F478973

General Info

Members Datasets Scaffolds Average Seq Length
748 477 1496 496

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0015572|Ga0495672_0015572_860_2521
Length 553
Sequence LATNRVDRSDEGCQAPLARFKLPPSSPVDPGAFLFISKRCPHLVQRLRIDHQFRDPDMELVVKSVNPQTLKTATLVVAVGEGRKLGAVAKQLDELSAGAISAVLKRGDLAGKVGQSLLLHSLPNLKAERVLLVGVGKDEELGDRPFRKIVAGILNTLKGLGGSDAVLALDEIVVKGRDSYGKTRLLAETLVDGEYQFDQFKSQKAEPRALKKITLVTIKAAEAEVQRAVTHATAIANGMAFTRDLGNLPPNICHPTFLGEQAKNLGKQFKDLKVEVLDEKKIKALGMGSFYAVGQGSAQPPRLIVMQYNGGKKSEKPYALVGKGITFDTGGISLKPGAGMDEMKYDMGGAASVFGTVRAVLELKLPINLVCILACAENMPSGNASRPGDIVTTMSGQTVEILNTDAEGRLVLCDALTYSERFKPQAVIDIATLTGACVVALGSHTSGLLGNNEQLIDQLLSAGKAADDRAWQLPLFDEYQEQLDSPFADIANIGGPKAGTITAACFLSRFTKNLNWAHLDIAGTAWTSGGKDKGATGRPVPLLTQYLLDRAKA

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
96 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
97 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
105 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
123 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
128 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
129 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
130 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
131 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
132 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
133 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
134 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
135 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
219 2511231004 Pseudomonas sp. GM102 Isolate Nodule
220 2511231006 Pseudomonas sp. GM17 Isolate Nodule
221 2511231007 Pseudomonas sp. GM18 Isolate Nodule
222 2511231008 Pseudomonas sp. GM21 Isolate Nodule
223 2511231010 Pseudomonas sp. GM25 Isolate Nodule
224 2511231011 Pseudomonas sp. GM30 Isolate Nodule
225 2511231012 Pseudomonas sp. GM33 Isolate Nodule
226 2511231014 Pseudomonas sp. GM48 Isolate Nodule
227 2511231015 Pseudomonas sp. GM49 Isolate Nodule
228 2511231016 Pseudomonas sp. GM50 Isolate Nodule
229 2511231017 Pseudomonas sp. GM55 Isolate Nodule
230 2511231018 Pseudomonas sp. GM60 Isolate Nodule
231 2511231019 Pseudomonas sp. GM67 Isolate Nodule
232 2511231020 Pseudomonas sp. GM74 Isolate Nodule
233 2511231021 Pseudomonas sp. GM78 Isolate Nodule
234 2511231022 Pseudomonas sp. GM79 Isolate Nodule
235 2511231023 Pseudomonas sp. GM80 Isolate Nodule
236 2511231024 Pseudomonas sp. GM84 Isolate Nodule
237 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
238 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
239 2547132512 Azospira oryzae 6a3 Isolate Unclassified
240 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
241 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
242 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
243 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
244 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
245 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
246 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
247 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
248 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
249 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
250 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
251 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
252 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
253 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
254 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
255 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
256 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
257 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
258 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
259 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
260 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
261 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
262 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
263 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
264 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
265 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
266 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
267 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
268 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
269 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
270 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
271 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
272 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
273 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
274 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
275 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
276 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
277 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
278 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
279 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
280 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
281 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
282 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
283 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
284 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
285 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
286 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
287 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
288 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
289 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
290 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
291 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
292 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
293 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
294 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
295 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
296 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
297 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
298 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
299 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
300 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
301 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
302 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
303 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
304 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
305 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
306 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
307 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
308 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
309 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
310 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
311 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
312 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
313 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
314 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
315 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
316 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
317 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
318 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
319 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
320 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
321 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
322 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
323 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
324 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
325 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
326 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
327 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
328 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
329 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
330 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
331 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
332 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
333 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
334 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
335 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
336 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
337 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
338 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
339 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
340 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
341 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
342 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
343 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
344 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
345 2765235841 Pseudomonas putida AA7 Isolate Unclassified
346 2773857670 Pseudomonas sp. 478 Isolate Unclassified
347 2773857673 Pseudomonas sp. 443 Isolate Unclassified
348 2784132063 Pseudomonas sp. 424 Isolate Unclassified
349 2784132072 Pseudomonas sp. 460 Isolate Unclassified
350 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
351 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
352 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
353 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
354 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
355 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
356 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
357 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
358 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
359 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
360 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
361 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
362 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
363 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
364 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
365 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
366 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
367 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
368 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
369 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
370 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
371 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
372 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
373 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
374 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
375 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
376 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
377 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
378 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
379 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
380 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
381 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
382 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
383 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
384 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
385 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
386 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
387 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
388 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
389 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
390 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
391 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
392 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
393 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
394 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
395 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
396 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
397 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
398 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
399 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
400 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
401 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
402 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
403 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
404 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
405 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
406 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
407 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
408 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
409 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
410 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
411 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
412 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
413 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
414 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
415 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
416 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
417 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
418 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
419 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
420 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
421 2941479691
422 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
423 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
424 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
425 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
426 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
427 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
428 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
429 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
430 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
431 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
432 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
433 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
434 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
435 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
436 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
437 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
438 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
439 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
440 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
441 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
442 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
443 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
444 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
445 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
446 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
447 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
448 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
449 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
450 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
451 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
452 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
453 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
454 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
455 8052494512 Pseudomonas putida LD6 Isolate Unclassified
456 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
457 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
458 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
459 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
460 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
461 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
462 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
463 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
464 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
465 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
466 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
467 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
468 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
469 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
470 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
471 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
472 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
473 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
474 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
475 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
476 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
477 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.37
Metatranscriptomes 0
Isolates 34.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.02
Nodule 3.61
Rhizoplane 9.49
Rhizosphere 62.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0015572 3300047320 Bacteria 5158
2 MRS2a_Contig_171 2124908027 Bacteria 22045
3 JGI25162J39368_1000101 3300002737 Bacteria 94481
4 JGI25162J39368_1000200 3300002737 Bacteria 63130
5 JGI25163J39215_1001257 3300002771 Bacteria 4629
6 JGI25163J39215_1001263 3300002771 Bacteria 4600
7 JGI25164J39214_1000097 3300002772 Bacteria 87008
8 JGI25164J39214_1000162 3300002772 Bacteria 63130
9 JGI25165J46597_1000184 3300003214 Bacteria 94481
10 JGI25165J46597_1000294 3300003214 Bacteria 63130
11 Ga0055538_1000029 3300003751 Bacteria 203858
12 Ga0055539_1000039 3300003752 Bacteria 203858
13 Ga0055533_1000049 3300003756 Bacteria 203858
14 Ga0055532_1000049 3300003758 Bacteria 174079
15 Ga0055525_1000077 3300003759 Bacteria 166608
16 Ga0055536_1000062 3300003781 Bacteria 99169
17 Ga0055536_1002715 3300003781 Bacteria 9816
18 Ga0055536_1002887 3300003781 Bacteria 9444
19 Ga0055530_10000489 3300003791 Bacteria 34449
20 Ga0055530_10003343 3300003791 Bacteria 9212
21 Ga0055530_10003378 3300003791 Bacteria 9124
22 Ga0055540_1001086 3300003792 Bacteria 17251
23 Ga0055540_1002667 3300003792 Bacteria 9212
24 Ga0055540_1002708 3300003792 Bacteria 9124
25 Ga0055531_10001423 3300003794 Bacteria 17662
26 Ga0055541_1000026 3300003841 Bacteria 203858
27 Ga0065714_10000532 3300005288 Bacteria 3983
28 Ga0065714_10004098 3300005288 Bacteria 9895
29 Ga0065714_10019409 3300005288 Bacteria 2195
30 Ga0065714_10025493 3300005288 Bacteria 1720
31 Ga0065714_10069308 3300005288 Bacteria 4285
32 Ga0065714_10095901 3300005288 Bacteria 1774
33 Ga0065714_10099438 3300005288 Bacteria 1676
34 Ga0065704_10079021 3300005289 Bacteria 4279
35 Ga0065704_10101051 3300005289 Bacteria 2251
36 Ga0065712_10000436 3300005290 Bacteria 11353
37 Ga0065712_10000741 3300005290 Bacteria 11999
38 Ga0065712_10067897 3300005290 Bacteria 22137
39 Ga0065715_10090306 3300005293 Bacteria 7253
40 Ga0070661_100000541 3300005344 Bacteria 28924
41 Ga0070661_100166088 3300005344 Bacteria 1674
42 Ga0070669_100000292 3300005353 Bacteria 39324
43 Ga0070669_100053265 3300005353 Bacteria 2961
44 Ga0070714_100001758 3300005435 Bacteria 15800
45 Ga0070662_100000560 3300005457 Bacteria 22585
46 Ga0068853_100045050 3300005539 Bacteria 3778
47 Ga0070704_100020015 3300005549 Bacteria 4306
48 Ga0068855_100000537 3300005563 Bacteria 46369
49 Ga0070664_100000977 3300005564 Bacteria 22391
50 Ga0068857_100129005 3300005577 Bacteria 2280
51 Ga0068854_100067271 3300005578 Bacteria 2610
52 Ga0068851_10000006 3300005834 Bacteria 258116
53 Ga0075364_10000144 3300006051 Bacteria 31200
54 Ga0075432_10005444 3300006058 Bacteria 4339
55 Ga0075370_10001507 3300006353 Bacteria 10178
56 Ga0075428_100010658 3300006844 Bacteria 10217
57 Ga0075431_100031620 3300006847 Bacteria 5451
58 Ga0075434_100166533 3300006871 Bacteria 2224
59 Ga0075429_100000080 3300006880 Bacteria 49555
60 Ga0099823_1008670 3300006944 Bacteria 10338
61 Ga0079104_1000168 3300006946 Bacteria 93546
62 Ga0079104_1001462 3300006946 Bacteria 15758
63 Ga0099826_10010925 3300006948 Bacteria 6820
64 Ga0105251_10000012 3300009011 Bacteria 167614
65 Ga0105251_10000152 3300009011 Bacteria 70853
66 Ga0105251_10024684 3300009011 Bacteria 3085
67 Ga0105251_10033567 3300009011 Bacteria 2546
68 Ga0105244_10000350 3300009036 Bacteria 43319
69 Ga0105244_10011854 3300009036 Bacteria 5195
70 Ga0105244_10025453 3300009036 Bacteria 3216
71 Ga0105244_10029878 3300009036 Bacteria 2905
72 Ga0105244_10031555 3300009036 Bacteria 2811
73 Ga0105244_10041160 3300009036 Bacteria 2395
74 Ga0105250_10002356 3300009092 Bacteria 9543
75 Ga0105250_10005971 3300009092 Bacteria 5378
76 Ga0105250_10006074 3300009092 Bacteria 5318
77 Ga0105250_10010171 3300009092 Bacteria 3927
78 Ga0105245_10024959 3300009098 Bacteria 5253
79 Ga0114129_10004258 3300009147 Bacteria 20227
80 Ga0105243_10001292 3300009148 Bacteria 22446
81 Ga0105243_10001767 3300009148 Bacteria 18576
82 Ga0105243_10018220 3300009148 Bacteria 5316
83 Ga0105243_10192385 3300009148 Bacteria 1783
84 Ga0105242_10000233 3300009176 Bacteria 43902
85 Ga0105242_10008309 3300009176 Bacteria 7973
86 Ga0105237_10019270 3300009545 Bacteria 7048
87 Ga0105246_10000822 3300011119 Bacteria 17660
88 Ga0105246_10006864 3300011119 Bacteria 6965
89 Ga0105246_10008702 3300011119 Bacteria 6245
90 Ga0157373_10018044 3300013100 Bacteria 5139
91 Ga0157373_10026662 3300013100 Bacteria 4172
92 Ga0157371_10000319 3300013102 Bacteria 62459
93 Ga0157371_10017344 3300013102 Bacteria 5352
94 Ga0157371_10017637 3300013102 Bacteria 5296
95 Ga0157370_10000158 3300013104 Bacteria 83884
96 Ga0157370_10049922 3300013104 Bacteria 4001
97 Ga0163162_10004406 3300013306 Bacteria 13546
98 Ga0157372_10000640 3300013307 Bacteria 38414
99 Ga0182008_10006586 3300014497 Bacteria 6478
100 Ga0182006_1005927 3300015261 Bacteria 5745
101 Ga0182006_1007080 3300015261 Bacteria 5162
102 Ga0182007_10005483 3300015262 Bacteria 5568
103 Ga0182005_1002034 3300015265 Bacteria 7593
104 Ga0163161_10020046 3300017792 Bacteria 4690
105 Ga0209435_101620 3300025206 Bacteria 2770
106 Ga0209760_100124 3300025207 Bacteria 51804
107 Ga0209760_100657 3300025207 Bacteria 5640
108 Ga0209784_100045 3300025224 Bacteria 203911
109 Ga0209566_100057 3300025225 Bacteria 203960
110 Ga0209674_100080 3300025226 Bacteria 203960
111 Ga0209147_100079 3300025229 Bacteria 203960
112 Ga0209563_100078 3300025230 Bacteria 203960
113 Ga0209563_102018 3300025230 Bacteria 4849
114 Ga0207427_100001 3300025231 Bacteria 1410763
115 Ga0207427_100004 3300025231 Bacteria 939600
116 Ga0209437_100003 3300025233 Bacteria 1517827
117 Ga0209437_100028 3300025233 Bacteria 540136
118 Ga0209258_100178 3300025242 Bacteria 138843
119 Ga0209646_1000311 3300025246 Bacteria 38501
120 Ga0209677_100045 3300025253 Bacteria 203960
121 Ga0209233_1000007 3300025261 Bacteria 1411234
122 Ga0209233_1000008 3300025261 Bacteria 1356712
123 Ga0209676_1000056 3300025292 Bacteria 361329
124 Ga0209676_1000078 3300025292 Bacteria 296293
125 Ga0209676_1000101 3300025292 Bacteria 227976
126 Ga0209676_1001261 3300025292 Bacteria 26362
127 Ga0209676_1003065 3300025292 Bacteria 10778
128 Ga0209676_1015895 3300025292 Bacteria 2747
129 Ga0209050_1000027 3300025298 Bacteria 483261
130 Ga0209050_1000041 3300025298 Bacteria 408004
131 Ga0209050_1000181 3300025298 Bacteria 142533
132 Ga0209050_1002328 3300025298 Bacteria 16701
133 Ga0209051_1000061 3300025303 Bacteria 253485
134 Ga0209051_1000065 3300025303 Bacteria 231445
135 Ga0209051_1000085 3300025303 Bacteria 189973
136 Ga0209051_1009606 3300025303 Bacteria 4967
137 Ga0209257_1000105 3300025304 Bacteria 243729
138 Ga0207656_10000017 3300025321 Bacteria 117646
139 Ga0207696_1000032 3300025711 Bacteria 380071
140 Ga0207696_1000112 3300025711 Bacteria 154384
141 Ga0207696_1000121 3300025711 Bacteria 143687
142 Ga0207696_1000129 3300025711 Bacteria 133308
143 Ga0207696_1002970 3300025711 Bacteria 7935
144 Ga0207696_1006453 3300025711 Bacteria 4723
145 Ga0207696_1006880 3300025711 Bacteria 4523
146 Ga0207696_1011992 3300025711 Bacteria 3089
147 Ga0207655_1000005 3300025728 Bacteria 917277
148 Ga0207655_1000015 3300025728 Bacteria 600662
149 Ga0207655_1000086 3300025728 Bacteria 206068
150 Ga0207655_1000515 3300025728 Bacteria 49164
151 Ga0207655_1001621 3300025728 Bacteria 19987
152 Ga0207655_1003475 3300025728 Bacteria 11712
153 Ga0207655_1004133 3300025728 Bacteria 10427
154 Ga0207655_1004813 3300025728 Bacteria 9396
155 Ga0207655_1011672 3300025728 Bacteria 5205
156 Ga0207655_1014486 3300025728 Bacteria 4452
157 Ga0207655_1015673 3300025728 Bacteria 4197
158 Ga0207655_1021057 3300025728 Bacteria 3324
159 Ga0207655_1024608 3300025728 Bacteria 2946
160 Ga0207655_1027042 3300025728 Bacteria 2742
161 Ga0207655_1027119 3300025728 Bacteria 2737
162 Ga0207713_1000068 3300025735 Bacteria 192415
163 Ga0207713_1000080 3300025735 Bacteria 168403
164 Ga0207713_1000356 3300025735 Bacteria 50001
165 Ga0207713_1003328 3300025735 Bacteria 11038
166 Ga0207713_1003358 3300025735 Bacteria 10976
167 Ga0207713_1003950 3300025735 Bacteria 9850
168 Ga0207713_1005319 3300025735 Bacteria 8088
169 Ga0207713_1008999 3300025735 Bacteria 5678
170 Ga0207713_1018211 3300025735 Bacteria 3484
171 Ga0207713_1020703 3300025735 Bacteria 3176
172 Ga0207671_10000019 3300025914 Bacteria 317781
173 Ga0207649_10000004 3300025920 Bacteria 360726
174 Ga0207681_10000275 3300025923 Bacteria 38387
175 Ga0207681_10008090 3300025923 Bacteria 6434
176 Ga0207650_10000668 3300025925 Bacteria 26952
177 Ga0207687_10028060 3300025927 Bacteria 3780
178 Ga0207664_10016070 3300025929 Bacteria 5451
179 Ga0207706_10001474 3300025933 Bacteria 23502
180 Ga0207706_10021457 3300025933 Bacteria 5800
181 Ga0207686_10000569 3300025934 Bacteria 23377
182 Ga0207686_10015911 3300025934 Bacteria 4214
183 Ga0207709_10000067 3300025935 Bacteria 189188
184 Ga0207709_10003359 3300025935 Bacteria 9563
185 Ga0207709_10009315 3300025935 Bacteria 5406
186 Ga0207709_10017682 3300025935 Bacteria 3982
187 Ga0207679_10000019 3300025945 Bacteria 230270
188 Ga0207667_10000910 3300025949 Bacteria 37665
189 Ga0207640_10105056 3300025981 Bacteria 1989
190 Ga0207639_10004738 3300026041 Bacteria 9160
191 Ga0209281_1000013 3300027111 Bacteria 653449
192 Ga0209281_1000015 3300027111 Bacteria 590084
193 Ga0209281_1001525 3300027111 Bacteria 13023
194 Ga0209389_1000005 3300027296 Bacteria 232255
195 Ga0209371_1000135 3300027312 Bacteria 121718
196 Ga0209371_1000456 3300027312 Bacteria 40349
197 Ga0209995_1001929 3300027471 Bacteria 3245
198 Ga0209971_1000592 3300027682 Bacteria 9429
199 Ga0209974_10011342 3300027876 Bacteria 2995
200 Ga0268266_10019836 3300028379 Bacteria 5730
201 Ga0265334_10000010 3300028573 Bacteria 188179
202 Ga0268256_1000148 3300030500 Bacteria 94347
203 Ga0268256_1000171 3300030500 Bacteria 78656
204 Ga0314311_1074035 3300030733 Bacteria 5250
205 Ga0316178_1042169 3300030735 Bacteria 25762
206 Ga0265332_10000004 3300031238 Bacteria 426592
207 Ga0265325_10024412 3300031241 Bacteria 3291
208 Ga0265327_10000814 3300031251 Bacteria 47176
209 Ga0265316_10041250 3300031344 Bacteria 3695
210 Ga0265316_10066504 3300031344 Bacteria 2789
211 Ga0307408_100000045 3300031548 Bacteria 169484
212 Ga0265313_10000125 3300031595 Bacteria 77022
213 Ga0307508_10066645 3300031616 Bacteria 3169
214 Ga0316575_10011753 3300031665 Bacteria 3244
215 Ga0307412_10002081 3300031911 Bacteria 11107
216 Ga0307414_10026965 3300032004 Bacteria 3705
217 Ga0307510_10035753 3300033180 Bacteria 5539
218 Ga0307510_10086555 3300033180 Bacteria 3005
219 Ga0373954_0000034 3300035118 Bacteria 52216
220 Ga0373927_0000002 3300035695 Bacteria 966219
221 Ga0373933_0001798 3300035724 Bacteria 12424
222 Ga0373937_0000166 3300036401 Bacteria 63970
223 Ga0316582_0072439 3300036647 Bacteria 2234
224 Ga0237819_01965 3300038705 Bacteria 4638
225 Ga0439438_002320 3300041405 Bacteria 8132
226 Ga0439438_009244 3300041405 Bacteria 3202
227 Ga0439447_005035 3300041407 Bacteria 4447
228 Ga0439447_017623 3300041407 Bacteria 1942
229 Ga0439466_0004327 3300041411 Bacteria 5479
230 Ga0439466_0004696 3300041411 Bacteria 5249
231 Ga0439466_0005581 3300041411 Bacteria 4801
232 Ga0439432_001476 3300042006 Bacteria 8822
233 Ga0439451_006736 3300042009 Bacteria 2348
234 Ga0439452_001965 3300042010 Bacteria 7863
235 Ga0439452_003737 3300042010 Bacteria 5246
236 Ga0439456_000434 3300042013 Bacteria 9314
237 Ga0439456_007779 3300042013 Bacteria 2205
238 Ga0439463_000909 3300042016 Bacteria 8130
239 Ga0450922_001509 3300042124 Bacteria 2282
240 Ga0450902_000266 3300042137 Bacteria 6292
241 Ga0450907_001504 3300042146 Bacteria 4986
242 Ga0450908_004718 3300042184 Bacteria 2626
243 Ga0450908_007654 3300042184 Bacteria 2034
244 Ga0450909_006818 3300042185 Bacteria 1646
245 Ga0439434_0004815 3300042435 Bacteria 3950
246 Ga0439464_0000161 3300042439 Bacteria 11092
247 Ga0439464_0000692 3300042439 Bacteria 7293
248 Ga0453684_0000623 3300044712 Bacteria 129254
249 Ga0453684_0003250 3300044712 Bacteria 37169
250 Ga0453684_0021525 3300044712 Bacteria 9626
251 Ga0451576_0039237 3300045051 Bacteria 5012
252 Ga0495617_003941 3300046452 Bacteria 5468
253 Ga0495627_000047 3300046453 Bacteria 170068
254 Ga0495627_004660 3300046453 Bacteria 5681
255 Ga0495627_005719 3300046453 Bacteria 4964
256 Ga0495591_000019 3300046458 Bacteria 223010
257 Ga0495591_000570 3300046458 Bacteria 28243
258 Ga0495591_001669 3300046458 Bacteria 13384
259 Ga0495591_003687 3300046458 Bacteria 7782
260 Ga0495591_004724 3300046458 Bacteria 6534
261 Ga0495591_005007 3300046458 Bacteria 6251
262 Ga0495591_005171 3300046458 Bacteria 6112
263 Ga0495638_0013887 3300046460 Bacteria 5462
264 Ga0495638_0016620 3300046460 Bacteria 4923
265 Ga0495638_0026089 3300046460 Bacteria 3792
266 Ga0495653_0010573 3300046463 Bacteria 7556
267 Ga0495653_0013322 3300046463 Bacteria 6701
268 Ga0495653_0142413 3300046463 Bacteria 1684
269 Ga0495650_0000346 3300046471 Bacteria 82519
270 Ga0495650_0006687 3300046471 Bacteria 7138
271 Ga0495650_0009667 3300046471 Bacteria 5465
272 Ga0495605_0000014 3300046474 Bacteria 305393
273 Ga0495605_0000030 3300046474 Bacteria 213339
274 Ga0495605_0000825 3300046474 Bacteria 22002
275 Ga0495605_0002824 3300046474 Bacteria 10560
276 Ga0495605_0007022 3300046474 Bacteria 6425
277 Ga0495605_0010932 3300046474 Bacteria 5070
278 Ga0495605_0011004 3300046474 Bacteria 5054
279 Ga0495605_0023895 3300046474 Bacteria 3206
280 Ga0495584_0002381 3300046491 Bacteria 10686
281 Ga0495584_0006396 3300046491 Bacteria 6170
282 Ga0495584_0008445 3300046491 Bacteria 5334
283 Ga0495584_0011503 3300046491 Bacteria 4533
284 Ga0495584_0051156 3300046491 Bacteria 2080
285 Ga0495585_0005212 3300046492 Bacteria 8238
286 Ga0495585_0008973 3300046492 Bacteria 6025
287 Ga0495585_0010614 3300046492 Bacteria 5474
288 Ga0495596_0003549 3300046500 Bacteria 7860
289 Ga0495596_0018288 3300046500 Bacteria 2889
290 Ga0495607_0002357 3300046501 Bacteria 15440
291 Ga0495607_0002577 3300046501 Bacteria 14625
292 Ga0495607_0004286 3300046501 Bacteria 10540
293 Ga0495607_0004407 3300046501 Bacteria 10373
294 Ga0495607_0005536 3300046501 Bacteria 9011
295 Ga0495607_0007923 3300046501 Bacteria 7304
296 Ga0495607_0009938 3300046501 Bacteria 6407
297 Ga0495607_0010517 3300046501 Bacteria 6216
298 Ga0495607_0011815 3300046501 Bacteria 5790
299 Ga0495607_0037919 3300046501 Bacteria 2890
300 Ga0495583_0000066 3300046506 Bacteria 191372
301 Ga0495583_0003486 3300046506 Bacteria 11919
302 Ga0495583_0004291 3300046506 Bacteria 10323
303 Ga0495583_0008243 3300046506 Bacteria 6392
304 Ga0495583_0009268 3300046506 Bacteria 5896
305 Ga0495606_0000441 3300046507 Bacteria 68151
306 Ga0495606_0002176 3300046507 Bacteria 23553
307 Ga0495606_0010656 3300046507 Bacteria 7602
308 Ga0495606_0014688 3300046507 Bacteria 6089
309 Ga0495606_0014788 3300046507 Bacteria 6062
310 Ga0495606_0018194 3300046507 Bacteria 5280
311 Ga0495606_0036974 3300046507 Bacteria 3319
312 Ga0495610_0008778 3300046512 Bacteria 6485
313 Ga0495610_0011769 3300046512 Bacteria 5315
314 Ga0495610_0013704 3300046512 Bacteria 4802
315 Ga0495610_0027749 3300046512 Bacteria 3003
316 Ga0495616_0019111 3300046513 Bacteria 3744
317 Ga0495616_0029828 3300046513 Bacteria 2874
318 Ga0495616_0037181 3300046513 Bacteria 2506
319 Ga0495616_0056811 3300046513 Bacteria 1931
320 Ga0495620_0000097 3300046515 Bacteria 69944
321 Ga0495620_0000432 3300046515 Bacteria 27942
322 Ga0495620_0001077 3300046515 Bacteria 16707
323 Ga0495620_0004402 3300046515 Bacteria 7940
324 Ga0495620_0006214 3300046515 Bacteria 6579
325 Ga0495620_0026136 3300046515 Bacteria 2748
326 Ga0495631_0003503 3300046518 Bacteria 8584
327 Ga0495631_0007864 3300046518 Bacteria 5405
328 Ga0495632_0005500 3300046519 Bacteria 8362
329 Ga0495632_0009068 3300046519 Bacteria 6024
330 Ga0495632_0010114 3300046519 Bacteria 5617
331 Ga0495632_0028042 3300046519 Bacteria 2941
332 Ga0495637_0000024 3300046520 Bacteria 169477
333 Ga0495637_0002603 3300046520 Bacteria 9907
334 Ga0495637_0007329 3300046520 Bacteria 5478
335 Ga0495637_0011984 3300046520 Bacteria 4157
336 Ga0495643_0000103 3300046522 Bacteria 140814
337 Ga0495643_0000296 3300046522 Bacteria 70161
338 Ga0495643_0001851 3300046522 Bacteria 17960
339 Ga0495643_0011836 3300046522 Bacteria 5290
340 Ga0495648_0006433 3300046524 Bacteria 9591
341 Ga0495648_0013621 3300046524 Bacteria 5999
342 Ga0495648_0014743 3300046524 Bacteria 5699
343 Ga0495648_0018371 3300046524 Bacteria 4951
344 Ga0495648_0019521 3300046524 Bacteria 4763
345 Ga0495648_0081683 3300046524 Bacteria 1837
346 Ga0495666_0024200 3300046526 Bacteria 3000
347 Ga0495654_0005159 3300046530 Bacteria 7622
348 Ga0495654_0010056 3300046530 Bacteria 5163
349 Ga0495654_0014033 3300046530 Bacteria 4272
350 Ga0495654_0017229 3300046530 Bacteria 3801
351 Ga0495654_0033897 3300046530 Bacteria 2580
352 Ga0495586_0029104 3300046535 Bacteria 2957
353 Ga0495587_0010157 3300046536 Bacteria 6004
354 Ga0495609_0000006 3300046538 Bacteria 431833
355 Ga0495609_0000024 3300046538 Bacteria 264100
356 Ga0495609_0000040 3300046538 Bacteria 177058
357 Ga0495609_0009316 3300046538 Bacteria 4755
358 Ga0495609_0012416 3300046538 Bacteria 4041
359 Ga0495609_0021644 3300046538 Bacteria 2966
360 Ga0495597_0000010 3300046542 Bacteria 222418
361 Ga0495597_0010956 3300046542 Bacteria 4408
362 Ga0495597_0015969 3300046542 Bacteria 3550
363 Ga0495622_0006245 3300046557 Bacteria 5531
364 Ga0495622_0007104 3300046557 Bacteria 5202
365 Ga0495633_0000030 3300046558 Bacteria 197184
366 Ga0495633_0009976 3300046558 Bacteria 5212
367 Ga0495668_0008053 3300046616 Bacteria 6637
368 Ga0495634_0013086 3300046642 Bacteria 5998
369 Ga0495611_0020876 3300046648 Bacteria 2823
370 Ga0495611_0025579 3300046648 Bacteria 2573
371 Ga0495625_0000111 3300046660 Bacteria 124977
372 Ga0495625_0062306 3300046660 Bacteria 2636
373 Ga0495661_0000015 3300046665 Bacteria 223740
374 Ga0495661_0000019 3300046665 Bacteria 200606
375 Ga0495661_0000034 3300046665 Bacteria 165606
376 Ga0495661_0000546 3300046665 Bacteria 38911
377 Ga0495661_0013768 3300046665 Bacteria 5427
378 Ga0495661_0013892 3300046665 Bacteria 5402
379 Ga0495657_0076365 3300046675 Bacteria 2176
380 Ga0495623_0020072 3300046679 Bacteria 4320
381 Ga0495670_0002238 3300046691 Bacteria 9556
382 Ga0495670_0022495 3300046691 Bacteria 3112
383 Ga0495671_0001897 3300046692 Bacteria 13422
384 Ga0495671_0002005 3300046692 Bacteria 13093
385 Ga0495671_0002854 3300046692 Bacteria 10809
386 Ga0495671_0005159 3300046692 Bacteria 7684
387 Ga0495671_0009970 3300046692 Bacteria 5287
388 Ga0495671_0029863 3300046692 Bacteria 2795
389 Ga0495649_0005160 3300046694 Bacteria 8373
390 Ga0495649_0009864 3300046694 Bacteria 5651
391 Ga0495649_0095028 3300046694 Bacteria 1587
392 Ga0495589_0007997 3300046794 Bacteria 5532
393 Ga0495589_0008320 3300046794 Bacteria 5419
394 Ga0495589_0014373 3300046794 Bacteria 4078
395 Ga0495589_0022624 3300046794 Bacteria 3206
396 Ga0495600_0059633 3300046809 Bacteria 2492
397 Ga0495660_0004564 3300046810 Bacteria 8360
398 Ga0495660_0010417 3300046810 Bacteria 5409
399 Ga0495660_0085775 3300046810 Bacteria 1644
400 Ga0495604_0020247 3300047317 Bacteria 5316
401 Ga0495672_0015135 3300047320 Bacteria 5249
402 Ga0495672_0043048 3300047320 Bacteria 2717
403 Ga0495676_0000010 3300047321 Bacteria 242637
404 Ga0495680_0062390 3300047322 Bacteria 2865
405 Ga0495683_0000056 3300047323 Bacteria 118944
406 Ga0495683_0000134 3300047323 Bacteria 72364
407 Ga0495683_0002325 3300047323 Bacteria 11552
408 Ga0495683_0008814 3300047323 Bacteria 5380
409 Ga0495687_002875 3300047443 Bacteria 13164
410 Ga0495675_0089390 3300047444 Bacteria 1933
411 Ga0495679_000201 3300047446 Bacteria 52238
412 Ga0495679_001565 3300047446 Bacteria 12893
413 Ga0495679_005895 3300047446 Bacteria 5372
414 Ga0495673_0001419 3300047469 Bacteria 19200
415 Ga0495673_0005023 3300047469 Bacteria 8111
416 Ga0495673_0007531 3300047469 Bacteria 6236
417 Ga0495673_0007953 3300047469 Bacteria 6018
418 Ga0495673_0009573 3300047469 Bacteria 5357
419 Ga0495673_0018214 3300047469 Bacteria 3547
420 Ga0495673_0038092 3300047469 Bacteria 2190
421 Ga0495681_0004244 3300047470 Bacteria 9830
422 Ga0495681_0010903 3300047470 Bacteria 5464
423 Ga0495681_0010949 3300047470 Bacteria 5446
424 Ga0495681_0022929 3300047470 Bacteria 3329
425 Ga0495593_0033886 3300047673 Bacteria 2779
426 Ga0495626_0000013 3300048091 Bacteria 248164
427 Ga0495626_0005893 3300048091 Bacteria 7055
428 Ga0495626_0008809 3300048091 Bacteria 5488
429 Ga0495626_0009178 3300048091 Bacteria 5356
430 Ga0496102_0024500 3300048905 Bacteria 5366
431 Ga0496110_0015985 3300048913 Bacteria 6258
432 Ga0496116_0000999 3300048919 Bacteria 34585
433 Ga0496116_0010595 3300048919 Bacteria 7709
434 Ga0496117_0008521 3300048920 Bacteria 9725
435 Ga0496117_0008597 3300048920 Bacteria 9674
436 Ga0496117_0031427 3300048920 Bacteria 4052
437 Ga0496118_0012702 3300048921 Bacteria 8054
438 Ga0496118_0022600 3300048921 Bacteria 5491
439 Ga0496118_0024693 3300048921 Bacteria 5178
440 Ga0496118_0029162 3300048921 Bacteria 4633
441 Ga0496119_0000100 3300048922 Bacteria 125646
442 Ga0496119_0015180 3300048922 Bacteria 5959
443 Ga0496120_0003060 3300048923 Bacteria 15783
444 Ga0496120_0015127 3300048923 Bacteria 5103
445 Ga0496121_0000306 3300048924 Bacteria 102245
446 Ga0496121_0001448 3300048924 Bacteria 40036
447 Ga0496121_0021757 3300048924 Bacteria 6265
448 Ga0496121_0027161 3300048924 Bacteria 5364
449 Ga0496121_0147018 3300048924 Bacteria 1740
450 Ga0496122_0002016 3300048925 Bacteria 30178
451 Ga0496122_0020102 3300048925 Bacteria 6061
452 Ga0496122_0025123 3300048925 Bacteria 5188
453 Ga0496122_0052167 3300048925 Bacteria 3099
454 Ga0496123_0003192 3300048926 Bacteria 18708
455 Ga0496123_0013088 3300048926 Bacteria 7000
456 Ga0496123_0014821 3300048926 Bacteria 6435
457 Ga0496123_0045581 3300048926 Bacteria 2985
458 Ga0496124_0000051 3300048927 Bacteria 255802
459 Ga0496124_0010670 3300048927 Bacteria 9269
460 Ga0496124_0011323 3300048927 Bacteria 8923
461 Ga0496124_0011430 3300048927 Bacteria 8876
462 Ga0496124_0032044 3300048927 Bacteria 4648
463 Ga0496124_0086432 3300048927 Bacteria 2566
464 Ga0496124_0139530 3300048927 Bacteria 1914
465 Ga0496125_0000011 3300048928 Bacteria 655895
466 Ga0496125_0008140 3300048928 Bacteria 11037
467 Ga0496125_0011261 3300048928 Bacteria 8964
468 Ga0496125_0025346 3300048928 Bacteria 5432
469 Ga0496126_0076258 3300048929 Bacteria 2974
470 Ga0496126_0139222 3300048929 Bacteria 2091
471 Ga0495678_000063 3300049459 Bacteria 140183
472 Ga0495678_001727 3300049459 Bacteria 16299
473 Ga0495678_004140 3300049459 Bacteria 8567
474 Ga0495678_021772 3300049459 Bacteria 2816
475 Ga0495678_028054 3300049459 Bacteria 2380
476 Ga0495682_0001146 3300049460 Bacteria 15282
477 Ga0495682_0002077 3300049460 Bacteria 9780
478 Ga0501034_0000020 3300049571 Bacteria 280294
479 Ga0501036_0118878 3300049572 Bacteria 2231
480 Ga0501039_0062745 3300049575 Bacteria 2879
481 Ga0501040_0025222 3300049576 Bacteria 3997
482 Ga0501041_0044449 3300049577 Bacteria 2700
483 Ga0501043_0135270 3300049579 Bacteria 1931
484 nmdc:mga00v17_24591_c1 3300050491 Bacteria 3495
485 nmdc:mga00v17_38170_c1 3300050491 Bacteria 2871
486 nmdc:mga05p37_46657_c1 3300050507 Bacteria 5327
487 nmdc:mga0qj67_7508_c1 3300050509 Bacteria 8054
488 nmdc:mga06r32_944_c1 3300050510 Bacteria 25862
489 Ga0500659_0027160 3300053135 Bacteria 3121
490 2511257395 2511231004 Bacteria 6669789
491 2511268764 2511231006 Bacteria 6794709
492 2511270789 2511231007 Bacteria 6306603
493 2511277027 2511231008 Bacteria 6624100
494 2511291513 2511231010 Bacteria 6373152
495 2511296164 2511231011 Bacteria 6149768
496 2511301357 2511231012 Bacteria 6738011
497 2511311923 2511231014 Bacteria 6462302
498 2511318301 2511231015 Bacteria 6598026
499 2511323543 2511231016 Bacteria 6704427
500 2511333864 2511231017 Bacteria 6503007
501 2511337181 2511231018 Bacteria 6436256
502 2511346132 2511231019 Bacteria 6520662
503 2511352557 2511231020 Bacteria 6115223
504 2511355014 2511231021 Bacteria 7302637
505 2511364011 2511231022 Bacteria 6719296
506 2511370155 2511231023 Bacteria 6808468
507 2511375211 2511231024 Bacteria 5835885
508 2511826715 2511231156 Bacteria 6845832
509 2512328297 2512047018 Bacteria 6663241
510 2548849289 2547132512 Bacteria 3416496
511 2554813456 2554235132 Bacteria 6772433
512 2555246851 2554235231 Bacteria 5215788
513 2555668027 2554235341 Bacteria 6867980
514 2583790470 2582580891 Bacteria 6800976
515 2597856243 2597489887 Bacteria 6666321
516 2597862322 2597489888 Bacteria 6179543
517 2597868041 2597489889 Bacteria 6297495
518 2599328198 2599185155 Bacteria 5827168
519 2599355027 2599185160 Bacteria 6844013
520 2599361149 2599185161 Bacteria 6960462
521 2599367471 2599185162 Bacteria 6957254
522 2599374261 2599185163 Bacteria 6995158
523 2599380133 2599185164 Bacteria 6841688
524 2599386580 2599185165 Bacteria 6843250
525 2599393119 2599185166 Bacteria 6959206
526 2599397072 2599185167 Bacteria 6353609
527 2599404886 2599185168 Bacteria 6997636
528 2599449065 2599185179 Bacteria 6611171
529 2599461861 2599185181 Bacteria 6844519
530 2599467096 2599185182 Bacteria 6883168
531 2599483501 2599185185 Bacteria 6652270
532 2599491046 2599185186 Bacteria 6831633
533 2599502934 2599185188 Bacteria 6164180
534 2599508817 2599185189 Bacteria 5862825
535 2599511191 2599185190 Bacteria 6285678
536 2599519318 2599185191 Bacteria 6297582
537 2599616761 2599185212 Bacteria 6765997
538 2599771236 2599185248 Bacteria 6696816
539 2599805407 2599185257 Bacteria 6492581
540 2599879638 2599185288 Bacteria 6666191
541 2599885992 2599185289 Bacteria 6778765
542 2599890565 2599185290 Bacteria 6289611
543 2599897706 2599185291 Bacteria 6775623
544 2599930038 2599185300 Bacteria 6062622
545 2599945432 2599185302 Bacteria 5954930
546 2599948137 2599185303 Bacteria 6512725
547 2599955704 2599185304 Bacteria 5951361
548 2599961074 2599185305 Bacteria 6748700
549 2599967238 2599185306 Bacteria 6637356
550 2599975505 2599185307 Bacteria 6194719
551 2599980365 2599185308 Bacteria 6621546
552 2599985816 2599185309 Bacteria 5969593
553 2599990710 2599185310 Bacteria 6014457
554 2599996032 2599185311 Bacteria 6354990
555 2600001904 2599185312 Bacteria 5912071
556 2600005628 2599185313 Bacteria 6658188
557 2600014192 2599185314 Bacteria 6621749
558 2600019126 2599185315 Bacteria 6771107
559 2600025602 2599185316 Bacteria 6320029
560 2600027783 2599185317 Bacteria 6435722
561 2600033501 2599185318 Bacteria 6961590
562 2600040213 2599185319 Bacteria 6637840
563 2600049415 2599185320 Bacteria 5963263
564 2600056694 2599185321 Bacteria 6764560
565 2600059181 2599185322 Bacteria 6763055
566 2600064303 2599185323 Bacteria 6688755
567 2600074712 2599185324 Bacteria 6590677
568 2600077249 2599185325 Bacteria 6324919
569 2600214483 2599185356 Bacteria 6843884
570 2600356950 2600254930 Bacteria 6431253
571 2600364113 2600254931 Bacteria 6734225
572 2600442521 2600254954 Bacteria 5100516
573 2601625982 2600255283 Bacteria 6061572
574 2601690907 2600255296 Bacteria 5784754
575 2601774812 2600255313 Bacteria 6842543
576 2601800060 2600255318 Bacteria 6383414
577 2602012465 2600255389 Bacteria 5275336
578 2606074676 2603880185 Bacteria 6379190
579 2606127539 2603880199 Bacteria 6377649
580 2608381371 2606217733 Bacteria 6360972
581 2621301553 2619619299 Bacteria 6649820
582 2624478807 2623620443 Bacteria 6427864
583 2624494145 2623620446 Bacteria 6500345
584 2643844236 2643221565 Bacteria 6216018
585 2643868907 2643221571 Bacteria 6228673
586 2643952324 2643221589 Bacteria 6250934
587 2644023913 2643221602 Bacteria 6249926
588 2644188319 2643221633 Bacteria 6733554
589 2644282459 2643221650 Bacteria 7029547
590 2644623998 2643221713 Bacteria 6554480
591 2652547727 2651869719 Bacteria 6047974
592 2671089801 2667528170 Bacteria 6786960
593 2671097628 2667528171 Bacteria 6900659
594 2671125569 2667528176 Bacteria 6724917
595 2671767857 2671180172 Bacteria 6495783
596 2677898738 2675903420 Bacteria 6247433
597 2678265080 2675903515 Bacteria 6580491
598 2715750828 2713897148 Bacteria 5883533
599 2715757524 2713897149 Bacteria 6506249
600 2718632692 2718217725 Bacteria 5758958
601 2723247211 2721755607 Bacteria 5841722
602 2729147813 2728369097 Bacteria 4333476
603 2738673773 2738541265 Bacteria 6594665
604 2738689492 2738541271 Bacteria 5657310
605 2738752166 2738541282 Bacteria 6593925
606 2738809096 2738541294 Bacteria 6925949
607 2738861207 2738541303 Bacteria 6591772
608 2738896456 2738541309 Bacteria 6926455
609 2739256884 2738543015 Bacteria 6750701
610 2739265266 2738543016 Bacteria 5657564
611 2739286719 2738543020 Bacteria 5718238
612 2739292032 2738543021 Bacteria 5718241
613 2739316410 2738543025 Bacteria 6600348
614 2743735652 2740892503 Bacteria 6855563
615 2745005537 2744054620 Bacteria 6551379
616 2765582159 2765235841 Bacteria 6137024
617 2774122151 2773857670 Bacteria 6407454
618 2774136717 2773857673 Bacteria 6513460
619 2784260468 2784132063 Bacteria 6262788
620 2784314396 2784132072 Bacteria 6596533
621 2794595614 2791355520 Bacteria 5948615
622 2807409980 2806310737 Bacteria 5751088
623 2807458327 2806310745 Bacteria 5742165
624 2808858601 2808606361 Bacteria 6136259
625 2808905059 2808606373 Bacteria 4423627
626 2808921893 2808606376 Bacteria 6248667
627 2808928768 2808606377 Bacteria 6646337
628 2808938774 2808606378 Bacteria 6177535
629 2808941075 2808606379 Bacteria 5022697
630 2808944014 2808606380 Bacteria 6248705
631 2808950889 2808606381 Bacteria 6646461
632 2808960437 2808606382 Bacteria 6841132
633 2808967090 2808606383 Bacteria 6138645
634 2808975235 2808606385 Bacteria 6711065
635 2808991126 2808606388 Bacteria 6706662
636 2809001916 2808606389 Bacteria 6138126
637 2809215745 2808606445 Bacteria 6057339
638 2812370832 2811994881 Bacteria 6298475
639 2817489091 2816332298 Bacteria 6852809
640 2819658362 2818991456 Bacteria 6123676
641 2819702711 2818991464 Bacteria 6907494
642 2823422481 2823421272 Bacteria 5372474
643 2825656023 2825651385 Bacteria 6715909
644 2826584006 2826581358 Bacteria 5963467
645 2834028996 2834028612 Bacteria 6354979
646 2842809306 2842805378 Bacteria 5385175
647 2842819485 2842815866 Bacteria 5947510
648 2842828713 2842826826 Bacteria 5974129
649 2842835725 2842832357 Bacteria 5959113
650 2842843224 2842837860 Bacteria 6066181
651 2842847472 2842843487 Bacteria 6004777
652 2842849819 2842849001 Bacteria 5924277
653 2842856427 2842854478 Bacteria 6143501
654 2844668529 2844665904 Bacteria 6817974
655 2852615519 2852612431 Bacteria 6885235
656 2852662837 2852657418 Bacteria 6472974
657 2852670487 2852667396 Bacteria 6885555
658 2860340650 2860339153 Bacteria 6846989
659 2860869025 2860867994 Bacteria 5645326
660 2878030771 2878029506 Bacteria 6418441
661 2880231683 2880230671 Bacteria 6140320
662 2887633251 2887630918 Bacteria 3239855
663 2904481903 2904479285 Bacteria 5073931
664 2904520718 2904518522 Bacteria 6068986
665 2904551103 2904550169 Bacteria 6221258
666 2908447818 2908446538 Bacteria 6829095
667 2912964800 2912963787 Bacteria 5646108
668 2913041690 2913036834 Bacteria 6704877
669 2916180849 2916178963 Bacteria 5265078
670 2917071789 2917070673 Bacteria 6868303
671 2919067279 2919063839 Bacteria 6302690
672 2919157952 2919155634 Bacteria 4860545
673 2919385821 2919385768 Bacteria 5897293
674 2919458360 2919456309 Bacteria 6586567
675 2919484628 2919481497 Bacteria 6907839
676 2919492801 2919487758 Bacteria 5929766
677 2919498757 2919497567 Bacteria 4408621
678 2919505112 2919501602 Bacteria 5286340
679 2919699938 2919697872 Bacteria 6553725
680 2923154660 2923153595 Bacteria 6870622
681 2923524937 2923519811 Bacteria 6298479
682 2923590338 2923586266 Bacteria 6565975
683 2926066789 2926063275 Bacteria 5285848
684 2929149012 2929144301 Bacteria 6622272
685 2929191022 2929189879 Bacteria 5930554
686 2931373567 2931369376 Bacteria 6847892
687 2931392027 2931390751 Bacteria 6273349
688 2931399448 2931396565 Bacteria 7251677
689 2935353962 2935353572 Unclassified 6955622
690 2939638131 2939636861 Bacteria 6297853
691 2939652301 2939651529 Bacteria 5895393
692 2941481953
693 2945929558 2945928738 Bacteria 6053221
694 2945961252 2945961074 Bacteria 7342064
695 2946011838 2946006987 Bacteria 6705746
696 2946029271 2946027586 Bacteria 6049274
697 2947235819 2947233263 Bacteria 6439278
698 2969305593 2969304461 Bacteria 6601805
699 2974292776 2974289157 Bacteria 6080362
700 2984291369 2984286254 Bacteria 6702062
701 2988730609 2988728565 Bacteria 6124362
702 2990200681 2990196909 Bacteria 4054280
703 2998141035 2998139840 Bacteria 6073514
704 3007253800 3007252601 Bacteria 4559114
705 3007317460 3007315729 Bacteria 5076637
706 3007400191 3007395558 Bacteria 6755444
707 3007420674 3007419365 Bacteria 7026924
708 3007516345 3007511990 Bacteria 6481491
709 3007618778 3007614139 Bacteria 6053559
710 3007622083 3007619802 Bacteria 6411688
711 3007719283 3007718800 Bacteria 5971527
712 3007860920 3007855910 Bacteria 5637581
713 3007863742 3007861166 Bacteria 6045338
714 3007867643 3007866637 Bacteria 5899198
715 3007872733 3007872151 Bacteria 5268868
716 637318406 637000220 Bacteria 7074893
717 640489002 640427133 Bacteria 4567418
718 651177092 651053060 Bacteria 4689946
719 8011353540 8011350971 Bacteria 6158957
720 8015688896 8015687852 Bacteria 6613826
721 8019773275 8019769354 Bacteria 6924660
722 8019776604 8019775933 Bacteria 6858656
723 8029999727 8029995093 Bacteria 5990776
724 8034964232 8034962539 Bacteria 4884839
725 8048749786 8048746797 Bacteria 3557226
726 8052498952 8052494512 Bacteria 5765634
727 8054286222 8054285046 Bacteria 6919322
728 8054352561 8054347763 Bacteria 5901107
729 8054359160 8054357960 Bacteria 2867777
730 8054504605 8054503363 Bacteria 6101651
731 8054934447 8054929484 Bacteria 5599761
732 8055772014 8055770955 Bacteria 6827675
733 8055819047 8055817908 Bacteria 6609162
734 8055883350 8055878733 Bacteria 5907058
735 8056120338 8056115690 Bacteria 5527654
736 8056121828 8056120720 Bacteria 5758328
737 8056127080 8056125926 Bacteria 6228218
738 8056132916 8056131705 Bacteria 6107031
739 8056141952 8056137416 Bacteria 6147080
740 8056144382 8056143049 Bacteria 6307666
741 8056149132 8056148874 Bacteria 6479865
742 8056155605 8056155041 Bacteria 6486948
743 8056161209 8056161164 Bacteria 6106669
744 8056170016 8056166840 Bacteria 5820959
745 8056176149 8056172158 Bacteria 6133900
746 8056180579 8056177738 Bacteria 6748268
747 8056569685 8056569372 Bacteria 5997322
748 8057803303 8057798959 Bacteria 6713499
749 Ga0495672_0015572
750 MRS2a_Contig_171
751 JGI25162J39368_1000101
752 JGI25162J39368_1000200
753 JGI25163J39215_1001257
754 JGI25163J39215_1001263
755 JGI25164J39214_1000097
756 JGI25164J39214_1000162
757 JGI25165J46597_1000184
758 JGI25165J46597_1000294
759 Ga0055538_1000029
760 Ga0055539_1000039
761 Ga0055533_1000049
762 Ga0055532_1000049
763 Ga0055525_1000077
764 Ga0055536_1000062
765 Ga0055536_1002715
766 Ga0055536_1002887
767 Ga0055530_10000489
768 Ga0055530_10003343
769 Ga0055530_10003378
770 Ga0055540_1001086
771 Ga0055540_1002667
772 Ga0055540_1002708
773 Ga0055531_10001423
774 Ga0055541_1000026
775 Ga0065714_10000532
776 Ga0065714_10004098
777 Ga0065714_10019409
778 Ga0065714_10025493
779 Ga0065714_10069308
780 Ga0065714_10095901
781 Ga0065714_10099438
782 Ga0065704_10079021
783 Ga0065704_10101051
784 Ga0065712_10000436
785 Ga0065712_10000741
786 Ga0065712_10067897
787 Ga0065715_10090306
788 Ga0070661_100000541
789 Ga0070661_100166088
790 Ga0070669_100000292
791 Ga0070669_100053265
792 Ga0070714_100001758
793 Ga0070662_100000560
794 Ga0068853_100045050
795 Ga0070704_100020015
796 Ga0068855_100000537
797 Ga0070664_100000977
798 Ga0068857_100129005
799 Ga0068854_100067271
800 Ga0068851_10000006
801 Ga0075364_10000144
802 Ga0075432_10005444
803 Ga0075370_10001507
804 Ga0075428_100010658
805 Ga0075431_100031620
806 Ga0075434_100166533
807 Ga0075429_100000080
808 Ga0099823_1008670
809 Ga0079104_1000168
810 Ga0079104_1001462
811 Ga0099826_10010925
812 Ga0105251_10000012
813 Ga0105251_10000152
814 Ga0105251_10024684
815 Ga0105251_10033567
816 Ga0105244_10000350
817 Ga0105244_10011854
818 Ga0105244_10025453
819 Ga0105244_10029878
820 Ga0105244_10031555
821 Ga0105244_10041160
822 Ga0105250_10002356
823 Ga0105250_10005971
824 Ga0105250_10006074
825 Ga0105250_10010171
826 Ga0105245_10024959
827 Ga0114129_10004258
828 Ga0105243_10001292
829 Ga0105243_10001767
830 Ga0105243_10018220
831 Ga0105243_10192385
832 Ga0105242_10000233
833 Ga0105242_10008309
834 Ga0105237_10019270
835 Ga0105246_10000822
836 Ga0105246_10006864
837 Ga0105246_10008702
838 Ga0157373_10018044
839 Ga0157373_10026662
840 Ga0157371_10000319
841 Ga0157371_10017344
842 Ga0157371_10017637
843 Ga0157370_10000158
844 Ga0157370_10049922
845 Ga0163162_10004406
846 Ga0157372_10000640
847 Ga0182008_10006586
848 Ga0182006_1005927
849 Ga0182006_1007080
850 Ga0182007_10005483
851 Ga0182005_1002034
852 Ga0163161_10020046
853 Ga0209435_101620
854 Ga0209760_100124
855 Ga0209760_100657
856 Ga0209784_100045
857 Ga0209566_100057
858 Ga0209674_100080
859 Ga0209147_100079
860 Ga0209563_100078
861 Ga0209563_102018
862 Ga0207427_100001
863 Ga0207427_100004
864 Ga0209437_100003
865 Ga0209437_100028
866 Ga0209258_100178
867 Ga0209646_1000311
868 Ga0209677_100045
869 Ga0209233_1000007
870 Ga0209233_1000008
871 Ga0209676_1000056
872 Ga0209676_1000078
873 Ga0209676_1000101
874 Ga0209676_1001261
875 Ga0209676_1003065
876 Ga0209676_1015895
877 Ga0209050_1000027
878 Ga0209050_1000041
879 Ga0209050_1000181
880 Ga0209050_1002328
881 Ga0209051_1000061
882 Ga0209051_1000065
883 Ga0209051_1000085
884 Ga0209051_1009606
885 Ga0209257_1000105
886 Ga0207656_10000017
887 Ga0207696_1000032
888 Ga0207696_1000112
889 Ga0207696_1000121
890 Ga0207696_1000129
891 Ga0207696_1002970
892 Ga0207696_1006453
893 Ga0207696_1006880
894 Ga0207696_1011992
895 Ga0207655_1000005
896 Ga0207655_1000015
897 Ga0207655_1000086
898 Ga0207655_1000515
899 Ga0207655_1001621
900 Ga0207655_1003475
901 Ga0207655_1004133
902 Ga0207655_1004813
903 Ga0207655_1011672
904 Ga0207655_1014486
905 Ga0207655_1015673
906 Ga0207655_1021057
907 Ga0207655_1024608
908 Ga0207655_1027042
909 Ga0207655_1027119
910 Ga0207713_1000068
911 Ga0207713_1000080
912 Ga0207713_1000356
913 Ga0207713_1003328
914 Ga0207713_1003358
915 Ga0207713_1003950
916 Ga0207713_1005319
917 Ga0207713_1008999
918 Ga0207713_1018211
919 Ga0207713_1020703
920 Ga0207671_10000019
921 Ga0207649_10000004
922 Ga0207681_10000275
923 Ga0207681_10008090
924 Ga0207650_10000668
925 Ga0207687_10028060
926 Ga0207664_10016070
927 Ga0207706_10001474
928 Ga0207706_10021457
929 Ga0207686_10000569
930 Ga0207686_10015911
931 Ga0207709_10000067
932 Ga0207709_10003359
933 Ga0207709_10009315
934 Ga0207709_10017682
935 Ga0207679_10000019
936 Ga0207667_10000910
937 Ga0207640_10105056
938 Ga0207639_10004738
939 Ga0209281_1000013
940 Ga0209281_1000015
941 Ga0209281_1001525
942 Ga0209389_1000005
943 Ga0209371_1000135
944 Ga0209371_1000456
945 Ga0209995_1001929
946 Ga0209971_1000592
947 Ga0209974_10011342
948 Ga0268266_10019836
949 Ga0265334_10000010
950 Ga0268256_1000148
951 Ga0268256_1000171
952 Ga0314311_1074035
953 Ga0316178_1042169
954 Ga0265332_10000004
955 Ga0265325_10024412
956 Ga0265327_10000814
957 Ga0265316_10041250
958 Ga0265316_10066504
959 Ga0307408_100000045
960 Ga0265313_10000125
961 Ga0307508_10066645
962 Ga0316575_10011753
963 Ga0307412_10002081
964 Ga0307414_10026965
965 Ga0307510_10035753
966 Ga0307510_10086555
967 Ga0373954_0000034
968 Ga0373927_0000002
969 Ga0373933_0001798
970 Ga0373937_0000166
971 Ga0316582_0072439
972 Ga0237819_01965
973 Ga0439438_002320
974 Ga0439438_009244
975 Ga0439447_005035
976 Ga0439447_017623
977 Ga0439466_0004327
978 Ga0439466_0004696
979 Ga0439466_0005581
980 Ga0439432_001476
981 Ga0439451_006736
982 Ga0439452_001965
983 Ga0439452_003737
984 Ga0439456_000434
985 Ga0439456_007779
986 Ga0439463_000909
987 Ga0450922_001509
988 Ga0450902_000266
989 Ga0450907_001504
990 Ga0450908_004718
991 Ga0450908_007654
992 Ga0450909_006818
993 Ga0439434_0004815
994 Ga0439464_0000161
995 Ga0439464_0000692
996 Ga0453684_0000623
997 Ga0453684_0003250
998 Ga0453684_0021525
999 Ga0451576_0039237
1000 Ga0495617_003941
1001 Ga0495627_000047
1002 Ga0495627_004660
1003 Ga0495627_005719
1004 Ga0495591_000019
1005 Ga0495591_000570
1006 Ga0495591_001669
1007 Ga0495591_003687
1008 Ga0495591_004724
1009 Ga0495591_005007
1010 Ga0495591_005171
1011 Ga0495638_0013887
1012 Ga0495638_0016620
1013 Ga0495638_0026089
1014 Ga0495653_0010573
1015 Ga0495653_0013322
1016 Ga0495653_0142413
1017 Ga0495650_0000346
1018 Ga0495650_0006687
1019 Ga0495650_0009667
1020 Ga0495605_0000014
1021 Ga0495605_0000030
1022 Ga0495605_0000825
1023 Ga0495605_0002824
1024 Ga0495605_0007022
1025 Ga0495605_0010932
1026 Ga0495605_0011004
1027 Ga0495605_0023895
1028 Ga0495584_0002381
1029 Ga0495584_0006396
1030 Ga0495584_0008445
1031 Ga0495584_0011503
1032 Ga0495584_0051156
1033 Ga0495585_0005212
1034 Ga0495585_0008973
1035 Ga0495585_0010614
1036 Ga0495596_0003549
1037 Ga0495596_0018288
1038 Ga0495607_0002357
1039 Ga0495607_0002577
1040 Ga0495607_0004286
1041 Ga0495607_0004407
1042 Ga0495607_0005536
1043 Ga0495607_0007923
1044 Ga0495607_0009938
1045 Ga0495607_0010517
1046 Ga0495607_0011815
1047 Ga0495607_0037919
1048 Ga0495583_0000066
1049 Ga0495583_0003486
1050 Ga0495583_0004291
1051 Ga0495583_0008243
1052 Ga0495583_0009268
1053 Ga0495606_0000441
1054 Ga0495606_0002176
1055 Ga0495606_0010656
1056 Ga0495606_0014688
1057 Ga0495606_0014788
1058 Ga0495606_0018194
1059 Ga0495606_0036974
1060 Ga0495610_0008778
1061 Ga0495610_0011769
1062 Ga0495610_0013704
1063 Ga0495610_0027749
1064 Ga0495616_0019111
1065 Ga0495616_0029828
1066 Ga0495616_0037181
1067 Ga0495616_0056811
1068 Ga0495620_0000097
1069 Ga0495620_0000432
1070 Ga0495620_0001077
1071 Ga0495620_0004402
1072 Ga0495620_0006214
1073 Ga0495620_0026136
1074 Ga0495631_0003503
1075 Ga0495631_0007864
1076 Ga0495632_0005500
1077 Ga0495632_0009068
1078 Ga0495632_0010114
1079 Ga0495632_0028042
1080 Ga0495637_0000024
1081 Ga0495637_0002603
1082 Ga0495637_0007329
1083 Ga0495637_0011984
1084 Ga0495643_0000103
1085 Ga0495643_0000296
1086 Ga0495643_0001851
1087 Ga0495643_0011836
1088 Ga0495648_0006433
1089 Ga0495648_0013621
1090 Ga0495648_0014743
1091 Ga0495648_0018371
1092 Ga0495648_0019521
1093 Ga0495648_0081683
1094 Ga0495666_0024200
1095 Ga0495654_0005159
1096 Ga0495654_0010056
1097 Ga0495654_0014033
1098 Ga0495654_0017229
1099 Ga0495654_0033897
1100 Ga0495586_0029104
1101 Ga0495587_0010157
1102 Ga0495609_0000006
1103 Ga0495609_0000024
1104 Ga0495609_0000040
1105 Ga0495609_0009316
1106 Ga0495609_0012416
1107 Ga0495609_0021644
1108 Ga0495597_0000010
1109 Ga0495597_0010956
1110 Ga0495597_0015969
1111 Ga0495622_0006245
1112 Ga0495622_0007104
1113 Ga0495633_0000030
1114 Ga0495633_0009976
1115 Ga0495668_0008053
1116 Ga0495634_0013086
1117 Ga0495611_0020876
1118 Ga0495611_0025579
1119 Ga0495625_0000111
1120 Ga0495625_0062306
1121 Ga0495661_0000015
1122 Ga0495661_0000019
1123 Ga0495661_0000034
1124 Ga0495661_0000546
1125 Ga0495661_0013768
1126 Ga0495661_0013892
1127 Ga0495657_0076365
1128 Ga0495623_0020072
1129 Ga0495670_0002238
1130 Ga0495670_0022495
1131 Ga0495671_0001897
1132 Ga0495671_0002005
1133 Ga0495671_0002854
1134 Ga0495671_0005159
1135 Ga0495671_0009970
1136 Ga0495671_0029863
1137 Ga0495649_0005160
1138 Ga0495649_0009864
1139 Ga0495649_0095028
1140 Ga0495589_0007997
1141 Ga0495589_0008320
1142 Ga0495589_0014373
1143 Ga0495589_0022624
1144 Ga0495600_0059633
1145 Ga0495660_0004564
1146 Ga0495660_0010417
1147 Ga0495660_0085775
1148 Ga0495604_0020247
1149 Ga0495672_0015135
1150 Ga0495672_0043048
1151 Ga0495676_0000010
1152 Ga0495680_0062390
1153 Ga0495683_0000056
1154 Ga0495683_0000134
1155 Ga0495683_0002325
1156 Ga0495683_0008814
1157 Ga0495687_002875
1158 Ga0495675_0089390
1159 Ga0495679_000201
1160 Ga0495679_001565
1161 Ga0495679_005895
1162 Ga0495673_0001419
1163 Ga0495673_0005023
1164 Ga0495673_0007531
1165 Ga0495673_0007953
1166 Ga0495673_0009573
1167 Ga0495673_0018214
1168 Ga0495673_0038092
1169 Ga0495681_0004244
1170 Ga0495681_0010903
1171 Ga0495681_0010949
1172 Ga0495681_0022929
1173 Ga0495593_0033886
1174 Ga0495626_0000013
1175 Ga0495626_0005893
1176 Ga0495626_0008809
1177 Ga0495626_0009178
1178 Ga0496102_0024500
1179 Ga0496110_0015985
1180 Ga0496116_0000999
1181 Ga0496116_0010595
1182 Ga0496117_0008521
1183 Ga0496117_0008597
1184 Ga0496117_0031427
1185 Ga0496118_0012702
1186 Ga0496118_0022600
1187 Ga0496118_0024693
1188 Ga0496118_0029162
1189 Ga0496119_0000100
1190 Ga0496119_0015180
1191 Ga0496120_0003060
1192 Ga0496120_0015127
1193 Ga0496121_0000306
1194 Ga0496121_0001448
1195 Ga0496121_0021757
1196 Ga0496121_0027161
1197 Ga0496121_0147018
1198 Ga0496122_0002016
1199 Ga0496122_0020102
1200 Ga0496122_0025123
1201 Ga0496122_0052167
1202 Ga0496123_0003192
1203 Ga0496123_0013088
1204 Ga0496123_0014821
1205 Ga0496123_0045581
1206 Ga0496124_0000051
1207 Ga0496124_0010670
1208 Ga0496124_0011323
1209 Ga0496124_0011430
1210 Ga0496124_0032044
1211 Ga0496124_0086432
1212 Ga0496124_0139530
1213 Ga0496125_0000011
1214 Ga0496125_0008140
1215 Ga0496125_0011261
1216 Ga0496125_0025346
1217 Ga0496126_0076258
1218 Ga0496126_0139222
1219 Ga0495678_000063
1220 Ga0495678_001727
1221 Ga0495678_004140
1222 Ga0495678_021772
1223 Ga0495678_028054
1224 Ga0495682_0001146
1225 Ga0495682_0002077
1226 Ga0501034_0000020
1227 Ga0501036_0118878
1228 Ga0501039_0062745
1229 Ga0501040_0025222
1230 Ga0501041_0044449
1231 Ga0501043_0135270
1232 nmdc:mga00v17_24591_c1
1233 nmdc:mga00v17_38170_c1
1234 nmdc:mga05p37_46657_c1
1235 nmdc:mga0qj67_7508_c1
1236 nmdc:mga06r32_944_c1
1237 Ga0500659_0027160
1238 2511257395
1239 2511268764
1240 2511270789
1241 2511277027
1242 2511291513
1243 2511296164
1244 2511301357
1245 2511311923
1246 2511318301
1247 2511323543
1248 2511333864
1249 2511337181
1250 2511346132
1251 2511352557
1252 2511355014
1253 2511364011
1254 2511370155
1255 2511375211
1256 2511826715
1257 2512328297
1258 2548849289
1259 2554813456
1260 2555246851
1261 2555668027
1262 2583790470
1263 2597856243
1264 2597862322
1265 2597868041
1266 2599328198
1267 2599355027
1268 2599361149
1269 2599367471
1270 2599374261
1271 2599380133
1272 2599386580
1273 2599393119
1274 2599397072
1275 2599404886
1276 2599449065
1277 2599461861
1278 2599467096
1279 2599483501
1280 2599491046
1281 2599502934
1282 2599508817
1283 2599511191
1284 2599519318
1285 2599616761
1286 2599771236
1287 2599805407
1288 2599879638
1289 2599885992
1290 2599890565
1291 2599897706
1292 2599930038
1293 2599945432
1294 2599948137
1295 2599955704
1296 2599961074
1297 2599967238
1298 2599975505
1299 2599980365
1300 2599985816
1301 2599990710
1302 2599996032
1303 2600001904
1304 2600005628
1305 2600014192
1306 2600019126
1307 2600025602
1308 2600027783
1309 2600033501
1310 2600040213
1311 2600049415
1312 2600056694
1313 2600059181
1314 2600064303
1315 2600074712
1316 2600077249
1317 2600214483
1318 2600356950
1319 2600364113
1320 2600442521
1321 2601625982
1322 2601690907
1323 2601774812
1324 2601800060
1325 2602012465
1326 2606074676
1327 2606127539
1328 2608381371
1329 2621301553
1330 2624478807
1331 2624494145
1332 2643844236
1333 2643868907
1334 2643952324
1335 2644023913
1336 2644188319
1337 2644282459
1338 2644623998
1339 2652547727
1340 2671089801
1341 2671097628
1342 2671125569
1343 2671767857
1344 2677898738
1345 2678265080
1346 2715750828
1347 2715757524
1348 2718632692
1349 2723247211
1350 2729147813
1351 2738673773
1352 2738689492
1353 2738752166
1354 2738809096
1355 2738861207
1356 2738896456
1357 2739256884
1358 2739265266
1359 2739286719
1360 2739292032
1361 2739316410
1362 2743735652
1363 2745005537
1364 2765582159
1365 2774122151
1366 2774136717
1367 2784260468
1368 2784314396
1369 2794595614
1370 2807409980
1371 2807458327
1372 2808858601
1373 2808905059
1374 2808921893
1375 2808928768
1376 2808938774
1377 2808941075
1378 2808944014
1379 2808950889
1380 2808960437
1381 2808967090
1382 2808975235
1383 2808991126
1384 2809001916
1385 2809215745
1386 2812370832
1387 2817489091
1388 2819658362
1389 2819702711
1390 2823422481
1391 2825656023
1392 2826584006
1393 2834028996
1394 2842809306
1395 2842819485
1396 2842828713
1397 2842835725
1398 2842843224
1399 2842847472
1400 2842849819
1401 2842856427
1402 2844668529
1403 2852615519
1404 2852662837
1405 2852670487
1406 2860340650
1407 2860869025
1408 2878030771
1409 2880231683
1410 2887633251
1411 2904481903
1412 2904520718
1413 2904551103
1414 2908447818
1415 2912964800
1416 2913041690
1417 2916180849
1418 2917071789
1419 2919067279
1420 2919157952
1421 2919385821
1422 2919458360
1423 2919484628
1424 2919492801
1425 2919498757
1426 2919505112
1427 2919699938
1428 2923154660
1429 2923524937
1430 2923590338
1431 2926066789
1432 2929149012
1433 2929191022
1434 2931373567
1435 2931392027
1436 2931399448
1437 2935353962
1438 2939638131
1439 2939652301
1440 2941481953
1441 2945929558
1442 2945961252
1443 2946011838
1444 2946029271
1445 2947235819
1446 2969305593
1447 2974292776
1448 2984291369
1449 2988730609
1450 2990200681
1451 2998141035
1452 3007253800
1453 3007317460
1454 3007400191
1455 3007420674
1456 3007516345
1457 3007618778
1458 3007622083
1459 3007719283
1460 3007860920
1461 3007863742
1462 3007867643
1463 3007872733
1464 637318406
1465 640489002
1466 651177092
1467 8011353540
1468 8015688896
1469 8019773275
1470 8019776604
1471 8029999727
1472 8034964232
1473 8048749786
1474 8052498952
1475 8054286222
1476 8054352561
1477 8054359160
1478 8054504605
1479 8054934447
1480 8055772014
1481 8055819047
1482 8055883350
1483 8056120338
1484 8056121828
1485 8056127080
1486 8056132916
1487 8056141952
1488 8056144382
1489 8056149132
1490 8056155605
1491 8056161209
1492 8056170016
1493 8056176149
1494 8056180579
1495 8056569685
1496 8057803303

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02789

Peptidase_M17_N

Cytosol aminopeptidase family, N-terminal domain

76

204

0.99

PF00883

Peptidase_M17

Cytosol aminopeptidase family, catalytic domain

240

544

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h8e-assembly1.cif.gz_A low ph native structure of leucine aminopeptidase from pseudomonas putida 0.9742 1 495
8pz0-assembly1.cif.gz_A intracellular leucine aminopeptidase of pseudomonas aeruginosa pa14. 0.9733 1 493
3h8e-assembly1.cif.gz_A low ph native structure of leucine aminopeptidase from pseudomonas putida 0.9722 1 495
3h8g-assembly1.cif.gz_D bestatin complex structure of leucine aminopeptidase from pseudomonas putida 0.9706 1 495
3h8g-assembly1.cif.gz_D bestatin complex structure of leucine aminopeptidase from pseudomonas putida 0.9686 1 495
ID Description Score Start End Superfamily
3h8fD01 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9705 1 159 3.40.220.10
3h8eB01 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9693 1 190 3.40.220.10
3h8eB02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9681 191 495 3.40.630.10
3h8eB02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9648 191 495 3.40.630.10
3h8eB01 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9643 1 190 3.40.220.10
ID Description Score Start End GO Terms
AF-A0A381GTH8-F1-model_v4 deleted 0.9766 1 212
AF-A0A718X9S2-F1-model_v4 Leucyl aminopeptidase (EC 3.4.11.1) 0.9764 1 250 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A4Z0B0V6-F1-model_v4 Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (EC 3.4.11.10) (Leucyl aminopeptidase) 0.9739 1 495 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A496N4L5-F1-model_v4 Leucyl aminopeptidase (EC 3.4.11.1) 0.9725 1 127 GO:0006508
GO:0070006
AF-A0A6D0F597-F1-model_v4 deleted 0.9721 49 427

Map