F478974
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 748 | 238 | 1496 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300047323|Ga0495683_0047425|Ga0495683_0047425_131_721 |
| Length | 196 |
| Sequence | MCPPDGNPVRRVFFRLEFYMHVETVLEVALLALVTAAAVVDLARRRIPNLLLLAGWMIALPLHLLSPHPAVALLGALTGVVFGFLLFLPLYLLRGMAAGDVKMMATVGLFVGPYDTLQVAVITWCVGGVMALAIIAGRGHARRAFANIGDLLRPMWMRARGMPAVAEPMRQPSVGGMPYGLAIAAATMLLMFMRHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 28 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 44 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 76 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 77 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 78 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 83 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 84 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 85 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 86 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 87 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 88 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 89 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 90 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 91 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 92 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 93 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 94 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 95 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 96 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 97 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 98 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 99 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 100 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 101 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 102 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 103 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 104 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 105 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 199 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 200 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 203 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 204 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 205 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 206 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 207 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 208 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 217 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 218 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 219 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 220 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 221 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 222 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 223 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 224 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 225 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 226 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 227 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 228 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 229 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 230 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 231 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 232 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 233 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 234 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 235 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 236 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 237 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 238 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.52 |
| Metatranscriptomes | 0.53 |
| Isolates | 2.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.34 |
| Nodule | 1.07 |
| Rhizoplane | 4.28 |
| Rhizosphere | 85.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495683_0047425 | 3300047323 | Bacteria | 2156 |
| 2 | JGI24740J21852_10015455 | 3300001979 | Bacteria | 2787 |
| 3 | JGI24739J22299_10005837 | 3300001989 | Bacteria | 4662 |
| 4 | JGI24735J21928_10003220 | 3300002067 | Bacteria | 5580 |
| 5 | JGI25156J39149_1000642 | 3300002705 | Bacteria | 19182 |
| 6 | JGI25153J46596_10037879 | 3300003215 | Bacteria | 1527 |
| 7 | rootL2_10078556 | 3300003322 | Bacteria | 4211 |
| 8 | rootL2_10181157 | 3300003322 | Bacteria | 4111 |
| 9 | Ga0055533_1000223 | 3300003756 | Bacteria | 39225 |
| 10 | Ga0055532_1000140 | 3300003758 | Bacteria | 71626 |
| 11 | Ga0055525_1000023 | 3300003759 | Bacteria | 359920 |
| 12 | Ga0055525_1005287 | 3300003759 | Bacteria | 1097 |
| 13 | Ga0055527_1000089 | 3300003760 | Bacteria | 71626 |
| 14 | Ga0055535_1000164 | 3300003761 | Bacteria | 71626 |
| 15 | Ga0055542_1000208 | 3300003762 | Bacteria | 71626 |
| 16 | Ga0055542_1018413 | 3300003762 | Bacteria | 1058 |
| 17 | Ga0055529_1000227 | 3300003763 | Bacteria | 71626 |
| 18 | Ga0055526_1001413 | 3300003771 | Bacteria | 17094 |
| 19 | Ga0065165_1000578 | 3300005262 | Bacteria | 54130 |
| 20 | Ga0065165_1044889 | 3300005262 | Bacteria | 1290 |
| 21 | Ga0070658_10065225 | 3300005327 | Bacteria | 2971 |
| 22 | Ga0070658_10121300 | 3300005327 | Bacteria | 2172 |
| 23 | Ga0070658_10360858 | 3300005327 | Bacteria | 1244 |
| 24 | Ga0070658_10383186 | 3300005327 | Bacteria | 1206 |
| 25 | Ga0070676_10140485 | 3300005328 | Bacteria | 1537 |
| 26 | Ga0070682_100013339 | 3300005337 | Bacteria | 4725 |
| 27 | Ga0070660_100048314 | 3300005339 | Bacteria | 3268 |
| 28 | Ga0070660_100079497 | 3300005339 | Bacteria | 2573 |
| 29 | Ga0070660_100173299 | 3300005339 | Bacteria | 1743 |
| 30 | Ga0070660_100559514 | 3300005339 | Bacteria | 954 |
| 31 | Ga0070661_100017303 | 3300005344 | Bacteria | 5112 |
| 32 | Ga0070659_100045623 | 3300005366 | Bacteria | 3433 |
| 33 | Ga0070659_100147485 | 3300005366 | Bacteria | 1917 |
| 34 | Ga0070663_100067704 | 3300005455 | Bacteria | 2591 |
| 35 | Ga0070662_100068715 | 3300005457 | Bacteria | 2605 |
| 36 | Ga0068855_100050457 | 3300005563 | Bacteria | 4903 |
| 37 | Ga0068855_100306940 | 3300005563 | Bacteria | 1756 |
| 38 | Ga0070664_100043706 | 3300005564 | Bacteria | 3781 |
| 39 | Ga0070664_101259068 | 3300005564 | Bacteria | 698 |
| 40 | Ga0068851_10139159 | 3300005834 | Bacteria | 1319 |
| 41 | Ga0079104_1008864 | 3300006946 | Bacteria | 3461 |
| 42 | Ga0079104_1015197 | 3300006946 | Bacteria | 2289 |
| 43 | Ga0105240_10369321 | 3300009093 | Bacteria | 1623 |
| 44 | Ga0105245_10143871 | 3300009098 | Bacteria | 2248 |
| 45 | Ga0105243_10013152 | 3300009148 | Bacteria | 6256 |
| 46 | Ga0105241_10016732 | 3300009174 | Bacteria | 5382 |
| 47 | Ga0105241_10053471 | 3300009174 | Bacteria | 3088 |
| 48 | Ga0105242_10011323 | 3300009176 | Bacteria | 6856 |
| 49 | Ga0105237_11261861 | 3300009545 | Bacteria | 745 |
| 50 | Ga0105238_10893887 | 3300009551 | Bacteria | 906 |
| 51 | Ga0105239_10241143 | 3300010375 | Bacteria | 2029 |
| 52 | Ga0105239_11048096 | 3300010375 | Bacteria | 938 |
| 53 | Ga0105246_10060506 | 3300011119 | Bacteria | 2632 |
| 54 | Ga0157373_10037708 | 3300013100 | Bacteria | 3464 |
| 55 | Ga0157371_10000003 | 3300013102 | Bacteria | 543317 |
| 56 | Ga0157369_10041563 | 3300013105 | Bacteria | 5017 |
| 57 | Ga0157378_10159200 | 3300013297 | Bacteria | 2110 |
| 58 | Ga0157372_10470147 | 3300013307 | Bacteria | 1466 |
| 59 | Ga0157372_10477848 | 3300013307 | Bacteria | 1453 |
| 60 | Ga0182008_10000333 | 3300014497 | Bacteria | 37184 |
| 61 | Ga0182008_10022318 | 3300014497 | Bacteria | 3242 |
| 62 | Ga0182008_10032363 | 3300014497 | Bacteria | 2628 |
| 63 | Ga0182008_10081506 | 3300014497 | Bacteria | 1592 |
| 64 | Ga0182008_10092100 | 3300014497 | Bacteria | 1495 |
| 65 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 66 | Ga0182006_1000059 | 3300015261 | Bacteria | 164868 |
| 67 | Ga0182006_1039465 | 3300015261 | Bacteria | 1863 |
| 68 | Ga0182007_10000120 | 3300015262 | Bacteria | 54341 |
| 69 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 70 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 71 | Ga0163161_10006100 | 3300017792 | Bacteria | 8352 |
| 72 | Ga0209674_100020 | 3300025226 | Bacteria | 672397 |
| 73 | Ga0209672_100013 | 3300025228 | Bacteria | 740693 |
| 74 | Ga0209147_100013 | 3300025229 | Bacteria | 660057 |
| 75 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 76 | Ga0209563_101319 | 3300025230 | Bacteria | 6773 |
| 77 | Ga0207427_100967 | 3300025231 | Bacteria | 12190 |
| 78 | Ga0209258_100328 | 3300025242 | Bacteria | 71792 |
| 79 | Ga0209677_102359 | 3300025253 | Bacteria | 7234 |
| 80 | Ga0209148_1000020 | 3300025254 | Bacteria | 740693 |
| 81 | Ga0209148_1000271 | 3300025254 | Bacteria | 81385 |
| 82 | Ga0209759_1000279 | 3300025256 | Bacteria | 71943 |
| 83 | Ga0209759_1000315 | 3300025256 | Bacteria | 64918 |
| 84 | Ga0209233_1000294 | 3300025261 | Bacteria | 62768 |
| 85 | Ga0209455_1000017 | 3300025272 | Bacteria | 740693 |
| 86 | Ga0207645_10148417 | 3300025907 | Bacteria | 1530 |
| 87 | Ga0207705_10001752 | 3300025909 | Bacteria | 17148 |
| 88 | Ga0207705_10008251 | 3300025909 | Bacteria | 7615 |
| 89 | Ga0207654_10056604 | 3300025911 | Bacteria | 2275 |
| 90 | Ga0207695_10243081 | 3300025913 | Bacteria | 1701 |
| 91 | Ga0207657_10010163 | 3300025919 | Bacteria | 9404 |
| 92 | Ga0207657_10087337 | 3300025919 | Bacteria | 2609 |
| 93 | Ga0207649_10403644 | 3300025920 | Bacteria | 1023 |
| 94 | Ga0207690_10547655 | 3300025932 | Bacteria | 940 |
| 95 | Ga0207706_10040679 | 3300025933 | Bacteria | 4120 |
| 96 | Ga0207686_10008517 | 3300025934 | Bacteria | 5541 |
| 97 | Ga0207709_10061620 | 3300025935 | Bacteria | 2345 |
| 98 | Ga0207689_10235867 | 3300025942 | Bacteria | 1512 |
| 99 | Ga0207679_10169222 | 3300025945 | Bacteria | 1797 |
| 100 | Ga0207679_10246071 | 3300025945 | Bacteria | 1518 |
| 101 | Ga0207667_10021087 | 3300025949 | Bacteria | 7226 |
| 102 | Ga0207667_10267962 | 3300025949 | Bacteria | 1746 |
| 103 | Ga0207678_10240666 | 3300026067 | Bacteria | 1550 |
| 104 | Ga0207675_100492760 | 3300026118 | Bacteria | 1219 |
| 105 | Ga0207698_10165534 | 3300026142 | Bacteria | 1940 |
| 106 | Ga0209281_1003179 | 3300027111 | Bacteria | 5658 |
| 107 | Ga0209281_1004335 | 3300027111 | Bacteria | 4277 |
| 108 | Ga0209281_1020263 | 3300027111 | Bacteria | 1302 |
| 109 | Ga0307408_100119454 | 3300031548 | Bacteria | 2040 |
| 110 | Ga0307518_10081426 | 3300031838 | Bacteria | 2337 |
| 111 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 112 | Ga0307414_10853938 | 3300032004 | Bacteria | 832 |
| 113 | Ga0395899_0000019 | 3300037312 | Bacteria | 411777 |
| 114 | Ga0395899_0006940 | 3300037312 | Bacteria | 8773 |
| 115 | Ga0395899_0024172 | 3300037312 | Bacteria | 4596 |
| 116 | Ga0395899_0029194 | 3300037312 | Bacteria | 4148 |
| 117 | Ga0395899_0065495 | 3300037312 | Bacteria | 2670 |
| 118 | Ga0395899_0078826 | 3300037312 | Bacteria | 2400 |
| 119 | Ga0395899_0271272 | 3300037312 | Bacteria | 1157 |
| 120 | Ga0395899_0606615 | 3300037312 | Bacteria | 696 |
| 121 | Ga0395900_0000094 | 3300037418 | Bacteria | 165903 |
| 122 | Ga0395900_0000689 | 3300037418 | Bacteria | 45109 |
| 123 | Ga0395900_0004719 | 3300037418 | Bacteria | 14373 |
| 124 | Ga0395900_0077274 | 3300037418 | Bacteria | 3420 |
| 125 | Ga0395900_0110095 | 3300037418 | Bacteria | 2829 |
| 126 | Ga0395900_0116909 | 3300037418 | Bacteria | 2736 |
| 127 | Ga0395900_0190969 | 3300037418 | Bacteria | 2077 |
| 128 | Ga0395900_0193682 | 3300037418 | Bacteria | 2060 |
| 129 | Ga0395900_0270338 | 3300037418 | Bacteria | 1694 |
| 130 | Ga0395900_0404015 | 3300037418 | Bacteria | 1329 |
| 131 | Ga0395900_0561045 | 3300037418 | Bacteria | 1085 |
| 132 | Ga0395900_0727080 | 3300037418 | Bacteria | 924 |
| 133 | Ga0395900_0976674 | 3300037418 | Bacteria | 768 |
| 134 | Ga0395898_0004656 | 3300037466 | Bacteria | 14955 |
| 135 | Ga0395898_0279555 | 3300037466 | Bacteria | 1592 |
| 136 | Ga0395898_0289519 | 3300037466 | Bacteria | 1562 |
| 137 | Ga0395898_0304039 | 3300037466 | Bacteria | 1521 |
| 138 | Ga0395898_0679776 | 3300037466 | Bacteria | 971 |
| 139 | Ga0395898_1313286 | 3300037466 | Bacteria | 652 |
| 140 | Ga0395898_1637749 | 3300037466 | Bacteria | 567 |
| 141 | Ga0395905_0036810 | 3300037471 | Bacteria | 4596 |
| 142 | Ga0395905_0073035 | 3300037471 | Bacteria | 3215 |
| 143 | Ga0395905_0085934 | 3300037471 | Bacteria | 2947 |
| 144 | Ga0395905_0112203 | 3300037471 | Bacteria | 2560 |
| 145 | Ga0395905_0113425 | 3300037471 | Bacteria | 2546 |
| 146 | Ga0395905_0159623 | 3300037471 | Bacteria | 2119 |
| 147 | Ga0395905_0273988 | 3300037471 | Bacteria | 1573 |
| 148 | Ga0395905_0329045 | 3300037471 | Bacteria | 1418 |
| 149 | Ga0395905_0367163 | 3300037471 | Bacteria | 1332 |
| 150 | Ga0395901_0000448 | 3300038443 | Bacteria | 47911 |
| 151 | Ga0395901_0000884 | 3300038443 | Bacteria | 32968 |
| 152 | Ga0395901_0150191 | 3300038443 | Bacteria | 2448 |
| 153 | Ga0395901_0221286 | 3300038443 | Bacteria | 1978 |
| 154 | Ga0395901_0434821 | 3300038443 | Bacteria | 1344 |
| 155 | Ga0395901_0626750 | 3300038443 | Bacteria | 1081 |
| 156 | Ga0395901_0628943 | 3300038443 | Bacteria | 1079 |
| 157 | Ga0395901_0869312 | 3300038443 | Bacteria | 885 |
| 158 | Ga0395901_0887188 | 3300038443 | Bacteria | 874 |
| 159 | Ga0439448_0000123 | 3300042005 | Bacteria | 14522 |
| 160 | Ga0439448_0037796 | 3300042005 | Bacteria | 1552 |
| 161 | Ga0439450_003093 | 3300042008 | Bacteria | 2711 |
| 162 | Ga0439450_068785 | 3300042008 | Bacteria | 866 |
| 163 | Ga0439450_082131 | 3300042008 | Bacteria | 802 |
| 164 | Ga0439450_139493 | 3300042008 | Bacteria | 632 |
| 165 | Ga0439455_0026950 | 3300042012 | Bacteria | 1406 |
| 166 | Ga0450911_003490 | 3300042115 | Bacteria | 2757 |
| 167 | Ga0450904_000074 | 3300042139 | Bacteria | 22429 |
| 168 | Ga0439458_0024616 | 3300042157 | Bacteria | 1408 |
| 169 | Ga0466969_0047829 | 3300044656 | Bacteria | 2116 |
| 170 | Ga0466969_0127776 | 3300044656 | Bacteria | 1180 |
| 171 | Ga0466969_0260740 | 3300044656 | Bacteria | 785 |
| 172 | Ga0466972_0005995 | 3300044658 | Bacteria | 6105 |
| 173 | Ga0466982_0362274 | 3300044672 | Bacteria | 800 |
| 174 | Ga0466965_0006435 | 3300044683 | Bacteria | 5333 |
| 175 | Ga0466965_0006873 | 3300044683 | Bacteria | 5201 |
| 176 | Ga0466965_0007121 | 3300044683 | Bacteria | 5120 |
| 177 | Ga0466965_0146966 | 3300044683 | Bacteria | 1230 |
| 178 | Ga0466965_0192555 | 3300044683 | Bacteria | 1079 |
| 179 | Ga0466965_0754065 | 3300044683 | Bacteria | 561 |
| 180 | Ga0466966_0000999 | 3300044684 | Bacteria | 18041 |
| 181 | Ga0466966_0010626 | 3300044684 | Bacteria | 6120 |
| 182 | Ga0466966_0109781 | 3300044684 | Bacteria | 1701 |
| 183 | Ga0466966_0138466 | 3300044684 | Bacteria | 1488 |
| 184 | Ga0466966_0141400 | 3300044684 | Bacteria | 1470 |
| 185 | Ga0466966_0276365 | 3300044684 | Bacteria | 1010 |
| 186 | Ga0466961_0009272 | 3300044693 | Bacteria | 6265 |
| 187 | Ga0466961_0128831 | 3300044693 | Bacteria | 1586 |
| 188 | Ga0466961_0245241 | 3300044693 | Bacteria | 1100 |
| 189 | Ga0466961_0393337 | 3300044693 | Bacteria | 841 |
| 190 | Ga0466963_0044035 | 3300044694 | Bacteria | 2937 |
| 191 | Ga0466964_0000189 | 3300044706 | Bacteria | 16990 |
| 192 | Ga0466964_0000291 | 3300044706 | Bacteria | 14722 |
| 193 | Ga0466964_0162095 | 3300044706 | Bacteria | 1046 |
| 194 | Ga0466971_0034716 | 3300044719 | Bacteria | 2260 |
| 195 | Ga0466971_0076650 | 3300044719 | Bacteria | 1521 |
| 196 | Ga0466971_0109299 | 3300044719 | Bacteria | 1275 |
| 197 | Ga0466968_0000291 | 3300044735 | Bacteria | 15994 |
| 198 | Ga0466968_0012729 | 3300044735 | Bacteria | 3299 |
| 199 | Ga0466968_0190918 | 3300044735 | Bacteria | 956 |
| 200 | Ga0466970_0080396 | 3300044765 | Bacteria | 1761 |
| 201 | Ga0466970_0244748 | 3300044765 | Bacteria | 1004 |
| 202 | Ga0466970_0331516 | 3300044765 | Bacteria | 861 |
| 203 | Ga0466957_0006423 | 3300044842 | Bacteria | 6638 |
| 204 | Ga0466957_0007450 | 3300044842 | Bacteria | 6182 |
| 205 | Ga0466957_0060398 | 3300044842 | Bacteria | 2324 |
| 206 | Ga0466957_0117986 | 3300044842 | Bacteria | 1689 |
| 207 | Ga0466957_0120487 | 3300044842 | Bacteria | 1672 |
| 208 | Ga0466957_0224320 | 3300044842 | Bacteria | 1242 |
| 209 | Ga0466960_0164692 | 3300044901 | Bacteria | 1193 |
| 210 | Ga0466959_0007591 | 3300045049 | Bacteria | 7622 |
| 211 | Ga0466959_0048218 | 3300045049 | Bacteria | 3130 |
| 212 | Ga0466959_0271798 | 3300045049 | Bacteria | 1165 |
| 213 | Ga0466959_0350610 | 3300045049 | Bacteria | 1006 |
| 214 | Ga0466959_0496019 | 3300045049 | Bacteria | 825 |
| 215 | Ga0466959_0770947 | 3300045049 | Bacteria | 643 |
| 216 | Ga0466958_0012065 | 3300045836 | Bacteria | 4883 |
| 217 | Ga0466958_0039876 | 3300045836 | Bacteria | 2822 |
| 218 | Ga0466958_0523187 | 3300045836 | Bacteria | 770 |
| 219 | Ga0466958_1155774 | 3300045836 | Bacteria | 505 |
| 220 | Ga0466967_0004562 | 3300045976 | Bacteria | 9379 |
| 221 | Ga0466967_0037707 | 3300045976 | Bacteria | 4139 |
| 222 | Ga0495617_000025 | 3300046452 | Bacteria | 164547 |
| 223 | Ga0495617_050972 | 3300046452 | Bacteria | 1376 |
| 224 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 225 | Ga0495627_011200 | 3300046453 | Bacteria | 3226 |
| 226 | Ga0495603_0016290 | 3300046455 | Bacteria | 4499 |
| 227 | Ga0495603_0042700 | 3300046455 | Bacteria | 2710 |
| 228 | Ga0495590_0000038 | 3300046457 | Bacteria | 127040 |
| 229 | Ga0495590_0002388 | 3300046457 | Bacteria | 7778 |
| 230 | Ga0495590_0009780 | 3300046457 | Bacteria | 3631 |
| 231 | Ga0495590_0012669 | 3300046457 | Bacteria | 3124 |
| 232 | Ga0495590_0029341 | 3300046457 | Bacteria | 1929 |
| 233 | Ga0495591_000034 | 3300046458 | Bacteria | 170328 |
| 234 | Ga0495629_0006447 | 3300046459 | Bacteria | 8697 |
| 235 | Ga0495629_0122801 | 3300046459 | Bacteria | 1809 |
| 236 | Ga0495638_0015576 | 3300046460 | Bacteria | 5106 |
| 237 | Ga0495638_0129329 | 3300046460 | Bacteria | 1485 |
| 238 | Ga0495653_0061804 | 3300046463 | Bacteria | 2832 |
| 239 | Ga0495653_0246519 | 3300046463 | Bacteria | 1187 |
| 240 | Ga0495650_0000062 | 3300046471 | Bacteria | 277977 |
| 241 | Ga0495650_0005211 | 3300046471 | Bacteria | 8541 |
| 242 | Ga0495650_0009778 | 3300046471 | Bacteria | 5422 |
| 243 | Ga0495580_0018980 | 3300046472 | Bacteria | 5114 |
| 244 | Ga0495582_0016188 | 3300046473 | Bacteria | 4086 |
| 245 | Ga0495582_0046284 | 3300046473 | Bacteria | 2396 |
| 246 | Ga0495582_0686869 | 3300046473 | Bacteria | 592 |
| 247 | Ga0495605_0000225 | 3300046474 | Bacteria | 69738 |
| 248 | Ga0495605_0001346 | 3300046474 | Bacteria | 16238 |
| 249 | Ga0495605_0012260 | 3300046474 | Bacteria | 4759 |
| 250 | Ga0495605_0020204 | 3300046474 | Bacteria | 3542 |
| 251 | Ga0495605_0021016 | 3300046474 | Bacteria | 3461 |
| 252 | Ga0495605_0025644 | 3300046474 | Bacteria | 3070 |
| 253 | Ga0495605_0036001 | 3300046474 | Bacteria | 2498 |
| 254 | Ga0495605_0037361 | 3300046474 | Bacteria | 2444 |
| 255 | Ga0495605_0047843 | 3300046474 | Bacteria | 2096 |
| 256 | Ga0495605_0136469 | 3300046474 | Bacteria | 1103 |
| 257 | Ga0495605_0137563 | 3300046474 | Bacteria | 1097 |
| 258 | Ga0495584_0000395 | 3300046491 | Bacteria | 30068 |
| 259 | Ga0495584_0000681 | 3300046491 | Bacteria | 22606 |
| 260 | Ga0495584_0000807 | 3300046491 | Bacteria | 20613 |
| 261 | Ga0495584_0006122 | 3300046491 | Bacteria | 6326 |
| 262 | Ga0495584_0061398 | 3300046491 | Bacteria | 1889 |
| 263 | Ga0495584_0073313 | 3300046491 | Bacteria | 1720 |
| 264 | Ga0495584_0074474 | 3300046491 | Bacteria | 1706 |
| 265 | Ga0495584_0092148 | 3300046491 | Bacteria | 1528 |
| 266 | Ga0495584_0125458 | 3300046491 | Bacteria | 1301 |
| 267 | Ga0495584_0128809 | 3300046491 | Bacteria | 1283 |
| 268 | Ga0495584_0160771 | 3300046491 | Bacteria | 1141 |
| 269 | Ga0495584_0337291 | 3300046491 | Bacteria | 765 |
| 270 | Ga0495585_0000822 | 3300046492 | Bacteria | 26833 |
| 271 | Ga0495585_0003937 | 3300046492 | Bacteria | 9818 |
| 272 | Ga0495585_0005132 | 3300046492 | Bacteria | 8326 |
| 273 | Ga0495585_0018964 | 3300046492 | Bacteria | 3969 |
| 274 | Ga0495585_0062673 | 3300046492 | Bacteria | 2042 |
| 275 | Ga0495585_0088999 | 3300046492 | Bacteria | 1664 |
| 276 | Ga0495585_0101233 | 3300046492 | Bacteria | 1540 |
| 277 | Ga0495585_0104955 | 3300046492 | Bacteria | 1507 |
| 278 | Ga0495585_0116096 | 3300046492 | Bacteria | 1419 |
| 279 | Ga0495585_0154994 | 3300046492 | Bacteria | 1192 |
| 280 | Ga0495594_0005281 | 3300046499 | Bacteria | 6633 |
| 281 | Ga0495594_0006886 | 3300046499 | Bacteria | 5845 |
| 282 | Ga0495594_0017042 | 3300046499 | Bacteria | 3834 |
| 283 | Ga0495594_0024361 | 3300046499 | Bacteria | 3250 |
| 284 | Ga0495594_0029394 | 3300046499 | Bacteria | 2969 |
| 285 | Ga0495594_0102613 | 3300046499 | Bacteria | 1609 |
| 286 | Ga0495596_0000907 | 3300046500 | Bacteria | 17730 |
| 287 | Ga0495596_0002970 | 3300046500 | Bacteria | 8794 |
| 288 | Ga0495596_0008594 | 3300046500 | Bacteria | 4536 |
| 289 | Ga0495596_0019205 | 3300046500 | Bacteria | 2810 |
| 290 | Ga0495596_0024745 | 3300046500 | Bacteria | 2430 |
| 291 | Ga0495596_0046393 | 3300046500 | Bacteria | 1707 |
| 292 | Ga0495596_0081832 | 3300046500 | Bacteria | 1253 |
| 293 | Ga0495596_0134264 | 3300046500 | Bacteria | 960 |
| 294 | Ga0495607_0001804 | 3300046501 | Bacteria | 18288 |
| 295 | Ga0495607_0003494 | 3300046501 | Bacteria | 12017 |
| 296 | Ga0495607_0004655 | 3300046501 | Bacteria | 10036 |
| 297 | Ga0495607_0007064 | 3300046501 | Bacteria | 7808 |
| 298 | Ga0495607_0022504 | 3300046501 | Bacteria | 3956 |
| 299 | Ga0495607_0120571 | 3300046501 | Unclassified | 1377 |
| 300 | Ga0495583_0001103 | 3300046506 | Bacteria | 29860 |
| 301 | Ga0495583_0001692 | 3300046506 | Bacteria | 21300 |
| 302 | Ga0495583_0008038 | 3300046506 | Bacteria | 6507 |
| 303 | Ga0495583_0009401 | 3300046506 | Bacteria | 5843 |
| 304 | Ga0495583_0009900 | 3300046506 | Bacteria | 5637 |
| 305 | Ga0495583_0018486 | 3300046506 | Bacteria | 3667 |
| 306 | Ga0495583_0038344 | 3300046506 | Bacteria | 2264 |
| 307 | Ga0495583_0082961 | 3300046506 | Bacteria | 1390 |
| 308 | Ga0495583_0093466 | 3300046506 | Bacteria | 1292 |
| 309 | Ga0495583_0113944 | 3300046506 | Bacteria | 1143 |
| 310 | Ga0495606_0000093 | 3300046507 | Bacteria | 152281 |
| 311 | Ga0495606_0036942 | 3300046507 | Bacteria | 3321 |
| 312 | Ga0495606_0047104 | 3300046507 | Bacteria | 2844 |
| 313 | Ga0495606_0050794 | 3300046507 | Bacteria | 2709 |
| 314 | Ga0495606_0051616 | 3300046507 | Bacteria | 2681 |
| 315 | Ga0495606_0084847 | 3300046507 | Bacteria | 1960 |
| 316 | Ga0495606_0086388 | 3300046507 | Bacteria | 1939 |
| 317 | Ga0495606_0119114 | 3300046507 | Bacteria | 1582 |
| 318 | Ga0495606_0175493 | 3300046507 | Bacteria | 1240 |
| 319 | Ga0495606_0186651 | 3300046507 | Bacteria | 1191 |
| 320 | Ga0495606_0260848 | 3300046507 | Bacteria | 956 |
| 321 | Ga0495606_0306985 | 3300046507 | Bacteria | 857 |
| 322 | Ga0495606_0374589 | 3300046507 | Bacteria | 748 |
| 323 | Ga0495610_0000775 | 3300046512 | Bacteria | 30121 |
| 324 | Ga0495610_0004317 | 3300046512 | Bacteria | 10554 |
| 325 | Ga0495610_0034371 | 3300046512 | Bacteria | 2612 |
| 326 | Ga0495610_0295800 | 3300046512 | Bacteria | 626 |
| 327 | Ga0495616_0000043 | 3300046513 | Bacteria | 118368 |
| 328 | Ga0495616_0000370 | 3300046513 | Bacteria | 35032 |
| 329 | Ga0495616_0000417 | 3300046513 | Bacteria | 32793 |
| 330 | Ga0495616_0005384 | 3300046513 | Bacteria | 7886 |
| 331 | Ga0495616_0006444 | 3300046513 | Bacteria | 7097 |
| 332 | Ga0495616_0006660 | 3300046513 | Bacteria | 6973 |
| 333 | Ga0495616_0054665 | 3300046513 | Bacteria | 1979 |
| 334 | Ga0495616_0078234 | 3300046513 | Bacteria | 1586 |
| 335 | Ga0495616_0100002 | 3300046513 | Bacteria | 1361 |
| 336 | Ga0495616_0132333 | 3300046513 | Bacteria | 1142 |
| 337 | Ga0495630_0041994 | 3300046517 | Bacteria | 3415 |
| 338 | Ga0495631_0000881 | 3300046518 | Bacteria | 18788 |
| 339 | Ga0495631_0000957 | 3300046518 | Bacteria | 17994 |
| 340 | Ga0495631_0005111 | 3300046518 | Bacteria | 6914 |
| 341 | Ga0495631_0007328 | 3300046518 | Bacteria | 5618 |
| 342 | Ga0495631_0007494 | 3300046518 | Bacteria | 5547 |
| 343 | Ga0495631_0009911 | 3300046518 | Bacteria | 4736 |
| 344 | Ga0495631_0010975 | 3300046518 | Bacteria | 4472 |
| 345 | Ga0495631_0016120 | 3300046518 | Bacteria | 3570 |
| 346 | Ga0495631_0024858 | 3300046518 | Bacteria | 2762 |
| 347 | Ga0495631_0046343 | 3300046518 | Bacteria | 1911 |
| 348 | Ga0495631_0050968 | 3300046518 | Bacteria | 1809 |
| 349 | Ga0495631_0130298 | 3300046518 | Bacteria | 1081 |
| 350 | Ga0495631_0173395 | 3300046518 | Bacteria | 924 |
| 351 | Ga0495631_0348084 | 3300046518 | Bacteria | 630 |
| 352 | Ga0495632_0000297 | 3300046519 | Bacteria | 48149 |
| 353 | Ga0495632_0000510 | 3300046519 | Bacteria | 36555 |
| 354 | Ga0495632_0002285 | 3300046519 | Bacteria | 14768 |
| 355 | Ga0495632_0046824 | 3300046519 | Bacteria | 2147 |
| 356 | Ga0495632_0055054 | 3300046519 | Bacteria | 1948 |
| 357 | Ga0495632_0084517 | 3300046519 | Bacteria | 1510 |
| 358 | Ga0495632_0164787 | 3300046519 | Bacteria | 1020 |
| 359 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 360 | Ga0495637_0014049 | 3300046520 | Bacteria | 3786 |
| 361 | Ga0495637_0212172 | 3300046520 | Unclassified | 708 |
| 362 | Ga0495637_0301436 | 3300046520 | Bacteria | 568 |
| 363 | Ga0495643_0001206 | 3300046522 | Bacteria | 25088 |
| 364 | Ga0495643_0002954 | 3300046522 | Bacteria | 12872 |
| 365 | Ga0495643_0008101 | 3300046522 | Bacteria | 6696 |
| 366 | Ga0495643_0009092 | 3300046522 | Bacteria | 6224 |
| 367 | Ga0495643_0026095 | 3300046522 | Bacteria | 3300 |
| 368 | Ga0495643_0026791 | 3300046522 | Bacteria | 3247 |
| 369 | Ga0495643_0074736 | 3300046522 | Bacteria | 1774 |
| 370 | Ga0495643_0092241 | 3300046522 | Bacteria | 1561 |
| 371 | Ga0495643_0102826 | 3300046522 | Bacteria | 1462 |
| 372 | Ga0495643_0335461 | 3300046522 | Unclassified | 680 |
| 373 | Ga0495644_0007661 | 3300046523 | Bacteria | 4164 |
| 374 | Ga0495644_0008459 | 3300046523 | Bacteria | 3963 |
| 375 | Ga0495644_0014026 | 3300046523 | Bacteria | 3071 |
| 376 | Ga0495644_0056583 | 3300046523 | Bacteria | 1473 |
| 377 | Ga0495648_0005746 | 3300046524 | Bacteria | 10237 |
| 378 | Ga0495648_0021065 | 3300046524 | Bacteria | 4526 |
| 379 | Ga0495648_0036264 | 3300046524 | Bacteria | 3184 |
| 380 | Ga0495648_0219433 | 3300046524 | Bacteria | 938 |
| 381 | Ga0495663_0038253 | 3300046525 | Bacteria | 1449 |
| 382 | Ga0495666_0002358 | 3300046526 | Bacteria | 9419 |
| 383 | Ga0495666_0013387 | 3300046526 | Bacteria | 4090 |
| 384 | Ga0495666_0489099 | 3300046526 | Bacteria | 550 |
| 385 | Ga0495642_0000405 | 3300046528 | Bacteria | 23196 |
| 386 | Ga0495642_0000546 | 3300046528 | Bacteria | 18957 |
| 387 | Ga0495642_0002111 | 3300046528 | Bacteria | 8216 |
| 388 | Ga0495642_0006821 | 3300046528 | Bacteria | 4377 |
| 389 | Ga0495642_0017958 | 3300046528 | Bacteria | 2766 |
| 390 | Ga0495642_0019499 | 3300046528 | Bacteria | 2659 |
| 391 | Ga0495642_0024293 | 3300046528 | Bacteria | 2397 |
| 392 | Ga0495642_0039431 | 3300046528 | Bacteria | 1916 |
| 393 | Ga0495642_0048195 | 3300046528 | Bacteria | 1747 |
| 394 | Ga0495642_0059988 | 3300046528 | Bacteria | 1577 |
| 395 | Ga0495642_0067352 | 3300046528 | Bacteria | 1493 |
| 396 | Ga0495642_0128587 | 3300046528 | Bacteria | 1089 |
| 397 | Ga0495642_0237462 | 3300046528 | Bacteria | 796 |
| 398 | Ga0495642_0268531 | 3300046528 | Bacteria | 746 |
| 399 | Ga0495654_0001583 | 3300046530 | Bacteria | 15445 |
| 400 | Ga0495654_0001792 | 3300046530 | Bacteria | 14303 |
| 401 | Ga0495654_0085074 | 3300046530 | Bacteria | 1476 |
| 402 | Ga0495654_0185548 | 3300046530 | Bacteria | 898 |
| 403 | Ga0495665_0003930 | 3300046531 | Bacteria | 8039 |
| 404 | Ga0495665_0019447 | 3300046531 | Bacteria | 3653 |
| 405 | Ga0495665_0022427 | 3300046531 | Bacteria | 3394 |
| 406 | Ga0495640_0015932 | 3300046533 | Bacteria | 5639 |
| 407 | Ga0495586_0004928 | 3300046535 | Bacteria | 7142 |
| 408 | Ga0495586_0008647 | 3300046535 | Bacteria | 5420 |
| 409 | Ga0495586_0136176 | 3300046535 | Bacteria | 1376 |
| 410 | Ga0495586_0142847 | 3300046535 | Bacteria | 1344 |
| 411 | Ga0495587_0077778 | 3300046536 | Bacteria | 1925 |
| 412 | Ga0495587_0235698 | 3300046536 | Bacteria | 1030 |
| 413 | Ga0495609_0000078 | 3300046538 | Bacteria | 119177 |
| 414 | Ga0495609_0003457 | 3300046538 | Bacteria | 9045 |
| 415 | Ga0495609_0013728 | 3300046538 | Bacteria | 3820 |
| 416 | Ga0495609_0033800 | 3300046538 | Bacteria | 2320 |
| 417 | Ga0495609_0036255 | 3300046538 | Bacteria | 2227 |
| 418 | Ga0495609_0072563 | 3300046538 | Bacteria | 1511 |
| 419 | Ga0495609_0077018 | 3300046538 | Bacteria | 1461 |
| 420 | Ga0495609_0123086 | 3300046538 | Bacteria | 1114 |
| 421 | Ga0495597_0000475 | 3300046542 | Bacteria | 34029 |
| 422 | Ga0495597_0000794 | 3300046542 | Bacteria | 24955 |
| 423 | Ga0495597_0003224 | 3300046542 | Bacteria | 9700 |
| 424 | Ga0495597_0005885 | 3300046542 | Bacteria | 6407 |
| 425 | Ga0495597_0020732 | 3300046542 | Bacteria | 3059 |
| 426 | Ga0495597_0029619 | 3300046542 | Bacteria | 2499 |
| 427 | Ga0495597_0048892 | 3300046542 | Bacteria | 1870 |
| 428 | Ga0495597_0070625 | 3300046542 | Bacteria | 1505 |
| 429 | Ga0495597_0117489 | 3300046542 | Bacteria | 1111 |
| 430 | Ga0495597_0140043 | 3300046542 | Bacteria | 998 |
| 431 | Ga0495645_0092231 | 3300046543 | Bacteria | 2163 |
| 432 | Ga0495622_0014461 | 3300046557 | Bacteria | 3664 |
| 433 | Ga0495622_0024122 | 3300046557 | Bacteria | 2839 |
| 434 | Ga0495622_0051769 | 3300046557 | Bacteria | 1904 |
| 435 | Ga0495622_0057247 | 3300046557 | Bacteria | 1807 |
| 436 | Ga0495622_0098404 | 3300046557 | Bacteria | 1341 |
| 437 | Ga0495622_0103816 | 3300046557 | Bacteria | 1302 |
| 438 | Ga0495622_0180673 | 3300046557 | Bacteria | 946 |
| 439 | Ga0495633_0000443 | 3300046558 | Bacteria | 42796 |
| 440 | Ga0495633_0001067 | 3300046558 | Bacteria | 22186 |
| 441 | Ga0495633_0006429 | 3300046558 | Bacteria | 6966 |
| 442 | Ga0495633_0007748 | 3300046558 | Bacteria | 6140 |
| 443 | Ga0495633_0021717 | 3300046558 | Bacteria | 3206 |
| 444 | Ga0495633_0033879 | 3300046558 | Bacteria | 2459 |
| 445 | Ga0495633_0036597 | 3300046558 | Bacteria | 2351 |
| 446 | Ga0495633_0076116 | 3300046558 | Bacteria | 1562 |
| 447 | Ga0495633_0095529 | 3300046558 | Bacteria | 1381 |
| 448 | Ga0495633_0121032 | 3300046558 | Bacteria | 1212 |
| 449 | Ga0495633_0158071 | 3300046558 | Bacteria | 1046 |
| 450 | Ga0495656_0047037 | 3300046615 | Bacteria | 1828 |
| 451 | Ga0495656_0221939 | 3300046615 | Bacteria | 945 |
| 452 | Ga0495656_0232093 | 3300046615 | Bacteria | 926 |
| 453 | Ga0495668_0000420 | 3300046616 | Bacteria | 55257 |
| 454 | Ga0495668_0000933 | 3300046616 | Bacteria | 32617 |
| 455 | Ga0495668_0017290 | 3300046616 | Bacteria | 4184 |
| 456 | Ga0495668_0018794 | 3300046616 | Bacteria | 3993 |
| 457 | Ga0495668_0020824 | 3300046616 | Bacteria | 3766 |
| 458 | Ga0495668_0025878 | 3300046616 | Bacteria | 3332 |
| 459 | Ga0495668_0030245 | 3300046616 | Bacteria | 3058 |
| 460 | Ga0495668_0389482 | 3300046616 | Bacteria | 765 |
| 461 | Ga0495668_0451521 | 3300046616 | Bacteria | 707 |
| 462 | Ga0495611_0000388 | 3300046648 | Bacteria | 27907 |
| 463 | Ga0495611_0011746 | 3300046648 | Bacteria | 3715 |
| 464 | Ga0495611_0012061 | 3300046648 | Bacteria | 3672 |
| 465 | Ga0495611_0022992 | 3300046648 | Bacteria | 2701 |
| 466 | Ga0495611_0061675 | 3300046648 | Bacteria | 1704 |
| 467 | Ga0495625_0004117 | 3300046660 | Bacteria | 13875 |
| 468 | Ga0495625_0024983 | 3300046660 | Bacteria | 4538 |
| 469 | Ga0495625_0093137 | 3300046660 | Bacteria | 2081 |
| 470 | Ga0495625_0236341 | 3300046660 | Bacteria | 1191 |
| 471 | Ga0495625_0289274 | 3300046660 | Bacteria | 1052 |
| 472 | Ga0495635_0001885 | 3300046663 | Bacteria | 14229 |
| 473 | Ga0495661_0000721 | 3300046665 | Bacteria | 32506 |
| 474 | Ga0495661_0000959 | 3300046665 | Bacteria | 26174 |
| 475 | Ga0495661_0001149 | 3300046665 | Bacteria | 23111 |
| 476 | Ga0495661_0001465 | 3300046665 | Bacteria | 19754 |
| 477 | Ga0495661_0036389 | 3300046665 | Bacteria | 3083 |
| 478 | Ga0495661_0045929 | 3300046665 | Bacteria | 2668 |
| 479 | Ga0495661_0065192 | 3300046665 | Bacteria | 2146 |
| 480 | Ga0495661_0076974 | 3300046665 | Bacteria | 1934 |
| 481 | Ga0495661_0085317 | 3300046665 | Bacteria | 1810 |
| 482 | Ga0495661_0123973 | 3300046665 | Bacteria | 1423 |
| 483 | Ga0495661_0164919 | 3300046665 | Bacteria | 1186 |
| 484 | Ga0495661_0236712 | 3300046665 | Bacteria | 938 |
| 485 | Ga0495588_0000091 | 3300046674 | Bacteria | 183183 |
| 486 | Ga0495588_0002124 | 3300046674 | Bacteria | 8503 |
| 487 | Ga0495588_0006949 | 3300046674 | Bacteria | 5130 |
| 488 | Ga0495588_0009015 | 3300046674 | Bacteria | 4596 |
| 489 | Ga0495588_0010383 | 3300046674 | Bacteria | 4330 |
| 490 | Ga0495588_0026607 | 3300046674 | Bacteria | 2889 |
| 491 | Ga0495588_0031393 | 3300046674 | Bacteria | 2673 |
| 492 | Ga0495588_0059740 | 3300046674 | Bacteria | 1972 |
| 493 | Ga0495588_0080808 | 3300046674 | Bacteria | 1696 |
| 494 | Ga0495588_0121520 | 3300046674 | Bacteria | 1376 |
| 495 | Ga0495623_0008295 | 3300046679 | Bacteria | 6759 |
| 496 | Ga0495623_0014569 | 3300046679 | Bacteria | 5087 |
| 497 | Ga0495623_0312333 | 3300046679 | Bacteria | 865 |
| 498 | Ga0495646_0379515 | 3300046680 | Bacteria | 737 |
| 499 | Ga0495669_0001144 | 3300046684 | Bacteria | 10993 |
| 500 | Ga0495669_0007932 | 3300046684 | Bacteria | 4457 |
| 501 | Ga0495669_0101822 | 3300046684 | Bacteria | 1334 |
| 502 | Ga0495669_0138184 | 3300046684 | Bacteria | 1149 |
| 503 | Ga0495669_0238131 | 3300046684 | Bacteria | 873 |
| 504 | Ga0495669_0288520 | 3300046684 | Unclassified | 790 |
| 505 | Ga0495669_0446733 | 3300046684 | Bacteria | 628 |
| 506 | Ga0495613_0005690 | 3300046689 | Bacteria | 9340 |
| 507 | Ga0495613_0030514 | 3300046689 | Bacteria | 4004 |
| 508 | Ga0495613_0267154 | 3300046689 | Bacteria | 1190 |
| 509 | Ga0495624_0059411 | 3300046690 | Bacteria | 2399 |
| 510 | Ga0495670_0000118 | 3300046691 | Bacteria | 34643 |
| 511 | Ga0495670_0011852 | 3300046691 | Bacteria | 4292 |
| 512 | Ga0495670_0053945 | 3300046691 | Bacteria | 2013 |
| 513 | Ga0495670_0059599 | 3300046691 | Bacteria | 1916 |
| 514 | Ga0495670_0095850 | 3300046691 | Bacteria | 1522 |
| 515 | Ga0495670_0107355 | 3300046691 | Bacteria | 1442 |
| 516 | Ga0495671_0002501 | 3300046692 | Bacteria | 11571 |
| 517 | Ga0495671_0002870 | 3300046692 | Bacteria | 10776 |
| 518 | Ga0495671_0007516 | 3300046692 | Bacteria | 6205 |
| 519 | Ga0495671_0048513 | 3300046692 | Bacteria | 2118 |
| 520 | Ga0495671_0059517 | 3300046692 | Bacteria | 1887 |
| 521 | Ga0495671_0085547 | 3300046692 | Bacteria | 1545 |
| 522 | Ga0495671_0202776 | 3300046692 | Bacteria | 962 |
| 523 | Ga0495649_0000283 | 3300046694 | Bacteria | 44818 |
| 524 | Ga0495649_0001108 | 3300046694 | Bacteria | 20990 |
| 525 | Ga0495649_0002571 | 3300046694 | Bacteria | 12703 |
| 526 | Ga0495649_0002828 | 3300046694 | Bacteria | 12048 |
| 527 | Ga0495649_0009423 | 3300046694 | Bacteria | 5807 |
| 528 | Ga0495649_0045190 | 3300046694 | Bacteria | 2402 |
| 529 | Ga0495649_0118717 | 3300046694 | Bacteria | 1399 |
| 530 | Ga0495649_0184689 | 3300046694 | Bacteria | 1087 |
| 531 | Ga0495589_0000031 | 3300046794 | Bacteria | 169809 |
| 532 | Ga0495589_0000688 | 3300046794 | Bacteria | 22021 |
| 533 | Ga0495589_0000741 | 3300046794 | Bacteria | 20996 |
| 534 | Ga0495589_0020954 | 3300046794 | Bacteria | 3341 |
| 535 | Ga0495589_0044417 | 3300046794 | Bacteria | 2210 |
| 536 | Ga0495589_0046084 | 3300046794 | Bacteria | 2164 |
| 537 | Ga0495589_0047300 | 3300046794 | Bacteria | 2132 |
| 538 | Ga0495600_0004015 | 3300046809 | Bacteria | 8745 |
| 539 | Ga0495600_0446594 | 3300046809 | Bacteria | 800 |
| 540 | Ga0495660_0000435 | 3300046810 | Bacteria | 35016 |
| 541 | Ga0495660_0000935 | 3300046810 | Bacteria | 21447 |
| 542 | Ga0495660_0001936 | 3300046810 | Bacteria | 13477 |
| 543 | Ga0495660_0017835 | 3300046810 | Bacteria | 4083 |
| 544 | Ga0495660_0021081 | 3300046810 | Bacteria | 3734 |
| 545 | Ga0495660_0027333 | 3300046810 | Bacteria | 3229 |
| 546 | Ga0495660_0033968 | 3300046810 | Bacteria | 2857 |
| 547 | Ga0495660_0063697 | 3300046810 | Bacteria | 1972 |
| 548 | Ga0495581_0028695 | 3300047315 | Bacteria | 3226 |
| 549 | Ga0495581_0033274 | 3300047315 | Bacteria | 2984 |
| 550 | Ga0495581_0046793 | 3300047315 | Bacteria | 2500 |
| 551 | Ga0495581_0058414 | 3300047315 | Bacteria | 2227 |
| 552 | Ga0495604_0002704 | 3300047317 | Bacteria | 14222 |
| 553 | Ga0495604_0008484 | 3300047317 | Bacteria | 8111 |
| 554 | Ga0495604_0028353 | 3300047317 | Bacteria | 4453 |
| 555 | Ga0495604_0090103 | 3300047317 | Bacteria | 2278 |
| 556 | Ga0495604_0217396 | 3300047317 | Bacteria | 1317 |
| 557 | Ga0495674_0010892 | 3300047319 | Bacteria | 8597 |
| 558 | Ga0495674_0033326 | 3300047319 | Bacteria | 4667 |
| 559 | Ga0495674_0110155 | 3300047319 | Bacteria | 2335 |
| 560 | Ga0495672_0000088 | 3300047320 | Bacteria | 153860 |
| 561 | Ga0495672_0000089 | 3300047320 | Bacteria | 150897 |
| 562 | Ga0495672_0000197 | 3300047320 | Bacteria | 86233 |
| 563 | Ga0495672_0000656 | 3300047320 | Bacteria | 38441 |
| 564 | Ga0495672_0004884 | 3300047320 | Bacteria | 10780 |
| 565 | Ga0495672_0027764 | 3300047320 | Bacteria | 3592 |
| 566 | Ga0495672_0047870 | 3300047320 | Bacteria | 2539 |
| 567 | Ga0495672_0088159 | 3300047320 | Bacteria | 1711 |
| 568 | Ga0495672_0117942 | 3300047320 | Bacteria | 1415 |
| 569 | Ga0495676_0018368 | 3300047321 | Bacteria | 6164 |
| 570 | Ga0495676_0098231 | 3300047321 | Bacteria | 2173 |
| 571 | Ga0495676_0117030 | 3300047321 | Bacteria | 1945 |
| 572 | Ga0495680_0011874 | 3300047322 | Bacteria | 7685 |
| 573 | Ga0495680_0400796 | 3300047322 | Bacteria | 947 |
| 574 | Ga0495683_0000052 | 3300047323 | Bacteria | 121895 |
| 575 | Ga0495683_0000597 | 3300047323 | Bacteria | 27120 |
| 576 | Ga0495683_0017482 | 3300047323 | Bacteria | 3716 |
| 577 | Ga0495683_0021932 | 3300047323 | Bacteria | 3287 |
| 578 | Ga0495683_0027162 | 3300047323 | Bacteria | 2928 |
| 579 | Ga0495683_0104999 | 3300047323 | Bacteria | 1354 |
| 580 | Ga0495683_0127563 | 3300047323 | Bacteria | 1202 |
| 581 | Ga0495683_0228168 | 3300047323 | Bacteria | 827 |
| 582 | Ga0495683_0253972 | 3300047323 | Bacteria | 770 |
| 583 | Ga0495687_000257 | 3300047443 | Bacteria | 71519 |
| 584 | Ga0495687_001414 | 3300047443 | Bacteria | 22102 |
| 585 | Ga0495687_001823 | 3300047443 | Bacteria | 18730 |
| 586 | Ga0495687_002092 | 3300047443 | Bacteria | 16778 |
| 587 | Ga0495687_006800 | 3300047443 | Bacteria | 6908 |
| 588 | Ga0495687_010400 | 3300047443 | Bacteria | 5105 |
| 589 | Ga0495687_104736 | 3300047443 | Bacteria | 1053 |
| 590 | Ga0495687_129592 | 3300047443 | Bacteria | 895 |
| 591 | Ga0495687_139570 | 3300047443 | Bacteria | 845 |
| 592 | Ga0495675_0001177 | 3300047444 | Bacteria | 15871 |
| 593 | Ga0495675_0011609 | 3300047444 | Bacteria | 5531 |
| 594 | Ga0495675_0051724 | 3300047444 | Bacteria | 2608 |
| 595 | Ga0495677_0000219 | 3300047445 | Bacteria | 26151 |
| 596 | Ga0495677_0000310 | 3300047445 | Bacteria | 21153 |
| 597 | Ga0495677_0002073 | 3300047445 | Bacteria | 7986 |
| 598 | Ga0495677_0004052 | 3300047445 | Bacteria | 5656 |
| 599 | Ga0495677_0012802 | 3300047445 | Bacteria | 3058 |
| 600 | Ga0495677_0020798 | 3300047445 | Bacteria | 2378 |
| 601 | Ga0495677_0025233 | 3300047445 | Bacteria | 2156 |
| 602 | Ga0495677_0030975 | 3300047445 | Bacteria | 1947 |
| 603 | Ga0495677_0069217 | 3300047445 | Bacteria | 1314 |
| 604 | Ga0495677_0072753 | 3300047445 | Bacteria | 1282 |
| 605 | Ga0495677_0075217 | 3300047445 | Bacteria | 1261 |
| 606 | Ga0495679_004495 | 3300047446 | Bacteria | 6408 |
| 607 | Ga0495679_006080 | 3300047446 | Bacteria | 5260 |
| 608 | Ga0495685_000614 | 3300047447 | Bacteria | 10897 |
| 609 | Ga0495685_005050 | 3300047447 | Bacteria | 4295 |
| 610 | Ga0495685_017470 | 3300047447 | Bacteria | 2458 |
| 611 | Ga0495685_076763 | 3300047447 | Bacteria | 1115 |
| 612 | Ga0495685_107816 | 3300047447 | Bacteria | 918 |
| 613 | Ga0495673_0142865 | 3300047469 | Bacteria | 931 |
| 614 | Ga0495681_0000492 | 3300047470 | Bacteria | 30331 |
| 615 | Ga0495681_0001563 | 3300047470 | Bacteria | 17059 |
| 616 | Ga0495681_0017548 | 3300047470 | Bacteria | 3970 |
| 617 | Ga0495681_0025124 | 3300047470 | Bacteria | 3122 |
| 618 | Ga0495681_0025339 | 3300047470 | Bacteria | 3103 |
| 619 | Ga0495681_0026883 | 3300047470 | Bacteria | 2986 |
| 620 | Ga0495681_0044411 | 3300047470 | Bacteria | 2136 |
| 621 | Ga0495681_0063432 | 3300047470 | Bacteria | 1695 |
| 622 | Ga0495681_0074434 | 3300047470 | Bacteria | 1531 |
| 623 | Ga0495681_0081388 | 3300047470 | Bacteria | 1445 |
| 624 | Ga0495681_0092044 | 3300047470 | Bacteria | 1337 |
| 625 | Ga0495686_0000212 | 3300047472 | Bacteria | 107418 |
| 626 | Ga0495686_0078714 | 3300047472 | Bacteria | 2017 |
| 627 | Ga0495686_0284241 | 3300047472 | Bacteria | 918 |
| 628 | Ga0495593_0000718 | 3300047673 | Bacteria | 19183 |
| 629 | Ga0495593_0003558 | 3300047673 | Bacteria | 9319 |
| 630 | Ga0495593_0012089 | 3300047673 | Bacteria | 4945 |
| 631 | Ga0495602_0014797 | 3300048088 | Bacteria | 7902 |
| 632 | Ga0495602_0072042 | 3300048088 | Bacteria | 2948 |
| 633 | Ga0495602_0301866 | 3300048088 | Bacteria | 1171 |
| 634 | Ga0495614_0002108 | 3300048089 | Bacteria | 8788 |
| 635 | Ga0495614_0067855 | 3300048089 | Bacteria | 1535 |
| 636 | Ga0495626_0000091 | 3300048091 | Bacteria | 118146 |
| 637 | Ga0495626_0001300 | 3300048091 | Bacteria | 20374 |
| 638 | Ga0495626_0001323 | 3300048091 | Bacteria | 20181 |
| 639 | Ga0495626_0001696 | 3300048091 | Bacteria | 16944 |
| 640 | Ga0495626_0003084 | 3300048091 | Bacteria | 10926 |
| 641 | Ga0495626_0003608 | 3300048091 | Bacteria | 9843 |
| 642 | Ga0495626_0005721 | 3300048091 | Bacteria | 7185 |
| 643 | Ga0495626_0006943 | 3300048091 | Bacteria | 6376 |
| 644 | Ga0495626_0007580 | 3300048091 | Bacteria | 6022 |
| 645 | Ga0495626_0011287 | 3300048091 | Bacteria | 4730 |
| 646 | Ga0495626_0020420 | 3300048091 | Bacteria | 3302 |
| 647 | Ga0495626_0044467 | 3300048091 | Bacteria | 2078 |
| 648 | Ga0495626_0058144 | 3300048091 | Bacteria | 1767 |
| 649 | Ga0495626_0070769 | 3300048091 | Bacteria | 1568 |
| 650 | Ga0495626_0094229 | 3300048091 | Bacteria | 1313 |
| 651 | Ga0495626_0246161 | 3300048091 | Bacteria | 718 |
| 652 | Ga0496100_0620286 | 3300048903 | Bacteria | 841 |
| 653 | Ga0496101_0308363 | 3300048904 | Bacteria | 1240 |
| 654 | Ga0496102_0002631 | 3300048905 | Bacteria | 15257 |
| 655 | Ga0496102_0022169 | 3300048905 | Bacteria | 5626 |
| 656 | Ga0496102_0030638 | 3300048905 | Bacteria | 4816 |
| 657 | Ga0496102_0108826 | 3300048905 | Bacteria | 2582 |
| 658 | Ga0496102_0256956 | 3300048905 | Bacteria | 1647 |
| 659 | Ga0496103_0574767 | 3300048906 | Bacteria | 719 |
| 660 | Ga0496104_1536541 | 3300048907 | Bacteria | 568 |
| 661 | Ga0496105_0265442 | 3300048908 | Bacteria | 1387 |
| 662 | Ga0496106_0018180 | 3300048909 | Bacteria | 5199 |
| 663 | Ga0496107_0036400 | 3300048910 | Bacteria | 3530 |
| 664 | Ga0496107_0072777 | 3300048910 | Bacteria | 2499 |
| 665 | Ga0496107_0769895 | 3300048910 | Bacteria | 706 |
| 666 | Ga0496108_0134274 | 3300048911 | Bacteria | 2128 |
| 667 | Ga0496108_1077971 | 3300048911 | Bacteria | 683 |
| 668 | Ga0496109_0001356 | 3300048912 | Bacteria | 20273 |
| 669 | Ga0496109_0104687 | 3300048912 | Bacteria | 2628 |
| 670 | Ga0496109_0178136 | 3300048912 | Bacteria | 1996 |
| 671 | Ga0496109_0645637 | 3300048912 | Bacteria | 995 |
| 672 | Ga0496110_0000332 | 3300048913 | Bacteria | 31569 |
| 673 | Ga0496110_0776304 | 3300048913 | Bacteria | 862 |
| 674 | Ga0496110_1104498 | 3300048913 | Unclassified | 701 |
| 675 | Ga0496111_0029424 | 3300048914 | Bacteria | 3902 |
| 676 | Ga0496111_0143379 | 3300048914 | Bacteria | 1770 |
| 677 | Ga0496113_0007319 | 3300048916 | Bacteria | 7087 |
| 678 | Ga0496113_0010007 | 3300048916 | Bacteria | 6252 |
| 679 | Ga0496113_0747294 | 3300048916 | Bacteria | 779 |
| 680 | Ga0496114_0507178 | 3300048917 | Bacteria | 1067 |
| 681 | Ga0496115_0002247 | 3300048918 | Bacteria | 13817 |
| 682 | Ga0496115_0304853 | 3300048918 | Bacteria | 1305 |
| 683 | Ga0496116_0013932 | 3300048919 | Bacteria | 6445 |
| 684 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 685 | Ga0496117_0022328 | 3300048920 | Bacteria | 5079 |
| 686 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 687 | Ga0496118_0014354 | 3300048921 | Bacteria | 7424 |
| 688 | Ga0496121_0002914 | 3300048924 | Bacteria | 25098 |
| 689 | Ga0496121_0013102 | 3300048924 | Bacteria | 8949 |
| 690 | Ga0496122_0000731 | 3300048925 | Bacteria | 64230 |
| 691 | Ga0496122_0001727 | 3300048925 | Bacteria | 33871 |
| 692 | Ga0496122_0018146 | 3300048925 | Bacteria | 6517 |
| 693 | Ga0496122_0095521 | 3300048925 | Bacteria | 2008 |
| 694 | Ga0496122_0135608 | 3300048925 | Bacteria | 1552 |
| 695 | Ga0496122_0248151 | 3300048925 | Bacteria | 998 |
| 696 | Ga0496123_0001518 | 3300048926 | Bacteria | 32147 |
| 697 | Ga0496123_0004851 | 3300048926 | Bacteria | 13847 |
| 698 | Ga0496123_0006510 | 3300048926 | Bacteria | 11293 |
| 699 | Ga0496123_0022970 | 3300048926 | Bacteria | 4789 |
| 700 | Ga0496124_0002800 | 3300048927 | Bacteria | 22098 |
| 701 | Ga0496124_0005115 | 3300048927 | Bacteria | 14934 |
| 702 | Ga0496124_0011970 | 3300048927 | Bacteria | 8629 |
| 703 | Ga0496124_0042599 | 3300048927 | Bacteria | 3908 |
| 704 | Ga0496124_0081569 | 3300048927 | Bacteria | 2658 |
| 705 | Ga0496125_0001489 | 3300048928 | Bacteria | 33623 |
| 706 | Ga0496125_0047236 | 3300048928 | Bacteria | 3602 |
| 707 | Ga0496125_0284322 | 3300048928 | Bacteria | 1022 |
| 708 | Ga0496125_0341306 | 3300048928 | Bacteria | 899 |
| 709 | Ga0496126_0012212 | 3300048929 | Bacteria | 8812 |
| 710 | Ga0495678_000051 | 3300049459 | Bacteria | 159383 |
| 711 | Ga0495678_000082 | 3300049459 | Bacteria | 118148 |
| 712 | Ga0495678_000367 | 3300049459 | Bacteria | 46226 |
| 713 | Ga0495678_000696 | 3300049459 | Bacteria | 30577 |
| 714 | Ga0495678_001406 | 3300049459 | Bacteria | 19057 |
| 715 | Ga0495678_073569 | 3300049459 | Bacteria | 1245 |
| 716 | Ga0495678_112151 | 3300049459 | Bacteria | 928 |
| 717 | Ga0495682_0000458 | 3300049460 | Bacteria | 28126 |
| 718 | Ga0495682_0001968 | 3300049460 | Bacteria | 10163 |
| 719 | Ga0495682_0010556 | 3300049460 | Bacteria | 3572 |
| 720 | Ga0501035_0002051 | 3300049822 | Bacteria | 20072 |
| 721 | Ga0501044_0353344 | 3300049823 | Bacteria | 1389 |
| 722 | Ga0587070_037979 | 3300059491 | Bacteria | 908 |
| 723 | Ga0587082_019547 | 3300059504 | Bacteria | 1089 |
| 724 | Ga0587083_0049976 | 3300059505 | Bacteria | 908 |
| 725 | Ga0587088_009585 | 3300059508 | Bacteria | 1398 |
| 726 | Ga0466962_0145195 | 3300061719 | Bacteria | 1150 |
| 727 | 2509131881 | 2508501125 | Bacteria | 7208311 |
| 728 | 2527080235 | 2526164713 | Bacteria | 6780608 |
| 729 | 2601671268 | 2600255292 | Bacteria | 6300551 |
| 730 | 2643801722 | 2643221556 | Bacteria | 7251154 |
| 731 | 2644474503 | 2643221684 | Bacteria | 7145183 |
| 732 | 2723876978 | 2721755763 | Bacteria | 4464185 |
| 733 | 2738824255 | 2738541296 | Bacteria | 7285013 |
| 734 | 2738836664 | 2738541298 | Bacteria | 7286732 |
| 735 | 2738878195 | 2738541306 | Bacteria | 7284992 |
| 736 | 2739189887 | 2738543002 | Bacteria | 7284546 |
| 737 | 2739224789 | 2738543008 | Bacteria | 7282815 |
| 738 | 2857548893 | 2857547612 | Bacteria | 6179999 |
| 739 | 2885085752 | 2885080285 | Bacteria | 6355622 |
| 740 | 2904489220 | 2904483920 | Bacteria | 7545285 |
| 741 | 2919476733 | 2919476304 | Bacteria | 5888696 |
| 742 | 2919529834 | 2919527303 | Bacteria | 7718827 |
| 743 | 2932415413 | 2932410948 | Bacteria | 6312192 |
| 744 | 2932421426 | 2932416698 | Bacteria | 6315112 |
| 745 | 2945938272 | 2945934425 | Bacteria | 7444609 |
| 746 | 2990708271 | 2990703756 | Bacteria | 7715990 |
| 747 | 8047676288 | 8047673197 | Bacteria | 7395230 |
| 748 | 8055272605 | 8055266321 | Bacteria | 7999742 |
| 749 | Ga0495683_0047425 | |||
| 750 | JGI24740J21852_10015455 | |||
| 751 | JGI24739J22299_10005837 | |||
| 752 | JGI24735J21928_10003220 | |||
| 753 | JGI25156J39149_1000642 | |||
| 754 | JGI25153J46596_10037879 | |||
| 755 | rootL2_10078556 | |||
| 756 | rootL2_10181157 | |||
| 757 | Ga0055533_1000223 | |||
| 758 | Ga0055532_1000140 | |||
| 759 | Ga0055525_1000023 | |||
| 760 | Ga0055525_1005287 | |||
| 761 | Ga0055527_1000089 | |||
| 762 | Ga0055535_1000164 | |||
| 763 | Ga0055542_1000208 | |||
| 764 | Ga0055542_1018413 | |||
| 765 | Ga0055529_1000227 | |||
| 766 | Ga0055526_1001413 | |||
| 767 | Ga0065165_1000578 | |||
| 768 | Ga0065165_1044889 | |||
| 769 | Ga0070658_10065225 | |||
| 770 | Ga0070658_10121300 | |||
| 771 | Ga0070658_10360858 | |||
| 772 | Ga0070658_10383186 | |||
| 773 | Ga0070676_10140485 | |||
| 774 | Ga0070682_100013339 | |||
| 775 | Ga0070660_100048314 | |||
| 776 | Ga0070660_100079497 | |||
| 777 | Ga0070660_100173299 | |||
| 778 | Ga0070660_100559514 | |||
| 779 | Ga0070661_100017303 | |||
| 780 | Ga0070659_100045623 | |||
| 781 | Ga0070659_100147485 | |||
| 782 | Ga0070663_100067704 | |||
| 783 | Ga0070662_100068715 | |||
| 784 | Ga0068855_100050457 | |||
| 785 | Ga0068855_100306940 | |||
| 786 | Ga0070664_100043706 | |||
| 787 | Ga0070664_101259068 | |||
| 788 | Ga0068851_10139159 | |||
| 789 | Ga0079104_1008864 | |||
| 790 | Ga0079104_1015197 | |||
| 791 | Ga0105240_10369321 | |||
| 792 | Ga0105245_10143871 | |||
| 793 | Ga0105243_10013152 | |||
| 794 | Ga0105241_10016732 | |||
| 795 | Ga0105241_10053471 | |||
| 796 | Ga0105242_10011323 | |||
| 797 | Ga0105237_11261861 | |||
| 798 | Ga0105238_10893887 | |||
| 799 | Ga0105239_10241143 | |||
| 800 | Ga0105239_11048096 | |||
| 801 | Ga0105246_10060506 | |||
| 802 | Ga0157373_10037708 | |||
| 803 | Ga0157371_10000003 | |||
| 804 | Ga0157369_10041563 | |||
| 805 | Ga0157378_10159200 | |||
| 806 | Ga0157372_10470147 | |||
| 807 | Ga0157372_10477848 | |||
| 808 | Ga0182008_10000333 | |||
| 809 | Ga0182008_10022318 | |||
| 810 | Ga0182008_10032363 | |||
| 811 | Ga0182008_10081506 | |||
| 812 | Ga0182008_10092100 | |||
| 813 | Ga0182006_1000007 | |||
| 814 | Ga0182006_1000059 | |||
| 815 | Ga0182006_1039465 | |||
| 816 | Ga0182007_10000120 | |||
| 817 | Ga0182005_1000006 | |||
| 818 | Ga0182005_1000010 | |||
| 819 | Ga0163161_10006100 | |||
| 820 | Ga0209674_100020 | |||
| 821 | Ga0209672_100013 | |||
| 822 | Ga0209147_100013 | |||
| 823 | Ga0209563_100011 | |||
| 824 | Ga0209563_101319 | |||
| 825 | Ga0207427_100967 | |||
| 826 | Ga0209258_100328 | |||
| 827 | Ga0209677_102359 | |||
| 828 | Ga0209148_1000020 | |||
| 829 | Ga0209148_1000271 | |||
| 830 | Ga0209759_1000279 | |||
| 831 | Ga0209759_1000315 | |||
| 832 | Ga0209233_1000294 | |||
| 833 | Ga0209455_1000017 | |||
| 834 | Ga0207645_10148417 | |||
| 835 | Ga0207705_10001752 | |||
| 836 | Ga0207705_10008251 | |||
| 837 | Ga0207654_10056604 | |||
| 838 | Ga0207695_10243081 | |||
| 839 | Ga0207657_10010163 | |||
| 840 | Ga0207657_10087337 | |||
| 841 | Ga0207649_10403644 | |||
| 842 | Ga0207690_10547655 | |||
| 843 | Ga0207706_10040679 | |||
| 844 | Ga0207686_10008517 | |||
| 845 | Ga0207709_10061620 | |||
| 846 | Ga0207689_10235867 | |||
| 847 | Ga0207679_10169222 | |||
| 848 | Ga0207679_10246071 | |||
| 849 | Ga0207667_10021087 | |||
| 850 | Ga0207667_10267962 | |||
| 851 | Ga0207678_10240666 | |||
| 852 | Ga0207675_100492760 | |||
| 853 | Ga0207698_10165534 | |||
| 854 | Ga0209281_1003179 | |||
| 855 | Ga0209281_1004335 | |||
| 856 | Ga0209281_1020263 | |||
| 857 | Ga0307408_100119454 | |||
| 858 | Ga0307518_10081426 | |||
| 859 | Ga0307412_10000002 | |||
| 860 | Ga0307414_10853938 | |||
| 861 | Ga0395899_0000019 | |||
| 862 | Ga0395899_0006940 | |||
| 863 | Ga0395899_0024172 | |||
| 864 | Ga0395899_0029194 | |||
| 865 | Ga0395899_0065495 | |||
| 866 | Ga0395899_0078826 | |||
| 867 | Ga0395899_0271272 | |||
| 868 | Ga0395899_0606615 | |||
| 869 | Ga0395900_0000094 | |||
| 870 | Ga0395900_0000689 | |||
| 871 | Ga0395900_0004719 | |||
| 872 | Ga0395900_0077274 | |||
| 873 | Ga0395900_0110095 | |||
| 874 | Ga0395900_0116909 | |||
| 875 | Ga0395900_0190969 | |||
| 876 | Ga0395900_0193682 | |||
| 877 | Ga0395900_0270338 | |||
| 878 | Ga0395900_0404015 | |||
| 879 | Ga0395900_0561045 | |||
| 880 | Ga0395900_0727080 | |||
| 881 | Ga0395900_0976674 | |||
| 882 | Ga0395898_0004656 | |||
| 883 | Ga0395898_0279555 | |||
| 884 | Ga0395898_0289519 | |||
| 885 | Ga0395898_0304039 | |||
| 886 | Ga0395898_0679776 | |||
| 887 | Ga0395898_1313286 | |||
| 888 | Ga0395898_1637749 | |||
| 889 | Ga0395905_0036810 | |||
| 890 | Ga0395905_0073035 | |||
| 891 | Ga0395905_0085934 | |||
| 892 | Ga0395905_0112203 | |||
| 893 | Ga0395905_0113425 | |||
| 894 | Ga0395905_0159623 | |||
| 895 | Ga0395905_0273988 | |||
| 896 | Ga0395905_0329045 | |||
| 897 | Ga0395905_0367163 | |||
| 898 | Ga0395901_0000448 | |||
| 899 | Ga0395901_0000884 | |||
| 900 | Ga0395901_0150191 | |||
| 901 | Ga0395901_0221286 | |||
| 902 | Ga0395901_0434821 | |||
| 903 | Ga0395901_0626750 | |||
| 904 | Ga0395901_0628943 | |||
| 905 | Ga0395901_0869312 | |||
| 906 | Ga0395901_0887188 | |||
| 907 | Ga0439448_0000123 | |||
| 908 | Ga0439448_0037796 | |||
| 909 | Ga0439450_003093 | |||
| 910 | Ga0439450_068785 | |||
| 911 | Ga0439450_082131 | |||
| 912 | Ga0439450_139493 | |||
| 913 | Ga0439455_0026950 | |||
| 914 | Ga0450911_003490 | |||
| 915 | Ga0450904_000074 | |||
| 916 | Ga0439458_0024616 | |||
| 917 | Ga0466969_0047829 | |||
| 918 | Ga0466969_0127776 | |||
| 919 | Ga0466969_0260740 | |||
| 920 | Ga0466972_0005995 | |||
| 921 | Ga0466982_0362274 | |||
| 922 | Ga0466965_0006435 | |||
| 923 | Ga0466965_0006873 | |||
| 924 | Ga0466965_0007121 | |||
| 925 | Ga0466965_0146966 | |||
| 926 | Ga0466965_0192555 | |||
| 927 | Ga0466965_0754065 | |||
| 928 | Ga0466966_0000999 | |||
| 929 | Ga0466966_0010626 | |||
| 930 | Ga0466966_0109781 | |||
| 931 | Ga0466966_0138466 | |||
| 932 | Ga0466966_0141400 | |||
| 933 | Ga0466966_0276365 | |||
| 934 | Ga0466961_0009272 | |||
| 935 | Ga0466961_0128831 | |||
| 936 | Ga0466961_0245241 | |||
| 937 | Ga0466961_0393337 | |||
| 938 | Ga0466963_0044035 | |||
| 939 | Ga0466964_0000189 | |||
| 940 | Ga0466964_0000291 | |||
| 941 | Ga0466964_0162095 | |||
| 942 | Ga0466971_0034716 | |||
| 943 | Ga0466971_0076650 | |||
| 944 | Ga0466971_0109299 | |||
| 945 | Ga0466968_0000291 | |||
| 946 | Ga0466968_0012729 | |||
| 947 | Ga0466968_0190918 | |||
| 948 | Ga0466970_0080396 | |||
| 949 | Ga0466970_0244748 | |||
| 950 | Ga0466970_0331516 | |||
| 951 | Ga0466957_0006423 | |||
| 952 | Ga0466957_0007450 | |||
| 953 | Ga0466957_0060398 | |||
| 954 | Ga0466957_0117986 | |||
| 955 | Ga0466957_0120487 | |||
| 956 | Ga0466957_0224320 | |||
| 957 | Ga0466960_0164692 | |||
| 958 | Ga0466959_0007591 | |||
| 959 | Ga0466959_0048218 | |||
| 960 | Ga0466959_0271798 | |||
| 961 | Ga0466959_0350610 | |||
| 962 | Ga0466959_0496019 | |||
| 963 | Ga0466959_0770947 | |||
| 964 | Ga0466958_0012065 | |||
| 965 | Ga0466958_0039876 | |||
| 966 | Ga0466958_0523187 | |||
| 967 | Ga0466958_1155774 | |||
| 968 | Ga0466967_0004562 | |||
| 969 | Ga0466967_0037707 | |||
| 970 | Ga0495617_000025 | |||
| 971 | Ga0495617_050972 | |||
| 972 | Ga0495627_000004 | |||
| 973 | Ga0495627_011200 | |||
| 974 | Ga0495603_0016290 | |||
| 975 | Ga0495603_0042700 | |||
| 976 | Ga0495590_0000038 | |||
| 977 | Ga0495590_0002388 | |||
| 978 | Ga0495590_0009780 | |||
| 979 | Ga0495590_0012669 | |||
| 980 | Ga0495590_0029341 | |||
| 981 | Ga0495591_000034 | |||
| 982 | Ga0495629_0006447 | |||
| 983 | Ga0495629_0122801 | |||
| 984 | Ga0495638_0015576 | |||
| 985 | Ga0495638_0129329 | |||
| 986 | Ga0495653_0061804 | |||
| 987 | Ga0495653_0246519 | |||
| 988 | Ga0495650_0000062 | |||
| 989 | Ga0495650_0005211 | |||
| 990 | Ga0495650_0009778 | |||
| 991 | Ga0495580_0018980 | |||
| 992 | Ga0495582_0016188 | |||
| 993 | Ga0495582_0046284 | |||
| 994 | Ga0495582_0686869 | |||
| 995 | Ga0495605_0000225 | |||
| 996 | Ga0495605_0001346 | |||
| 997 | Ga0495605_0012260 | |||
| 998 | Ga0495605_0020204 | |||
| 999 | Ga0495605_0021016 | |||
| 1000 | Ga0495605_0025644 | |||
| 1001 | Ga0495605_0036001 | |||
| 1002 | Ga0495605_0037361 | |||
| 1003 | Ga0495605_0047843 | |||
| 1004 | Ga0495605_0136469 | |||
| 1005 | Ga0495605_0137563 | |||
| 1006 | Ga0495584_0000395 | |||
| 1007 | Ga0495584_0000681 | |||
| 1008 | Ga0495584_0000807 | |||
| 1009 | Ga0495584_0006122 | |||
| 1010 | Ga0495584_0061398 | |||
| 1011 | Ga0495584_0073313 | |||
| 1012 | Ga0495584_0074474 | |||
| 1013 | Ga0495584_0092148 | |||
| 1014 | Ga0495584_0125458 | |||
| 1015 | Ga0495584_0128809 | |||
| 1016 | Ga0495584_0160771 | |||
| 1017 | Ga0495584_0337291 | |||
| 1018 | Ga0495585_0000822 | |||
| 1019 | Ga0495585_0003937 | |||
| 1020 | Ga0495585_0005132 | |||
| 1021 | Ga0495585_0018964 | |||
| 1022 | Ga0495585_0062673 | |||
| 1023 | Ga0495585_0088999 | |||
| 1024 | Ga0495585_0101233 | |||
| 1025 | Ga0495585_0104955 | |||
| 1026 | Ga0495585_0116096 | |||
| 1027 | Ga0495585_0154994 | |||
| 1028 | Ga0495594_0005281 | |||
| 1029 | Ga0495594_0006886 | |||
| 1030 | Ga0495594_0017042 | |||
| 1031 | Ga0495594_0024361 | |||
| 1032 | Ga0495594_0029394 | |||
| 1033 | Ga0495594_0102613 | |||
| 1034 | Ga0495596_0000907 | |||
| 1035 | Ga0495596_0002970 | |||
| 1036 | Ga0495596_0008594 | |||
| 1037 | Ga0495596_0019205 | |||
| 1038 | Ga0495596_0024745 | |||
| 1039 | Ga0495596_0046393 | |||
| 1040 | Ga0495596_0081832 | |||
| 1041 | Ga0495596_0134264 | |||
| 1042 | Ga0495607_0001804 | |||
| 1043 | Ga0495607_0003494 | |||
| 1044 | Ga0495607_0004655 | |||
| 1045 | Ga0495607_0007064 | |||
| 1046 | Ga0495607_0022504 | |||
| 1047 | Ga0495607_0120571 | |||
| 1048 | Ga0495583_0001103 | |||
| 1049 | Ga0495583_0001692 | |||
| 1050 | Ga0495583_0008038 | |||
| 1051 | Ga0495583_0009401 | |||
| 1052 | Ga0495583_0009900 | |||
| 1053 | Ga0495583_0018486 | |||
| 1054 | Ga0495583_0038344 | |||
| 1055 | Ga0495583_0082961 | |||
| 1056 | Ga0495583_0093466 | |||
| 1057 | Ga0495583_0113944 | |||
| 1058 | Ga0495606_0000093 | |||
| 1059 | Ga0495606_0036942 | |||
| 1060 | Ga0495606_0047104 | |||
| 1061 | Ga0495606_0050794 | |||
| 1062 | Ga0495606_0051616 | |||
| 1063 | Ga0495606_0084847 | |||
| 1064 | Ga0495606_0086388 | |||
| 1065 | Ga0495606_0119114 | |||
| 1066 | Ga0495606_0175493 | |||
| 1067 | Ga0495606_0186651 | |||
| 1068 | Ga0495606_0260848 | |||
| 1069 | Ga0495606_0306985 | |||
| 1070 | Ga0495606_0374589 | |||
| 1071 | Ga0495610_0000775 | |||
| 1072 | Ga0495610_0004317 | |||
| 1073 | Ga0495610_0034371 | |||
| 1074 | Ga0495610_0295800 | |||
| 1075 | Ga0495616_0000043 | |||
| 1076 | Ga0495616_0000370 | |||
| 1077 | Ga0495616_0000417 | |||
| 1078 | Ga0495616_0005384 | |||
| 1079 | Ga0495616_0006444 | |||
| 1080 | Ga0495616_0006660 | |||
| 1081 | Ga0495616_0054665 | |||
| 1082 | Ga0495616_0078234 | |||
| 1083 | Ga0495616_0100002 | |||
| 1084 | Ga0495616_0132333 | |||
| 1085 | Ga0495630_0041994 | |||
| 1086 | Ga0495631_0000881 | |||
| 1087 | Ga0495631_0000957 | |||
| 1088 | Ga0495631_0005111 | |||
| 1089 | Ga0495631_0007328 | |||
| 1090 | Ga0495631_0007494 | |||
| 1091 | Ga0495631_0009911 | |||
| 1092 | Ga0495631_0010975 | |||
| 1093 | Ga0495631_0016120 | |||
| 1094 | Ga0495631_0024858 | |||
| 1095 | Ga0495631_0046343 | |||
| 1096 | Ga0495631_0050968 | |||
| 1097 | Ga0495631_0130298 | |||
| 1098 | Ga0495631_0173395 | |||
| 1099 | Ga0495631_0348084 | |||
| 1100 | Ga0495632_0000297 | |||
| 1101 | Ga0495632_0000510 | |||
| 1102 | Ga0495632_0002285 | |||
| 1103 | Ga0495632_0046824 | |||
| 1104 | Ga0495632_0055054 | |||
| 1105 | Ga0495632_0084517 | |||
| 1106 | Ga0495632_0164787 | |||
| 1107 | Ga0495637_0000003 | |||
| 1108 | Ga0495637_0014049 | |||
| 1109 | Ga0495637_0212172 | |||
| 1110 | Ga0495637_0301436 | |||
| 1111 | Ga0495643_0001206 | |||
| 1112 | Ga0495643_0002954 | |||
| 1113 | Ga0495643_0008101 | |||
| 1114 | Ga0495643_0009092 | |||
| 1115 | Ga0495643_0026095 | |||
| 1116 | Ga0495643_0026791 | |||
| 1117 | Ga0495643_0074736 | |||
| 1118 | Ga0495643_0092241 | |||
| 1119 | Ga0495643_0102826 | |||
| 1120 | Ga0495643_0335461 | |||
| 1121 | Ga0495644_0007661 | |||
| 1122 | Ga0495644_0008459 | |||
| 1123 | Ga0495644_0014026 | |||
| 1124 | Ga0495644_0056583 | |||
| 1125 | Ga0495648_0005746 | |||
| 1126 | Ga0495648_0021065 | |||
| 1127 | Ga0495648_0036264 | |||
| 1128 | Ga0495648_0219433 | |||
| 1129 | Ga0495663_0038253 | |||
| 1130 | Ga0495666_0002358 | |||
| 1131 | Ga0495666_0013387 | |||
| 1132 | Ga0495666_0489099 | |||
| 1133 | Ga0495642_0000405 | |||
| 1134 | Ga0495642_0000546 | |||
| 1135 | Ga0495642_0002111 | |||
| 1136 | Ga0495642_0006821 | |||
| 1137 | Ga0495642_0017958 | |||
| 1138 | Ga0495642_0019499 | |||
| 1139 | Ga0495642_0024293 | |||
| 1140 | Ga0495642_0039431 | |||
| 1141 | Ga0495642_0048195 | |||
| 1142 | Ga0495642_0059988 | |||
| 1143 | Ga0495642_0067352 | |||
| 1144 | Ga0495642_0128587 | |||
| 1145 | Ga0495642_0237462 | |||
| 1146 | Ga0495642_0268531 | |||
| 1147 | Ga0495654_0001583 | |||
| 1148 | Ga0495654_0001792 | |||
| 1149 | Ga0495654_0085074 | |||
| 1150 | Ga0495654_0185548 | |||
| 1151 | Ga0495665_0003930 | |||
| 1152 | Ga0495665_0019447 | |||
| 1153 | Ga0495665_0022427 | |||
| 1154 | Ga0495640_0015932 | |||
| 1155 | Ga0495586_0004928 | |||
| 1156 | Ga0495586_0008647 | |||
| 1157 | Ga0495586_0136176 | |||
| 1158 | Ga0495586_0142847 | |||
| 1159 | Ga0495587_0077778 | |||
| 1160 | Ga0495587_0235698 | |||
| 1161 | Ga0495609_0000078 | |||
| 1162 | Ga0495609_0003457 | |||
| 1163 | Ga0495609_0013728 | |||
| 1164 | Ga0495609_0033800 | |||
| 1165 | Ga0495609_0036255 | |||
| 1166 | Ga0495609_0072563 | |||
| 1167 | Ga0495609_0077018 | |||
| 1168 | Ga0495609_0123086 | |||
| 1169 | Ga0495597_0000475 | |||
| 1170 | Ga0495597_0000794 | |||
| 1171 | Ga0495597_0003224 | |||
| 1172 | Ga0495597_0005885 | |||
| 1173 | Ga0495597_0020732 | |||
| 1174 | Ga0495597_0029619 | |||
| 1175 | Ga0495597_0048892 | |||
| 1176 | Ga0495597_0070625 | |||
| 1177 | Ga0495597_0117489 | |||
| 1178 | Ga0495597_0140043 | |||
| 1179 | Ga0495645_0092231 | |||
| 1180 | Ga0495622_0014461 | |||
| 1181 | Ga0495622_0024122 | |||
| 1182 | Ga0495622_0051769 | |||
| 1183 | Ga0495622_0057247 | |||
| 1184 | Ga0495622_0098404 | |||
| 1185 | Ga0495622_0103816 | |||
| 1186 | Ga0495622_0180673 | |||
| 1187 | Ga0495633_0000443 | |||
| 1188 | Ga0495633_0001067 | |||
| 1189 | Ga0495633_0006429 | |||
| 1190 | Ga0495633_0007748 | |||
| 1191 | Ga0495633_0021717 | |||
| 1192 | Ga0495633_0033879 | |||
| 1193 | Ga0495633_0036597 | |||
| 1194 | Ga0495633_0076116 | |||
| 1195 | Ga0495633_0095529 | |||
| 1196 | Ga0495633_0121032 | |||
| 1197 | Ga0495633_0158071 | |||
| 1198 | Ga0495656_0047037 | |||
| 1199 | Ga0495656_0221939 | |||
| 1200 | Ga0495656_0232093 | |||
| 1201 | Ga0495668_0000420 | |||
| 1202 | Ga0495668_0000933 | |||
| 1203 | Ga0495668_0017290 | |||
| 1204 | Ga0495668_0018794 | |||
| 1205 | Ga0495668_0020824 | |||
| 1206 | Ga0495668_0025878 | |||
| 1207 | Ga0495668_0030245 | |||
| 1208 | Ga0495668_0389482 | |||
| 1209 | Ga0495668_0451521 | |||
| 1210 | Ga0495611_0000388 | |||
| 1211 | Ga0495611_0011746 | |||
| 1212 | Ga0495611_0012061 | |||
| 1213 | Ga0495611_0022992 | |||
| 1214 | Ga0495611_0061675 | |||
| 1215 | Ga0495625_0004117 | |||
| 1216 | Ga0495625_0024983 | |||
| 1217 | Ga0495625_0093137 | |||
| 1218 | Ga0495625_0236341 | |||
| 1219 | Ga0495625_0289274 | |||
| 1220 | Ga0495635_0001885 | |||
| 1221 | Ga0495661_0000721 | |||
| 1222 | Ga0495661_0000959 | |||
| 1223 | Ga0495661_0001149 | |||
| 1224 | Ga0495661_0001465 | |||
| 1225 | Ga0495661_0036389 | |||
| 1226 | Ga0495661_0045929 | |||
| 1227 | Ga0495661_0065192 | |||
| 1228 | Ga0495661_0076974 | |||
| 1229 | Ga0495661_0085317 | |||
| 1230 | Ga0495661_0123973 | |||
| 1231 | Ga0495661_0164919 | |||
| 1232 | Ga0495661_0236712 | |||
| 1233 | Ga0495588_0000091 | |||
| 1234 | Ga0495588_0002124 | |||
| 1235 | Ga0495588_0006949 | |||
| 1236 | Ga0495588_0009015 | |||
| 1237 | Ga0495588_0010383 | |||
| 1238 | Ga0495588_0026607 | |||
| 1239 | Ga0495588_0031393 | |||
| 1240 | Ga0495588_0059740 | |||
| 1241 | Ga0495588_0080808 | |||
| 1242 | Ga0495588_0121520 | |||
| 1243 | Ga0495623_0008295 | |||
| 1244 | Ga0495623_0014569 | |||
| 1245 | Ga0495623_0312333 | |||
| 1246 | Ga0495646_0379515 | |||
| 1247 | Ga0495669_0001144 | |||
| 1248 | Ga0495669_0007932 | |||
| 1249 | Ga0495669_0101822 | |||
| 1250 | Ga0495669_0138184 | |||
| 1251 | Ga0495669_0238131 | |||
| 1252 | Ga0495669_0288520 | |||
| 1253 | Ga0495669_0446733 | |||
| 1254 | Ga0495613_0005690 | |||
| 1255 | Ga0495613_0030514 | |||
| 1256 | Ga0495613_0267154 | |||
| 1257 | Ga0495624_0059411 | |||
| 1258 | Ga0495670_0000118 | |||
| 1259 | Ga0495670_0011852 | |||
| 1260 | Ga0495670_0053945 | |||
| 1261 | Ga0495670_0059599 | |||
| 1262 | Ga0495670_0095850 | |||
| 1263 | Ga0495670_0107355 | |||
| 1264 | Ga0495671_0002501 | |||
| 1265 | Ga0495671_0002870 | |||
| 1266 | Ga0495671_0007516 | |||
| 1267 | Ga0495671_0048513 | |||
| 1268 | Ga0495671_0059517 | |||
| 1269 | Ga0495671_0085547 | |||
| 1270 | Ga0495671_0202776 | |||
| 1271 | Ga0495649_0000283 | |||
| 1272 | Ga0495649_0001108 | |||
| 1273 | Ga0495649_0002571 | |||
| 1274 | Ga0495649_0002828 | |||
| 1275 | Ga0495649_0009423 | |||
| 1276 | Ga0495649_0045190 | |||
| 1277 | Ga0495649_0118717 | |||
| 1278 | Ga0495649_0184689 | |||
| 1279 | Ga0495589_0000031 | |||
| 1280 | Ga0495589_0000688 | |||
| 1281 | Ga0495589_0000741 | |||
| 1282 | Ga0495589_0020954 | |||
| 1283 | Ga0495589_0044417 | |||
| 1284 | Ga0495589_0046084 | |||
| 1285 | Ga0495589_0047300 | |||
| 1286 | Ga0495600_0004015 | |||
| 1287 | Ga0495600_0446594 | |||
| 1288 | Ga0495660_0000435 | |||
| 1289 | Ga0495660_0000935 | |||
| 1290 | Ga0495660_0001936 | |||
| 1291 | Ga0495660_0017835 | |||
| 1292 | Ga0495660_0021081 | |||
| 1293 | Ga0495660_0027333 | |||
| 1294 | Ga0495660_0033968 | |||
| 1295 | Ga0495660_0063697 | |||
| 1296 | Ga0495581_0028695 | |||
| 1297 | Ga0495581_0033274 | |||
| 1298 | Ga0495581_0046793 | |||
| 1299 | Ga0495581_0058414 | |||
| 1300 | Ga0495604_0002704 | |||
| 1301 | Ga0495604_0008484 | |||
| 1302 | Ga0495604_0028353 | |||
| 1303 | Ga0495604_0090103 | |||
| 1304 | Ga0495604_0217396 | |||
| 1305 | Ga0495674_0010892 | |||
| 1306 | Ga0495674_0033326 | |||
| 1307 | Ga0495674_0110155 | |||
| 1308 | Ga0495672_0000088 | |||
| 1309 | Ga0495672_0000089 | |||
| 1310 | Ga0495672_0000197 | |||
| 1311 | Ga0495672_0000656 | |||
| 1312 | Ga0495672_0004884 | |||
| 1313 | Ga0495672_0027764 | |||
| 1314 | Ga0495672_0047870 | |||
| 1315 | Ga0495672_0088159 | |||
| 1316 | Ga0495672_0117942 | |||
| 1317 | Ga0495676_0018368 | |||
| 1318 | Ga0495676_0098231 | |||
| 1319 | Ga0495676_0117030 | |||
| 1320 | Ga0495680_0011874 | |||
| 1321 | Ga0495680_0400796 | |||
| 1322 | Ga0495683_0000052 | |||
| 1323 | Ga0495683_0000597 | |||
| 1324 | Ga0495683_0017482 | |||
| 1325 | Ga0495683_0021932 | |||
| 1326 | Ga0495683_0027162 | |||
| 1327 | Ga0495683_0104999 | |||
| 1328 | Ga0495683_0127563 | |||
| 1329 | Ga0495683_0228168 | |||
| 1330 | Ga0495683_0253972 | |||
| 1331 | Ga0495687_000257 | |||
| 1332 | Ga0495687_001414 | |||
| 1333 | Ga0495687_001823 | |||
| 1334 | Ga0495687_002092 | |||
| 1335 | Ga0495687_006800 | |||
| 1336 | Ga0495687_010400 | |||
| 1337 | Ga0495687_104736 | |||
| 1338 | Ga0495687_129592 | |||
| 1339 | Ga0495687_139570 | |||
| 1340 | Ga0495675_0001177 | |||
| 1341 | Ga0495675_0011609 | |||
| 1342 | Ga0495675_0051724 | |||
| 1343 | Ga0495677_0000219 | |||
| 1344 | Ga0495677_0000310 | |||
| 1345 | Ga0495677_0002073 | |||
| 1346 | Ga0495677_0004052 | |||
| 1347 | Ga0495677_0012802 | |||
| 1348 | Ga0495677_0020798 | |||
| 1349 | Ga0495677_0025233 | |||
| 1350 | Ga0495677_0030975 | |||
| 1351 | Ga0495677_0069217 | |||
| 1352 | Ga0495677_0072753 | |||
| 1353 | Ga0495677_0075217 | |||
| 1354 | Ga0495679_004495 | |||
| 1355 | Ga0495679_006080 | |||
| 1356 | Ga0495685_000614 | |||
| 1357 | Ga0495685_005050 | |||
| 1358 | Ga0495685_017470 | |||
| 1359 | Ga0495685_076763 | |||
| 1360 | Ga0495685_107816 | |||
| 1361 | Ga0495673_0142865 | |||
| 1362 | Ga0495681_0000492 | |||
| 1363 | Ga0495681_0001563 | |||
| 1364 | Ga0495681_0017548 | |||
| 1365 | Ga0495681_0025124 | |||
| 1366 | Ga0495681_0025339 | |||
| 1367 | Ga0495681_0026883 | |||
| 1368 | Ga0495681_0044411 | |||
| 1369 | Ga0495681_0063432 | |||
| 1370 | Ga0495681_0074434 | |||
| 1371 | Ga0495681_0081388 | |||
| 1372 | Ga0495681_0092044 | |||
| 1373 | Ga0495686_0000212 | |||
| 1374 | Ga0495686_0078714 | |||
| 1375 | Ga0495686_0284241 | |||
| 1376 | Ga0495593_0000718 | |||
| 1377 | Ga0495593_0003558 | |||
| 1378 | Ga0495593_0012089 | |||
| 1379 | Ga0495602_0014797 | |||
| 1380 | Ga0495602_0072042 | |||
| 1381 | Ga0495602_0301866 | |||
| 1382 | Ga0495614_0002108 | |||
| 1383 | Ga0495614_0067855 | |||
| 1384 | Ga0495626_0000091 | |||
| 1385 | Ga0495626_0001300 | |||
| 1386 | Ga0495626_0001323 | |||
| 1387 | Ga0495626_0001696 | |||
| 1388 | Ga0495626_0003084 | |||
| 1389 | Ga0495626_0003608 | |||
| 1390 | Ga0495626_0005721 | |||
| 1391 | Ga0495626_0006943 | |||
| 1392 | Ga0495626_0007580 | |||
| 1393 | Ga0495626_0011287 | |||
| 1394 | Ga0495626_0020420 | |||
| 1395 | Ga0495626_0044467 | |||
| 1396 | Ga0495626_0058144 | |||
| 1397 | Ga0495626_0070769 | |||
| 1398 | Ga0495626_0094229 | |||
| 1399 | Ga0495626_0246161 | |||
| 1400 | Ga0496100_0620286 | |||
| 1401 | Ga0496101_0308363 | |||
| 1402 | Ga0496102_0002631 | |||
| 1403 | Ga0496102_0022169 | |||
| 1404 | Ga0496102_0030638 | |||
| 1405 | Ga0496102_0108826 | |||
| 1406 | Ga0496102_0256956 | |||
| 1407 | Ga0496103_0574767 | |||
| 1408 | Ga0496104_1536541 | |||
| 1409 | Ga0496105_0265442 | |||
| 1410 | Ga0496106_0018180 | |||
| 1411 | Ga0496107_0036400 | |||
| 1412 | Ga0496107_0072777 | |||
| 1413 | Ga0496107_0769895 | |||
| 1414 | Ga0496108_0134274 | |||
| 1415 | Ga0496108_1077971 | |||
| 1416 | Ga0496109_0001356 | |||
| 1417 | Ga0496109_0104687 | |||
| 1418 | Ga0496109_0178136 | |||
| 1419 | Ga0496109_0645637 | |||
| 1420 | Ga0496110_0000332 | |||
| 1421 | Ga0496110_0776304 | |||
| 1422 | Ga0496110_1104498 | |||
| 1423 | Ga0496111_0029424 | |||
| 1424 | Ga0496111_0143379 | |||
| 1425 | Ga0496113_0007319 | |||
| 1426 | Ga0496113_0010007 | |||
| 1427 | Ga0496113_0747294 | |||
| 1428 | Ga0496114_0507178 | |||
| 1429 | Ga0496115_0002247 | |||
| 1430 | Ga0496115_0304853 | |||
| 1431 | Ga0496116_0013932 | |||
| 1432 | Ga0496117_0000005 | |||
| 1433 | Ga0496117_0022328 | |||
| 1434 | Ga0496118_0000022 | |||
| 1435 | Ga0496118_0014354 | |||
| 1436 | Ga0496121_0002914 | |||
| 1437 | Ga0496121_0013102 | |||
| 1438 | Ga0496122_0000731 | |||
| 1439 | Ga0496122_0001727 | |||
| 1440 | Ga0496122_0018146 | |||
| 1441 | Ga0496122_0095521 | |||
| 1442 | Ga0496122_0135608 | |||
| 1443 | Ga0496122_0248151 | |||
| 1444 | Ga0496123_0001518 | |||
| 1445 | Ga0496123_0004851 | |||
| 1446 | Ga0496123_0006510 | |||
| 1447 | Ga0496123_0022970 | |||
| 1448 | Ga0496124_0002800 | |||
| 1449 | Ga0496124_0005115 | |||
| 1450 | Ga0496124_0011970 | |||
| 1451 | Ga0496124_0042599 | |||
| 1452 | Ga0496124_0081569 | |||
| 1453 | Ga0496125_0001489 | |||
| 1454 | Ga0496125_0047236 | |||
| 1455 | Ga0496125_0284322 | |||
| 1456 | Ga0496125_0341306 | |||
| 1457 | Ga0496126_0012212 | |||
| 1458 | Ga0495678_000051 | |||
| 1459 | Ga0495678_000082 | |||
| 1460 | Ga0495678_000367 | |||
| 1461 | Ga0495678_000696 | |||
| 1462 | Ga0495678_001406 | |||
| 1463 | Ga0495678_073569 | |||
| 1464 | Ga0495678_112151 | |||
| 1465 | Ga0495682_0000458 | |||
| 1466 | Ga0495682_0001968 | |||
| 1467 | Ga0495682_0010556 | |||
| 1468 | Ga0501035_0002051 | |||
| 1469 | Ga0501044_0353344 | |||
| 1470 | Ga0587070_037979 | |||
| 1471 | Ga0587082_019547 | |||
| 1472 | Ga0587083_0049976 | |||
| 1473 | Ga0587088_009585 | |||
| 1474 | Ga0466962_0145195 | |||
| 1475 | 2509131881 | |||
| 1476 | 2527080235 | |||
| 1477 | 2601671268 | |||
| 1478 | 2643801722 | |||
| 1479 | 2644474503 | |||
| 1480 | 2723876978 | |||
| 1481 | 2738824255 | |||
| 1482 | 2738836664 | |||
| 1483 | 2738878195 | |||
| 1484 | 2739189887 | |||
| 1485 | 2739224789 | |||
| 1486 | 2857548893 | |||
| 1487 | 2885085752 | |||
| 1488 | 2904489220 | |||
| 1489 | 2919476733 | |||
| 1490 | 2919529834 | |||
| 1491 | 2932415413 | |||
| 1492 | 2932421426 | |||
| 1493 | 2945938272 | |||
| 1494 | 2990708271 | |||
| 1495 | 8047676288 | |||
| 1496 | 8055272605 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s0x-assembly2.cif.gz_B-2 | the crystal structure of gxgd membrane protease flak | 0.6716 | 12 | 171 |
| 3s0x-assembly2.cif.gz_B-2 | the crystal structure of gxgd membrane protease flak | 0.6109 | 12 | 171 |
| 3s0x-assembly1.cif.gz_A | the crystal structure of gxgd membrane protease flak | 0.5242 | 6 | 171 |
| 3s0x-assembly1.cif.gz_A | the crystal structure of gxgd membrane protease flak | 0.4947 | 6 | 171 |
| 6o6r-assembly1.cif.gz_A | structure of the trpm8 cold receptor by single particle electron cryo-microscopy, amtb-bound state | 0.2913 | 13 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y9M6_1_137_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7345 | 14 | 172 | 1.20.120.1220 |
| af_Q46836_122_264_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7292 | 6 | 170 | 1.20.120.1220 |
| af_Q46836_122_264_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7204 | 6 | 170 | 1.20.120.1220 |
| af_I6Y9M6_1_137_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7075 | 14 | 172 | 1.20.120.1220 |
| af_P81324_4_130_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6847 | 12 | 133 | 1.20.120.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A853QV74-F1-model_v4 | deleted | 0.9335 | 3 | 124 |
|
| AF-C0GDK4-F1-model_v4 | Peptidase A24A prepilin type IV | 0.9264 | 12 | 176 |
GO:0004190
GO:0005886 GO:0006465 |
| AF-A0A1Q6U246-F1-model_v4 | Prepilin type IV endopeptidase peptidase domain-containing protein | 0.9245 | 12 | 174 |
GO:0004190
GO:0016020 |
| AF-A0A2N2EUV7-F1-model_v4 | Prepilin type IV endopeptidase peptidase domain-containing protein | 0.9217 | 8 | 174 |
GO:0004190
GO:0005886 GO:0006465 |
| AF-A0A1I0YBB0-F1-model_v4 | Prepilin peptidase CpaA | 0.9204 | 14 | 171 |
GO:0004190
GO:0005886 GO:0006465 |