F478973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 748 | 477 | 1496 | 496 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0015572|Ga0495672_0015572_860_2521 |
| Length | 553 |
| Sequence | LATNRVDRSDEGCQAPLARFKLPPSSPVDPGAFLFISKRCPHLVQRLRIDHQFRDPDMELVVKSVNPQTLKTATLVVAVGEGRKLGAVAKQLDELSAGAISAVLKRGDLAGKVGQSLLLHSLPNLKAERVLLVGVGKDEELGDRPFRKIVAGILNTLKGLGGSDAVLALDEIVVKGRDSYGKTRLLAETLVDGEYQFDQFKSQKAEPRALKKITLVTIKAAEAEVQRAVTHATAIANGMAFTRDLGNLPPNICHPTFLGEQAKNLGKQFKDLKVEVLDEKKIKALGMGSFYAVGQGSAQPPRLIVMQYNGGKKSEKPYALVGKGITFDTGGISLKPGAGMDEMKYDMGGAASVFGTVRAVLELKLPINLVCILACAENMPSGNASRPGDIVTTMSGQTVEILNTDAEGRLVLCDALTYSERFKPQAVIDIATLTGACVVALGSHTSGLLGNNEQLIDQLLSAGKAADDRAWQLPLFDEYQEQLDSPFADIANIGGPKAGTITAACFLSRFTKNLNWAHLDIAGTAWTSGGKDKGATGRPVPLLTQYLLDRAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 105 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 106 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 113 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 117 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 122 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 123 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 124 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 125 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 126 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 127 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 128 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 129 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 130 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 131 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 132 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 133 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 134 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 135 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 196 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 197 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 198 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 199 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 200 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 201 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 202 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 203 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 204 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 205 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 206 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 219 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 220 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 221 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 222 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 223 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 224 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 225 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 226 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 227 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 228 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 229 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 230 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 231 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 232 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 233 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 234 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 235 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 236 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 237 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 238 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 239 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 240 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 241 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 242 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 243 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 244 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 245 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 246 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 247 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 248 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 249 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 250 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 251 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 252 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 253 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 254 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 255 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 256 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 257 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 258 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 259 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 260 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 261 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 262 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 263 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 264 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 265 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 266 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 267 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 268 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 269 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 270 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 271 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 272 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 273 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 274 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 275 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 276 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 277 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 278 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 279 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 280 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 281 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 282 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 283 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 284 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 285 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 286 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 287 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 288 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 289 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 290 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 291 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 292 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 293 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 294 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 295 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 296 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 297 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 298 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 299 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 300 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 301 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 302 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 303 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 304 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 305 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 306 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 307 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 308 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 309 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 310 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 311 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 312 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 313 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 314 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 315 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 316 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 317 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 318 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 319 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 320 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 321 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 322 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 323 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 324 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 325 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 326 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 327 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 328 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 329 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 330 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 331 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 332 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 333 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 334 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 335 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 336 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 337 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 338 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 339 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 340 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 341 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 342 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 343 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 344 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 345 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 346 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 347 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 348 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 349 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 350 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 351 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 352 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 353 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 354 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 355 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 356 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 357 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 358 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 359 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 360 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 361 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 362 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 363 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 364 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 365 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 366 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 367 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 368 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 369 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 370 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 371 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 372 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 373 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 374 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 375 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 376 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 377 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 378 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 379 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 380 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 381 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 382 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 383 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 384 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 385 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 386 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 387 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 388 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 389 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 390 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 391 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 392 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 393 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 394 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 395 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 396 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 397 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 398 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 399 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 400 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 401 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 402 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 403 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 404 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 405 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 406 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 407 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 408 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 409 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 410 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 411 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 412 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 413 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 414 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 415 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 416 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 417 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 418 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 419 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 420 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 421 | 2941479691 | |||
| 422 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 423 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 424 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 425 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 426 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 427 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 428 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 429 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 430 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 431 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 432 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 433 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 434 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 435 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 436 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 437 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 438 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 439 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 440 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 441 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 442 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 443 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 444 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 445 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 446 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 447 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 448 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 449 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 450 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 451 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 452 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 453 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 454 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 455 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 456 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 457 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 458 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 459 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 460 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 461 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 462 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 463 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 464 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 465 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 466 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 467 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 468 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 469 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 470 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 471 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 472 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 473 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 474 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 475 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 476 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 477 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 65.37 |
| Metatranscriptomes | 0 |
| Isolates | 34.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.02 |
| Nodule | 3.61 |
| Rhizoplane | 9.49 |
| Rhizosphere | 62.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495672_0015572 | 3300047320 | Bacteria | 5158 |
| 2 | MRS2a_Contig_171 | 2124908027 | Bacteria | 22045 |
| 3 | JGI25162J39368_1000101 | 3300002737 | Bacteria | 94481 |
| 4 | JGI25162J39368_1000200 | 3300002737 | Bacteria | 63130 |
| 5 | JGI25163J39215_1001257 | 3300002771 | Bacteria | 4629 |
| 6 | JGI25163J39215_1001263 | 3300002771 | Bacteria | 4600 |
| 7 | JGI25164J39214_1000097 | 3300002772 | Bacteria | 87008 |
| 8 | JGI25164J39214_1000162 | 3300002772 | Bacteria | 63130 |
| 9 | JGI25165J46597_1000184 | 3300003214 | Bacteria | 94481 |
| 10 | JGI25165J46597_1000294 | 3300003214 | Bacteria | 63130 |
| 11 | Ga0055538_1000029 | 3300003751 | Bacteria | 203858 |
| 12 | Ga0055539_1000039 | 3300003752 | Bacteria | 203858 |
| 13 | Ga0055533_1000049 | 3300003756 | Bacteria | 203858 |
| 14 | Ga0055532_1000049 | 3300003758 | Bacteria | 174079 |
| 15 | Ga0055525_1000077 | 3300003759 | Bacteria | 166608 |
| 16 | Ga0055536_1000062 | 3300003781 | Bacteria | 99169 |
| 17 | Ga0055536_1002715 | 3300003781 | Bacteria | 9816 |
| 18 | Ga0055536_1002887 | 3300003781 | Bacteria | 9444 |
| 19 | Ga0055530_10000489 | 3300003791 | Bacteria | 34449 |
| 20 | Ga0055530_10003343 | 3300003791 | Bacteria | 9212 |
| 21 | Ga0055530_10003378 | 3300003791 | Bacteria | 9124 |
| 22 | Ga0055540_1001086 | 3300003792 | Bacteria | 17251 |
| 23 | Ga0055540_1002667 | 3300003792 | Bacteria | 9212 |
| 24 | Ga0055540_1002708 | 3300003792 | Bacteria | 9124 |
| 25 | Ga0055531_10001423 | 3300003794 | Bacteria | 17662 |
| 26 | Ga0055541_1000026 | 3300003841 | Bacteria | 203858 |
| 27 | Ga0065714_10000532 | 3300005288 | Bacteria | 3983 |
| 28 | Ga0065714_10004098 | 3300005288 | Bacteria | 9895 |
| 29 | Ga0065714_10019409 | 3300005288 | Bacteria | 2195 |
| 30 | Ga0065714_10025493 | 3300005288 | Bacteria | 1720 |
| 31 | Ga0065714_10069308 | 3300005288 | Bacteria | 4285 |
| 32 | Ga0065714_10095901 | 3300005288 | Bacteria | 1774 |
| 33 | Ga0065714_10099438 | 3300005288 | Bacteria | 1676 |
| 34 | Ga0065704_10079021 | 3300005289 | Bacteria | 4279 |
| 35 | Ga0065704_10101051 | 3300005289 | Bacteria | 2251 |
| 36 | Ga0065712_10000436 | 3300005290 | Bacteria | 11353 |
| 37 | Ga0065712_10000741 | 3300005290 | Bacteria | 11999 |
| 38 | Ga0065712_10067897 | 3300005290 | Bacteria | 22137 |
| 39 | Ga0065715_10090306 | 3300005293 | Bacteria | 7253 |
| 40 | Ga0070661_100000541 | 3300005344 | Bacteria | 28924 |
| 41 | Ga0070661_100166088 | 3300005344 | Bacteria | 1674 |
| 42 | Ga0070669_100000292 | 3300005353 | Bacteria | 39324 |
| 43 | Ga0070669_100053265 | 3300005353 | Bacteria | 2961 |
| 44 | Ga0070714_100001758 | 3300005435 | Bacteria | 15800 |
| 45 | Ga0070662_100000560 | 3300005457 | Bacteria | 22585 |
| 46 | Ga0068853_100045050 | 3300005539 | Bacteria | 3778 |
| 47 | Ga0070704_100020015 | 3300005549 | Bacteria | 4306 |
| 48 | Ga0068855_100000537 | 3300005563 | Bacteria | 46369 |
| 49 | Ga0070664_100000977 | 3300005564 | Bacteria | 22391 |
| 50 | Ga0068857_100129005 | 3300005577 | Bacteria | 2280 |
| 51 | Ga0068854_100067271 | 3300005578 | Bacteria | 2610 |
| 52 | Ga0068851_10000006 | 3300005834 | Bacteria | 258116 |
| 53 | Ga0075364_10000144 | 3300006051 | Bacteria | 31200 |
| 54 | Ga0075432_10005444 | 3300006058 | Bacteria | 4339 |
| 55 | Ga0075370_10001507 | 3300006353 | Bacteria | 10178 |
| 56 | Ga0075428_100010658 | 3300006844 | Bacteria | 10217 |
| 57 | Ga0075431_100031620 | 3300006847 | Bacteria | 5451 |
| 58 | Ga0075434_100166533 | 3300006871 | Bacteria | 2224 |
| 59 | Ga0075429_100000080 | 3300006880 | Bacteria | 49555 |
| 60 | Ga0099823_1008670 | 3300006944 | Bacteria | 10338 |
| 61 | Ga0079104_1000168 | 3300006946 | Bacteria | 93546 |
| 62 | Ga0079104_1001462 | 3300006946 | Bacteria | 15758 |
| 63 | Ga0099826_10010925 | 3300006948 | Bacteria | 6820 |
| 64 | Ga0105251_10000012 | 3300009011 | Bacteria | 167614 |
| 65 | Ga0105251_10000152 | 3300009011 | Bacteria | 70853 |
| 66 | Ga0105251_10024684 | 3300009011 | Bacteria | 3085 |
| 67 | Ga0105251_10033567 | 3300009011 | Bacteria | 2546 |
| 68 | Ga0105244_10000350 | 3300009036 | Bacteria | 43319 |
| 69 | Ga0105244_10011854 | 3300009036 | Bacteria | 5195 |
| 70 | Ga0105244_10025453 | 3300009036 | Bacteria | 3216 |
| 71 | Ga0105244_10029878 | 3300009036 | Bacteria | 2905 |
| 72 | Ga0105244_10031555 | 3300009036 | Bacteria | 2811 |
| 73 | Ga0105244_10041160 | 3300009036 | Bacteria | 2395 |
| 74 | Ga0105250_10002356 | 3300009092 | Bacteria | 9543 |
| 75 | Ga0105250_10005971 | 3300009092 | Bacteria | 5378 |
| 76 | Ga0105250_10006074 | 3300009092 | Bacteria | 5318 |
| 77 | Ga0105250_10010171 | 3300009092 | Bacteria | 3927 |
| 78 | Ga0105245_10024959 | 3300009098 | Bacteria | 5253 |
| 79 | Ga0114129_10004258 | 3300009147 | Bacteria | 20227 |
| 80 | Ga0105243_10001292 | 3300009148 | Bacteria | 22446 |
| 81 | Ga0105243_10001767 | 3300009148 | Bacteria | 18576 |
| 82 | Ga0105243_10018220 | 3300009148 | Bacteria | 5316 |
| 83 | Ga0105243_10192385 | 3300009148 | Bacteria | 1783 |
| 84 | Ga0105242_10000233 | 3300009176 | Bacteria | 43902 |
| 85 | Ga0105242_10008309 | 3300009176 | Bacteria | 7973 |
| 86 | Ga0105237_10019270 | 3300009545 | Bacteria | 7048 |
| 87 | Ga0105246_10000822 | 3300011119 | Bacteria | 17660 |
| 88 | Ga0105246_10006864 | 3300011119 | Bacteria | 6965 |
| 89 | Ga0105246_10008702 | 3300011119 | Bacteria | 6245 |
| 90 | Ga0157373_10018044 | 3300013100 | Bacteria | 5139 |
| 91 | Ga0157373_10026662 | 3300013100 | Bacteria | 4172 |
| 92 | Ga0157371_10000319 | 3300013102 | Bacteria | 62459 |
| 93 | Ga0157371_10017344 | 3300013102 | Bacteria | 5352 |
| 94 | Ga0157371_10017637 | 3300013102 | Bacteria | 5296 |
| 95 | Ga0157370_10000158 | 3300013104 | Bacteria | 83884 |
| 96 | Ga0157370_10049922 | 3300013104 | Bacteria | 4001 |
| 97 | Ga0163162_10004406 | 3300013306 | Bacteria | 13546 |
| 98 | Ga0157372_10000640 | 3300013307 | Bacteria | 38414 |
| 99 | Ga0182008_10006586 | 3300014497 | Bacteria | 6478 |
| 100 | Ga0182006_1005927 | 3300015261 | Bacteria | 5745 |
| 101 | Ga0182006_1007080 | 3300015261 | Bacteria | 5162 |
| 102 | Ga0182007_10005483 | 3300015262 | Bacteria | 5568 |
| 103 | Ga0182005_1002034 | 3300015265 | Bacteria | 7593 |
| 104 | Ga0163161_10020046 | 3300017792 | Bacteria | 4690 |
| 105 | Ga0209435_101620 | 3300025206 | Bacteria | 2770 |
| 106 | Ga0209760_100124 | 3300025207 | Bacteria | 51804 |
| 107 | Ga0209760_100657 | 3300025207 | Bacteria | 5640 |
| 108 | Ga0209784_100045 | 3300025224 | Bacteria | 203911 |
| 109 | Ga0209566_100057 | 3300025225 | Bacteria | 203960 |
| 110 | Ga0209674_100080 | 3300025226 | Bacteria | 203960 |
| 111 | Ga0209147_100079 | 3300025229 | Bacteria | 203960 |
| 112 | Ga0209563_100078 | 3300025230 | Bacteria | 203960 |
| 113 | Ga0209563_102018 | 3300025230 | Bacteria | 4849 |
| 114 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 115 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 116 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 117 | Ga0209437_100028 | 3300025233 | Bacteria | 540136 |
| 118 | Ga0209258_100178 | 3300025242 | Bacteria | 138843 |
| 119 | Ga0209646_1000311 | 3300025246 | Bacteria | 38501 |
| 120 | Ga0209677_100045 | 3300025253 | Bacteria | 203960 |
| 121 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 122 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 123 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 124 | Ga0209676_1000078 | 3300025292 | Bacteria | 296293 |
| 125 | Ga0209676_1000101 | 3300025292 | Bacteria | 227976 |
| 126 | Ga0209676_1001261 | 3300025292 | Bacteria | 26362 |
| 127 | Ga0209676_1003065 | 3300025292 | Bacteria | 10778 |
| 128 | Ga0209676_1015895 | 3300025292 | Bacteria | 2747 |
| 129 | Ga0209050_1000027 | 3300025298 | Bacteria | 483261 |
| 130 | Ga0209050_1000041 | 3300025298 | Bacteria | 408004 |
| 131 | Ga0209050_1000181 | 3300025298 | Bacteria | 142533 |
| 132 | Ga0209050_1002328 | 3300025298 | Bacteria | 16701 |
| 133 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 134 | Ga0209051_1000065 | 3300025303 | Bacteria | 231445 |
| 135 | Ga0209051_1000085 | 3300025303 | Bacteria | 189973 |
| 136 | Ga0209051_1009606 | 3300025303 | Bacteria | 4967 |
| 137 | Ga0209257_1000105 | 3300025304 | Bacteria | 243729 |
| 138 | Ga0207656_10000017 | 3300025321 | Bacteria | 117646 |
| 139 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 140 | Ga0207696_1000112 | 3300025711 | Bacteria | 154384 |
| 141 | Ga0207696_1000121 | 3300025711 | Bacteria | 143687 |
| 142 | Ga0207696_1000129 | 3300025711 | Bacteria | 133308 |
| 143 | Ga0207696_1002970 | 3300025711 | Bacteria | 7935 |
| 144 | Ga0207696_1006453 | 3300025711 | Bacteria | 4723 |
| 145 | Ga0207696_1006880 | 3300025711 | Bacteria | 4523 |
| 146 | Ga0207696_1011992 | 3300025711 | Bacteria | 3089 |
| 147 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 148 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 149 | Ga0207655_1000086 | 3300025728 | Bacteria | 206068 |
| 150 | Ga0207655_1000515 | 3300025728 | Bacteria | 49164 |
| 151 | Ga0207655_1001621 | 3300025728 | Bacteria | 19987 |
| 152 | Ga0207655_1003475 | 3300025728 | Bacteria | 11712 |
| 153 | Ga0207655_1004133 | 3300025728 | Bacteria | 10427 |
| 154 | Ga0207655_1004813 | 3300025728 | Bacteria | 9396 |
| 155 | Ga0207655_1011672 | 3300025728 | Bacteria | 5205 |
| 156 | Ga0207655_1014486 | 3300025728 | Bacteria | 4452 |
| 157 | Ga0207655_1015673 | 3300025728 | Bacteria | 4197 |
| 158 | Ga0207655_1021057 | 3300025728 | Bacteria | 3324 |
| 159 | Ga0207655_1024608 | 3300025728 | Bacteria | 2946 |
| 160 | Ga0207655_1027042 | 3300025728 | Bacteria | 2742 |
| 161 | Ga0207655_1027119 | 3300025728 | Bacteria | 2737 |
| 162 | Ga0207713_1000068 | 3300025735 | Bacteria | 192415 |
| 163 | Ga0207713_1000080 | 3300025735 | Bacteria | 168403 |
| 164 | Ga0207713_1000356 | 3300025735 | Bacteria | 50001 |
| 165 | Ga0207713_1003328 | 3300025735 | Bacteria | 11038 |
| 166 | Ga0207713_1003358 | 3300025735 | Bacteria | 10976 |
| 167 | Ga0207713_1003950 | 3300025735 | Bacteria | 9850 |
| 168 | Ga0207713_1005319 | 3300025735 | Bacteria | 8088 |
| 169 | Ga0207713_1008999 | 3300025735 | Bacteria | 5678 |
| 170 | Ga0207713_1018211 | 3300025735 | Bacteria | 3484 |
| 171 | Ga0207713_1020703 | 3300025735 | Bacteria | 3176 |
| 172 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 173 | Ga0207649_10000004 | 3300025920 | Bacteria | 360726 |
| 174 | Ga0207681_10000275 | 3300025923 | Bacteria | 38387 |
| 175 | Ga0207681_10008090 | 3300025923 | Bacteria | 6434 |
| 176 | Ga0207650_10000668 | 3300025925 | Bacteria | 26952 |
| 177 | Ga0207687_10028060 | 3300025927 | Bacteria | 3780 |
| 178 | Ga0207664_10016070 | 3300025929 | Bacteria | 5451 |
| 179 | Ga0207706_10001474 | 3300025933 | Bacteria | 23502 |
| 180 | Ga0207706_10021457 | 3300025933 | Bacteria | 5800 |
| 181 | Ga0207686_10000569 | 3300025934 | Bacteria | 23377 |
| 182 | Ga0207686_10015911 | 3300025934 | Bacteria | 4214 |
| 183 | Ga0207709_10000067 | 3300025935 | Bacteria | 189188 |
| 184 | Ga0207709_10003359 | 3300025935 | Bacteria | 9563 |
| 185 | Ga0207709_10009315 | 3300025935 | Bacteria | 5406 |
| 186 | Ga0207709_10017682 | 3300025935 | Bacteria | 3982 |
| 187 | Ga0207679_10000019 | 3300025945 | Bacteria | 230270 |
| 188 | Ga0207667_10000910 | 3300025949 | Bacteria | 37665 |
| 189 | Ga0207640_10105056 | 3300025981 | Bacteria | 1989 |
| 190 | Ga0207639_10004738 | 3300026041 | Bacteria | 9160 |
| 191 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 192 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 193 | Ga0209281_1001525 | 3300027111 | Bacteria | 13023 |
| 194 | Ga0209389_1000005 | 3300027296 | Bacteria | 232255 |
| 195 | Ga0209371_1000135 | 3300027312 | Bacteria | 121718 |
| 196 | Ga0209371_1000456 | 3300027312 | Bacteria | 40349 |
| 197 | Ga0209995_1001929 | 3300027471 | Bacteria | 3245 |
| 198 | Ga0209971_1000592 | 3300027682 | Bacteria | 9429 |
| 199 | Ga0209974_10011342 | 3300027876 | Bacteria | 2995 |
| 200 | Ga0268266_10019836 | 3300028379 | Bacteria | 5730 |
| 201 | Ga0265334_10000010 | 3300028573 | Bacteria | 188179 |
| 202 | Ga0268256_1000148 | 3300030500 | Bacteria | 94347 |
| 203 | Ga0268256_1000171 | 3300030500 | Bacteria | 78656 |
| 204 | Ga0314311_1074035 | 3300030733 | Bacteria | 5250 |
| 205 | Ga0316178_1042169 | 3300030735 | Bacteria | 25762 |
| 206 | Ga0265332_10000004 | 3300031238 | Bacteria | 426592 |
| 207 | Ga0265325_10024412 | 3300031241 | Bacteria | 3291 |
| 208 | Ga0265327_10000814 | 3300031251 | Bacteria | 47176 |
| 209 | Ga0265316_10041250 | 3300031344 | Bacteria | 3695 |
| 210 | Ga0265316_10066504 | 3300031344 | Bacteria | 2789 |
| 211 | Ga0307408_100000045 | 3300031548 | Bacteria | 169484 |
| 212 | Ga0265313_10000125 | 3300031595 | Bacteria | 77022 |
| 213 | Ga0307508_10066645 | 3300031616 | Bacteria | 3169 |
| 214 | Ga0316575_10011753 | 3300031665 | Bacteria | 3244 |
| 215 | Ga0307412_10002081 | 3300031911 | Bacteria | 11107 |
| 216 | Ga0307414_10026965 | 3300032004 | Bacteria | 3705 |
| 217 | Ga0307510_10035753 | 3300033180 | Bacteria | 5539 |
| 218 | Ga0307510_10086555 | 3300033180 | Bacteria | 3005 |
| 219 | Ga0373954_0000034 | 3300035118 | Bacteria | 52216 |
| 220 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 221 | Ga0373933_0001798 | 3300035724 | Bacteria | 12424 |
| 222 | Ga0373937_0000166 | 3300036401 | Bacteria | 63970 |
| 223 | Ga0316582_0072439 | 3300036647 | Bacteria | 2234 |
| 224 | Ga0237819_01965 | 3300038705 | Bacteria | 4638 |
| 225 | Ga0439438_002320 | 3300041405 | Bacteria | 8132 |
| 226 | Ga0439438_009244 | 3300041405 | Bacteria | 3202 |
| 227 | Ga0439447_005035 | 3300041407 | Bacteria | 4447 |
| 228 | Ga0439447_017623 | 3300041407 | Bacteria | 1942 |
| 229 | Ga0439466_0004327 | 3300041411 | Bacteria | 5479 |
| 230 | Ga0439466_0004696 | 3300041411 | Bacteria | 5249 |
| 231 | Ga0439466_0005581 | 3300041411 | Bacteria | 4801 |
| 232 | Ga0439432_001476 | 3300042006 | Bacteria | 8822 |
| 233 | Ga0439451_006736 | 3300042009 | Bacteria | 2348 |
| 234 | Ga0439452_001965 | 3300042010 | Bacteria | 7863 |
| 235 | Ga0439452_003737 | 3300042010 | Bacteria | 5246 |
| 236 | Ga0439456_000434 | 3300042013 | Bacteria | 9314 |
| 237 | Ga0439456_007779 | 3300042013 | Bacteria | 2205 |
| 238 | Ga0439463_000909 | 3300042016 | Bacteria | 8130 |
| 239 | Ga0450922_001509 | 3300042124 | Bacteria | 2282 |
| 240 | Ga0450902_000266 | 3300042137 | Bacteria | 6292 |
| 241 | Ga0450907_001504 | 3300042146 | Bacteria | 4986 |
| 242 | Ga0450908_004718 | 3300042184 | Bacteria | 2626 |
| 243 | Ga0450908_007654 | 3300042184 | Bacteria | 2034 |
| 244 | Ga0450909_006818 | 3300042185 | Bacteria | 1646 |
| 245 | Ga0439434_0004815 | 3300042435 | Bacteria | 3950 |
| 246 | Ga0439464_0000161 | 3300042439 | Bacteria | 11092 |
| 247 | Ga0439464_0000692 | 3300042439 | Bacteria | 7293 |
| 248 | Ga0453684_0000623 | 3300044712 | Bacteria | 129254 |
| 249 | Ga0453684_0003250 | 3300044712 | Bacteria | 37169 |
| 250 | Ga0453684_0021525 | 3300044712 | Bacteria | 9626 |
| 251 | Ga0451576_0039237 | 3300045051 | Bacteria | 5012 |
| 252 | Ga0495617_003941 | 3300046452 | Bacteria | 5468 |
| 253 | Ga0495627_000047 | 3300046453 | Bacteria | 170068 |
| 254 | Ga0495627_004660 | 3300046453 | Bacteria | 5681 |
| 255 | Ga0495627_005719 | 3300046453 | Bacteria | 4964 |
| 256 | Ga0495591_000019 | 3300046458 | Bacteria | 223010 |
| 257 | Ga0495591_000570 | 3300046458 | Bacteria | 28243 |
| 258 | Ga0495591_001669 | 3300046458 | Bacteria | 13384 |
| 259 | Ga0495591_003687 | 3300046458 | Bacteria | 7782 |
| 260 | Ga0495591_004724 | 3300046458 | Bacteria | 6534 |
| 261 | Ga0495591_005007 | 3300046458 | Bacteria | 6251 |
| 262 | Ga0495591_005171 | 3300046458 | Bacteria | 6112 |
| 263 | Ga0495638_0013887 | 3300046460 | Bacteria | 5462 |
| 264 | Ga0495638_0016620 | 3300046460 | Bacteria | 4923 |
| 265 | Ga0495638_0026089 | 3300046460 | Bacteria | 3792 |
| 266 | Ga0495653_0010573 | 3300046463 | Bacteria | 7556 |
| 267 | Ga0495653_0013322 | 3300046463 | Bacteria | 6701 |
| 268 | Ga0495653_0142413 | 3300046463 | Bacteria | 1684 |
| 269 | Ga0495650_0000346 | 3300046471 | Bacteria | 82519 |
| 270 | Ga0495650_0006687 | 3300046471 | Bacteria | 7138 |
| 271 | Ga0495650_0009667 | 3300046471 | Bacteria | 5465 |
| 272 | Ga0495605_0000014 | 3300046474 | Bacteria | 305393 |
| 273 | Ga0495605_0000030 | 3300046474 | Bacteria | 213339 |
| 274 | Ga0495605_0000825 | 3300046474 | Bacteria | 22002 |
| 275 | Ga0495605_0002824 | 3300046474 | Bacteria | 10560 |
| 276 | Ga0495605_0007022 | 3300046474 | Bacteria | 6425 |
| 277 | Ga0495605_0010932 | 3300046474 | Bacteria | 5070 |
| 278 | Ga0495605_0011004 | 3300046474 | Bacteria | 5054 |
| 279 | Ga0495605_0023895 | 3300046474 | Bacteria | 3206 |
| 280 | Ga0495584_0002381 | 3300046491 | Bacteria | 10686 |
| 281 | Ga0495584_0006396 | 3300046491 | Bacteria | 6170 |
| 282 | Ga0495584_0008445 | 3300046491 | Bacteria | 5334 |
| 283 | Ga0495584_0011503 | 3300046491 | Bacteria | 4533 |
| 284 | Ga0495584_0051156 | 3300046491 | Bacteria | 2080 |
| 285 | Ga0495585_0005212 | 3300046492 | Bacteria | 8238 |
| 286 | Ga0495585_0008973 | 3300046492 | Bacteria | 6025 |
| 287 | Ga0495585_0010614 | 3300046492 | Bacteria | 5474 |
| 288 | Ga0495596_0003549 | 3300046500 | Bacteria | 7860 |
| 289 | Ga0495596_0018288 | 3300046500 | Bacteria | 2889 |
| 290 | Ga0495607_0002357 | 3300046501 | Bacteria | 15440 |
| 291 | Ga0495607_0002577 | 3300046501 | Bacteria | 14625 |
| 292 | Ga0495607_0004286 | 3300046501 | Bacteria | 10540 |
| 293 | Ga0495607_0004407 | 3300046501 | Bacteria | 10373 |
| 294 | Ga0495607_0005536 | 3300046501 | Bacteria | 9011 |
| 295 | Ga0495607_0007923 | 3300046501 | Bacteria | 7304 |
| 296 | Ga0495607_0009938 | 3300046501 | Bacteria | 6407 |
| 297 | Ga0495607_0010517 | 3300046501 | Bacteria | 6216 |
| 298 | Ga0495607_0011815 | 3300046501 | Bacteria | 5790 |
| 299 | Ga0495607_0037919 | 3300046501 | Bacteria | 2890 |
| 300 | Ga0495583_0000066 | 3300046506 | Bacteria | 191372 |
| 301 | Ga0495583_0003486 | 3300046506 | Bacteria | 11919 |
| 302 | Ga0495583_0004291 | 3300046506 | Bacteria | 10323 |
| 303 | Ga0495583_0008243 | 3300046506 | Bacteria | 6392 |
| 304 | Ga0495583_0009268 | 3300046506 | Bacteria | 5896 |
| 305 | Ga0495606_0000441 | 3300046507 | Bacteria | 68151 |
| 306 | Ga0495606_0002176 | 3300046507 | Bacteria | 23553 |
| 307 | Ga0495606_0010656 | 3300046507 | Bacteria | 7602 |
| 308 | Ga0495606_0014688 | 3300046507 | Bacteria | 6089 |
| 309 | Ga0495606_0014788 | 3300046507 | Bacteria | 6062 |
| 310 | Ga0495606_0018194 | 3300046507 | Bacteria | 5280 |
| 311 | Ga0495606_0036974 | 3300046507 | Bacteria | 3319 |
| 312 | Ga0495610_0008778 | 3300046512 | Bacteria | 6485 |
| 313 | Ga0495610_0011769 | 3300046512 | Bacteria | 5315 |
| 314 | Ga0495610_0013704 | 3300046512 | Bacteria | 4802 |
| 315 | Ga0495610_0027749 | 3300046512 | Bacteria | 3003 |
| 316 | Ga0495616_0019111 | 3300046513 | Bacteria | 3744 |
| 317 | Ga0495616_0029828 | 3300046513 | Bacteria | 2874 |
| 318 | Ga0495616_0037181 | 3300046513 | Bacteria | 2506 |
| 319 | Ga0495616_0056811 | 3300046513 | Bacteria | 1931 |
| 320 | Ga0495620_0000097 | 3300046515 | Bacteria | 69944 |
| 321 | Ga0495620_0000432 | 3300046515 | Bacteria | 27942 |
| 322 | Ga0495620_0001077 | 3300046515 | Bacteria | 16707 |
| 323 | Ga0495620_0004402 | 3300046515 | Bacteria | 7940 |
| 324 | Ga0495620_0006214 | 3300046515 | Bacteria | 6579 |
| 325 | Ga0495620_0026136 | 3300046515 | Bacteria | 2748 |
| 326 | Ga0495631_0003503 | 3300046518 | Bacteria | 8584 |
| 327 | Ga0495631_0007864 | 3300046518 | Bacteria | 5405 |
| 328 | Ga0495632_0005500 | 3300046519 | Bacteria | 8362 |
| 329 | Ga0495632_0009068 | 3300046519 | Bacteria | 6024 |
| 330 | Ga0495632_0010114 | 3300046519 | Bacteria | 5617 |
| 331 | Ga0495632_0028042 | 3300046519 | Bacteria | 2941 |
| 332 | Ga0495637_0000024 | 3300046520 | Bacteria | 169477 |
| 333 | Ga0495637_0002603 | 3300046520 | Bacteria | 9907 |
| 334 | Ga0495637_0007329 | 3300046520 | Bacteria | 5478 |
| 335 | Ga0495637_0011984 | 3300046520 | Bacteria | 4157 |
| 336 | Ga0495643_0000103 | 3300046522 | Bacteria | 140814 |
| 337 | Ga0495643_0000296 | 3300046522 | Bacteria | 70161 |
| 338 | Ga0495643_0001851 | 3300046522 | Bacteria | 17960 |
| 339 | Ga0495643_0011836 | 3300046522 | Bacteria | 5290 |
| 340 | Ga0495648_0006433 | 3300046524 | Bacteria | 9591 |
| 341 | Ga0495648_0013621 | 3300046524 | Bacteria | 5999 |
| 342 | Ga0495648_0014743 | 3300046524 | Bacteria | 5699 |
| 343 | Ga0495648_0018371 | 3300046524 | Bacteria | 4951 |
| 344 | Ga0495648_0019521 | 3300046524 | Bacteria | 4763 |
| 345 | Ga0495648_0081683 | 3300046524 | Bacteria | 1837 |
| 346 | Ga0495666_0024200 | 3300046526 | Bacteria | 3000 |
| 347 | Ga0495654_0005159 | 3300046530 | Bacteria | 7622 |
| 348 | Ga0495654_0010056 | 3300046530 | Bacteria | 5163 |
| 349 | Ga0495654_0014033 | 3300046530 | Bacteria | 4272 |
| 350 | Ga0495654_0017229 | 3300046530 | Bacteria | 3801 |
| 351 | Ga0495654_0033897 | 3300046530 | Bacteria | 2580 |
| 352 | Ga0495586_0029104 | 3300046535 | Bacteria | 2957 |
| 353 | Ga0495587_0010157 | 3300046536 | Bacteria | 6004 |
| 354 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 355 | Ga0495609_0000024 | 3300046538 | Bacteria | 264100 |
| 356 | Ga0495609_0000040 | 3300046538 | Bacteria | 177058 |
| 357 | Ga0495609_0009316 | 3300046538 | Bacteria | 4755 |
| 358 | Ga0495609_0012416 | 3300046538 | Bacteria | 4041 |
| 359 | Ga0495609_0021644 | 3300046538 | Bacteria | 2966 |
| 360 | Ga0495597_0000010 | 3300046542 | Bacteria | 222418 |
| 361 | Ga0495597_0010956 | 3300046542 | Bacteria | 4408 |
| 362 | Ga0495597_0015969 | 3300046542 | Bacteria | 3550 |
| 363 | Ga0495622_0006245 | 3300046557 | Bacteria | 5531 |
| 364 | Ga0495622_0007104 | 3300046557 | Bacteria | 5202 |
| 365 | Ga0495633_0000030 | 3300046558 | Bacteria | 197184 |
| 366 | Ga0495633_0009976 | 3300046558 | Bacteria | 5212 |
| 367 | Ga0495668_0008053 | 3300046616 | Bacteria | 6637 |
| 368 | Ga0495634_0013086 | 3300046642 | Bacteria | 5998 |
| 369 | Ga0495611_0020876 | 3300046648 | Bacteria | 2823 |
| 370 | Ga0495611_0025579 | 3300046648 | Bacteria | 2573 |
| 371 | Ga0495625_0000111 | 3300046660 | Bacteria | 124977 |
| 372 | Ga0495625_0062306 | 3300046660 | Bacteria | 2636 |
| 373 | Ga0495661_0000015 | 3300046665 | Bacteria | 223740 |
| 374 | Ga0495661_0000019 | 3300046665 | Bacteria | 200606 |
| 375 | Ga0495661_0000034 | 3300046665 | Bacteria | 165606 |
| 376 | Ga0495661_0000546 | 3300046665 | Bacteria | 38911 |
| 377 | Ga0495661_0013768 | 3300046665 | Bacteria | 5427 |
| 378 | Ga0495661_0013892 | 3300046665 | Bacteria | 5402 |
| 379 | Ga0495657_0076365 | 3300046675 | Bacteria | 2176 |
| 380 | Ga0495623_0020072 | 3300046679 | Bacteria | 4320 |
| 381 | Ga0495670_0002238 | 3300046691 | Bacteria | 9556 |
| 382 | Ga0495670_0022495 | 3300046691 | Bacteria | 3112 |
| 383 | Ga0495671_0001897 | 3300046692 | Bacteria | 13422 |
| 384 | Ga0495671_0002005 | 3300046692 | Bacteria | 13093 |
| 385 | Ga0495671_0002854 | 3300046692 | Bacteria | 10809 |
| 386 | Ga0495671_0005159 | 3300046692 | Bacteria | 7684 |
| 387 | Ga0495671_0009970 | 3300046692 | Bacteria | 5287 |
| 388 | Ga0495671_0029863 | 3300046692 | Bacteria | 2795 |
| 389 | Ga0495649_0005160 | 3300046694 | Bacteria | 8373 |
| 390 | Ga0495649_0009864 | 3300046694 | Bacteria | 5651 |
| 391 | Ga0495649_0095028 | 3300046694 | Bacteria | 1587 |
| 392 | Ga0495589_0007997 | 3300046794 | Bacteria | 5532 |
| 393 | Ga0495589_0008320 | 3300046794 | Bacteria | 5419 |
| 394 | Ga0495589_0014373 | 3300046794 | Bacteria | 4078 |
| 395 | Ga0495589_0022624 | 3300046794 | Bacteria | 3206 |
| 396 | Ga0495600_0059633 | 3300046809 | Bacteria | 2492 |
| 397 | Ga0495660_0004564 | 3300046810 | Bacteria | 8360 |
| 398 | Ga0495660_0010417 | 3300046810 | Bacteria | 5409 |
| 399 | Ga0495660_0085775 | 3300046810 | Bacteria | 1644 |
| 400 | Ga0495604_0020247 | 3300047317 | Bacteria | 5316 |
| 401 | Ga0495672_0015135 | 3300047320 | Bacteria | 5249 |
| 402 | Ga0495672_0043048 | 3300047320 | Bacteria | 2717 |
| 403 | Ga0495676_0000010 | 3300047321 | Bacteria | 242637 |
| 404 | Ga0495680_0062390 | 3300047322 | Bacteria | 2865 |
| 405 | Ga0495683_0000056 | 3300047323 | Bacteria | 118944 |
| 406 | Ga0495683_0000134 | 3300047323 | Bacteria | 72364 |
| 407 | Ga0495683_0002325 | 3300047323 | Bacteria | 11552 |
| 408 | Ga0495683_0008814 | 3300047323 | Bacteria | 5380 |
| 409 | Ga0495687_002875 | 3300047443 | Bacteria | 13164 |
| 410 | Ga0495675_0089390 | 3300047444 | Bacteria | 1933 |
| 411 | Ga0495679_000201 | 3300047446 | Bacteria | 52238 |
| 412 | Ga0495679_001565 | 3300047446 | Bacteria | 12893 |
| 413 | Ga0495679_005895 | 3300047446 | Bacteria | 5372 |
| 414 | Ga0495673_0001419 | 3300047469 | Bacteria | 19200 |
| 415 | Ga0495673_0005023 | 3300047469 | Bacteria | 8111 |
| 416 | Ga0495673_0007531 | 3300047469 | Bacteria | 6236 |
| 417 | Ga0495673_0007953 | 3300047469 | Bacteria | 6018 |
| 418 | Ga0495673_0009573 | 3300047469 | Bacteria | 5357 |
| 419 | Ga0495673_0018214 | 3300047469 | Bacteria | 3547 |
| 420 | Ga0495673_0038092 | 3300047469 | Bacteria | 2190 |
| 421 | Ga0495681_0004244 | 3300047470 | Bacteria | 9830 |
| 422 | Ga0495681_0010903 | 3300047470 | Bacteria | 5464 |
| 423 | Ga0495681_0010949 | 3300047470 | Bacteria | 5446 |
| 424 | Ga0495681_0022929 | 3300047470 | Bacteria | 3329 |
| 425 | Ga0495593_0033886 | 3300047673 | Bacteria | 2779 |
| 426 | Ga0495626_0000013 | 3300048091 | Bacteria | 248164 |
| 427 | Ga0495626_0005893 | 3300048091 | Bacteria | 7055 |
| 428 | Ga0495626_0008809 | 3300048091 | Bacteria | 5488 |
| 429 | Ga0495626_0009178 | 3300048091 | Bacteria | 5356 |
| 430 | Ga0496102_0024500 | 3300048905 | Bacteria | 5366 |
| 431 | Ga0496110_0015985 | 3300048913 | Bacteria | 6258 |
| 432 | Ga0496116_0000999 | 3300048919 | Bacteria | 34585 |
| 433 | Ga0496116_0010595 | 3300048919 | Bacteria | 7709 |
| 434 | Ga0496117_0008521 | 3300048920 | Bacteria | 9725 |
| 435 | Ga0496117_0008597 | 3300048920 | Bacteria | 9674 |
| 436 | Ga0496117_0031427 | 3300048920 | Bacteria | 4052 |
| 437 | Ga0496118_0012702 | 3300048921 | Bacteria | 8054 |
| 438 | Ga0496118_0022600 | 3300048921 | Bacteria | 5491 |
| 439 | Ga0496118_0024693 | 3300048921 | Bacteria | 5178 |
| 440 | Ga0496118_0029162 | 3300048921 | Bacteria | 4633 |
| 441 | Ga0496119_0000100 | 3300048922 | Bacteria | 125646 |
| 442 | Ga0496119_0015180 | 3300048922 | Bacteria | 5959 |
| 443 | Ga0496120_0003060 | 3300048923 | Bacteria | 15783 |
| 444 | Ga0496120_0015127 | 3300048923 | Bacteria | 5103 |
| 445 | Ga0496121_0000306 | 3300048924 | Bacteria | 102245 |
| 446 | Ga0496121_0001448 | 3300048924 | Bacteria | 40036 |
| 447 | Ga0496121_0021757 | 3300048924 | Bacteria | 6265 |
| 448 | Ga0496121_0027161 | 3300048924 | Bacteria | 5364 |
| 449 | Ga0496121_0147018 | 3300048924 | Bacteria | 1740 |
| 450 | Ga0496122_0002016 | 3300048925 | Bacteria | 30178 |
| 451 | Ga0496122_0020102 | 3300048925 | Bacteria | 6061 |
| 452 | Ga0496122_0025123 | 3300048925 | Bacteria | 5188 |
| 453 | Ga0496122_0052167 | 3300048925 | Bacteria | 3099 |
| 454 | Ga0496123_0003192 | 3300048926 | Bacteria | 18708 |
| 455 | Ga0496123_0013088 | 3300048926 | Bacteria | 7000 |
| 456 | Ga0496123_0014821 | 3300048926 | Bacteria | 6435 |
| 457 | Ga0496123_0045581 | 3300048926 | Bacteria | 2985 |
| 458 | Ga0496124_0000051 | 3300048927 | Bacteria | 255802 |
| 459 | Ga0496124_0010670 | 3300048927 | Bacteria | 9269 |
| 460 | Ga0496124_0011323 | 3300048927 | Bacteria | 8923 |
| 461 | Ga0496124_0011430 | 3300048927 | Bacteria | 8876 |
| 462 | Ga0496124_0032044 | 3300048927 | Bacteria | 4648 |
| 463 | Ga0496124_0086432 | 3300048927 | Bacteria | 2566 |
| 464 | Ga0496124_0139530 | 3300048927 | Bacteria | 1914 |
| 465 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 466 | Ga0496125_0008140 | 3300048928 | Bacteria | 11037 |
| 467 | Ga0496125_0011261 | 3300048928 | Bacteria | 8964 |
| 468 | Ga0496125_0025346 | 3300048928 | Bacteria | 5432 |
| 469 | Ga0496126_0076258 | 3300048929 | Bacteria | 2974 |
| 470 | Ga0496126_0139222 | 3300048929 | Bacteria | 2091 |
| 471 | Ga0495678_000063 | 3300049459 | Bacteria | 140183 |
| 472 | Ga0495678_001727 | 3300049459 | Bacteria | 16299 |
| 473 | Ga0495678_004140 | 3300049459 | Bacteria | 8567 |
| 474 | Ga0495678_021772 | 3300049459 | Bacteria | 2816 |
| 475 | Ga0495678_028054 | 3300049459 | Bacteria | 2380 |
| 476 | Ga0495682_0001146 | 3300049460 | Bacteria | 15282 |
| 477 | Ga0495682_0002077 | 3300049460 | Bacteria | 9780 |
| 478 | Ga0501034_0000020 | 3300049571 | Bacteria | 280294 |
| 479 | Ga0501036_0118878 | 3300049572 | Bacteria | 2231 |
| 480 | Ga0501039_0062745 | 3300049575 | Bacteria | 2879 |
| 481 | Ga0501040_0025222 | 3300049576 | Bacteria | 3997 |
| 482 | Ga0501041_0044449 | 3300049577 | Bacteria | 2700 |
| 483 | Ga0501043_0135270 | 3300049579 | Bacteria | 1931 |
| 484 | nmdc:mga00v17_24591_c1 | 3300050491 | Bacteria | 3495 |
| 485 | nmdc:mga00v17_38170_c1 | 3300050491 | Bacteria | 2871 |
| 486 | nmdc:mga05p37_46657_c1 | 3300050507 | Bacteria | 5327 |
| 487 | nmdc:mga0qj67_7508_c1 | 3300050509 | Bacteria | 8054 |
| 488 | nmdc:mga06r32_944_c1 | 3300050510 | Bacteria | 25862 |
| 489 | Ga0500659_0027160 | 3300053135 | Bacteria | 3121 |
| 490 | 2511257395 | 2511231004 | Bacteria | 6669789 |
| 491 | 2511268764 | 2511231006 | Bacteria | 6794709 |
| 492 | 2511270789 | 2511231007 | Bacteria | 6306603 |
| 493 | 2511277027 | 2511231008 | Bacteria | 6624100 |
| 494 | 2511291513 | 2511231010 | Bacteria | 6373152 |
| 495 | 2511296164 | 2511231011 | Bacteria | 6149768 |
| 496 | 2511301357 | 2511231012 | Bacteria | 6738011 |
| 497 | 2511311923 | 2511231014 | Bacteria | 6462302 |
| 498 | 2511318301 | 2511231015 | Bacteria | 6598026 |
| 499 | 2511323543 | 2511231016 | Bacteria | 6704427 |
| 500 | 2511333864 | 2511231017 | Bacteria | 6503007 |
| 501 | 2511337181 | 2511231018 | Bacteria | 6436256 |
| 502 | 2511346132 | 2511231019 | Bacteria | 6520662 |
| 503 | 2511352557 | 2511231020 | Bacteria | 6115223 |
| 504 | 2511355014 | 2511231021 | Bacteria | 7302637 |
| 505 | 2511364011 | 2511231022 | Bacteria | 6719296 |
| 506 | 2511370155 | 2511231023 | Bacteria | 6808468 |
| 507 | 2511375211 | 2511231024 | Bacteria | 5835885 |
| 508 | 2511826715 | 2511231156 | Bacteria | 6845832 |
| 509 | 2512328297 | 2512047018 | Bacteria | 6663241 |
| 510 | 2548849289 | 2547132512 | Bacteria | 3416496 |
| 511 | 2554813456 | 2554235132 | Bacteria | 6772433 |
| 512 | 2555246851 | 2554235231 | Bacteria | 5215788 |
| 513 | 2555668027 | 2554235341 | Bacteria | 6867980 |
| 514 | 2583790470 | 2582580891 | Bacteria | 6800976 |
| 515 | 2597856243 | 2597489887 | Bacteria | 6666321 |
| 516 | 2597862322 | 2597489888 | Bacteria | 6179543 |
| 517 | 2597868041 | 2597489889 | Bacteria | 6297495 |
| 518 | 2599328198 | 2599185155 | Bacteria | 5827168 |
| 519 | 2599355027 | 2599185160 | Bacteria | 6844013 |
| 520 | 2599361149 | 2599185161 | Bacteria | 6960462 |
| 521 | 2599367471 | 2599185162 | Bacteria | 6957254 |
| 522 | 2599374261 | 2599185163 | Bacteria | 6995158 |
| 523 | 2599380133 | 2599185164 | Bacteria | 6841688 |
| 524 | 2599386580 | 2599185165 | Bacteria | 6843250 |
| 525 | 2599393119 | 2599185166 | Bacteria | 6959206 |
| 526 | 2599397072 | 2599185167 | Bacteria | 6353609 |
| 527 | 2599404886 | 2599185168 | Bacteria | 6997636 |
| 528 | 2599449065 | 2599185179 | Bacteria | 6611171 |
| 529 | 2599461861 | 2599185181 | Bacteria | 6844519 |
| 530 | 2599467096 | 2599185182 | Bacteria | 6883168 |
| 531 | 2599483501 | 2599185185 | Bacteria | 6652270 |
| 532 | 2599491046 | 2599185186 | Bacteria | 6831633 |
| 533 | 2599502934 | 2599185188 | Bacteria | 6164180 |
| 534 | 2599508817 | 2599185189 | Bacteria | 5862825 |
| 535 | 2599511191 | 2599185190 | Bacteria | 6285678 |
| 536 | 2599519318 | 2599185191 | Bacteria | 6297582 |
| 537 | 2599616761 | 2599185212 | Bacteria | 6765997 |
| 538 | 2599771236 | 2599185248 | Bacteria | 6696816 |
| 539 | 2599805407 | 2599185257 | Bacteria | 6492581 |
| 540 | 2599879638 | 2599185288 | Bacteria | 6666191 |
| 541 | 2599885992 | 2599185289 | Bacteria | 6778765 |
| 542 | 2599890565 | 2599185290 | Bacteria | 6289611 |
| 543 | 2599897706 | 2599185291 | Bacteria | 6775623 |
| 544 | 2599930038 | 2599185300 | Bacteria | 6062622 |
| 545 | 2599945432 | 2599185302 | Bacteria | 5954930 |
| 546 | 2599948137 | 2599185303 | Bacteria | 6512725 |
| 547 | 2599955704 | 2599185304 | Bacteria | 5951361 |
| 548 | 2599961074 | 2599185305 | Bacteria | 6748700 |
| 549 | 2599967238 | 2599185306 | Bacteria | 6637356 |
| 550 | 2599975505 | 2599185307 | Bacteria | 6194719 |
| 551 | 2599980365 | 2599185308 | Bacteria | 6621546 |
| 552 | 2599985816 | 2599185309 | Bacteria | 5969593 |
| 553 | 2599990710 | 2599185310 | Bacteria | 6014457 |
| 554 | 2599996032 | 2599185311 | Bacteria | 6354990 |
| 555 | 2600001904 | 2599185312 | Bacteria | 5912071 |
| 556 | 2600005628 | 2599185313 | Bacteria | 6658188 |
| 557 | 2600014192 | 2599185314 | Bacteria | 6621749 |
| 558 | 2600019126 | 2599185315 | Bacteria | 6771107 |
| 559 | 2600025602 | 2599185316 | Bacteria | 6320029 |
| 560 | 2600027783 | 2599185317 | Bacteria | 6435722 |
| 561 | 2600033501 | 2599185318 | Bacteria | 6961590 |
| 562 | 2600040213 | 2599185319 | Bacteria | 6637840 |
| 563 | 2600049415 | 2599185320 | Bacteria | 5963263 |
| 564 | 2600056694 | 2599185321 | Bacteria | 6764560 |
| 565 | 2600059181 | 2599185322 | Bacteria | 6763055 |
| 566 | 2600064303 | 2599185323 | Bacteria | 6688755 |
| 567 | 2600074712 | 2599185324 | Bacteria | 6590677 |
| 568 | 2600077249 | 2599185325 | Bacteria | 6324919 |
| 569 | 2600214483 | 2599185356 | Bacteria | 6843884 |
| 570 | 2600356950 | 2600254930 | Bacteria | 6431253 |
| 571 | 2600364113 | 2600254931 | Bacteria | 6734225 |
| 572 | 2600442521 | 2600254954 | Bacteria | 5100516 |
| 573 | 2601625982 | 2600255283 | Bacteria | 6061572 |
| 574 | 2601690907 | 2600255296 | Bacteria | 5784754 |
| 575 | 2601774812 | 2600255313 | Bacteria | 6842543 |
| 576 | 2601800060 | 2600255318 | Bacteria | 6383414 |
| 577 | 2602012465 | 2600255389 | Bacteria | 5275336 |
| 578 | 2606074676 | 2603880185 | Bacteria | 6379190 |
| 579 | 2606127539 | 2603880199 | Bacteria | 6377649 |
| 580 | 2608381371 | 2606217733 | Bacteria | 6360972 |
| 581 | 2621301553 | 2619619299 | Bacteria | 6649820 |
| 582 | 2624478807 | 2623620443 | Bacteria | 6427864 |
| 583 | 2624494145 | 2623620446 | Bacteria | 6500345 |
| 584 | 2643844236 | 2643221565 | Bacteria | 6216018 |
| 585 | 2643868907 | 2643221571 | Bacteria | 6228673 |
| 586 | 2643952324 | 2643221589 | Bacteria | 6250934 |
| 587 | 2644023913 | 2643221602 | Bacteria | 6249926 |
| 588 | 2644188319 | 2643221633 | Bacteria | 6733554 |
| 589 | 2644282459 | 2643221650 | Bacteria | 7029547 |
| 590 | 2644623998 | 2643221713 | Bacteria | 6554480 |
| 591 | 2652547727 | 2651869719 | Bacteria | 6047974 |
| 592 | 2671089801 | 2667528170 | Bacteria | 6786960 |
| 593 | 2671097628 | 2667528171 | Bacteria | 6900659 |
| 594 | 2671125569 | 2667528176 | Bacteria | 6724917 |
| 595 | 2671767857 | 2671180172 | Bacteria | 6495783 |
| 596 | 2677898738 | 2675903420 | Bacteria | 6247433 |
| 597 | 2678265080 | 2675903515 | Bacteria | 6580491 |
| 598 | 2715750828 | 2713897148 | Bacteria | 5883533 |
| 599 | 2715757524 | 2713897149 | Bacteria | 6506249 |
| 600 | 2718632692 | 2718217725 | Bacteria | 5758958 |
| 601 | 2723247211 | 2721755607 | Bacteria | 5841722 |
| 602 | 2729147813 | 2728369097 | Bacteria | 4333476 |
| 603 | 2738673773 | 2738541265 | Bacteria | 6594665 |
| 604 | 2738689492 | 2738541271 | Bacteria | 5657310 |
| 605 | 2738752166 | 2738541282 | Bacteria | 6593925 |
| 606 | 2738809096 | 2738541294 | Bacteria | 6925949 |
| 607 | 2738861207 | 2738541303 | Bacteria | 6591772 |
| 608 | 2738896456 | 2738541309 | Bacteria | 6926455 |
| 609 | 2739256884 | 2738543015 | Bacteria | 6750701 |
| 610 | 2739265266 | 2738543016 | Bacteria | 5657564 |
| 611 | 2739286719 | 2738543020 | Bacteria | 5718238 |
| 612 | 2739292032 | 2738543021 | Bacteria | 5718241 |
| 613 | 2739316410 | 2738543025 | Bacteria | 6600348 |
| 614 | 2743735652 | 2740892503 | Bacteria | 6855563 |
| 615 | 2745005537 | 2744054620 | Bacteria | 6551379 |
| 616 | 2765582159 | 2765235841 | Bacteria | 6137024 |
| 617 | 2774122151 | 2773857670 | Bacteria | 6407454 |
| 618 | 2774136717 | 2773857673 | Bacteria | 6513460 |
| 619 | 2784260468 | 2784132063 | Bacteria | 6262788 |
| 620 | 2784314396 | 2784132072 | Bacteria | 6596533 |
| 621 | 2794595614 | 2791355520 | Bacteria | 5948615 |
| 622 | 2807409980 | 2806310737 | Bacteria | 5751088 |
| 623 | 2807458327 | 2806310745 | Bacteria | 5742165 |
| 624 | 2808858601 | 2808606361 | Bacteria | 6136259 |
| 625 | 2808905059 | 2808606373 | Bacteria | 4423627 |
| 626 | 2808921893 | 2808606376 | Bacteria | 6248667 |
| 627 | 2808928768 | 2808606377 | Bacteria | 6646337 |
| 628 | 2808938774 | 2808606378 | Bacteria | 6177535 |
| 629 | 2808941075 | 2808606379 | Bacteria | 5022697 |
| 630 | 2808944014 | 2808606380 | Bacteria | 6248705 |
| 631 | 2808950889 | 2808606381 | Bacteria | 6646461 |
| 632 | 2808960437 | 2808606382 | Bacteria | 6841132 |
| 633 | 2808967090 | 2808606383 | Bacteria | 6138645 |
| 634 | 2808975235 | 2808606385 | Bacteria | 6711065 |
| 635 | 2808991126 | 2808606388 | Bacteria | 6706662 |
| 636 | 2809001916 | 2808606389 | Bacteria | 6138126 |
| 637 | 2809215745 | 2808606445 | Bacteria | 6057339 |
| 638 | 2812370832 | 2811994881 | Bacteria | 6298475 |
| 639 | 2817489091 | 2816332298 | Bacteria | 6852809 |
| 640 | 2819658362 | 2818991456 | Bacteria | 6123676 |
| 641 | 2819702711 | 2818991464 | Bacteria | 6907494 |
| 642 | 2823422481 | 2823421272 | Bacteria | 5372474 |
| 643 | 2825656023 | 2825651385 | Bacteria | 6715909 |
| 644 | 2826584006 | 2826581358 | Bacteria | 5963467 |
| 645 | 2834028996 | 2834028612 | Bacteria | 6354979 |
| 646 | 2842809306 | 2842805378 | Bacteria | 5385175 |
| 647 | 2842819485 | 2842815866 | Bacteria | 5947510 |
| 648 | 2842828713 | 2842826826 | Bacteria | 5974129 |
| 649 | 2842835725 | 2842832357 | Bacteria | 5959113 |
| 650 | 2842843224 | 2842837860 | Bacteria | 6066181 |
| 651 | 2842847472 | 2842843487 | Bacteria | 6004777 |
| 652 | 2842849819 | 2842849001 | Bacteria | 5924277 |
| 653 | 2842856427 | 2842854478 | Bacteria | 6143501 |
| 654 | 2844668529 | 2844665904 | Bacteria | 6817974 |
| 655 | 2852615519 | 2852612431 | Bacteria | 6885235 |
| 656 | 2852662837 | 2852657418 | Bacteria | 6472974 |
| 657 | 2852670487 | 2852667396 | Bacteria | 6885555 |
| 658 | 2860340650 | 2860339153 | Bacteria | 6846989 |
| 659 | 2860869025 | 2860867994 | Bacteria | 5645326 |
| 660 | 2878030771 | 2878029506 | Bacteria | 6418441 |
| 661 | 2880231683 | 2880230671 | Bacteria | 6140320 |
| 662 | 2887633251 | 2887630918 | Bacteria | 3239855 |
| 663 | 2904481903 | 2904479285 | Bacteria | 5073931 |
| 664 | 2904520718 | 2904518522 | Bacteria | 6068986 |
| 665 | 2904551103 | 2904550169 | Bacteria | 6221258 |
| 666 | 2908447818 | 2908446538 | Bacteria | 6829095 |
| 667 | 2912964800 | 2912963787 | Bacteria | 5646108 |
| 668 | 2913041690 | 2913036834 | Bacteria | 6704877 |
| 669 | 2916180849 | 2916178963 | Bacteria | 5265078 |
| 670 | 2917071789 | 2917070673 | Bacteria | 6868303 |
| 671 | 2919067279 | 2919063839 | Bacteria | 6302690 |
| 672 | 2919157952 | 2919155634 | Bacteria | 4860545 |
| 673 | 2919385821 | 2919385768 | Bacteria | 5897293 |
| 674 | 2919458360 | 2919456309 | Bacteria | 6586567 |
| 675 | 2919484628 | 2919481497 | Bacteria | 6907839 |
| 676 | 2919492801 | 2919487758 | Bacteria | 5929766 |
| 677 | 2919498757 | 2919497567 | Bacteria | 4408621 |
| 678 | 2919505112 | 2919501602 | Bacteria | 5286340 |
| 679 | 2919699938 | 2919697872 | Bacteria | 6553725 |
| 680 | 2923154660 | 2923153595 | Bacteria | 6870622 |
| 681 | 2923524937 | 2923519811 | Bacteria | 6298479 |
| 682 | 2923590338 | 2923586266 | Bacteria | 6565975 |
| 683 | 2926066789 | 2926063275 | Bacteria | 5285848 |
| 684 | 2929149012 | 2929144301 | Bacteria | 6622272 |
| 685 | 2929191022 | 2929189879 | Bacteria | 5930554 |
| 686 | 2931373567 | 2931369376 | Bacteria | 6847892 |
| 687 | 2931392027 | 2931390751 | Bacteria | 6273349 |
| 688 | 2931399448 | 2931396565 | Bacteria | 7251677 |
| 689 | 2935353962 | 2935353572 | Unclassified | 6955622 |
| 690 | 2939638131 | 2939636861 | Bacteria | 6297853 |
| 691 | 2939652301 | 2939651529 | Bacteria | 5895393 |
| 692 | 2941481953 | |||
| 693 | 2945929558 | 2945928738 | Bacteria | 6053221 |
| 694 | 2945961252 | 2945961074 | Bacteria | 7342064 |
| 695 | 2946011838 | 2946006987 | Bacteria | 6705746 |
| 696 | 2946029271 | 2946027586 | Bacteria | 6049274 |
| 697 | 2947235819 | 2947233263 | Bacteria | 6439278 |
| 698 | 2969305593 | 2969304461 | Bacteria | 6601805 |
| 699 | 2974292776 | 2974289157 | Bacteria | 6080362 |
| 700 | 2984291369 | 2984286254 | Bacteria | 6702062 |
| 701 | 2988730609 | 2988728565 | Bacteria | 6124362 |
| 702 | 2990200681 | 2990196909 | Bacteria | 4054280 |
| 703 | 2998141035 | 2998139840 | Bacteria | 6073514 |
| 704 | 3007253800 | 3007252601 | Bacteria | 4559114 |
| 705 | 3007317460 | 3007315729 | Bacteria | 5076637 |
| 706 | 3007400191 | 3007395558 | Bacteria | 6755444 |
| 707 | 3007420674 | 3007419365 | Bacteria | 7026924 |
| 708 | 3007516345 | 3007511990 | Bacteria | 6481491 |
| 709 | 3007618778 | 3007614139 | Bacteria | 6053559 |
| 710 | 3007622083 | 3007619802 | Bacteria | 6411688 |
| 711 | 3007719283 | 3007718800 | Bacteria | 5971527 |
| 712 | 3007860920 | 3007855910 | Bacteria | 5637581 |
| 713 | 3007863742 | 3007861166 | Bacteria | 6045338 |
| 714 | 3007867643 | 3007866637 | Bacteria | 5899198 |
| 715 | 3007872733 | 3007872151 | Bacteria | 5268868 |
| 716 | 637318406 | 637000220 | Bacteria | 7074893 |
| 717 | 640489002 | 640427133 | Bacteria | 4567418 |
| 718 | 651177092 | 651053060 | Bacteria | 4689946 |
| 719 | 8011353540 | 8011350971 | Bacteria | 6158957 |
| 720 | 8015688896 | 8015687852 | Bacteria | 6613826 |
| 721 | 8019773275 | 8019769354 | Bacteria | 6924660 |
| 722 | 8019776604 | 8019775933 | Bacteria | 6858656 |
| 723 | 8029999727 | 8029995093 | Bacteria | 5990776 |
| 724 | 8034964232 | 8034962539 | Bacteria | 4884839 |
| 725 | 8048749786 | 8048746797 | Bacteria | 3557226 |
| 726 | 8052498952 | 8052494512 | Bacteria | 5765634 |
| 727 | 8054286222 | 8054285046 | Bacteria | 6919322 |
| 728 | 8054352561 | 8054347763 | Bacteria | 5901107 |
| 729 | 8054359160 | 8054357960 | Bacteria | 2867777 |
| 730 | 8054504605 | 8054503363 | Bacteria | 6101651 |
| 731 | 8054934447 | 8054929484 | Bacteria | 5599761 |
| 732 | 8055772014 | 8055770955 | Bacteria | 6827675 |
| 733 | 8055819047 | 8055817908 | Bacteria | 6609162 |
| 734 | 8055883350 | 8055878733 | Bacteria | 5907058 |
| 735 | 8056120338 | 8056115690 | Bacteria | 5527654 |
| 736 | 8056121828 | 8056120720 | Bacteria | 5758328 |
| 737 | 8056127080 | 8056125926 | Bacteria | 6228218 |
| 738 | 8056132916 | 8056131705 | Bacteria | 6107031 |
| 739 | 8056141952 | 8056137416 | Bacteria | 6147080 |
| 740 | 8056144382 | 8056143049 | Bacteria | 6307666 |
| 741 | 8056149132 | 8056148874 | Bacteria | 6479865 |
| 742 | 8056155605 | 8056155041 | Bacteria | 6486948 |
| 743 | 8056161209 | 8056161164 | Bacteria | 6106669 |
| 744 | 8056170016 | 8056166840 | Bacteria | 5820959 |
| 745 | 8056176149 | 8056172158 | Bacteria | 6133900 |
| 746 | 8056180579 | 8056177738 | Bacteria | 6748268 |
| 747 | 8056569685 | 8056569372 | Bacteria | 5997322 |
| 748 | 8057803303 | 8057798959 | Bacteria | 6713499 |
| 749 | Ga0495672_0015572 | |||
| 750 | MRS2a_Contig_171 | |||
| 751 | JGI25162J39368_1000101 | |||
| 752 | JGI25162J39368_1000200 | |||
| 753 | JGI25163J39215_1001257 | |||
| 754 | JGI25163J39215_1001263 | |||
| 755 | JGI25164J39214_1000097 | |||
| 756 | JGI25164J39214_1000162 | |||
| 757 | JGI25165J46597_1000184 | |||
| 758 | JGI25165J46597_1000294 | |||
| 759 | Ga0055538_1000029 | |||
| 760 | Ga0055539_1000039 | |||
| 761 | Ga0055533_1000049 | |||
| 762 | Ga0055532_1000049 | |||
| 763 | Ga0055525_1000077 | |||
| 764 | Ga0055536_1000062 | |||
| 765 | Ga0055536_1002715 | |||
| 766 | Ga0055536_1002887 | |||
| 767 | Ga0055530_10000489 | |||
| 768 | Ga0055530_10003343 | |||
| 769 | Ga0055530_10003378 | |||
| 770 | Ga0055540_1001086 | |||
| 771 | Ga0055540_1002667 | |||
| 772 | Ga0055540_1002708 | |||
| 773 | Ga0055531_10001423 | |||
| 774 | Ga0055541_1000026 | |||
| 775 | Ga0065714_10000532 | |||
| 776 | Ga0065714_10004098 | |||
| 777 | Ga0065714_10019409 | |||
| 778 | Ga0065714_10025493 | |||
| 779 | Ga0065714_10069308 | |||
| 780 | Ga0065714_10095901 | |||
| 781 | Ga0065714_10099438 | |||
| 782 | Ga0065704_10079021 | |||
| 783 | Ga0065704_10101051 | |||
| 784 | Ga0065712_10000436 | |||
| 785 | Ga0065712_10000741 | |||
| 786 | Ga0065712_10067897 | |||
| 787 | Ga0065715_10090306 | |||
| 788 | Ga0070661_100000541 | |||
| 789 | Ga0070661_100166088 | |||
| 790 | Ga0070669_100000292 | |||
| 791 | Ga0070669_100053265 | |||
| 792 | Ga0070714_100001758 | |||
| 793 | Ga0070662_100000560 | |||
| 794 | Ga0068853_100045050 | |||
| 795 | Ga0070704_100020015 | |||
| 796 | Ga0068855_100000537 | |||
| 797 | Ga0070664_100000977 | |||
| 798 | Ga0068857_100129005 | |||
| 799 | Ga0068854_100067271 | |||
| 800 | Ga0068851_10000006 | |||
| 801 | Ga0075364_10000144 | |||
| 802 | Ga0075432_10005444 | |||
| 803 | Ga0075370_10001507 | |||
| 804 | Ga0075428_100010658 | |||
| 805 | Ga0075431_100031620 | |||
| 806 | Ga0075434_100166533 | |||
| 807 | Ga0075429_100000080 | |||
| 808 | Ga0099823_1008670 | |||
| 809 | Ga0079104_1000168 | |||
| 810 | Ga0079104_1001462 | |||
| 811 | Ga0099826_10010925 | |||
| 812 | Ga0105251_10000012 | |||
| 813 | Ga0105251_10000152 | |||
| 814 | Ga0105251_10024684 | |||
| 815 | Ga0105251_10033567 | |||
| 816 | Ga0105244_10000350 | |||
| 817 | Ga0105244_10011854 | |||
| 818 | Ga0105244_10025453 | |||
| 819 | Ga0105244_10029878 | |||
| 820 | Ga0105244_10031555 | |||
| 821 | Ga0105244_10041160 | |||
| 822 | Ga0105250_10002356 | |||
| 823 | Ga0105250_10005971 | |||
| 824 | Ga0105250_10006074 | |||
| 825 | Ga0105250_10010171 | |||
| 826 | Ga0105245_10024959 | |||
| 827 | Ga0114129_10004258 | |||
| 828 | Ga0105243_10001292 | |||
| 829 | Ga0105243_10001767 | |||
| 830 | Ga0105243_10018220 | |||
| 831 | Ga0105243_10192385 | |||
| 832 | Ga0105242_10000233 | |||
| 833 | Ga0105242_10008309 | |||
| 834 | Ga0105237_10019270 | |||
| 835 | Ga0105246_10000822 | |||
| 836 | Ga0105246_10006864 | |||
| 837 | Ga0105246_10008702 | |||
| 838 | Ga0157373_10018044 | |||
| 839 | Ga0157373_10026662 | |||
| 840 | Ga0157371_10000319 | |||
| 841 | Ga0157371_10017344 | |||
| 842 | Ga0157371_10017637 | |||
| 843 | Ga0157370_10000158 | |||
| 844 | Ga0157370_10049922 | |||
| 845 | Ga0163162_10004406 | |||
| 846 | Ga0157372_10000640 | |||
| 847 | Ga0182008_10006586 | |||
| 848 | Ga0182006_1005927 | |||
| 849 | Ga0182006_1007080 | |||
| 850 | Ga0182007_10005483 | |||
| 851 | Ga0182005_1002034 | |||
| 852 | Ga0163161_10020046 | |||
| 853 | Ga0209435_101620 | |||
| 854 | Ga0209760_100124 | |||
| 855 | Ga0209760_100657 | |||
| 856 | Ga0209784_100045 | |||
| 857 | Ga0209566_100057 | |||
| 858 | Ga0209674_100080 | |||
| 859 | Ga0209147_100079 | |||
| 860 | Ga0209563_100078 | |||
| 861 | Ga0209563_102018 | |||
| 862 | Ga0207427_100001 | |||
| 863 | Ga0207427_100004 | |||
| 864 | Ga0209437_100003 | |||
| 865 | Ga0209437_100028 | |||
| 866 | Ga0209258_100178 | |||
| 867 | Ga0209646_1000311 | |||
| 868 | Ga0209677_100045 | |||
| 869 | Ga0209233_1000007 | |||
| 870 | Ga0209233_1000008 | |||
| 871 | Ga0209676_1000056 | |||
| 872 | Ga0209676_1000078 | |||
| 873 | Ga0209676_1000101 | |||
| 874 | Ga0209676_1001261 | |||
| 875 | Ga0209676_1003065 | |||
| 876 | Ga0209676_1015895 | |||
| 877 | Ga0209050_1000027 | |||
| 878 | Ga0209050_1000041 | |||
| 879 | Ga0209050_1000181 | |||
| 880 | Ga0209050_1002328 | |||
| 881 | Ga0209051_1000061 | |||
| 882 | Ga0209051_1000065 | |||
| 883 | Ga0209051_1000085 | |||
| 884 | Ga0209051_1009606 | |||
| 885 | Ga0209257_1000105 | |||
| 886 | Ga0207656_10000017 | |||
| 887 | Ga0207696_1000032 | |||
| 888 | Ga0207696_1000112 | |||
| 889 | Ga0207696_1000121 | |||
| 890 | Ga0207696_1000129 | |||
| 891 | Ga0207696_1002970 | |||
| 892 | Ga0207696_1006453 | |||
| 893 | Ga0207696_1006880 | |||
| 894 | Ga0207696_1011992 | |||
| 895 | Ga0207655_1000005 | |||
| 896 | Ga0207655_1000015 | |||
| 897 | Ga0207655_1000086 | |||
| 898 | Ga0207655_1000515 | |||
| 899 | Ga0207655_1001621 | |||
| 900 | Ga0207655_1003475 | |||
| 901 | Ga0207655_1004133 | |||
| 902 | Ga0207655_1004813 | |||
| 903 | Ga0207655_1011672 | |||
| 904 | Ga0207655_1014486 | |||
| 905 | Ga0207655_1015673 | |||
| 906 | Ga0207655_1021057 | |||
| 907 | Ga0207655_1024608 | |||
| 908 | Ga0207655_1027042 | |||
| 909 | Ga0207655_1027119 | |||
| 910 | Ga0207713_1000068 | |||
| 911 | Ga0207713_1000080 | |||
| 912 | Ga0207713_1000356 | |||
| 913 | Ga0207713_1003328 | |||
| 914 | Ga0207713_1003358 | |||
| 915 | Ga0207713_1003950 | |||
| 916 | Ga0207713_1005319 | |||
| 917 | Ga0207713_1008999 | |||
| 918 | Ga0207713_1018211 | |||
| 919 | Ga0207713_1020703 | |||
| 920 | Ga0207671_10000019 | |||
| 921 | Ga0207649_10000004 | |||
| 922 | Ga0207681_10000275 | |||
| 923 | Ga0207681_10008090 | |||
| 924 | Ga0207650_10000668 | |||
| 925 | Ga0207687_10028060 | |||
| 926 | Ga0207664_10016070 | |||
| 927 | Ga0207706_10001474 | |||
| 928 | Ga0207706_10021457 | |||
| 929 | Ga0207686_10000569 | |||
| 930 | Ga0207686_10015911 | |||
| 931 | Ga0207709_10000067 | |||
| 932 | Ga0207709_10003359 | |||
| 933 | Ga0207709_10009315 | |||
| 934 | Ga0207709_10017682 | |||
| 935 | Ga0207679_10000019 | |||
| 936 | Ga0207667_10000910 | |||
| 937 | Ga0207640_10105056 | |||
| 938 | Ga0207639_10004738 | |||
| 939 | Ga0209281_1000013 | |||
| 940 | Ga0209281_1000015 | |||
| 941 | Ga0209281_1001525 | |||
| 942 | Ga0209389_1000005 | |||
| 943 | Ga0209371_1000135 | |||
| 944 | Ga0209371_1000456 | |||
| 945 | Ga0209995_1001929 | |||
| 946 | Ga0209971_1000592 | |||
| 947 | Ga0209974_10011342 | |||
| 948 | Ga0268266_10019836 | |||
| 949 | Ga0265334_10000010 | |||
| 950 | Ga0268256_1000148 | |||
| 951 | Ga0268256_1000171 | |||
| 952 | Ga0314311_1074035 | |||
| 953 | Ga0316178_1042169 | |||
| 954 | Ga0265332_10000004 | |||
| 955 | Ga0265325_10024412 | |||
| 956 | Ga0265327_10000814 | |||
| 957 | Ga0265316_10041250 | |||
| 958 | Ga0265316_10066504 | |||
| 959 | Ga0307408_100000045 | |||
| 960 | Ga0265313_10000125 | |||
| 961 | Ga0307508_10066645 | |||
| 962 | Ga0316575_10011753 | |||
| 963 | Ga0307412_10002081 | |||
| 964 | Ga0307414_10026965 | |||
| 965 | Ga0307510_10035753 | |||
| 966 | Ga0307510_10086555 | |||
| 967 | Ga0373954_0000034 | |||
| 968 | Ga0373927_0000002 | |||
| 969 | Ga0373933_0001798 | |||
| 970 | Ga0373937_0000166 | |||
| 971 | Ga0316582_0072439 | |||
| 972 | Ga0237819_01965 | |||
| 973 | Ga0439438_002320 | |||
| 974 | Ga0439438_009244 | |||
| 975 | Ga0439447_005035 | |||
| 976 | Ga0439447_017623 | |||
| 977 | Ga0439466_0004327 | |||
| 978 | Ga0439466_0004696 | |||
| 979 | Ga0439466_0005581 | |||
| 980 | Ga0439432_001476 | |||
| 981 | Ga0439451_006736 | |||
| 982 | Ga0439452_001965 | |||
| 983 | Ga0439452_003737 | |||
| 984 | Ga0439456_000434 | |||
| 985 | Ga0439456_007779 | |||
| 986 | Ga0439463_000909 | |||
| 987 | Ga0450922_001509 | |||
| 988 | Ga0450902_000266 | |||
| 989 | Ga0450907_001504 | |||
| 990 | Ga0450908_004718 | |||
| 991 | Ga0450908_007654 | |||
| 992 | Ga0450909_006818 | |||
| 993 | Ga0439434_0004815 | |||
| 994 | Ga0439464_0000161 | |||
| 995 | Ga0439464_0000692 | |||
| 996 | Ga0453684_0000623 | |||
| 997 | Ga0453684_0003250 | |||
| 998 | Ga0453684_0021525 | |||
| 999 | Ga0451576_0039237 | |||
| 1000 | Ga0495617_003941 | |||
| 1001 | Ga0495627_000047 | |||
| 1002 | Ga0495627_004660 | |||
| 1003 | Ga0495627_005719 | |||
| 1004 | Ga0495591_000019 | |||
| 1005 | Ga0495591_000570 | |||
| 1006 | Ga0495591_001669 | |||
| 1007 | Ga0495591_003687 | |||
| 1008 | Ga0495591_004724 | |||
| 1009 | Ga0495591_005007 | |||
| 1010 | Ga0495591_005171 | |||
| 1011 | Ga0495638_0013887 | |||
| 1012 | Ga0495638_0016620 | |||
| 1013 | Ga0495638_0026089 | |||
| 1014 | Ga0495653_0010573 | |||
| 1015 | Ga0495653_0013322 | |||
| 1016 | Ga0495653_0142413 | |||
| 1017 | Ga0495650_0000346 | |||
| 1018 | Ga0495650_0006687 | |||
| 1019 | Ga0495650_0009667 | |||
| 1020 | Ga0495605_0000014 | |||
| 1021 | Ga0495605_0000030 | |||
| 1022 | Ga0495605_0000825 | |||
| 1023 | Ga0495605_0002824 | |||
| 1024 | Ga0495605_0007022 | |||
| 1025 | Ga0495605_0010932 | |||
| 1026 | Ga0495605_0011004 | |||
| 1027 | Ga0495605_0023895 | |||
| 1028 | Ga0495584_0002381 | |||
| 1029 | Ga0495584_0006396 | |||
| 1030 | Ga0495584_0008445 | |||
| 1031 | Ga0495584_0011503 | |||
| 1032 | Ga0495584_0051156 | |||
| 1033 | Ga0495585_0005212 | |||
| 1034 | Ga0495585_0008973 | |||
| 1035 | Ga0495585_0010614 | |||
| 1036 | Ga0495596_0003549 | |||
| 1037 | Ga0495596_0018288 | |||
| 1038 | Ga0495607_0002357 | |||
| 1039 | Ga0495607_0002577 | |||
| 1040 | Ga0495607_0004286 | |||
| 1041 | Ga0495607_0004407 | |||
| 1042 | Ga0495607_0005536 | |||
| 1043 | Ga0495607_0007923 | |||
| 1044 | Ga0495607_0009938 | |||
| 1045 | Ga0495607_0010517 | |||
| 1046 | Ga0495607_0011815 | |||
| 1047 | Ga0495607_0037919 | |||
| 1048 | Ga0495583_0000066 | |||
| 1049 | Ga0495583_0003486 | |||
| 1050 | Ga0495583_0004291 | |||
| 1051 | Ga0495583_0008243 | |||
| 1052 | Ga0495583_0009268 | |||
| 1053 | Ga0495606_0000441 | |||
| 1054 | Ga0495606_0002176 | |||
| 1055 | Ga0495606_0010656 | |||
| 1056 | Ga0495606_0014688 | |||
| 1057 | Ga0495606_0014788 | |||
| 1058 | Ga0495606_0018194 | |||
| 1059 | Ga0495606_0036974 | |||
| 1060 | Ga0495610_0008778 | |||
| 1061 | Ga0495610_0011769 | |||
| 1062 | Ga0495610_0013704 | |||
| 1063 | Ga0495610_0027749 | |||
| 1064 | Ga0495616_0019111 | |||
| 1065 | Ga0495616_0029828 | |||
| 1066 | Ga0495616_0037181 | |||
| 1067 | Ga0495616_0056811 | |||
| 1068 | Ga0495620_0000097 | |||
| 1069 | Ga0495620_0000432 | |||
| 1070 | Ga0495620_0001077 | |||
| 1071 | Ga0495620_0004402 | |||
| 1072 | Ga0495620_0006214 | |||
| 1073 | Ga0495620_0026136 | |||
| 1074 | Ga0495631_0003503 | |||
| 1075 | Ga0495631_0007864 | |||
| 1076 | Ga0495632_0005500 | |||
| 1077 | Ga0495632_0009068 | |||
| 1078 | Ga0495632_0010114 | |||
| 1079 | Ga0495632_0028042 | |||
| 1080 | Ga0495637_0000024 | |||
| 1081 | Ga0495637_0002603 | |||
| 1082 | Ga0495637_0007329 | |||
| 1083 | Ga0495637_0011984 | |||
| 1084 | Ga0495643_0000103 | |||
| 1085 | Ga0495643_0000296 | |||
| 1086 | Ga0495643_0001851 | |||
| 1087 | Ga0495643_0011836 | |||
| 1088 | Ga0495648_0006433 | |||
| 1089 | Ga0495648_0013621 | |||
| 1090 | Ga0495648_0014743 | |||
| 1091 | Ga0495648_0018371 | |||
| 1092 | Ga0495648_0019521 | |||
| 1093 | Ga0495648_0081683 | |||
| 1094 | Ga0495666_0024200 | |||
| 1095 | Ga0495654_0005159 | |||
| 1096 | Ga0495654_0010056 | |||
| 1097 | Ga0495654_0014033 | |||
| 1098 | Ga0495654_0017229 | |||
| 1099 | Ga0495654_0033897 | |||
| 1100 | Ga0495586_0029104 | |||
| 1101 | Ga0495587_0010157 | |||
| 1102 | Ga0495609_0000006 | |||
| 1103 | Ga0495609_0000024 | |||
| 1104 | Ga0495609_0000040 | |||
| 1105 | Ga0495609_0009316 | |||
| 1106 | Ga0495609_0012416 | |||
| 1107 | Ga0495609_0021644 | |||
| 1108 | Ga0495597_0000010 | |||
| 1109 | Ga0495597_0010956 | |||
| 1110 | Ga0495597_0015969 | |||
| 1111 | Ga0495622_0006245 | |||
| 1112 | Ga0495622_0007104 | |||
| 1113 | Ga0495633_0000030 | |||
| 1114 | Ga0495633_0009976 | |||
| 1115 | Ga0495668_0008053 | |||
| 1116 | Ga0495634_0013086 | |||
| 1117 | Ga0495611_0020876 | |||
| 1118 | Ga0495611_0025579 | |||
| 1119 | Ga0495625_0000111 | |||
| 1120 | Ga0495625_0062306 | |||
| 1121 | Ga0495661_0000015 | |||
| 1122 | Ga0495661_0000019 | |||
| 1123 | Ga0495661_0000034 | |||
| 1124 | Ga0495661_0000546 | |||
| 1125 | Ga0495661_0013768 | |||
| 1126 | Ga0495661_0013892 | |||
| 1127 | Ga0495657_0076365 | |||
| 1128 | Ga0495623_0020072 | |||
| 1129 | Ga0495670_0002238 | |||
| 1130 | Ga0495670_0022495 | |||
| 1131 | Ga0495671_0001897 | |||
| 1132 | Ga0495671_0002005 | |||
| 1133 | Ga0495671_0002854 | |||
| 1134 | Ga0495671_0005159 | |||
| 1135 | Ga0495671_0009970 | |||
| 1136 | Ga0495671_0029863 | |||
| 1137 | Ga0495649_0005160 | |||
| 1138 | Ga0495649_0009864 | |||
| 1139 | Ga0495649_0095028 | |||
| 1140 | Ga0495589_0007997 | |||
| 1141 | Ga0495589_0008320 | |||
| 1142 | Ga0495589_0014373 | |||
| 1143 | Ga0495589_0022624 | |||
| 1144 | Ga0495600_0059633 | |||
| 1145 | Ga0495660_0004564 | |||
| 1146 | Ga0495660_0010417 | |||
| 1147 | Ga0495660_0085775 | |||
| 1148 | Ga0495604_0020247 | |||
| 1149 | Ga0495672_0015135 | |||
| 1150 | Ga0495672_0043048 | |||
| 1151 | Ga0495676_0000010 | |||
| 1152 | Ga0495680_0062390 | |||
| 1153 | Ga0495683_0000056 | |||
| 1154 | Ga0495683_0000134 | |||
| 1155 | Ga0495683_0002325 | |||
| 1156 | Ga0495683_0008814 | |||
| 1157 | Ga0495687_002875 | |||
| 1158 | Ga0495675_0089390 | |||
| 1159 | Ga0495679_000201 | |||
| 1160 | Ga0495679_001565 | |||
| 1161 | Ga0495679_005895 | |||
| 1162 | Ga0495673_0001419 | |||
| 1163 | Ga0495673_0005023 | |||
| 1164 | Ga0495673_0007531 | |||
| 1165 | Ga0495673_0007953 | |||
| 1166 | Ga0495673_0009573 | |||
| 1167 | Ga0495673_0018214 | |||
| 1168 | Ga0495673_0038092 | |||
| 1169 | Ga0495681_0004244 | |||
| 1170 | Ga0495681_0010903 | |||
| 1171 | Ga0495681_0010949 | |||
| 1172 | Ga0495681_0022929 | |||
| 1173 | Ga0495593_0033886 | |||
| 1174 | Ga0495626_0000013 | |||
| 1175 | Ga0495626_0005893 | |||
| 1176 | Ga0495626_0008809 | |||
| 1177 | Ga0495626_0009178 | |||
| 1178 | Ga0496102_0024500 | |||
| 1179 | Ga0496110_0015985 | |||
| 1180 | Ga0496116_0000999 | |||
| 1181 | Ga0496116_0010595 | |||
| 1182 | Ga0496117_0008521 | |||
| 1183 | Ga0496117_0008597 | |||
| 1184 | Ga0496117_0031427 | |||
| 1185 | Ga0496118_0012702 | |||
| 1186 | Ga0496118_0022600 | |||
| 1187 | Ga0496118_0024693 | |||
| 1188 | Ga0496118_0029162 | |||
| 1189 | Ga0496119_0000100 | |||
| 1190 | Ga0496119_0015180 | |||
| 1191 | Ga0496120_0003060 | |||
| 1192 | Ga0496120_0015127 | |||
| 1193 | Ga0496121_0000306 | |||
| 1194 | Ga0496121_0001448 | |||
| 1195 | Ga0496121_0021757 | |||
| 1196 | Ga0496121_0027161 | |||
| 1197 | Ga0496121_0147018 | |||
| 1198 | Ga0496122_0002016 | |||
| 1199 | Ga0496122_0020102 | |||
| 1200 | Ga0496122_0025123 | |||
| 1201 | Ga0496122_0052167 | |||
| 1202 | Ga0496123_0003192 | |||
| 1203 | Ga0496123_0013088 | |||
| 1204 | Ga0496123_0014821 | |||
| 1205 | Ga0496123_0045581 | |||
| 1206 | Ga0496124_0000051 | |||
| 1207 | Ga0496124_0010670 | |||
| 1208 | Ga0496124_0011323 | |||
| 1209 | Ga0496124_0011430 | |||
| 1210 | Ga0496124_0032044 | |||
| 1211 | Ga0496124_0086432 | |||
| 1212 | Ga0496124_0139530 | |||
| 1213 | Ga0496125_0000011 | |||
| 1214 | Ga0496125_0008140 | |||
| 1215 | Ga0496125_0011261 | |||
| 1216 | Ga0496125_0025346 | |||
| 1217 | Ga0496126_0076258 | |||
| 1218 | Ga0496126_0139222 | |||
| 1219 | Ga0495678_000063 | |||
| 1220 | Ga0495678_001727 | |||
| 1221 | Ga0495678_004140 | |||
| 1222 | Ga0495678_021772 | |||
| 1223 | Ga0495678_028054 | |||
| 1224 | Ga0495682_0001146 | |||
| 1225 | Ga0495682_0002077 | |||
| 1226 | Ga0501034_0000020 | |||
| 1227 | Ga0501036_0118878 | |||
| 1228 | Ga0501039_0062745 | |||
| 1229 | Ga0501040_0025222 | |||
| 1230 | Ga0501041_0044449 | |||
| 1231 | Ga0501043_0135270 | |||
| 1232 | nmdc:mga00v17_24591_c1 | |||
| 1233 | nmdc:mga00v17_38170_c1 | |||
| 1234 | nmdc:mga05p37_46657_c1 | |||
| 1235 | nmdc:mga0qj67_7508_c1 | |||
| 1236 | nmdc:mga06r32_944_c1 | |||
| 1237 | Ga0500659_0027160 | |||
| 1238 | 2511257395 | |||
| 1239 | 2511268764 | |||
| 1240 | 2511270789 | |||
| 1241 | 2511277027 | |||
| 1242 | 2511291513 | |||
| 1243 | 2511296164 | |||
| 1244 | 2511301357 | |||
| 1245 | 2511311923 | |||
| 1246 | 2511318301 | |||
| 1247 | 2511323543 | |||
| 1248 | 2511333864 | |||
| 1249 | 2511337181 | |||
| 1250 | 2511346132 | |||
| 1251 | 2511352557 | |||
| 1252 | 2511355014 | |||
| 1253 | 2511364011 | |||
| 1254 | 2511370155 | |||
| 1255 | 2511375211 | |||
| 1256 | 2511826715 | |||
| 1257 | 2512328297 | |||
| 1258 | 2548849289 | |||
| 1259 | 2554813456 | |||
| 1260 | 2555246851 | |||
| 1261 | 2555668027 | |||
| 1262 | 2583790470 | |||
| 1263 | 2597856243 | |||
| 1264 | 2597862322 | |||
| 1265 | 2597868041 | |||
| 1266 | 2599328198 | |||
| 1267 | 2599355027 | |||
| 1268 | 2599361149 | |||
| 1269 | 2599367471 | |||
| 1270 | 2599374261 | |||
| 1271 | 2599380133 | |||
| 1272 | 2599386580 | |||
| 1273 | 2599393119 | |||
| 1274 | 2599397072 | |||
| 1275 | 2599404886 | |||
| 1276 | 2599449065 | |||
| 1277 | 2599461861 | |||
| 1278 | 2599467096 | |||
| 1279 | 2599483501 | |||
| 1280 | 2599491046 | |||
| 1281 | 2599502934 | |||
| 1282 | 2599508817 | |||
| 1283 | 2599511191 | |||
| 1284 | 2599519318 | |||
| 1285 | 2599616761 | |||
| 1286 | 2599771236 | |||
| 1287 | 2599805407 | |||
| 1288 | 2599879638 | |||
| 1289 | 2599885992 | |||
| 1290 | 2599890565 | |||
| 1291 | 2599897706 | |||
| 1292 | 2599930038 | |||
| 1293 | 2599945432 | |||
| 1294 | 2599948137 | |||
| 1295 | 2599955704 | |||
| 1296 | 2599961074 | |||
| 1297 | 2599967238 | |||
| 1298 | 2599975505 | |||
| 1299 | 2599980365 | |||
| 1300 | 2599985816 | |||
| 1301 | 2599990710 | |||
| 1302 | 2599996032 | |||
| 1303 | 2600001904 | |||
| 1304 | 2600005628 | |||
| 1305 | 2600014192 | |||
| 1306 | 2600019126 | |||
| 1307 | 2600025602 | |||
| 1308 | 2600027783 | |||
| 1309 | 2600033501 | |||
| 1310 | 2600040213 | |||
| 1311 | 2600049415 | |||
| 1312 | 2600056694 | |||
| 1313 | 2600059181 | |||
| 1314 | 2600064303 | |||
| 1315 | 2600074712 | |||
| 1316 | 2600077249 | |||
| 1317 | 2600214483 | |||
| 1318 | 2600356950 | |||
| 1319 | 2600364113 | |||
| 1320 | 2600442521 | |||
| 1321 | 2601625982 | |||
| 1322 | 2601690907 | |||
| 1323 | 2601774812 | |||
| 1324 | 2601800060 | |||
| 1325 | 2602012465 | |||
| 1326 | 2606074676 | |||
| 1327 | 2606127539 | |||
| 1328 | 2608381371 | |||
| 1329 | 2621301553 | |||
| 1330 | 2624478807 | |||
| 1331 | 2624494145 | |||
| 1332 | 2643844236 | |||
| 1333 | 2643868907 | |||
| 1334 | 2643952324 | |||
| 1335 | 2644023913 | |||
| 1336 | 2644188319 | |||
| 1337 | 2644282459 | |||
| 1338 | 2644623998 | |||
| 1339 | 2652547727 | |||
| 1340 | 2671089801 | |||
| 1341 | 2671097628 | |||
| 1342 | 2671125569 | |||
| 1343 | 2671767857 | |||
| 1344 | 2677898738 | |||
| 1345 | 2678265080 | |||
| 1346 | 2715750828 | |||
| 1347 | 2715757524 | |||
| 1348 | 2718632692 | |||
| 1349 | 2723247211 | |||
| 1350 | 2729147813 | |||
| 1351 | 2738673773 | |||
| 1352 | 2738689492 | |||
| 1353 | 2738752166 | |||
| 1354 | 2738809096 | |||
| 1355 | 2738861207 | |||
| 1356 | 2738896456 | |||
| 1357 | 2739256884 | |||
| 1358 | 2739265266 | |||
| 1359 | 2739286719 | |||
| 1360 | 2739292032 | |||
| 1361 | 2739316410 | |||
| 1362 | 2743735652 | |||
| 1363 | 2745005537 | |||
| 1364 | 2765582159 | |||
| 1365 | 2774122151 | |||
| 1366 | 2774136717 | |||
| 1367 | 2784260468 | |||
| 1368 | 2784314396 | |||
| 1369 | 2794595614 | |||
| 1370 | 2807409980 | |||
| 1371 | 2807458327 | |||
| 1372 | 2808858601 | |||
| 1373 | 2808905059 | |||
| 1374 | 2808921893 | |||
| 1375 | 2808928768 | |||
| 1376 | 2808938774 | |||
| 1377 | 2808941075 | |||
| 1378 | 2808944014 | |||
| 1379 | 2808950889 | |||
| 1380 | 2808960437 | |||
| 1381 | 2808967090 | |||
| 1382 | 2808975235 | |||
| 1383 | 2808991126 | |||
| 1384 | 2809001916 | |||
| 1385 | 2809215745 | |||
| 1386 | 2812370832 | |||
| 1387 | 2817489091 | |||
| 1388 | 2819658362 | |||
| 1389 | 2819702711 | |||
| 1390 | 2823422481 | |||
| 1391 | 2825656023 | |||
| 1392 | 2826584006 | |||
| 1393 | 2834028996 | |||
| 1394 | 2842809306 | |||
| 1395 | 2842819485 | |||
| 1396 | 2842828713 | |||
| 1397 | 2842835725 | |||
| 1398 | 2842843224 | |||
| 1399 | 2842847472 | |||
| 1400 | 2842849819 | |||
| 1401 | 2842856427 | |||
| 1402 | 2844668529 | |||
| 1403 | 2852615519 | |||
| 1404 | 2852662837 | |||
| 1405 | 2852670487 | |||
| 1406 | 2860340650 | |||
| 1407 | 2860869025 | |||
| 1408 | 2878030771 | |||
| 1409 | 2880231683 | |||
| 1410 | 2887633251 | |||
| 1411 | 2904481903 | |||
| 1412 | 2904520718 | |||
| 1413 | 2904551103 | |||
| 1414 | 2908447818 | |||
| 1415 | 2912964800 | |||
| 1416 | 2913041690 | |||
| 1417 | 2916180849 | |||
| 1418 | 2917071789 | |||
| 1419 | 2919067279 | |||
| 1420 | 2919157952 | |||
| 1421 | 2919385821 | |||
| 1422 | 2919458360 | |||
| 1423 | 2919484628 | |||
| 1424 | 2919492801 | |||
| 1425 | 2919498757 | |||
| 1426 | 2919505112 | |||
| 1427 | 2919699938 | |||
| 1428 | 2923154660 | |||
| 1429 | 2923524937 | |||
| 1430 | 2923590338 | |||
| 1431 | 2926066789 | |||
| 1432 | 2929149012 | |||
| 1433 | 2929191022 | |||
| 1434 | 2931373567 | |||
| 1435 | 2931392027 | |||
| 1436 | 2931399448 | |||
| 1437 | 2935353962 | |||
| 1438 | 2939638131 | |||
| 1439 | 2939652301 | |||
| 1440 | 2941481953 | |||
| 1441 | 2945929558 | |||
| 1442 | 2945961252 | |||
| 1443 | 2946011838 | |||
| 1444 | 2946029271 | |||
| 1445 | 2947235819 | |||
| 1446 | 2969305593 | |||
| 1447 | 2974292776 | |||
| 1448 | 2984291369 | |||
| 1449 | 2988730609 | |||
| 1450 | 2990200681 | |||
| 1451 | 2998141035 | |||
| 1452 | 3007253800 | |||
| 1453 | 3007317460 | |||
| 1454 | 3007400191 | |||
| 1455 | 3007420674 | |||
| 1456 | 3007516345 | |||
| 1457 | 3007618778 | |||
| 1458 | 3007622083 | |||
| 1459 | 3007719283 | |||
| 1460 | 3007860920 | |||
| 1461 | 3007863742 | |||
| 1462 | 3007867643 | |||
| 1463 | 3007872733 | |||
| 1464 | 637318406 | |||
| 1465 | 640489002 | |||
| 1466 | 651177092 | |||
| 1467 | 8011353540 | |||
| 1468 | 8015688896 | |||
| 1469 | 8019773275 | |||
| 1470 | 8019776604 | |||
| 1471 | 8029999727 | |||
| 1472 | 8034964232 | |||
| 1473 | 8048749786 | |||
| 1474 | 8052498952 | |||
| 1475 | 8054286222 | |||
| 1476 | 8054352561 | |||
| 1477 | 8054359160 | |||
| 1478 | 8054504605 | |||
| 1479 | 8054934447 | |||
| 1480 | 8055772014 | |||
| 1481 | 8055819047 | |||
| 1482 | 8055883350 | |||
| 1483 | 8056120338 | |||
| 1484 | 8056121828 | |||
| 1485 | 8056127080 | |||
| 1486 | 8056132916 | |||
| 1487 | 8056141952 | |||
| 1488 | 8056144382 | |||
| 1489 | 8056149132 | |||
| 1490 | 8056155605 | |||
| 1491 | 8056161209 | |||
| 1492 | 8056170016 | |||
| 1493 | 8056176149 | |||
| 1494 | 8056180579 | |||
| 1495 | 8056569685 | |||
| 1496 | 8057803303 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h8e-assembly1.cif.gz_A | low ph native structure of leucine aminopeptidase from pseudomonas putida | 0.9742 | 1 | 495 |
| 8pz0-assembly1.cif.gz_A | intracellular leucine aminopeptidase of pseudomonas aeruginosa pa14. | 0.9733 | 1 | 493 |
| 3h8e-assembly1.cif.gz_A | low ph native structure of leucine aminopeptidase from pseudomonas putida | 0.9722 | 1 | 495 |
| 3h8g-assembly1.cif.gz_D | bestatin complex structure of leucine aminopeptidase from pseudomonas putida | 0.9706 | 1 | 495 |
| 3h8g-assembly1.cif.gz_D | bestatin complex structure of leucine aminopeptidase from pseudomonas putida | 0.9686 | 1 | 495 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3h8fD01 | Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 | 0.9705 | 1 | 159 | 3.40.220.10 |
| 3h8eB01 | Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 | 0.9693 | 1 | 190 | 3.40.220.10 |
| 3h8eB02 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9681 | 191 | 495 | 3.40.630.10 |
| 3h8eB02 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9648 | 191 | 495 | 3.40.630.10 |
| 3h8eB01 | Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 | 0.9643 | 1 | 190 | 3.40.220.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381GTH8-F1-model_v4 | deleted | 0.9766 | 1 | 212 |
|
| AF-A0A718X9S2-F1-model_v4 | Leucyl aminopeptidase (EC 3.4.11.1) | 0.9764 | 1 | 250 |
GO:0005737
GO:0006508 GO:0030145 GO:0070006 |
| AF-A0A4Z0B0V6-F1-model_v4 | Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase) (LAP) (EC 3.4.11.10) (Leucyl aminopeptidase) | 0.9739 | 1 | 495 |
GO:0005737
GO:0006508 GO:0030145 GO:0070006 |
| AF-A0A496N4L5-F1-model_v4 | Leucyl aminopeptidase (EC 3.4.11.1) | 0.9725 | 1 | 127 |
GO:0006508
GO:0070006 |
| AF-A0A6D0F597-F1-model_v4 | deleted | 0.9721 | 49 | 427 |
|