215 Ga0114129_100852152 173
422 3300046454 Ga0495592_0105109 Ga0495592_0105109_1456_1977 173
423 3300047319 Ga0495674_0007981 Ga0495674_0007981_9564_10085 173
424 3300049590 Ga0501074_0384213 Ga0501074_0384213_449_970 173
425 3300049592 Ga0501076_0151173 Ga0501076_0151173_1349_1870 173
426 3300050507 nmdc:mga05p37_11912_c3 nmdc:mga05p37_11912_c3_1007_1576 173
427 3300050513 nmdc:mga0rr50_49619_c1 nmdc:mga0rr50_49619_c1_1770_2291 173
428 3300005841 Ga0068863_100112640 Ga0068863_1001126402 174
429 3300006173 Ga0070716_100041817 Ga0070716_1000418172 174
430 3300006175 Ga0070712_100306496 Ga0070712_1003064962 174
431 3300006237 Ga0097621_100000066 Ga0097621_10000006644 174
432 3300006358 Ga0068871_100000170 Ga0068871_10000017021 174
433 3300006358 Ga0068871_100337008 Ga0068871_1003370081 174
434 3300006852 Ga0075433_10540358 Ga0075433_105403582 174
435 3300006880 Ga0075429_100095845 Ga0075429_1000958452 174
436 3300009147 Ga0114129_10865377 Ga0114129_108653771 174
437 3300009177 Ga0105248_10224887 Ga0105248_102248872 174
438 3300013308 Ga0157375_10425541 Ga0157375_104255412 174
439 3300025906 Ga0207699_10529356 Ga0207699_105293562 174
440 3300025939 Ga0207665_10012342 Ga0207665_100123424 174
441 3300026088 Ga0207641_10163865 Ga0207641_101638652 174
442 3300026121 Ga0207683_10359937 Ga0207683_103599372 174
443 3300027907 Ga0207428_10088773 Ga0207428_100887732 174
444 3300028380 Ga0268265_10490539 Ga0268265_104905392 174
445 3300032004 Ga0307414_10991689 Ga0307414_109916891 174
446 3300045051 Ga0451576_1800552 Ga0451576_1800552_26_595 174
447 3300050507 nmdc:mga05p37_817852_c1 nmdc:mga05p37_817852_c1_80_649 174
448 3300005471 Ga0070698_100708319 Ga0070698_1007083191 175
449 3300046681 Ga0495647_0206941 Ga0495647_0206941_203_772 175
450 3300050512 nmdc:mga0n895_353422_c1 nmdc:mga0n895_353422_c1_288_857 175
451 3300005458 Ga0070681_10076512 Ga0070681_100765121 176
452 3300005842 Ga0068858_100013804 Ga0068858_1000138046 176
453 3300014968 Ga0157379_10049621 Ga0157379_100496213 176
454 3300025912 Ga0207707_10746528 Ga0207707_107465281 176
455 3300026035 Ga0207703_10023951 Ga0207703_100239513 176
456 3300028381 Ga0268264_10134387 Ga0268264_101343873 176
457 3300006880 Ga0075429_100913907 Ga0075429_1009139071 177
458 3300009147 Ga0114129_10048371 Ga0114129_100483712 177
459 3300031240 Ga0265320_10153836 Ga0265320_101538362 177
460 3300046683 Ga0495658_0388732 Ga0495658_0388732_141_710 177
461 3300048907 Ga0496104_0287112 Ga0496104_0287112_341_910 177
462 3300049591 Ga0501075_0073759 Ga0501075_0073759_30_599 177
463 3300050507 nmdc:mga05p37_194142_c1 nmdc:mga05p37_194142_c1_1860_2429 177
464 3300006237 Ga0097621_100200610 Ga0097621_1002006102 178
465 3300014969 Ga0157376_10210051 Ga0157376_102100512 178
466 3300026075 Ga0207708_10352005 Ga0207708_103520052 178
467 3300042125 Ga0450923_014261 Ga0450923_014261_567_1136 179
468 3300042531 Ga0450918_013685 Ga0450918_013685_60_629 179
469 3300046492 Ga0495585_0394763 Ga0495585_0394763_46_615 179
470 3300046615 Ga0495656_0007853 Ga0495656_0007853_1772_2341 179
471 3300025907 Ga0207645_10276405 Ga0207645_102764052 180
472 3300032002 Ga0307416_100614390 Ga0307416_1006143901 180
473 3300032126 Ga0307415_100326313 Ga0307415_1003263132 180
474 3300005295 Ga0065707_10101877 Ga0065707_101018773 181
475 3300005329 Ga0070683_100214025 Ga0070683_1002140252 181
476 3300005330 Ga0070690_100571123 Ga0070690_1005711232 181
477 3300005331 Ga0070670_100034706 Ga0070670_1000347066 181
478 3300005335 Ga0070666_10135228 Ga0070666_101352281 181
479 3300005339 Ga0070660_100723930 Ga0070660_1007239301 181
480 3300005466 Ga0070685_10552915 Ga0070685_105529152 181
481 3300005535 Ga0070684_100000085 Ga0070684_1000000852 181
482 3300005543 Ga0070672_100550322 Ga0070672_1005503222 181
483 3300005548 Ga0070665_101241110 Ga0070665_1012411101 181
484 3300005564 Ga0070664_100000442 Ga0070664_1000004422 181
485 3300006358 Ga0068871_100530007 Ga0068871_1005300071 181
486 3300011119 Ga0105246_10419679 Ga0105246_104196792 181
487 3300013296 Ga0157374_10048498 Ga0157374_100484984 181
488 3300013306 Ga0163162_10427928 Ga0163162_104279282 181
489 3300014325 Ga0163163_10063166 Ga0163163_100631662 181
490 3300025903 Ga0207680_10170713 Ga0207680_101707132 181
491 3300025925 Ga0207650_10019273 Ga0207650_100192734 181
492 3300025931 Ga0207644_10195169 Ga0207644_101951691 181
493 3300025944 Ga0207661_10003551 Ga0207661_100035517 181
494 3300025945 Ga0207679_10005303 Ga0207679_100053035 181
495 3300028379 Ga0268266_10703705 Ga0268266_107037052 181
496 3300048907 Ga0496104_0082818 Ga0496104_0082818_1507_2076 181
497 3300048911 Ga0496108_0004831 Ga0496108_0004831_3822_4391 181
498 3300048912 Ga0496109_0000242 Ga0496109_0000242_11712_12281 181
499 3300048913 Ga0496110_0001366 Ga0496110_0001366_6386_6955 181
500 3300048914 Ga0496111_0042971 Ga0496111_0042971_960_1529 181
501 3300048915 Ga0496112_0001340 Ga0496112_0001340_5475_6044 181
502 3300005444 Ga0070694_100464340 Ga0070694_1004643402 182
503 3300006914 Ga0075436_100104702 Ga0075436_1001047022 182
504 3300025926 Ga0207659_10150489 Ga0207659_101504892 182
505 3300025937 Ga0207669_10779612 Ga0207669_107796122 182
506 3300025986 Ga0207658_10334916 Ga0207658_103349162 182
507 3300026121 Ga0207683_10025896 Ga0207683_100258963 182
508 3300005329 Ga0070683_100422151 Ga0070683_1004221512 183
509 3300009093 Ga0105240_10043908 Ga0105240_100439083 183
510 3300009551 Ga0105238_10367596 Ga0105238_103675962 183
511 3300025900 Ga0207710_10069529 Ga0207710_100695292 183
512 3300025944 Ga0207661_10378100 Ga0207661_103781002 183
513 3300046455 Ga0495603_0179976 Ga0495603_0179976_85_636 183
514 3300046461 Ga0495641_0032592 Ga0495641_0032592_1218_1769 183
515 3300046463 Ga0495653_0186621 Ga0495653_0186621_605_1156 183
516 3300046473 Ga0495582_0157544 Ga0495582_0157544_214_765 183
517 3300046559 Ga0495667_0243925 Ga0495667_0243925_43_594 183
518 3300046642 Ga0495634_0028417 Ga0495634_0028417_2350_2901 183
519 3300046663 Ga0495635_0059317 Ga0495635_0059317_32_583 183
520 3300046689 Ga0495613_0126865 Ga0495613_0126865_47_598 183
521 3300047319 Ga0495674_0062170 Ga0495674_0062170_1160_1711 183
522 3300047322 Ga0495680_0003636 Ga0495680_0003636_2348_2899 183
523 3300047471 Ga0495684_0107881 Ga0495684_0107881_1282_1833 183
524 3300048903 Ga0496100_0805546 Ga0496100_0805546_72_623 183
525 3300048911 Ga0496108_0119376 Ga0496108_0119376_596_1147 183
526 3300048912 Ga0496109_0198657 Ga0496109_0198657_1075_1626 183
527 3300048913 Ga0496110_0913132 Ga0496110_0913132_72_623 183
528 3300053084 Ga0495595_0013969 Ga0495595_0013969_869_1420 183
529 3300009177 Ga0105248_10087056 Ga0105248_100870564 184
530 3300014969 Ga0157376_10482257 Ga0157376_104822572 184
531 3300025941 Ga0207711_10291277 Ga0207711_102912772 184
532 3300050509 nmdc:mga0qj67_153853_c1 nmdc:mga0qj67_153853_c1_1299_1853 184
533 3300005543 Ga0070672_100550943 Ga0070672_1005509432 186
534 3300026075 Ga0207708_10909075 Ga0207708_109090751 186
535 3300026142 Ga0207698_10764689 Ga0207698_107646892 186
536 3300039438 Ga0436360_0379591 Ga0436360_0379591_227_787 186
537 3300046516 Ga0495628_0293564 Ga0495628_0293564_592_1155 187
538 2162886007 SwRhRL2b_contig_3181706 SwRhRL2b_0548.00001720 189
539 2162886011 MRS1b_contig_7392549 MRS1b_0869.00001680 189
540 3300005289 Ga0065704_10025299 Ga0065704_100252992 189
541 3300005290 Ga0065712_10086516 Ga0065712_100865162 189
542 3300005293 Ga0065715_10089447 Ga0065715_100894475 189
543 3300005293 Ga0065715_10173661 Ga0065715_101736612 189
544 3300005295 Ga0065707_10083745 Ga0065707_100837454 189
545 3300005295 Ga0065707_10373122 Ga0065707_103731221 189
546 3300005328 Ga0070676_10109671 Ga0070676_101096712 189
547 3300005331 Ga0070670_100002347 Ga0070670_10000234716 189
548 3300005331 Ga0070670_100418034 Ga0070670_1004180342 189
549 3300005331 Ga0070670_100804841 Ga0070670_1008048411 189
550 3300005333 Ga0070677_10028118 Ga0070677_100281182 189
551 3300005334 Ga0068869_100491312 Ga0068869_1004913122 189
552 3300005335 Ga0070666_10175809 Ga0070666_101758092 189
553 3300005343 Ga0070687_100436072 Ga0070687_1004360721 189
554 3300005353 Ga0070669_100001373 Ga0070669_10000137315 189
555 3300005353 Ga0070669_100040264 Ga0070669_1000402644 189
556 3300005353 Ga0070669_100045667 Ga0070669_1000456672 189
557 3300005353 Ga0070669_100079821 Ga0070669_1000798212 189
558 3300005354 Ga0070675_100113009 Ga0070675_1001130092 189
559 3300005354 Ga0070675_100270944 Ga0070675_1002709442 189
560 3300005354 Ga0070675_100522728 Ga0070675_1005227281 189
561 3300005354 Ga0070675_100750312 Ga0070675_1007503122 189
562 3300005354 Ga0070675_101321027 Ga0070675_1013210271 189
563 3300005355 Ga0070671_100064404 Ga0070671_1000644042 189
564 3300005355 Ga0070671_100414103 Ga0070671_1004141032 189
565 3300005356 Ga0070674_100078066 Ga0070674_1000780663 189
566 3300005356 Ga0070674_100318598 Ga0070674_1003185982 189
567 3300005356 Ga0070674_100678257 Ga0070674_1006782571 189
568 3300005364 Ga0070673_100102553 Ga0070673_1001025533 189
569 3300005364 Ga0070673_100315794 Ga0070673_1003157942 189
570 3300005365 Ga0070688_100002960 Ga0070688_1000029602 189
571 3300005365 Ga0070688_100227841 Ga0070688_1002278412 189
572 3300005365 Ga0070688_100303170 Ga0070688_1003031702 189
573 3300005366 Ga0070659_100305224 Ga0070659_1003052242 189
574 3300005456 Ga0070678_100019556 Ga0070678_1000195561 189
575 3300005456 Ga0070678_100042628 Ga0070678_1000426284 189
576 3300005457 Ga0070662_100053417 Ga0070662_1000534172 189
577 3300005457 Ga0070662_100611760 Ga0070662_1006117602 189
578 3300005459 Ga0068867_100032508 Ga0068867_1000325082 189
579 3300005466 Ga0070685_10020352 Ga0070685_100203522 189
580 3300005518 Ga0070699_100145338 Ga0070699_1001453382 189
581 3300005543 Ga0070672_100021287 Ga0070672_1000212875 189
582 3300005543 Ga0070672_100090097 Ga0070672_1000900974 189
583 3300005543 Ga0070672_100183130 Ga0070672_1001831302 189
584 3300005548 Ga0070665_100107181 Ga0070665_1001071813 189
585 3300005548 Ga0070665_100818989 Ga0070665_1008189892 189
586 3300005549 Ga0070704_100270366 Ga0070704_1002703662 189
587 3300005564 Ga0070664_100111623 Ga0070664_1001116232 189
588 3300005564 Ga0070664_101449005 Ga0070664_1014490051 189
589 3300005577 Ga0068857_100460418 Ga0068857_1004604182 189
590 3300005617 Ga0068859_100145708 Ga0068859_1001457083 189
591 3300005617 Ga0068859_100253435 Ga0068859_1002534352 189
592 3300005617 Ga0068859_100303550 Ga0068859_1003035502 189
593 3300005617 Ga0068859_100536005 Ga0068859_1005360052 189
594 3300005618 Ga0068864_100004401 Ga0068864_10000440111 189
595 3300005718 Ga0068866_10639602 Ga0068866_106396021 189
596 3300005719 Ga0068861_100131328 Ga0068861_1001313283 189
597 3300005719 Ga0068861_100367482 Ga0068861_1003674822 189
598 3300005840 Ga0068870_10150032 Ga0068870_101500322 189
599 3300005841 Ga0068863_100012648 Ga0068863_1000126487 189
600 3300005843 Ga0068860_100313743 Ga0068860_1003137432 189
601 3300005844 Ga0068862_100004280 Ga0068862_1000042804 189
602 3300005844 Ga0068862_100127539 Ga0068862_1001275392 189
603 3300005844 Ga0068862_100152636 Ga0068862_1001526362 189
604 3300005937 Ga0081455_10338177 Ga0081455_103381772 189
605 3300006237 Ga0097621_100081888 Ga0097621_1000818882 189
606 3300006237 Ga0097621_100272309 Ga0097621_1002723092 189
607 3300006237 Ga0097621_100453499 Ga0097621_1004534992 189
608 3300006358 Ga0068871_100853584 Ga0068871_1008535842 189
609 3300006844 Ga0075428_100000003 Ga0075428_10000000319 189
610 3300006844 Ga0075428_100001358 Ga0075428_10000135813 189
611 3300006847 Ga0075431_100009235 Ga0075431_1000092352 189
612 3300006847 Ga0075431_100601125 Ga0075431_1006011252 189
613 3300006852 Ga0075433_10101463 Ga0075433_101014632 189
614 3300006871 Ga0075434_100201344 Ga0075434_1002013443 189
615 3300006880 Ga0075429_100416474 Ga0075429_1004164742 189
616 3300006881 Ga0068865_100163612 Ga0068865_1001636122 189
617 3300006914 Ga0075436_100531818 Ga0075436_1005318181 189
618 3300006931 Ga0097620_100145711 Ga0097620_1001457112 189
619 3300006931 Ga0097620_100253429 Ga0097620_1002534292 189
620 3300006931 Ga0097620_100303565 Ga0097620_1003035652 189
621 3300006931 Ga0097620_100536020 Ga0097620_1005360202 189
622 3300007076 Ga0075435_100198882 Ga0075435_1001988822 189
623 3300007076 Ga0075435_100235627 Ga0075435_1002356272 189
624 3300009094 Ga0111539_10000001 Ga0111539_10000001277 189
625 3300009094 Ga0111539_10002104 Ga0111539_100021042 189
626 3300009094 Ga0111539_10074840 Ga0111539_100748404 189
627 3300009094 Ga0111539_10098674 Ga0111539_100986742 189
628 3300009147 Ga0114129_10072782 Ga0114129_100727822 189
629 3300009176 Ga0105242_10137415 Ga0105242_101374152 189
630 3300009176 Ga0105242_10223217 Ga0105242_102232172 189
631 3300009177 Ga0105248_10022784 Ga0105248_100227845 189
632 3300009177 Ga0105248_10077836 Ga0105248_100778362 189
633 3300009177 Ga0105248_10593224 Ga0105248_105932241 189
634 3300009553 Ga0105249_10000688 Ga0105249_1000068818 189
635 3300009553 Ga0105249_10059463 Ga0105249_100594631 189
636 3300009553 Ga0105249_10393036 Ga0105249_103930361 189
637 3300010375 Ga0105239_10288919 Ga0105239_102889192 189
638 3300011119 Ga0105246_10391354 Ga0105246_103913542 189
639 3300013297 Ga0157378_10982756 Ga0157378_109827562 189
640 3300013306 Ga0163162_10285217 Ga0163162_102852172 189
641 3300013306 Ga0163162_10479723 Ga0163162_104797232 189
642 3300013308 Ga0157375_10119756 Ga0157375_101197562 189
643 3300013308 Ga0157375_10725113 Ga0157375_107251132 189
644 3300014326 Ga0157380_11168831 Ga0157380_111688312 189
645 3300014745 Ga0157377_10204807 Ga0157377_102048072 189
646 3300014968 Ga0157379_10418094 Ga0157379_104180941 189
647 3300014969 Ga0157376_10623461 Ga0157376_106234612 189
648 3300017792 Ga0163161_10074971 Ga0163161_100749712 189
649 3300025315 Ga0207697_10183488 Ga0207697_101834881 189
650 3300025893 Ga0207682_10025795 Ga0207682_100257953 189
651 3300025918 Ga0207662_10076398 Ga0207662_100763981 189
652 3300025923 Ga0207681_10030491 Ga0207681_100304914 189
653 3300025923 Ga0207681_10514216 Ga0207681_105142161 189
654 3300025925 Ga0207650_10022579 Ga0207650_100225796 189
655 3300025925 Ga0207650_10187307 Ga0207650_101873072 189
656 3300025925 Ga0207650_11116792 Ga0207650_111167921 189
657 3300025926 Ga0207659_10078119 Ga0207659_100781192 189
658 3300025926 Ga0207659_10289199 Ga0207659_102891992 189
659 3300025926 Ga0207659_11005346 Ga0207659_110053461 189
660 3300025927 Ga0207687_10072618 Ga0207687_100726182 189
661 3300025931 Ga0207644_10026930 Ga0207644_100269304 189
662 3300025931 Ga0207644_10329599 Ga0207644_103295991 189
663 3300025933 Ga0207706_10124461 Ga0207706_101244611 189
664 3300025933 Ga0207706_10142262 Ga0207706_101422621 189
665 3300025933 Ga0207706_10545605 Ga0207706_105456051 189
666 3300025934 Ga0207686_10560960 Ga0207686_105609602 189
667 3300025937 Ga0207669_10681147 Ga0207669_106811472 189
668 3300025938 Ga0207704_10014059 Ga0207704_100140594 189
669 3300025940 Ga0207691_10020300 Ga0207691_100203004 189
670 3300025940 Ga0207691_10196469 Ga0207691_101964692 189
671 3300025940 Ga0207691_10205126 Ga0207691_102051262 189
672 3300025941 Ga0207711_10012469 Ga0207711_100124695 189
673 3300025941 Ga0207711_10322740 Ga0207711_103227402 189
674 3300025941 Ga0207711_10730992 Ga0207711_107309921 189
675 3300025941 Ga0207711_10808736 Ga0207711_108087362 189
676 3300025942 Ga0207689_10446730 Ga0207689_104467302 189
677 3300025945 Ga0207679_10105085 Ga0207679_101050852 189
678 3300025960 Ga0207651_10074198 Ga0207651_100741983 189
679 3300025960 Ga0207651_10077248 Ga0207651_100772482 189
680 3300025961 Ga0207712_10298995 Ga0207712_102989952 189
681 3300025961 Ga0207712_10813594 Ga0207712_108135942 189
682 3300025972 Ga0207668_10244030 Ga0207668_102440302 189
683 3300025986 Ga0207658_10446924 Ga0207658_104469241 189
684 3300025986 Ga0207658_10738898 Ga0207658_107388982 189
685 3300026067 Ga0207678_10443220 Ga0207678_104432202 189
686 3300026067 Ga0207678_10712885 Ga0207678_107128851 189
687 3300026075 Ga0207708_10406892 Ga0207708_104068922 189
688 3300026088 Ga0207641_10204106 Ga0207641_102041063 189
689 3300026089 Ga0207648_10032669 Ga0207648_100326695 189
690 3300026095 Ga0207676_10050187 Ga0207676_100501872 189
691 3300026116 Ga0207674_10446163 Ga0207674_104461632 189
692 3300026118 Ga0207675_100226283 Ga0207675_1002262833 189
693 3300026118 Ga0207675_100328310 Ga0207675_1003283103 189
694 3300026121 Ga0207683_10018509 Ga0207683_100185092 189
695 3300026121 Ga0207683_10081095 Ga0207683_100810952 189
696 3300026121 Ga0207683_10214370 Ga0207683_102143702 189
697 3300026121 Ga0207683_10640777 Ga0207683_106407772 189
698 3300027907 Ga0207428_10000002 Ga0207428_10000002290 189
699 3300027907 Ga0207428_10078208 Ga0207428_100782083 189
700 3300028379 Ga0268266_10228936 Ga0268266_102289362 189
701 3300028380 Ga0268265_10005753 Ga0268265_1000575312 189
702 3300028380 Ga0268265_10182846 Ga0268265_101828463 189
703 3300028381 Ga0268264_10252644 Ga0268264_102526442 189
704 3300031711 Ga0265314_10013713 Ga0265314_100137136 189
705 3300035116 Ga0373945_0224724 Ga0373945_0224724_132_701 189
706 3300036401 Ga0373937_0337926 Ga0373937_0337926_80_649 189
707 3300039450 Ga0436363_0340096 Ga0436363_0340096_625_1194 189
708 3300042133 Ga0450896_001674 Ga0450896_001674_188_757 189
709 3300046642 Ga0495634_0558054 Ga0495634_0558054_33_602 189
710 3300047319 Ga0495674_0068429 Ga0495674_0068429_1995_2564 189
711 3300048903 Ga0496100_0096561 Ga0496100_0096561_920_1489 189
712 3300048904 Ga0496101_0009325 Ga0496101_0009325_4673_5242 189
713 3300048905 Ga0496102_0391561 Ga0496102_0391561_162_731 189
714 3300048907 Ga0496104_0111413 Ga0496104_0111413_1423_1992 189
715 3300048907 Ga0496104_0923537 Ga0496104_0923537_122_691 189
716 3300048908 Ga0496105_0124319 Ga0496105_0124319_208_777 189
717 3300048910 Ga0496107_0065627 Ga0496107_0065627_189_758 189
718 3300048911 Ga0496108_0044963 Ga0496108_0044963_2304_2873 189
719 3300048912 Ga0496109_0232488 Ga0496109_0232488_901_1470 189
720 3300048913 Ga0496110_0004909 Ga0496110_0004909_7502_8071 189
721 3300048915 Ga0496112_0000481 Ga0496112_0000481_2935_3504 189
722 3300048916 Ga0496113_0041716 Ga0496113_0041716_1760_2329 189
723 3300048917 Ga0496114_0181735 Ga0496114_0181735_817_1386 189
724 3300049572 Ga0501036_0354713 Ga0501036_0354713_104_673 189
725 3300049572 Ga0501036_0421561 Ga0501036_0421561_443_1012 189
726 3300049572 Ga0501036_1013160 Ga0501036_1013160_34_603 189
727 3300049576 Ga0501040_0172021 Ga0501040_0172021_440_1009 189
728 3300049577 Ga0501041_0446005 Ga0501041_0446005_14_583 189
729 3300049582 Ga0501048_0072954 Ga0501048_0072954_103_672 189
730 3300049588 Ga0501072_0301372 Ga0501072_0301372_649_1218 189
731 3300049743 Ga0501081_0033914 Ga0501081_0033914_1885_2454 189
732 3300049822 Ga0501035_0085009 Ga0501035_0085009_1434_2003 189
733 3300049824 Ga0501045_0042038 Ga0501045_0042038_1058_1627 189
734 3300050507 nmdc:mga05p37_18511_c1 nmdc:mga05p37_18511_c1_6940_7509 189
735 3300050508 nmdc:mga09592_164309_c1 nmdc:mga09592_164309_c1_851_1420 189
736 3300050510 nmdc:mga06r32_269789_c1 nmdc:mga06r32_269789_c1_940_1509 189
737 3300050510 nmdc:mga06r32_72373_c1 nmdc:mga06r32_72373_c1_1184_1753 189
738 3300050511 nmdc:mga08y16_329085_c1 nmdc:mga08y16_329085_c1_860_1429 189
739 3300050511 nmdc:mga08y16_389430_c1 nmdc:mga08y16_389430_c1_118_687 189
740 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_308963_309532 189
741 3300050511 nmdc:mga08y16_55360_c1 nmdc:mga08y16_55360_c1_711_1280 189
742 3300050512 nmdc:mga0n895_110200_c1 nmdc:mga0n895_110200_c1_1154_1723 189
743 3300050513 nmdc:mga0rr50_9595_c1 nmdc:mga0rr50_9595_c1_1389_1958 189
744 3300050514 nmdc:mga08x19_476429_c1 nmdc:mga08x19_476429_c1_67_636 189
745 3300050515 nmdc:mga0a205_72644_c1 nmdc:mga0a205_72644_c1_1464_2033 189
746 3300053077 Ga0495601_0083628 Ga0495601_0083628_930_1499 189
747 3300053085 Ga0495619_0005033 Ga0495619_0005033_617_1186 189
748 3300060353 Ga0501082_0061166 Ga0501082_0061166_2478_3047 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

21

184

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lhp-assembly2.cif.gz_T crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9623 110 186
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.9546 6 187
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9463 6 187
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.9348 6 187
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.9316 7 186
ID Description Score Start End Superfamily
1is1A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9941 7 187 1.10.132.20
1wqhA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9852 8 187 1.10.132.20
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.982 7 182 1.10.132.20
1iseA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.981 7 189 1.10.132.20
4kawX01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9798 7 187 1.10.132.20
ID Description Score Start End GO Terms
AF-A0A6N4TFV1-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9747 8 187 GO:0005737
GO:0006415
GO:0043023
AF-A0A7C6N339-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.971 6 187 GO:0005737
GO:0006415
GO:0043023
AF-A0A4V1UUT9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.968 6 186 GO:0005737
GO:0006415
GO:0043023
AF-P61306-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.968 6 189 GO:0005737
GO:0006415
GO:0043023
AF-A0A7D7ZIN6-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9679 6 189 GO:0005737
GO:0006415
GO:0043023

Feature Viewer

pLDDT pTM Quality
84.13 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map