F478975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 748 | 394 | 712 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300047471|Ga0495684_0275602|Ga0495684_0275602_91_1086 |
| Length | 318 |
| Sequence | MTIAPPGFTSTSRFVITNGMRLHYHEAGPAGGDGAGTPVVLLHGGGPGASAWSNFGPNLPVFAGRFRTLMVDMPGFGRSDKPAVTGNYFTFAAGALAGLLGELGIGRVHLVGNSLGGGTAVRFALAHPERAGRLVLMGPGGLNLNVFAPDPTEGVKALAAFPADPTEEKLAAFLRTLVYDQRLITDELVKERFAAASDPAALAAMASLGASFFDPATAEQGMLWREAHRLRQDVLLIWGREDRVNPLDGALVALKLIRRAQLHVFSRCGHWAQLEKFDEFNRLVIGFLEAPQAAGRTPRQRCPSAEDQPPAAPRGADK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 4 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 5 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 6 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 7 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 8 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 9 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 10 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 11 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 12 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 13 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 14 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 15 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 16 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 17 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 18 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 19 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 20 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 21 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 22 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 23 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 24 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 25 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 26 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 27 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 28 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 29 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 30 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 31 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 32 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 33 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 34 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 35 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 36 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 37 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 38 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 39 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 40 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 41 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 42 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 43 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 253 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 254 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 255 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 260 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 268 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 384 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 386 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 387 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 392 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.65 |
| Metatranscriptomes | 0.53 |
| Isolates | 4.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.83 |
| Nodule | 0.13 |
| Rhizoplane | 13.24 |
| Rhizosphere | 62.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1011962 | 3300001977 | Bacteria | 1272 |
| 2 | JGI24739J22299_10020316 | 3300001989 | Bacteria | 2373 |
| 3 | JGI24743J22301_10002008 | 3300001991 | Bacteria | 2977 |
| 4 | JGI24735J21928_10044461 | 3300002067 | Bacteria | 1290 |
| 5 | JGI24745J21846_1000594 | 3300002073 | Bacteria | 3249 |
| 6 | JGI24749J21850_1002284 | 3300002076 | Bacteria | 2698 |
| 7 | JGI24744J21845_10000552 | 3300002077 | Bacteria | 6743 |
| 8 | JGI24034J26672_10000794 | 3300002239 | Bacteria | 4088 |
| 9 | JGI24742J22300_10000392 | 3300002244 | Bacteria | 6505 |
| 10 | Ga0055532_1000666 | 3300003758 | Bacteria | 13052 |
| 11 | Ga0055527_1000220 | 3300003760 | Bacteria | 37160 |
| 12 | Ga0055535_1000465 | 3300003761 | Bacteria | 37160 |
| 13 | Ga0055542_1001377 | 3300003762 | Bacteria | 12348 |
| 14 | Ga0055540_1000060 | 3300003792 | Bacteria | 131775 |
| 15 | Ga0055540_1000332 | 3300003792 | Bacteria | 41197 |
| 16 | Ga0055540_1010383 | 3300003792 | Bacteria | 3106 |
| 17 | Ga0058863_11834253 | 3300004799 | Bacteria | 1330 |
| 18 | Ga0070666_10076744 | 3300005335 | Bacteria | 2280 |
| 19 | Ga0070666_10152896 | 3300005335 | Bacteria | 1610 |
| 20 | Ga0070682_100002887 | 3300005337 | Bacteria | 9535 |
| 21 | Ga0070682_100011802 | 3300005337 | Bacteria | 4998 |
| 22 | Ga0068868_100002906 | 3300005338 | Bacteria | 11889 |
| 23 | Ga0068868_100106291 | 3300005338 | Bacteria | 2276 |
| 24 | Ga0068868_100356701 | 3300005338 | Bacteria | 1253 |
| 25 | Ga0070660_100087808 | 3300005339 | Bacteria | 2448 |
| 26 | Ga0070660_100344405 | 3300005339 | Bacteria | 1227 |
| 27 | Ga0070689_100002306 | 3300005340 | Bacteria | 12418 |
| 28 | Ga0070689_100074150 | 3300005340 | Bacteria | 2663 |
| 29 | Ga0070691_10060023 | 3300005341 | Bacteria | 1828 |
| 30 | Ga0070692_10294913 | 3300005345 | Bacteria | 988 |
| 31 | Ga0070668_100002295 | 3300005347 | Bacteria | 14103 |
| 32 | Ga0070668_100003547 | 3300005347 | Bacteria | 11508 |
| 33 | Ga0070668_100006108 | 3300005347 | Bacteria | 8932 |
| 34 | Ga0070669_100005151 | 3300005353 | Bacteria | 9453 |
| 35 | Ga0070671_100000491 | 3300005355 | Bacteria | 27625 |
| 36 | Ga0070674_100000467 | 3300005356 | Bacteria | 20390 |
| 37 | Ga0070673_100075803 | 3300005364 | Bacteria | 2714 |
| 38 | Ga0070688_100005614 | 3300005365 | Bacteria | 6619 |
| 39 | Ga0070659_100028696 | 3300005366 | Bacteria | 4299 |
| 40 | Ga0070659_100383093 | 3300005366 | Bacteria | 1185 |
| 41 | Ga0070667_100000220 | 3300005367 | Bacteria | 65980 |
| 42 | Ga0070667_100004618 | 3300005367 | Bacteria | 11565 |
| 43 | Ga0070667_100035411 | 3300005367 | Bacteria | 4182 |
| 44 | Ga0070667_100184076 | 3300005367 | Bacteria | 1848 |
| 45 | Ga0070709_10028515 | 3300005434 | Bacteria | 3330 |
| 46 | Ga0070714_100320280 | 3300005435 | Bacteria | 1450 |
| 47 | Ga0070710_10000613 | 3300005437 | Bacteria | 16962 |
| 48 | Ga0070701_10002866 | 3300005438 | Bacteria | 6724 |
| 49 | Ga0070701_10124622 | 3300005438 | Bacteria | 1456 |
| 50 | Ga0070711_100001974 | 3300005439 | Bacteria | 11519 |
| 51 | Ga0070711_100005893 | 3300005439 | Bacteria | 7355 |
| 52 | Ga0070705_100018275 | 3300005440 | Bacteria | 3673 |
| 53 | Ga0070705_100350016 | 3300005440 | Bacteria | 1077 |
| 54 | Ga0070700_100002887 | 3300005441 | Bacteria | 8832 |
| 55 | Ga0070708_100002951 | 3300005445 | Bacteria | 13224 |
| 56 | Ga0070663_100000346 | 3300005455 | Bacteria | 24250 |
| 57 | Ga0070663_100001369 | 3300005455 | Bacteria | 13348 |
| 58 | Ga0070663_100002179 | 3300005455 | Bacteria | 10942 |
| 59 | Ga0070663_100016151 | 3300005455 | Bacteria | 4839 |
| 60 | Ga0070678_100000278 | 3300005456 | Bacteria | 23752 |
| 61 | Ga0070678_100159194 | 3300005456 | Bacteria | 1827 |
| 62 | Ga0070678_100454047 | 3300005456 | Bacteria | 1123 |
| 63 | Ga0068867_100006337 | 3300005459 | Bacteria | 8370 |
| 64 | Ga0070706_100008204 | 3300005467 | Bacteria | 9742 |
| 65 | Ga0070707_100008267 | 3300005468 | Bacteria | 9658 |
| 66 | Ga0070698_100011824 | 3300005471 | Bacteria | 9261 |
| 67 | Ga0068853_100007614 | 3300005539 | Bacteria | 8675 |
| 68 | Ga0068853_100061775 | 3300005539 | Bacteria | 3241 |
| 69 | Ga0070672_100020487 | 3300005543 | Bacteria | 4824 |
| 70 | Ga0070686_100082109 | 3300005544 | Bacteria | 2137 |
| 71 | Ga0070695_100053980 | 3300005545 | Bacteria | 2585 |
| 72 | Ga0070696_100003712 | 3300005546 | Bacteria | 10185 |
| 73 | Ga0070696_100025465 | 3300005546 | Bacteria | 4023 |
| 74 | Ga0070696_100247563 | 3300005546 | Bacteria | 1347 |
| 75 | Ga0070693_100011974 | 3300005547 | Bacteria | 4379 |
| 76 | Ga0070665_100020724 | 3300005548 | Bacteria | 6606 |
| 77 | Ga0070665_100029853 | 3300005548 | Bacteria | 5487 |
| 78 | Ga0070665_100585264 | 3300005548 | Bacteria | 1129 |
| 79 | Ga0068855_100336667 | 3300005563 | Bacteria | 1665 |
| 80 | Ga0068855_100638286 | 3300005563 | Bacteria | 1145 |
| 81 | Ga0068857_100124185 | 3300005577 | Bacteria | 2326 |
| 82 | Ga0068854_100008114 | 3300005578 | Bacteria | 6737 |
| 83 | Ga0068854_100233326 | 3300005578 | Bacteria | 1461 |
| 84 | Ga0068856_100054190 | 3300005614 | Bacteria | 3955 |
| 85 | Ga0068856_100238825 | 3300005614 | Bacteria | 1832 |
| 86 | Ga0070702_100000779 | 3300005615 | Bacteria | 12093 |
| 87 | Ga0068852_100076831 | 3300005616 | Bacteria | 2949 |
| 88 | Ga0068859_100001001 | 3300005617 | Bacteria | 28962 |
| 89 | Ga0068859_100007711 | 3300005617 | Bacteria | 10930 |
| 90 | Ga0068859_100293508 | 3300005617 | Bacteria | 1719 |
| 91 | Ga0068866_10001053 | 3300005718 | Bacteria | 12150 |
| 92 | Ga0068861_100000788 | 3300005719 | Bacteria | 19065 |
| 93 | Ga0068863_100002617 | 3300005841 | Bacteria | 17842 |
| 94 | Ga0068863_100004423 | 3300005841 | Bacteria | 13860 |
| 95 | Ga0068863_100191821 | 3300005841 | Bacteria | 1964 |
| 96 | Ga0068858_100015127 | 3300005842 | Bacteria | 7257 |
| 97 | Ga0068858_100024463 | 3300005842 | Bacteria | 5626 |
| 98 | Ga0068858_100712778 | 3300005842 | Bacteria | 977 |
| 99 | Ga0068860_100000150 | 3300005843 | Bacteria | 113021 |
| 100 | Ga0068860_100007160 | 3300005843 | Bacteria | 11159 |
| 101 | Ga0068862_100000078 | 3300005844 | Bacteria | 114008 |
| 102 | Ga0068862_100003622 | 3300005844 | Bacteria | 13216 |
| 103 | Ga0068862_100165692 | 3300005844 | Bacteria | 1975 |
| 104 | Ga0081455_10027109 | 3300005937 | Bacteria | 5254 |
| 105 | Ga0070717_10002375 | 3300006028 | Bacteria | 13272 |
| 106 | Ga0070717_10016214 | 3300006028 | Bacteria | 5773 |
| 107 | Ga0070717_10038636 | 3300006028 | Bacteria | 3880 |
| 108 | Ga0075365_10005534 | 3300006038 | Bacteria | 6824 |
| 109 | Ga0075365_10036397 | 3300006038 | Bacteria | 3188 |
| 110 | Ga0075365_10089670 | 3300006038 | Bacteria | 2093 |
| 111 | Ga0075363_100003677 | 3300006048 | Bacteria | 6589 |
| 112 | Ga0075363_100006977 | 3300006048 | Bacteria | 5165 |
| 113 | Ga0075363_100007827 | 3300006048 | Bacteria | 4940 |
| 114 | Ga0075363_100019226 | 3300006048 | Bacteria | 3412 |
| 115 | Ga0075363_100020922 | 3300006048 | Bacteria | 3287 |
| 116 | Ga0075363_100038058 | 3300006048 | Bacteria | 2528 |
| 117 | Ga0075363_100081229 | 3300006048 | Bacteria | 1773 |
| 118 | Ga0075364_10001016 | 3300006051 | Bacteria | 14889 |
| 119 | Ga0075364_10002829 | 3300006051 | Bacteria | 9768 |
| 120 | Ga0075364_10004336 | 3300006051 | Bacteria | 8136 |
| 121 | Ga0075364_10019822 | 3300006051 | Bacteria | 4226 |
| 122 | Ga0075364_10040100 | 3300006051 | Bacteria | 3037 |
| 123 | Ga0075364_10049452 | 3300006051 | Bacteria | 2742 |
| 124 | Ga0075364_10060205 | 3300006051 | Bacteria | 2490 |
| 125 | Ga0075364_10202868 | 3300006051 | Bacteria | 1344 |
| 126 | Ga0075364_10212586 | 3300006051 | Bacteria | 1312 |
| 127 | Ga0070715_10015599 | 3300006163 | Bacteria | 2838 |
| 128 | Ga0070716_100001586 | 3300006173 | Bacteria | 10228 |
| 129 | Ga0070716_100048737 | 3300006173 | Bacteria | 2396 |
| 130 | Ga0070712_100002517 | 3300006175 | Bacteria | 11308 |
| 131 | Ga0075362_10074568 | 3300006177 | Bacteria | 1555 |
| 132 | Ga0075367_10006961 | 3300006178 | Bacteria | 5759 |
| 133 | Ga0075367_10017486 | 3300006178 | Bacteria | 3936 |
| 134 | Ga0075367_10024095 | 3300006178 | Bacteria | 3431 |
| 135 | Ga0075369_10004514 | 3300006186 | Bacteria | 5149 |
| 136 | Ga0075369_10009126 | 3300006186 | Bacteria | 3843 |
| 137 | Ga0075369_10017960 | 3300006186 | Bacteria | 2875 |
| 138 | Ga0075369_10025789 | 3300006186 | Bacteria | 2446 |
| 139 | Ga0075369_10035050 | 3300006186 | Bacteria | 2132 |
| 140 | Ga0075369_10105734 | 3300006186 | Bacteria | 1266 |
| 141 | Ga0075369_10135147 | 3300006186 | Bacteria | 1122 |
| 142 | Ga0097621_100097790 | 3300006237 | Bacteria | 2465 |
| 143 | Ga0097621_100276089 | 3300006237 | Bacteria | 1478 |
| 144 | Ga0075370_10005056 | 3300006353 | Bacteria | 6498 |
| 145 | Ga0075370_10009925 | 3300006353 | Bacteria | 4961 |
| 146 | Ga0075370_10133760 | 3300006353 | Bacteria | 1448 |
| 147 | Ga0068871_100177072 | 3300006358 | Bacteria | 1831 |
| 148 | Ga0075428_100053494 | 3300006844 | Bacteria | 4424 |
| 149 | Ga0075428_100095057 | 3300006844 | Bacteria | 3249 |
| 150 | Ga0075428_100239600 | 3300006844 | Unclassified | 1957 |
| 151 | Ga0075430_100050758 | 3300006846 | Bacteria | 3497 |
| 152 | Ga0075431_100141517 | 3300006847 | Bacteria | 2480 |
| 153 | Ga0075433_10499350 | 3300006852 | Bacteria | 1071 |
| 154 | Ga0075434_100007704 | 3300006871 | Bacteria | 9967 |
| 155 | Ga0075429_100009538 | 3300006880 | Bacteria | 8419 |
| 156 | Ga0068865_100001704 | 3300006881 | Bacteria | 12886 |
| 157 | Ga0068865_100090625 | 3300006881 | Bacteria | 2217 |
| 158 | Ga0097620_100001001 | 3300006931 | Bacteria | 28962 |
| 159 | Ga0097620_100007711 | 3300006931 | Bacteria | 10930 |
| 160 | Ga0097620_100293519 | 3300006931 | Bacteria | 1719 |
| 161 | Ga0075435_100265708 | 3300007076 | Bacteria | 1463 |
| 162 | Ga0099794_10009175 | 3300007265 | Bacteria | 4142 |
| 163 | Ga0099794_10117055 | 3300007265 | Bacteria | 1338 |
| 164 | Ga0105250_10012535 | 3300009092 | Bacteria | 3498 |
| 165 | Ga0105245_10020738 | 3300009098 | Bacteria | 5761 |
| 166 | Ga0105247_10000074 | 3300009101 | Bacteria | 113207 |
| 167 | Ga0105247_10000600 | 3300009101 | Bacteria | 29224 |
| 168 | Ga0105247_10242311 | 3300009101 | Bacteria | 1229 |
| 169 | Ga0114129_10022901 | 3300009147 | Bacteria | 8860 |
| 170 | Ga0114129_10254944 | 3300009147 | Bacteria | 2354 |
| 171 | Ga0114129_10290825 | 3300009147 | Bacteria | 2180 |
| 172 | Ga0105243_10000320 | 3300009148 | Bacteria | 52858 |
| 173 | Ga0105243_10338340 | 3300009148 | Bacteria | 1377 |
| 174 | Ga0105241_10026241 | 3300009174 | Bacteria | 4333 |
| 175 | Ga0105242_10001286 | 3300009176 | Bacteria | 19813 |
| 176 | Ga0105242_10293937 | 3300009176 | Bacteria | 1480 |
| 177 | Ga0105248_10000077 | 3300009177 | Bacteria | 113148 |
| 178 | Ga0105248_10012868 | 3300009177 | Bacteria | 9229 |
| 179 | Ga0105248_10837816 | 3300009177 | Bacteria | 1038 |
| 180 | Ga0105237_10004421 | 3300009545 | Bacteria | 16294 |
| 181 | Ga0105237_10019639 | 3300009545 | Bacteria | 6978 |
| 182 | Ga0105238_10042391 | 3300009551 | Bacteria | 4609 |
| 183 | Ga0105238_10232276 | 3300009551 | Bacteria | 1821 |
| 184 | Ga0105238_10237513 | 3300009551 | Bacteria | 1800 |
| 185 | Ga0105249_10000111 | 3300009553 | Bacteria | 109164 |
| 186 | Ga0105249_10090677 | 3300009553 | Bacteria | 2858 |
| 187 | Ga0105239_10030311 | 3300010375 | Bacteria | 5946 |
| 188 | Ga0105239_10073784 | 3300010375 | Bacteria | 3751 |
| 189 | Ga0105239_10235464 | 3300010375 | Bacteria | 2055 |
| 190 | Ga0105246_10156418 | 3300011119 | Bacteria | 1732 |
| 191 | Ga0105246_10190703 | 3300011119 | Bacteria | 1586 |
| 192 | Ga0105246_10262243 | 3300011119 | Bacteria | 1377 |
| 193 | Ga0157369_10008809 | 3300013105 | Bacteria | 11561 |
| 194 | Ga0157369_10059876 | 3300013105 | Bacteria | 4107 |
| 195 | Ga0157374_10057850 | 3300013296 | Bacteria | 3622 |
| 196 | Ga0157374_10265967 | 3300013296 | Bacteria | 1690 |
| 197 | Ga0157374_10393745 | 3300013296 | Bacteria | 1381 |
| 198 | Ga0157374_10972151 | 3300013296 | Bacteria | 868 |
| 199 | Ga0157378_10005317 | 3300013297 | Bacteria | 11304 |
| 200 | Ga0157378_10268840 | 3300013297 | Bacteria | 1639 |
| 201 | Ga0157378_10473530 | 3300013297 | Bacteria | 1247 |
| 202 | Ga0163162_10003832 | 3300013306 | Bacteria | 14422 |
| 203 | Ga0163162_10062325 | 3300013306 | Bacteria | 3769 |
| 204 | Ga0157372_10008077 | 3300013307 | Bacteria | 11193 |
| 205 | Ga0157375_10001203 | 3300013308 | Bacteria | 22312 |
| 206 | Ga0157375_10180065 | 3300013308 | Bacteria | 2265 |
| 207 | Ga0163163_10045801 | 3300014325 | Bacteria | 4295 |
| 208 | Ga0163163_10162680 | 3300014325 | Bacteria | 2278 |
| 209 | Ga0163163_10668042 | 3300014325 | Bacteria | 1103 |
| 210 | Ga0157380_10007981 | 3300014326 | Bacteria | 7538 |
| 211 | Ga0157380_10046880 | 3300014326 | Bacteria | 3396 |
| 212 | Ga0157377_10004027 | 3300014745 | Bacteria | 6702 |
| 213 | Ga0157377_10005407 | 3300014745 | Bacteria | 6003 |
| 214 | Ga0157379_10000746 | 3300014968 | Bacteria | 26283 |
| 215 | Ga0157379_10157414 | 3300014968 | Bacteria | 2050 |
| 216 | Ga0157379_10504016 | 3300014968 | Bacteria | 1122 |
| 217 | Ga0157376_10095301 | 3300014969 | Bacteria | 2588 |
| 218 | Ga0157376_10242606 | 3300014969 | Bacteria | 1679 |
| 219 | Ga0163161_10001220 | 3300017792 | Bacteria | 19370 |
| 220 | Ga0163161_10003217 | 3300017792 | Bacteria | 11485 |
| 221 | Ga0163161_10018910 | 3300017792 | Bacteria | 4829 |
| 222 | Ga0197907_10921680 | 3300020069 | Bacteria | 1180 |
| 223 | Ga0206350_11005135 | 3300020080 | Bacteria | 2093 |
| 224 | Ga0206354_10133537 | 3300020081 | Bacteria | 2519 |
| 225 | Ga0213876_10049126 | 3300021384 | Bacteria | 2228 |
| 226 | Ga0213875_10007594 | 3300021388 | Bacteria | 5592 |
| 227 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 228 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 229 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 230 | Ga0209148_1000337 | 3300025254 | Bacteria | 63295 |
| 231 | Ga0209759_1002516 | 3300025256 | Bacteria | 7977 |
| 232 | Ga0209455_1000138 | 3300025272 | Bacteria | 141021 |
| 233 | Ga0209673_1004584 | 3300025273 | Bacteria | 7327 |
| 234 | Ga0209051_1000149 | 3300025303 | Bacteria | 132185 |
| 235 | Ga0209051_1000557 | 3300025303 | Bacteria | 45433 |
| 236 | Ga0209051_1001535 | 3300025303 | Bacteria | 19215 |
| 237 | Ga0209051_1003218 | 3300025303 | Bacteria | 10906 |
| 238 | Ga0209051_1035491 | 3300025303 | Bacteria | 1854 |
| 239 | Ga0207692_10003062 | 3300025898 | Bacteria | 6491 |
| 240 | Ga0207642_10000883 | 3300025899 | Bacteria | 9374 |
| 241 | Ga0207710_10000086 | 3300025900 | Bacteria | 129918 |
| 242 | Ga0207710_10002512 | 3300025900 | Bacteria | 8487 |
| 243 | Ga0207688_10000239 | 3300025901 | Bacteria | 24883 |
| 244 | Ga0207688_10003514 | 3300025901 | Bacteria | 8554 |
| 245 | Ga0207680_10059271 | 3300025903 | Bacteria | 2324 |
| 246 | Ga0207647_10104708 | 3300025904 | Bacteria | 1676 |
| 247 | Ga0207647_10110616 | 3300025904 | Bacteria | 1624 |
| 248 | Ga0207685_10001909 | 3300025905 | Bacteria | 4599 |
| 249 | Ga0207699_10009792 | 3300025906 | Bacteria | 4788 |
| 250 | Ga0207684_10007721 | 3300025910 | Bacteria | 9633 |
| 251 | Ga0207654_10014497 | 3300025911 | Bacteria | 4073 |
| 252 | Ga0207671_10016244 | 3300025914 | Bacteria | 5792 |
| 253 | Ga0207693_10000380 | 3300025915 | Bacteria | 40807 |
| 254 | Ga0207693_10006585 | 3300025915 | Bacteria | 9615 |
| 255 | Ga0207693_10422270 | 3300025915 | Bacteria | 1042 |
| 256 | Ga0207663_10000829 | 3300025916 | Bacteria | 13989 |
| 257 | Ga0207663_10011400 | 3300025916 | Bacteria | 4773 |
| 258 | Ga0207662_10020799 | 3300025918 | Bacteria | 3746 |
| 259 | Ga0207662_10030839 | 3300025918 | Bacteria | 3114 |
| 260 | Ga0207657_10197006 | 3300025919 | Bacteria | 1622 |
| 261 | Ga0207657_10435003 | 3300025919 | Bacteria | 1030 |
| 262 | Ga0207646_10006000 | 3300025922 | Bacteria | 12653 |
| 263 | Ga0207681_10003701 | 3300025923 | Bacteria | 9499 |
| 264 | Ga0207681_10059196 | 3300025923 | Bacteria | 2625 |
| 265 | Ga0207694_10045304 | 3300025924 | Bacteria | 3397 |
| 266 | Ga0207659_10078511 | 3300025926 | Bacteria | 2432 |
| 267 | Ga0207687_10010041 | 3300025927 | Bacteria | 6194 |
| 268 | Ga0207700_10017422 | 3300025928 | Bacteria | 4798 |
| 269 | Ga0207700_10538420 | 3300025928 | Bacteria | 1036 |
| 270 | Ga0207664_10158690 | 3300025929 | Bacteria | 1927 |
| 271 | Ga0207644_10053739 | 3300025931 | Bacteria | 2899 |
| 272 | Ga0207690_10054022 | 3300025932 | Bacteria | 2699 |
| 273 | Ga0207690_10242750 | 3300025932 | Bacteria | 1388 |
| 274 | Ga0207706_10006853 | 3300025933 | Bacteria | 10533 |
| 275 | Ga0207706_10023033 | 3300025933 | Bacteria | 5593 |
| 276 | Ga0207686_10002784 | 3300025934 | Bacteria | 9463 |
| 277 | Ga0207709_10009193 | 3300025935 | Bacteria | 5445 |
| 278 | Ga0207709_10027010 | 3300025935 | Bacteria | 3303 |
| 279 | Ga0207670_10326006 | 3300025936 | Bacteria | 1209 |
| 280 | Ga0207669_10003512 | 3300025937 | Bacteria | 6783 |
| 281 | Ga0207665_10001300 | 3300025939 | Bacteria | 16838 |
| 282 | Ga0207665_10032126 | 3300025939 | Bacteria | 3475 |
| 283 | Ga0207691_10047834 | 3300025940 | Bacteria | 3924 |
| 284 | Ga0207691_10067442 | 3300025940 | Bacteria | 3235 |
| 285 | Ga0207711_10000577 | 3300025941 | Bacteria | 37314 |
| 286 | Ga0207689_10013555 | 3300025942 | Bacteria | 6957 |
| 287 | Ga0207689_10090857 | 3300025942 | Bacteria | 2509 |
| 288 | Ga0207667_10432568 | 3300025949 | Bacteria | 1338 |
| 289 | Ga0207651_10050982 | 3300025960 | Bacteria | 2814 |
| 290 | Ga0207651_10125761 | 3300025960 | Bacteria | 1953 |
| 291 | Ga0207712_10000162 | 3300025961 | Bacteria | 69049 |
| 292 | Ga0207712_10010674 | 3300025961 | Bacteria | 5833 |
| 293 | Ga0207712_10192537 | 3300025961 | Bacteria | 1611 |
| 294 | Ga0207668_10000532 | 3300025972 | Bacteria | 23828 |
| 295 | Ga0207668_10031438 | 3300025972 | Bacteria | 3496 |
| 296 | Ga0207668_10034876 | 3300025972 | Bacteria | 3345 |
| 297 | Ga0207640_10002011 | 3300025981 | Bacteria | 10985 |
| 298 | Ga0207640_10210342 | 3300025981 | Bacteria | 1481 |
| 299 | Ga0207658_10000314 | 3300025986 | Bacteria | 48821 |
| 300 | Ga0207677_10023591 | 3300026023 | Bacteria | 3805 |
| 301 | Ga0207677_10563503 | 3300026023 | Bacteria | 995 |
| 302 | Ga0207703_10029584 | 3300026035 | Bacteria | 4323 |
| 303 | Ga0207703_10602452 | 3300026035 | Bacteria | 1039 |
| 304 | Ga0207639_10021887 | 3300026041 | Bacteria | 4597 |
| 305 | Ga0207639_10047386 | 3300026041 | Bacteria | 3248 |
| 306 | Ga0207639_10048415 | 3300026041 | Bacteria | 3217 |
| 307 | Ga0207678_10000470 | 3300026067 | Bacteria | 36474 |
| 308 | Ga0207678_10000480 | 3300026067 | Bacteria | 36254 |
| 309 | Ga0207678_10005983 | 3300026067 | Bacteria | 10823 |
| 310 | Ga0207678_10045640 | 3300026067 | Bacteria | 3789 |
| 311 | Ga0207678_10055292 | 3300026067 | Bacteria | 3419 |
| 312 | Ga0207678_10108381 | 3300026067 | Bacteria | 2369 |
| 313 | Ga0207708_10002484 | 3300026075 | Bacteria | 13570 |
| 314 | Ga0207708_10007259 | 3300026075 | Bacteria | 8194 |
| 315 | Ga0207708_10170298 | 3300026075 | Bacteria | 1724 |
| 316 | Ga0207702_10205935 | 3300026078 | Bacteria | 1826 |
| 317 | Ga0207641_10005441 | 3300026088 | Bacteria | 10867 |
| 318 | Ga0207641_10141708 | 3300026088 | Bacteria | 2170 |
| 319 | Ga0207641_10147343 | 3300026088 | Bacteria | 2129 |
| 320 | Ga0207648_10000899 | 3300026089 | Bacteria | 33528 |
| 321 | Ga0207676_10103194 | 3300026095 | Bacteria | 2369 |
| 322 | Ga0207674_10080347 | 3300026116 | Bacteria | 3264 |
| 323 | Ga0207675_100000475 | 3300026118 | Bacteria | 39052 |
| 324 | Ga0207683_10000256 | 3300026121 | Bacteria | 47418 |
| 325 | Ga0207683_10131617 | 3300026121 | Bacteria | 2250 |
| 326 | Ga0207683_10475557 | 3300026121 | Bacteria | 1153 |
| 327 | Ga0207698_10102746 | 3300026142 | Bacteria | 2373 |
| 328 | Ga0268266_10002797 | 3300028379 | Bacteria | 18195 |
| 329 | Ga0268266_10011939 | 3300028379 | Bacteria | 7521 |
| 330 | Ga0268266_10057105 | 3300028379 | Bacteria | 3358 |
| 331 | Ga0268266_10316207 | 3300028379 | Bacteria | 1460 |
| 332 | Ga0268265_10000012 | 3300028380 | Bacteria | 343132 |
| 333 | Ga0268265_10062039 | 3300028380 | Bacteria | 2871 |
| 334 | Ga0268264_10000104 | 3300028381 | Bacteria | 217837 |
| 335 | Ga0268264_10004698 | 3300028381 | Bacteria | 11607 |
| 336 | Ga0268264_10300279 | 3300028381 | Bacteria | 1511 |
| 337 | Ga0307517_10061247 | 3300028786 | Bacteria | 3565 |
| 338 | Ga0307515_10000192 | 3300028794 | Bacteria | 149030 |
| 339 | Ga0307515_10069528 | 3300028794 | Bacteria | 4811 |
| 340 | Ga0265340_10002821 | 3300031247 | Bacteria | 9890 |
| 341 | Ga0265316_10130848 | 3300031344 | Bacteria | 1890 |
| 342 | Ga0307513_10118878 | 3300031456 | Bacteria | 2616 |
| 343 | Ga0307509_10085936 | 3300031507 | Bacteria | 3236 |
| 344 | Ga0307408_100467929 | 3300031548 | Bacteria | 1097 |
| 345 | Ga0307508_10065510 | 3300031616 | Bacteria | 3201 |
| 346 | Ga0307516_10087317 | 3300031730 | Bacteria | 2953 |
| 347 | Ga0307413_10192035 | 3300031824 | Bacteria | 1467 |
| 348 | Ga0307406_10101904 | 3300031901 | Bacteria | 1957 |
| 349 | Ga0307407_10165441 | 3300031903 | Bacteria | 1451 |
| 350 | Ga0307409_100147981 | 3300031995 | Bacteria | 2034 |
| 351 | Ga0307416_100102641 | 3300032002 | Bacteria | 2494 |
| 352 | Ga0307416_100468423 | 3300032002 | Bacteria | 1317 |
| 353 | Ga0307415_100002557 | 3300032126 | Bacteria | 9099 |
| 354 | Ga0307507_10007039 | 3300033179 | Bacteria | 16658 |
| 355 | Ga0307510_10096415 | 3300033180 | Bacteria | 2773 |
| 356 | Ga0373948_0003054 | 3300034817 | Bacteria | 2537 |
| 357 | Ga0373929_0010430 | 3300035085 | Bacteria | 1737 |
| 358 | Ga0373934_0026775 | 3300035086 | Bacteria | 2237 |
| 359 | Ga0373934_0088653 | 3300035086 | Bacteria | 1246 |
| 360 | Ga0373949_0002005 | 3300035090 | Bacteria | 5435 |
| 361 | Ga0373945_0042784 | 3300035116 | Bacteria | 1642 |
| 362 | Ga0373956_0000244 | 3300035119 | Bacteria | 21525 |
| 363 | Ga0373957_0017035 | 3300035120 | Bacteria | 2524 |
| 364 | Ga0373946_0042188 | 3300035171 | Bacteria | 1874 |
| 365 | Ga0373946_0122760 | 3300035171 | Bacteria | 1187 |
| 366 | Ga0373962_0008802 | 3300035242 | Bacteria | 2492 |
| 367 | Ga0373962_0028027 | 3300035242 | Bacteria | 1526 |
| 368 | Ga0373931_0004902 | 3300035691 | Bacteria | 6153 |
| 369 | Ga0373931_0043696 | 3300035691 | Bacteria | 2361 |
| 370 | Ga0373935_0268394 | 3300035692 | Bacteria | 1198 |
| 371 | Ga0373927_0179805 | 3300035695 | Bacteria | 1387 |
| 372 | Ga0373933_0003594 | 3300035724 | Bacteria | 8612 |
| 373 | Ga0373933_0007198 | 3300035724 | Bacteria | 6065 |
| 374 | Ga0373947_0293945 | 3300035725 | Bacteria | 1082 |
| 375 | Ga0373947_0328753 | 3300035725 | Bacteria | 1023 |
| 376 | Ga0316582_0457587 | 3300036647 | Bacteria | 880 |
| 377 | Ga0373925_0538051 | 3300037068 | Bacteria | 960 |
| 378 | Ga0395905_0307413 | 3300037471 | Unclassified | 1474 |
| 379 | Ga0436364_0506337 | 3300037853 | Bacteria | 16554 |
| 380 | Ga0436364_1383012 | 3300037853 | Bacteria | 5516 |
| 381 | Ga0436365_0123515 | 3300039437 | Bacteria | 51393 |
| 382 | Ga0436365_1317649 | 3300039437 | Bacteria | 1632 |
| 383 | Ga0436365_1820296 | 3300039437 | Bacteria | 13703 |
| 384 | Ga0436361_0031463 | 3300039447 | Bacteria | 1152 |
| 385 | Ga0436363_0404252 | 3300039450 | Bacteria | 13876 |
| 386 | Ga0439466_0029215 | 3300041411 | Bacteria | 1898 |
| 387 | Ga0439465_0051285 | 3300041413 | Bacteria | 1351 |
| 388 | Ga0451793_0168371 | 3300041452 | Bacteria | 1152 |
| 389 | Ga0451793_0265482 | 3300041452 | Bacteria | 2209 |
| 390 | Ga0451797_1187442 | 3300041453 | Bacteria | 997 |
| 391 | Ga0451795_0137542 | 3300041456 | Bacteria | 1925 |
| 392 | Ga0451853_2277362 | 3300041512 | Bacteria | 4495 |
| 393 | Ga0439442_007232 | 3300042002 | Bacteria | 2232 |
| 394 | Ga0439435_0055240 | 3300042436 | Bacteria | 1145 |
| 395 | Ga0451577_0030894 | 3300042876 | Bacteria | 4837 |
| 396 | Ga0451577_0060150 | 3300042876 | Bacteria | 3387 |
| 397 | Ga0466969_0010807 | 3300044656 | Bacteria | 4836 |
| 398 | Ga0466969_0028966 | 3300044656 | Bacteria | 2829 |
| 399 | Ga0466972_0007466 | 3300044658 | Bacteria | 5494 |
| 400 | Ga0466972_0014989 | 3300044658 | Bacteria | 3877 |
| 401 | Ga0466972_0026501 | 3300044658 | Bacteria | 2873 |
| 402 | Ga0466965_0000989 | 3300044683 | Bacteria | 10991 |
| 403 | Ga0466965_0011498 | 3300044683 | Bacteria | 4150 |
| 404 | Ga0466965_0087420 | 3300044683 | Bacteria | 1582 |
| 405 | Ga0466965_0117359 | 3300044683 | Bacteria | 1372 |
| 406 | Ga0466965_0194892 | 3300044683 | Bacteria | 1073 |
| 407 | Ga0466966_0001650 | 3300044684 | Bacteria | 14382 |
| 408 | Ga0466966_0209102 | 3300044684 | Bacteria | 1179 |
| 409 | Ga0466961_0006085 | 3300044693 | Bacteria | 7654 |
| 410 | Ga0466961_0090667 | 3300044693 | Bacteria | 1930 |
| 411 | Ga0466964_0009079 | 3300044706 | Bacteria | 3740 |
| 412 | Ga0466971_0008238 | 3300044719 | Bacteria | 4548 |
| 413 | Ga0466971_0056090 | 3300044719 | Bacteria | 1777 |
| 414 | Ga0466971_0158726 | 3300044719 | Unclassified | 1058 |
| 415 | Ga0466968_0009276 | 3300044735 | Bacteria | 3785 |
| 416 | Ga0466968_0058866 | 3300044735 | Bacteria | 1654 |
| 417 | Ga0466970_0010388 | 3300044765 | Bacteria | 4726 |
| 418 | Ga0466970_0023693 | 3300044765 | Bacteria | 3208 |
| 419 | Ga0466957_0016321 | 3300044842 | Bacteria | 4344 |
| 420 | Ga0466957_0028986 | 3300044842 | Bacteria | 3297 |
| 421 | Ga0466957_0279618 | 3300044842 | Bacteria | 1117 |
| 422 | Ga0466960_0000322 | 3300044901 | Bacteria | 16464 |
| 423 | Ga0466960_0000833 | 3300044901 | Bacteria | 10867 |
| 424 | Ga0466960_0017734 | 3300044901 | Bacteria | 3110 |
| 425 | Ga0466959_0001337 | 3300045049 | Bacteria | 15006 |
| 426 | Ga0466959_0001896 | 3300045049 | Bacteria | 13166 |
| 427 | Ga0466959_0424934 | 3300045049 | Bacteria | 902 |
| 428 | Ga0466958_0005688 | 3300045836 | Bacteria | 6733 |
| 429 | Ga0466967_0017264 | 3300045976 | Bacteria | 5723 |
| 430 | Ga0466967_0020526 | 3300045976 | Bacteria | 5344 |
| 431 | Ga0466967_0237093 | 3300045976 | Bacteria | 1739 |
| 432 | Ga0495592_0036341 | 3300046454 | Bacteria | 3710 |
| 433 | Ga0495603_0279058 | 3300046455 | Bacteria | 960 |
| 434 | Ga0495638_0001699 | 3300046460 | Bacteria | 19377 |
| 435 | Ga0495638_0001757 | 3300046460 | Bacteria | 18992 |
| 436 | Ga0495641_0039940 | 3300046461 | Bacteria | 2184 |
| 437 | Ga0495641_0068738 | 3300046461 | Bacteria | 1592 |
| 438 | Ga0495651_0114139 | 3300046462 | Bacteria | 1993 |
| 439 | Ga0495653_0001061 | 3300046463 | Bacteria | 21169 |
| 440 | Ga0495653_0174319 | 3300046463 | Bacteria | 1481 |
| 441 | Ga0495653_0208135 | 3300046463 | Bacteria | 1323 |
| 442 | Ga0495580_0028064 | 3300046472 | Bacteria | 4093 |
| 443 | Ga0495580_0293286 | 3300046472 | Bacteria | 1108 |
| 444 | Ga0495582_0043826 | 3300046473 | Bacteria | 2463 |
| 445 | Ga0495605_0000040 | 3300046474 | Bacteria | 193955 |
| 446 | Ga0495639_0046080 | 3300046475 | Bacteria | 1973 |
| 447 | Ga0495662_0045114 | 3300046476 | Bacteria | 2127 |
| 448 | Ga0495664_0002014 | 3300046477 | Bacteria | 10848 |
| 449 | Ga0495664_0096191 | 3300046477 | Bacteria | 1782 |
| 450 | Ga0495607_0010791 | 3300046501 | Bacteria | 6116 |
| 451 | Ga0495606_0037881 | 3300046507 | Bacteria | 3269 |
| 452 | Ga0495608_0009916 | 3300046511 | Bacteria | 6650 |
| 453 | Ga0495628_0080917 | 3300046516 | Bacteria | 2523 |
| 454 | Ga0495630_0001092 | 3300046517 | Bacteria | 18641 |
| 455 | Ga0495630_0156008 | 3300046517 | Bacteria | 1737 |
| 456 | Ga0495648_0003145 | 3300046524 | Bacteria | 14696 |
| 457 | Ga0495666_0036890 | 3300046526 | Bacteria | 2379 |
| 458 | Ga0495652_0079996 | 3300046529 | Bacteria | 2701 |
| 459 | Ga0495665_0000088 | 3300046531 | Bacteria | 41277 |
| 460 | Ga0495665_0037779 | 3300046531 | Bacteria | 2576 |
| 461 | Ga0495640_0241210 | 3300046533 | Bacteria | 1134 |
| 462 | Ga0495586_0054860 | 3300046535 | Bacteria | 2160 |
| 463 | Ga0495587_0024741 | 3300046536 | Bacteria | 3676 |
| 464 | Ga0495645_0001816 | 3300046543 | Bacteria | 14507 |
| 465 | Ga0495645_0098639 | 3300046543 | Bacteria | 2079 |
| 466 | Ga0495667_0043456 | 3300046559 | Bacteria | 2977 |
| 467 | Ga0495668_0009011 | 3300046616 | Bacteria | 6161 |
| 468 | Ga0495634_0026821 | 3300046642 | Bacteria | 4016 |
| 469 | Ga0495635_0007133 | 3300046663 | Bacteria | 7812 |
| 470 | Ga0495635_0056149 | 3300046663 | Bacteria | 2711 |
| 471 | Ga0495635_0204247 | 3300046663 | Bacteria | 1339 |
| 472 | Ga0495657_0075232 | 3300046675 | Bacteria | 2195 |
| 473 | Ga0495623_0045035 | 3300046679 | Bacteria | 2803 |
| 474 | Ga0495623_0050580 | 3300046679 | Bacteria | 2631 |
| 475 | Ga0495647_0028697 | 3300046681 | Bacteria | 2053 |
| 476 | Ga0495658_0050333 | 3300046683 | Bacteria | 2356 |
| 477 | Ga0495658_0058766 | 3300046683 | Bacteria | 2200 |
| 478 | Ga0495613_0114048 | 3300046689 | Bacteria | 1945 |
| 479 | Ga0495624_0025996 | 3300046690 | Bacteria | 3840 |
| 480 | Ga0495624_0099665 | 3300046690 | Bacteria | 1789 |
| 481 | Ga0495671_0131620 | 3300046692 | Bacteria | 1220 |
| 482 | Ga0495649_0096652 | 3300046694 | Bacteria | 1572 |
| 483 | Ga0495649_0102202 | 3300046694 | Bacteria | 1523 |
| 484 | Ga0495600_0093903 | 3300046809 | Bacteria | 1956 |
| 485 | Ga0495581_0018190 | 3300047315 | Bacteria | 4083 |
| 486 | Ga0495604_0005466 | 3300047317 | Bacteria | 10076 |
| 487 | Ga0495604_0235841 | 3300047317 | Bacteria | 1253 |
| 488 | Ga0495674_0004761 | 3300047319 | Bacteria | 13047 |
| 489 | Ga0495674_0103240 | 3300047319 | Bacteria | 2424 |
| 490 | Ga0495672_0002466 | 3300047320 | Bacteria | 17010 |
| 491 | Ga0495672_0036464 | 3300047320 | Bacteria | 3019 |
| 492 | Ga0495672_0045977 | 3300047320 | Bacteria | 2607 |
| 493 | Ga0495676_0059373 | 3300047321 | Bacteria | 3004 |
| 494 | Ga0495680_0001743 | 3300047322 | Bacteria | 23092 |
| 495 | Ga0495680_0007513 | 3300047322 | Bacteria | 9981 |
| 496 | Ga0495680_0230909 | 3300047322 | Bacteria | 1317 |
| 497 | Ga0495675_0061410 | 3300047444 | Bacteria | 2380 |
| 498 | Ga0495673_0000617 | 3300047469 | Bacteria | 35151 |
| 499 | Ga0495684_0093617 | 3300047471 | Bacteria | 2275 |
| 500 | Ga0495684_0275602 | 3300047471 | Bacteria | 1215 |
| 501 | Ga0495686_0001662 | 3300047472 | Bacteria | 23169 |
| 502 | Ga0495686_0001752 | 3300047472 | Bacteria | 22276 |
| 503 | Ga0495593_0000023 | 3300047673 | Bacteria | 66020 |
| 504 | Ga0495602_0000395 | 3300048088 | Bacteria | 40667 |
| 505 | Ga0495602_0164958 | 3300048088 | Bacteria | 1725 |
| 506 | Ga0495602_0213332 | 3300048088 | Bacteria | 1463 |
| 507 | Ga0495626_0040210 | 3300048091 | Bacteria | 2210 |
| 508 | Ga0496100_0000021 | 3300048903 | Bacteria | 140074 |
| 509 | Ga0496100_0000468 | 3300048903 | Bacteria | 19363 |
| 510 | Ga0496100_0001410 | 3300048903 | Bacteria | 11755 |
| 511 | Ga0496100_0001990 | 3300048903 | Bacteria | 10236 |
| 512 | Ga0496100_0012513 | 3300048903 | Bacteria | 4868 |
| 513 | Ga0496101_0000037 | 3300048904 | Bacteria | 166198 |
| 514 | Ga0496101_0000155 | 3300048904 | Bacteria | 58347 |
| 515 | Ga0496101_0000190 | 3300048904 | Bacteria | 48412 |
| 516 | Ga0496101_0000286 | 3300048904 | Bacteria | 35339 |
| 517 | Ga0496101_0008179 | 3300048904 | Bacteria | 6831 |
| 518 | Ga0496101_0027213 | 3300048904 | Bacteria | 3981 |
| 519 | Ga0496101_0051230 | 3300048904 | Bacteria | 2974 |
| 520 | Ga0496101_0228302 | 3300048904 | Bacteria | 1446 |
| 521 | Ga0496102_0000083 | 3300048905 | Bacteria | 138102 |
| 522 | Ga0496102_0000214 | 3300048905 | Bacteria | 76691 |
| 523 | Ga0496102_0000603 | 3300048905 | Bacteria | 37505 |
| 524 | Ga0496102_0000919 | 3300048905 | Bacteria | 27779 |
| 525 | Ga0496102_0008173 | 3300048905 | Bacteria | 8955 |
| 526 | Ga0496102_0043702 | 3300048905 | Bacteria | 4064 |
| 527 | Ga0496102_0080777 | 3300048905 | Bacteria | 2996 |
| 528 | Ga0496102_0169638 | 3300048905 | Bacteria | 2054 |
| 529 | Ga0496102_0386744 | 3300048905 | Bacteria | 1316 |
| 530 | Ga0496103_0000060 | 3300048906 | Bacteria | 138526 |
| 531 | Ga0496103_0001250 | 3300048906 | Bacteria | 17360 |
| 532 | Ga0496103_0002031 | 3300048906 | Bacteria | 12993 |
| 533 | Ga0496103_0003083 | 3300048906 | Bacteria | 10242 |
| 534 | Ga0496103_0005460 | 3300048906 | Bacteria | 7601 |
| 535 | Ga0496103_0006962 | 3300048906 | Bacteria | 6751 |
| 536 | Ga0496103_0044848 | 3300048906 | Bacteria | 2726 |
| 537 | Ga0496103_0241910 | 3300048906 | Bacteria | 1161 |
| 538 | Ga0496103_0274922 | 3300048906 | Bacteria | 1083 |
| 539 | Ga0496104_0001338 | 3300048907 | Bacteria | 21315 |
| 540 | Ga0496104_0003271 | 3300048907 | Bacteria | 13978 |
| 541 | Ga0496104_0014101 | 3300048907 | Bacteria | 7215 |
| 542 | Ga0496104_0016584 | 3300048907 | Bacteria | 6694 |
| 543 | Ga0496104_0139908 | 3300048907 | Bacteria | 2325 |
| 544 | Ga0496104_0469961 | 3300048907 | Bacteria | 1169 |
| 545 | Ga0496105_0000791 | 3300048908 | Bacteria | 21421 |
| 546 | Ga0496105_0004580 | 3300048908 | Bacteria | 10419 |
| 547 | Ga0496105_0004706 | 3300048908 | Bacteria | 10292 |
| 548 | Ga0496105_0012249 | 3300048908 | Bacteria | 6789 |
| 549 | Ga0496105_0016141 | 3300048908 | Bacteria | 5956 |
| 550 | Ga0496105_0027113 | 3300048908 | Bacteria | 4677 |
| 551 | Ga0496105_0332728 | 3300048908 | Bacteria | 1215 |
| 552 | Ga0496106_0000744 | 3300048909 | Bacteria | 23478 |
| 553 | Ga0496106_0001314 | 3300048909 | Bacteria | 18647 |
| 554 | Ga0496106_0005332 | 3300048909 | Bacteria | 9517 |
| 555 | Ga0496106_0016857 | 3300048909 | Bacteria | 5406 |
| 556 | Ga0496106_0017053 | 3300048909 | Bacteria | 5375 |
| 557 | Ga0496106_0023966 | 3300048909 | Bacteria | 4535 |
| 558 | Ga0496106_0143175 | 3300048909 | Bacteria | 1881 |
| 559 | Ga0496107_0004639 | 3300048910 | Bacteria | 9319 |
| 560 | Ga0496107_0008155 | 3300048910 | Bacteria | 7244 |
| 561 | Ga0496107_0012527 | 3300048910 | Bacteria | 5920 |
| 562 | Ga0496107_0015109 | 3300048910 | Bacteria | 5409 |
| 563 | Ga0496107_0032134 | 3300048910 | Bacteria | 3750 |
| 564 | Ga0496107_0077672 | 3300048910 | Bacteria | 2418 |
| 565 | Ga0496107_0123829 | 3300048910 | Bacteria | 1905 |
| 566 | Ga0496108_0000636 | 3300048911 | Bacteria | 27379 |
| 567 | Ga0496108_0001179 | 3300048911 | Bacteria | 20386 |
| 568 | Ga0496108_0012383 | 3300048911 | Bacteria | 6942 |
| 569 | Ga0496108_0160034 | 3300048911 | Bacteria | 1945 |
| 570 | Ga0496108_0167476 | 3300048911 | Bacteria | 1900 |
| 571 | Ga0496109_0000042 | 3300048912 | Bacteria | 138654 |
| 572 | Ga0496109_0004114 | 3300048912 | Bacteria | 12155 |
| 573 | Ga0496109_0017818 | 3300048912 | Bacteria | 6230 |
| 574 | Ga0496109_0142578 | 3300048912 | Bacteria | 2241 |
| 575 | Ga0496110_0007684 | 3300048913 | Bacteria | 8627 |
| 576 | Ga0496110_0018421 | 3300048913 | Bacteria | 5855 |
| 577 | Ga0496110_0078907 | 3300048913 | Bacteria | 2931 |
| 578 | Ga0496110_0435983 | 3300048913 | Bacteria | 1194 |
| 579 | Ga0496111_0001504 | 3300048914 | Bacteria | 13359 |
| 580 | Ga0496111_0084080 | 3300048914 | Bacteria | 2326 |
| 581 | Ga0496111_0095534 | 3300048914 | Bacteria | 2181 |
| 582 | Ga0496111_0166993 | 3300048914 | Bacteria | 1635 |
| 583 | Ga0496111_0217875 | 3300048914 | Bacteria | 1418 |
| 584 | Ga0496111_0274357 | 3300048914 | Bacteria | 1251 |
| 585 | Ga0496112_0008556 | 3300048915 | Bacteria | 9170 |
| 586 | Ga0496112_0028965 | 3300048915 | Bacteria | 5352 |
| 587 | Ga0496112_0045839 | 3300048915 | Bacteria | 4286 |
| 588 | Ga0496112_0058420 | 3300048915 | Bacteria | 3798 |
| 589 | Ga0496112_0102848 | 3300048915 | Bacteria | 2826 |
| 590 | Ga0496113_0003392 | 3300048916 | Bacteria | 9532 |
| 591 | Ga0496113_0087693 | 3300048916 | Bacteria | 2393 |
| 592 | Ga0496113_0152888 | 3300048916 | Bacteria | 1821 |
| 593 | Ga0496114_0012474 | 3300048917 | Bacteria | 6804 |
| 594 | Ga0496114_0018548 | 3300048917 | Bacteria | 5627 |
| 595 | Ga0496114_0030357 | 3300048917 | Bacteria | 4447 |
| 596 | Ga0496114_0041906 | 3300048917 | Bacteria | 3793 |
| 597 | Ga0496115_0004929 | 3300048918 | Bacteria | 9697 |
| 598 | Ga0496115_0015699 | 3300048918 | Bacteria | 5750 |
| 599 | Ga0496115_0029792 | 3300048918 | Bacteria | 4290 |
| 600 | Ga0496115_0044952 | 3300048918 | Bacteria | 3524 |
| 601 | Ga0496115_0243854 | 3300048918 | Bacteria | 1481 |
| 602 | Ga0496115_0420549 | 3300048918 | Bacteria | 1083 |
| 603 | Ga0496116_0000159 | 3300048919 | Bacteria | 138102 |
| 604 | Ga0496116_0004063 | 3300048919 | Bacteria | 14149 |
| 605 | Ga0496116_0027718 | 3300048919 | Bacteria | 4117 |
| 606 | Ga0496116_0133021 | 3300048919 | Bacteria | 1414 |
| 607 | Ga0496117_0000167 | 3300048920 | Bacteria | 138102 |
| 608 | Ga0496117_0191466 | 3300048920 | Bacteria | 1164 |
| 609 | Ga0496118_0000121 | 3300048921 | Bacteria | 138102 |
| 610 | Ga0496118_0000160 | 3300048921 | Bacteria | 120349 |
| 611 | Ga0496118_0000331 | 3300048921 | Bacteria | 80747 |
| 612 | Ga0496118_0008109 | 3300048921 | Bacteria | 10943 |
| 613 | Ga0496119_0001018 | 3300048922 | Bacteria | 35880 |
| 614 | Ga0496119_0007205 | 3300048922 | Bacteria | 10074 |
| 615 | Ga0496119_0018795 | 3300048922 | Bacteria | 5123 |
| 616 | Ga0496119_0054437 | 3300048922 | Bacteria | 2436 |
| 617 | Ga0496119_0120412 | 3300048922 | Bacteria | 1443 |
| 618 | Ga0496120_0005219 | 3300048923 | Bacteria | 10464 |
| 619 | Ga0496120_0025111 | 3300048923 | Bacteria | 3702 |
| 620 | Ga0496120_0068628 | 3300048923 | Bacteria | 1955 |
| 621 | Ga0496120_0201910 | 3300048923 | Bacteria | 962 |
| 622 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 623 | Ga0496121_0000062 | 3300048924 | Bacteria | 274819 |
| 624 | Ga0496121_0002221 | 3300048924 | Bacteria | 30314 |
| 625 | Ga0496121_0017296 | 3300048924 | Bacteria | 7375 |
| 626 | Ga0496122_0000048 | 3300048925 | Bacteria | 269532 |
| 627 | Ga0496122_0120269 | 3300048925 | Bacteria | 1695 |
| 628 | Ga0496123_0005503 | 3300048926 | Bacteria | 12732 |
| 629 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 630 | Ga0496124_0027611 | 3300048927 | Bacteria | 5091 |
| 631 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 632 | Ga0496125_0027310 | 3300048928 | Bacteria | 5177 |
| 633 | Ga0496125_0039009 | 3300048928 | Bacteria | 4099 |
| 634 | Ga0496125_0058856 | 3300048928 | Bacteria | 3100 |
| 635 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 636 | Ga0496126_0000368 | 3300048929 | Bacteria | 92918 |
| 637 | Ga0496126_0002432 | 3300048929 | Bacteria | 25158 |
| 638 | Ga0496126_0017163 | 3300048929 | Bacteria | 7218 |
| 639 | Ga0496126_0019383 | 3300048929 | Bacteria | 6701 |
| 640 | Ga0496126_0024434 | 3300048929 | Bacteria | 5835 |
| 641 | Ga0496126_0100879 | 3300048929 | Bacteria | 2525 |
| 642 | Ga0501032_0000658 | 3300049569 | Bacteria | 28038 |
| 643 | Ga0501034_0021557 | 3300049571 | Bacteria | 6564 |
| 644 | Ga0501034_0240850 | 3300049571 | Bacteria | 1755 |
| 645 | Ga0501036_0016193 | 3300049572 | Bacteria | 6226 |
| 646 | Ga0501037_0000252 | 3300049573 | Bacteria | 45847 |
| 647 | Ga0501038_0002661 | 3300049574 | Bacteria | 16689 |
| 648 | Ga0501039_0000203 | 3300049575 | Bacteria | 43175 |
| 649 | Ga0501043_0001559 | 3300049579 | Bacteria | 19955 |
| 650 | Ga0501047_0382496 | 3300049581 | Bacteria | 1242 |
| 651 | Ga0501070_0031096 | 3300049586 | Bacteria | 4471 |
| 652 | Ga0501080_0266438 | 3300049742 | Bacteria | 1560 |
| 653 | Ga0501044_0008362 | 3300049823 | Bacteria | 11346 |
| 654 | Ga0501044_0111165 | 3300049823 | Bacteria | 2748 |
| 655 | nmdc:mga03n38_188_c1 | 3300050490 | Bacteria | 14022 |
| 656 | nmdc:mga03n38_33556_c1 | 3300050490 | Bacteria | 2185 |
| 657 | nmdc:mga03n38_47961_c1 | 3300050490 | Bacteria | 1893 |
| 658 | nmdc:mga03n38_55078_c1 | 3300050490 | Bacteria | 1790 |
| 659 | nmdc:mga00v17_12297_c1 | 3300050491 | Bacteria | 4722 |
| 660 | nmdc:mga00v17_175233_c1 | 3300050491 | Bacteria | 1383 |
| 661 | nmdc:mga00v17_26692_c1 | 3300050491 | Bacteria | 3368 |
| 662 | nmdc:mga00v17_28359_c1 | 3300050491 | Bacteria | 3278 |
| 663 | nmdc:mga00v17_292133_c1 | 3300050491 | Bacteria | 1058 |
| 664 | nmdc:mga00v17_31762_c1 | 3300050491 | Bacteria | 3116 |
| 665 | nmdc:mga00v17_329663_c1 | 3300050491 | Bacteria | 992 |
| 666 | nmdc:mga00v17_6174_c1 | 3300050491 | Bacteria | 6351 |
| 667 | nmdc:mga0yw44_12379_c1 | 3300050492 | Bacteria | 4444 |
| 668 | nmdc:mga0yw44_5694_c1 | 3300050492 | Bacteria | 5931 |
| 669 | nmdc:mga0yw44_74181_c1 | 3300050492 | Bacteria | 2119 |
| 670 | nmdc:mga06z11_17556_c1 | 3300050494 | Bacteria | 3250 |
| 671 | nmdc:mga06z11_37020_c1 | 3300050494 | Bacteria | 2414 |
| 672 | nmdc:mga07m45_11739_c1 | 3300050496 | Bacteria | 4609 |
| 673 | nmdc:mga07m45_198456_c1 | 3300050496 | Bacteria | 1167 |
| 674 | nmdc:mga07m45_2412_c1 | 3300050496 | Bacteria | 8766 |
| 675 | nmdc:mga07m45_39517_c1 | 3300050496 | Bacteria | 2636 |
| 676 | nmdc:mga07m45_70944_c1 | 3300050496 | Bacteria | 1982 |
| 677 | nmdc:mga07m45_95634_c1 | 3300050496 | Bacteria | 1704 |
| 678 | nmdc:mga09592_21042_c1 | 3300050508 | Bacteria | 5372 |
| 679 | nmdc:mga0qj67_23128_c1 | 3300050509 | Bacteria | 4778 |
| 680 | nmdc:mga0qj67_438357_c1 | 3300050509 | Bacteria | 1053 |
| 681 | nmdc:mga06r32_354922_c1 | 3300050510 | Bacteria | 1451 |
| 682 | nmdc:mga06r32_357433_c1 | 3300050510 | Bacteria | 1445 |
| 683 | nmdc:mga08y16_698372_c1 | 3300050511 | Bacteria | 1014 |
| 684 | nmdc:mga0rr50_8456_c1 | 3300050513 | Bacteria | 6409 |
| 685 | nmdc:mga08x19_128680_c1 | 3300050514 | Bacteria | 1702 |
| 686 | nmdc:mga0a205_332362_c1 | 3300050515 | Bacteria | 1389 |
| 687 | nmdc:mga0sz30_14375_c1 | 3300050516 | Bacteria | 3114 |
| 688 | nmdc:mga0sz30_15042_c1 | 3300050516 | Bacteria | 3054 |
| 689 | nmdc:mga0sz30_16955_c1 | 3300050516 | Bacteria | 2899 |
| 690 | nmdc:mga0sz30_21985_c1 | 3300050516 | Bacteria | 2586 |
| 691 | nmdc:mga0sz30_23486_c1 | 3300050516 | Bacteria | 2509 |
| 692 | nmdc:mga0sz30_41463_c1 | 3300050516 | Bacteria | 1935 |
| 693 | nmdc:mga0sz30_92573_c1 | 3300050516 | Bacteria | 1316 |
| 694 | Ga0495601_0129730 | 3300053077 | Bacteria | 1641 |
| 695 | Ga0500610_0000753 | 3300053079 | Bacteria | 10172 |
| 696 | Ga0500635_0043082 | 3300053080 | Bacteria | 1516 |
| 697 | Ga0495595_0005323 | 3300053084 | Bacteria | 5204 |
| 698 | Ga0495619_0050635 | 3300053085 | Bacteria | 2742 |
| 699 | Ga0500643_008420 | 3300053087 | Bacteria | 4054 |
| 700 | Ga0500643_015183 | 3300053087 | Bacteria | 2648 |
| 701 | Ga0500643_025423 | 3300053087 | Bacteria | 1868 |
| 702 | Ga0500556_0010818 | 3300053104 | Bacteria | 2686 |
| 703 | Ga0500608_042595 | 3300053122 | Bacteria | 2179 |
| 704 | Ga0500652_004525 | 3300053131 | Bacteria | 4309 |
| 705 | Ga0500658_0055681 | 3300053134 | Bacteria | 1629 |
| 706 | Ga0500616_0008482 | 3300053153 | Bacteria | 6374 |
| 707 | Ga0500616_0028309 | 3300053153 | Bacteria | 3088 |
| 708 | Ga0500627_0001734 | 3300053158 | Bacteria | 6191 |
| 709 | Ga0500634_0136478 | 3300053161 | Unclassified | 1169 |
| 710 | Ga0500637_0213776 | 3300053178 | Unclassified | 1093 |
| 711 | Ga0500645_000020 | 3300053730 | Bacteria | 134162 |
| 712 | Ga0466962_0043468 | 3300061719 | Bacteria | 2150 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035725 | Ga0373947_0328753 | Ga0373947_0328753_21_755 | 241 |
| 2 | 3300013296 | Ga0157374_10972151 | Ga0157374_109721512 | 244 |
| 3 | 3300028380 | Ga0268265_10062039 | Ga0268265_100620392 | 256 |
| 4 | iso_pu_bacteria | 2870782633 | 2870787846 | 256 |
| 5 | iso_pu_bacteria | 2980125574 | 2980130722 | 263 |
| 6 | 3300009148 | Ga0105243_10338340 | Ga0105243_103383402 | 264 |
| 7 | 3300031901 | Ga0307406_10101904 | Ga0307406_101019042 | 265 |
| 8 | 3300048906 | Ga0496103_0241910 | Ga0496103_0241910_341_1141 | 266 |
| 9 | 3300031548 | Ga0307408_100467929 | Ga0307408_1004679291 | 267 |
| 10 | 3300035086 | Ga0373934_0088653 | Ga0373934_0088653_99_923 | 267 |
| 11 | 3300035242 | Ga0373962_0028027 | Ga0373962_0028027_50_874 | 267 |
| 12 | 3300053161 | Ga0500634_0136478 | Ga0500634_0136478_319_1131 | 267 |
| 13 | iso_pu_bacteria | 2881101125 | 2881103590 | 267 |
| 14 | 3300046472 | Ga0495580_0293286 | Ga0495580_0293286_231_1079 | 268 |
| 15 | iso_pu_bacteria | 2866612099 | 2866618469 | 268 |
| 16 | 3300048923 | Ga0496120_0201910 | Ga0496120_0201910_84_908 | 269 |
| 17 | 3300003758 | Ga0055532_1000666 | Ga0055532_100066611 | 270 |
| 18 | 3300003760 | Ga0055527_1000220 | Ga0055527_10002207 | 270 |
| 19 | 3300003761 | Ga0055535_1000465 | Ga0055535_10004657 | 270 |
| 20 | 3300003762 | Ga0055542_1001377 | Ga0055542_10013777 | 270 |
| 21 | 3300005539 | Ga0068853_100061775 | Ga0068853_1000617753 | 270 |
| 22 | 3300006028 | Ga0070717_10016214 | Ga0070717_100162144 | 270 |
| 23 | 3300007265 | Ga0099794_10117055 | Ga0099794_101170552 | 270 |
| 24 | 3300009551 | Ga0105238_10237513 | Ga0105238_102375132 | 270 |
| 25 | 3300025228 | Ga0209672_100012 | Ga0209672_100012366 | 270 |
| 26 | 3300025229 | Ga0209147_100007 | Ga0209147_100007406 | 270 |
| 27 | 3300025242 | Ga0209258_100014 | Ga0209258_100014298 | 270 |
| 28 | 3300025254 | Ga0209148_1000337 | Ga0209148_100033766 | 270 |
| 29 | 3300025272 | Ga0209455_1000138 | Ga0209455_100013879 | 270 |
| 30 | 3300026041 | Ga0207639_10047386 | Ga0207639_100473863 | 270 |
| 31 | 3300044693 | Ga0466961_0090667 | Ga0466961_0090667_943_1767 | 270 |
| 32 | 3300044735 | Ga0466968_0058866 | Ga0466968_0058866_183_1007 | 270 |
| 33 | 3300044765 | Ga0466970_0023693 | Ga0466970_0023693_109_933 | 270 |
| 34 | 3300048903 | Ga0496100_0012513 | Ga0496100_0012513_3351_4163 | 270 |
| 35 | 3300048904 | Ga0496101_0000037 | Ga0496101_0000037_58071_58883 | 270 |
| 36 | 3300048905 | Ga0496102_0000083 | Ga0496102_0000083_76666_77478 | 270 |
| 37 | 3300048906 | Ga0496103_0000060 | Ga0496103_0000060_77090_77902 | 270 |
| 38 | 3300048909 | Ga0496106_0005332 | Ga0496106_0005332_5441_6253 | 270 |
| 39 | 3300048910 | Ga0496107_0015109 | Ga0496107_0015109_3194_4006 | 270 |
| 40 | 3300048919 | Ga0496116_0000159 | Ga0496116_0000159_60625_61437 | 270 |
| 41 | 3300048920 | Ga0496117_0000167 | Ga0496117_0000167_76666_77478 | 270 |
| 42 | 3300048921 | Ga0496118_0000121 | Ga0496118_0000121_60625_61437 | 270 |
| 43 | 3300048922 | Ga0496119_0120412 | Ga0496119_0120412_473_1285 | 270 |
| 44 | 3300048923 | Ga0496120_0025111 | Ga0496120_0025111_1982_2794 | 270 |
| 45 | 3300048924 | Ga0496121_0000062 | Ga0496121_0000062_260181_260993 | 270 |
| 46 | 3300048929 | Ga0496126_0000368 | Ga0496126_0000368_80500_81312 | 270 |
| 47 | iso_pu_bacteria | 2558860280 | 2559431302 | 270 |
| 48 | 3300006048 | Ga0075363_100081229 | Ga0075363_1000812292 | 271 |
| 49 | 3300042876 | Ga0451577_0030894 | Ga0451577_0030894_1994_2818 | 271 |
| 50 | 3300050490 | nmdc:mga03n38_55078_c1 | nmdc:mga03n38_55078_c1_524_1378 | 271 |
| 51 | 3300050491 | nmdc:mga00v17_175233_c1 | nmdc:mga00v17_175233_c1_137_991 | 271 |
| 52 | iso_pu_bacteria | 2738541295 | 2738815531 | 271 |
| 53 | 3300005445 | Ga0070708_100002951 | Ga0070708_1000029519 | 272 |
| 54 | 3300005467 | Ga0070706_100008204 | Ga0070706_1000082043 | 272 |
| 55 | 3300005468 | Ga0070707_100008267 | Ga0070707_1000082676 | 272 |
| 56 | 3300005471 | Ga0070698_100011824 | Ga0070698_1000118245 | 272 |
| 57 | 3300006028 | Ga0070717_10002375 | Ga0070717_100023755 | 272 |
| 58 | 3300006844 | Ga0075428_100239600 | Ga0075428_1002396002 | 272 |
| 59 | 3300025910 | Ga0207684_10007721 | Ga0207684_100077213 | 272 |
| 60 | 3300025922 | Ga0207646_10006000 | Ga0207646_100060006 | 272 |
| 61 | 3300025928 | Ga0207700_10538420 | Ga0207700_105384202 | 272 |
| 62 | 3300031456 | Ga0307513_10118878 | Ga0307513_101188782 | 272 |
| 63 | 3300044656 | Ga0466969_0010807 | Ga0466969_0010807_3438_4268 | 272 |
| 64 | 3300044656 | Ga0466969_0028966 | Ga0466969_0028966_365_1195 | 272 |
| 65 | 3300044684 | Ga0466966_0001650 | Ga0466966_0001650_10256_11086 | 272 |
| 66 | 3300047472 | Ga0495686_0001662 | Ga0495686_0001662_14447_15274 | 272 |
| 67 | 3300048091 | Ga0495626_0040210 | Ga0495626_0040210_556_1419 | 272 |
| 68 | iso_pu_bacteria | 2917736166 | 2917741677 | 272 |
| 69 | 3300001989 | JGI24739J22299_10020316 | JGI24739J22299_100203162 | 273 |
| 70 | 3300002076 | JGI24749J21850_1002284 | JGI24749J21850_10022843 | 273 |
| 71 | 3300005335 | Ga0070666_10076744 | Ga0070666_100767442 | 273 |
| 72 | 3300005337 | Ga0070682_100002887 | Ga0070682_10000288710 | 273 |
| 73 | 3300005339 | Ga0070660_100344405 | Ga0070660_1003444052 | 273 |
| 74 | 3300005341 | Ga0070691_10060023 | Ga0070691_100600231 | 273 |
| 75 | 3300005345 | Ga0070692_10294913 | Ga0070692_102949131 | 273 |
| 76 | 3300005356 | Ga0070674_100000467 | Ga0070674_1000004676 | 273 |
| 77 | 3300005439 | Ga0070711_100001974 | Ga0070711_10000197411 | 273 |
| 78 | 3300005441 | Ga0070700_100002887 | Ga0070700_10000288710 | 273 |
| 79 | 3300005456 | Ga0070678_100000278 | Ga0070678_10000027820 | 273 |
| 80 | 3300005459 | Ga0068867_100006337 | Ga0068867_1000063379 | 273 |
| 81 | 3300005544 | Ga0070686_100082109 | Ga0070686_1000821093 | 273 |
| 82 | 3300005546 | Ga0070696_100003712 | Ga0070696_1000037123 | 273 |
| 83 | 3300005614 | Ga0068856_100238825 | Ga0068856_1002388252 | 273 |
| 84 | 3300005719 | Ga0068861_100000788 | Ga0068861_1000007884 | 273 |
| 85 | 3300006163 | Ga0070715_10015599 | Ga0070715_100155992 | 273 |
| 86 | 3300006881 | Ga0068865_100001704 | Ga0068865_1000017043 | 273 |
| 87 | 3300025256 | Ga0209759_1002516 | Ga0209759_10025161 | 273 |
| 88 | 3300025903 | Ga0207680_10059271 | Ga0207680_100592712 | 273 |
| 89 | 3300025905 | Ga0207685_10001909 | Ga0207685_100019093 | 273 |
| 90 | 3300025906 | Ga0207699_10009792 | Ga0207699_100097923 | 273 |
| 91 | 3300025911 | Ga0207654_10014497 | Ga0207654_100144972 | 273 |
| 92 | 3300025918 | Ga0207662_10020799 | Ga0207662_100207994 | 273 |
| 93 | 3300025919 | Ga0207657_10435003 | Ga0207657_104350031 | 273 |
| 94 | 3300025923 | Ga0207681_10059196 | Ga0207681_100591961 | 273 |
| 95 | 3300025927 | Ga0207687_10010041 | Ga0207687_100100414 | 273 |
| 96 | 3300025932 | Ga0207690_10054022 | Ga0207690_100540222 | 273 |
| 97 | 3300025935 | Ga0207709_10009193 | Ga0207709_100091933 | 273 |
| 98 | 3300025939 | Ga0207665_10001300 | Ga0207665_100013007 | 273 |
| 99 | 3300025960 | Ga0207651_10050982 | Ga0207651_100509822 | 273 |
| 100 | 3300025972 | Ga0207668_10034876 | Ga0207668_100348762 | 273 |
| 101 | 3300025981 | Ga0207640_10002011 | Ga0207640_100020118 | 273 |
| 102 | 3300026023 | Ga0207677_10023591 | Ga0207677_100235912 | 273 |
| 103 | 3300026035 | Ga0207703_10029584 | Ga0207703_100295843 | 273 |
| 104 | 3300026041 | Ga0207639_10021887 | Ga0207639_100218874 | 273 |
| 105 | 3300026067 | Ga0207678_10055292 | Ga0207678_100552924 | 273 |
| 106 | 3300026075 | Ga0207708_10002484 | Ga0207708_100024844 | 273 |
| 107 | 3300031344 | Ga0265316_10130848 | Ga0265316_101308482 | 273 |
| 108 | 3300037068 | Ga0373925_0538051 | Ga0373925_0538051_28_849 | 273 |
| 109 | 3300044683 | Ga0466965_0117359 | Ga0466965_0117359_112_942 | 273 |
| 110 | 3300044842 | Ga0466957_0016321 | Ga0466957_0016321_931_1761 | 273 |
| 111 | 3300046690 | Ga0495624_0099665 | Ga0495624_0099665_19_840 | 273 |
| 112 | iso_pu_bacteria | 2501025502 | 2501077736 | 273 |
| 113 | iso_pu_bacteria | 2501025502 | 2501085591 | 273 |
| 114 | iso_pu_bacteria | 2510917013 | 2511092292 | 273 |
| 115 | iso_pu_bacteria | 2510917013 | 2511093157 | 273 |
| 116 | iso_pu_bacteria | 2515154189 | 2516024146 | 273 |
| 117 | iso_pu_bacteria | 8003314358 | 8003316828 | 273 |
| 118 | 3300006844 | Ga0075428_100095057 | Ga0075428_1000950574 | 274 |
| 119 | 3300006846 | Ga0075430_100050758 | Ga0075430_1000507581 | 274 |
| 120 | 3300006880 | Ga0075429_100009538 | Ga0075429_1000095384 | 274 |
| 121 | 3300009147 | Ga0114129_10022901 | Ga0114129_100229014 | 274 |
| 122 | 3300033179 | Ga0307507_10007039 | Ga0307507_1000703913 | 274 |
| 123 | 3300033180 | Ga0307510_10096415 | Ga0307510_100964152 | 274 |
| 124 | 3300037471 | Ga0395905_0307413 | Ga0395905_0307413_614_1456 | 274 |
| 125 | 3300048907 | Ga0496104_0016584 | Ga0496104_0016584_2058_2891 | 274 |
| 126 | 3300048908 | Ga0496105_0012249 | Ga0496105_0012249_4599_5432 | 274 |
| 127 | 3300048922 | Ga0496119_0001018 | Ga0496119_0001018_15902_16735 | 274 |
| 128 | 3300050508 | nmdc:mga09592_21042_c1 | nmdc:mga09592_21042_c1_4332_5174 | 274 |
| 129 | 3300050509 | nmdc:mga0qj67_438357_c1 | nmdc:mga0qj67_438357_c1_50_892 | 274 |
| 130 | 3300050510 | nmdc:mga06r32_354922_c1 | nmdc:mga06r32_354922_c1_180_1022 | 274 |
| 131 | 3300005347 | Ga0070668_100003547 | Ga0070668_10000354712 | 275 |
| 132 | 3300005367 | Ga0070667_100184076 | Ga0070667_1001840763 | 275 |
| 133 | 3300013105 | Ga0157369_10008809 | Ga0157369_100088093 | 275 |
| 134 | 3300013296 | Ga0157374_10265967 | Ga0157374_102659672 | 275 |
| 135 | 3300025924 | Ga0207694_10045304 | Ga0207694_100453041 | 275 |
| 136 | 3300025972 | Ga0207668_10031438 | Ga0207668_100314382 | 275 |
| 137 | 3300031507 | Ga0307509_10085936 | Ga0307509_100859363 | 275 |
| 138 | 3300035119 | Ga0373956_0000244 | Ga0373956_0000244_11042_11878 | 275 |
| 139 | 3300035724 | Ga0373933_0007198 | Ga0373933_0007198_4768_5604 | 275 |
| 140 | 3300044658 | Ga0466972_0007466 | Ga0466972_0007466_1324_2166 | 275 |
| 141 | 3300044683 | Ga0466965_0194892 | Ga0466965_0194892_214_1056 | 275 |
| 142 | 3300046463 | Ga0495653_0001061 | Ga0495653_0001061_16793_17629 | 275 |
| 143 | 3300046477 | Ga0495664_0002014 | Ga0495664_0002014_3578_4414 | 275 |
| 144 | 3300046517 | Ga0495630_0001092 | Ga0495630_0001092_2165_3001 | 275 |
| 145 | 3300046529 | Ga0495652_0079996 | Ga0495652_0079996_247_1083 | 275 |
| 146 | 3300046531 | Ga0495665_0000088 | Ga0495665_0000088_8628_9464 | 275 |
| 147 | 3300046543 | Ga0495645_0001816 | Ga0495645_0001816_2549_3385 | 275 |
| 148 | 3300046663 | Ga0495635_0007133 | Ga0495635_0007133_6697_7533 | 275 |
| 149 | 3300046679 | Ga0495623_0050580 | Ga0495623_0050580_243_1079 | 275 |
| 150 | 3300046690 | Ga0495624_0025996 | Ga0495624_0025996_1345_2181 | 275 |
| 151 | 3300046809 | Ga0495600_0093903 | Ga0495600_0093903_195_1031 | 275 |
| 152 | 3300047317 | Ga0495604_0235841 | Ga0495604_0235841_281_1117 | 275 |
| 153 | 3300047319 | Ga0495674_0004761 | Ga0495674_0004761_6788_7624 | 275 |
| 154 | 3300047322 | Ga0495680_0001743 | Ga0495680_0001743_10069_10905 | 275 |
| 155 | 3300047673 | Ga0495593_0000023 | Ga0495593_0000023_33286_34122 | 275 |
| 156 | 3300048088 | Ga0495602_0000395 | Ga0495602_0000395_36270_37106 | 275 |
| 157 | 3300048903 | Ga0496100_0000468 | Ga0496100_0000468_9674_10510 | 275 |
| 158 | 3300048904 | Ga0496101_0000286 | Ga0496101_0000286_25671_26507 | 275 |
| 159 | 3300048905 | Ga0496102_0000603 | Ga0496102_0000603_31148_31984 | 275 |
| 160 | 3300048906 | Ga0496103_0001250 | Ga0496103_0001250_15245_16081 | 275 |
| 161 | 3300048907 | Ga0496104_0014101 | Ga0496104_0014101_6072_6908 | 275 |
| 162 | 3300048908 | Ga0496105_0004706 | Ga0496105_0004706_4268_5104 | 275 |
| 163 | 3300048909 | Ga0496106_0143175 | Ga0496106_0143175_945_1781 | 275 |
| 164 | 3300048910 | Ga0496107_0032134 | Ga0496107_0032134_1896_2732 | 275 |
| 165 | 3300048914 | Ga0496111_0166993 | Ga0496111_0166993_584_1420 | 275 |
| 166 | 3300048919 | Ga0496116_0133021 | Ga0496116_0133021_64_900 | 275 |
| 167 | 3300048922 | Ga0496119_0054437 | Ga0496119_0054437_1158_1994 | 275 |
| 168 | 3300048924 | Ga0496121_0017296 | Ga0496121_0017296_6225_7061 | 275 |
| 169 | 3300048929 | Ga0496126_0019383 | Ga0496126_0019383_3047_3883 | 275 |
| 170 | 3300005455 | Ga0070663_100000346 | Ga0070663_1000003465 | 276 |
| 171 | 3300026067 | Ga0207678_10000470 | Ga0207678_1000047013 | 276 |
| 172 | 3300053153 | Ga0500616_0028309 | Ga0500616_0028309_392_1264 | 276 |
| 173 | 3300017792 | Ga0163161_10003217 | Ga0163161_100032176 | 277 |
| 174 | 3300017792 | Ga0163161_10018910 | Ga0163161_100189102 | 277 |
| 175 | 3300028794 | Ga0307515_10069528 | Ga0307515_100695281 | 277 |
| 176 | 3300044719 | Ga0466971_0158726 | Ga0466971_0158726_99_941 | 277 |
| 177 | 3300047317 | Ga0495604_0005466 | Ga0495604_0005466_1799_2659 | 277 |
| 178 | 3300002067 | JGI24735J21928_10044461 | JGI24735J21928_100444612 | 278 |
| 179 | 3300004799 | Ga0058863_11834253 | Ga0058863_118342532 | 278 |
| 180 | 3300005455 | Ga0070663_100001369 | Ga0070663_10000136910 | 278 |
| 181 | 3300005577 | Ga0068857_100124185 | Ga0068857_1001241852 | 278 |
| 182 | 3300005614 | Ga0068856_100054190 | Ga0068856_1000541904 | 278 |
| 183 | 3300006038 | Ga0075365_10089670 | Ga0075365_100896702 | 278 |
| 184 | 3300006048 | Ga0075363_100019226 | Ga0075363_1000192263 | 278 |
| 185 | 3300006051 | Ga0075364_10049452 | Ga0075364_100494522 | 278 |
| 186 | 3300006186 | Ga0075369_10009126 | Ga0075369_100091262 | 278 |
| 187 | 3300006353 | Ga0075370_10133760 | Ga0075370_101337602 | 278 |
| 188 | 3300013105 | Ga0157369_10059876 | Ga0157369_100598764 | 278 |
| 189 | 3300020069 | Ga0197907_10921680 | Ga0197907_109216802 | 278 |
| 190 | 3300020080 | Ga0206350_11005135 | Ga0206350_110051351 | 278 |
| 191 | 3300020081 | Ga0206354_10133537 | Ga0206354_101335372 | 278 |
| 192 | 3300025904 | Ga0207647_10104708 | Ga0207647_101047082 | 278 |
| 193 | 3300025929 | Ga0207664_10158690 | Ga0207664_101586902 | 278 |
| 194 | 3300026067 | Ga0207678_10000480 | Ga0207678_1000048022 | 278 |
| 195 | 3300026078 | Ga0207702_10205935 | Ga0207702_102059352 | 278 |
| 196 | 3300026116 | Ga0207674_10080347 | Ga0207674_100803472 | 278 |
| 197 | 3300044684 | Ga0466966_0209102 | Ga0466966_0209102_81_932 | 278 |
| 198 | 3300045049 | Ga0466959_0424934 | Ga0466959_0424934_11_862 | 278 |
| 199 | 3300046460 | Ga0495638_0001757 | Ga0495638_0001757_349_1212 | 278 |
| 200 | 3300048907 | Ga0496104_0001338 | Ga0496104_0001338_4261_5109 | 278 |
| 201 | 3300048908 | Ga0496105_0000791 | Ga0496105_0000791_4364_5212 | 278 |
| 202 | 3300048918 | Ga0496115_0029792 | Ga0496115_0029792_2335_3183 | 278 |
| 203 | 3300050491 | nmdc:mga00v17_26692_c1 | nmdc:mga00v17_26692_c1_1323_2204 | 278 |
| 204 | 3300050492 | nmdc:mga0yw44_74181_c1 | nmdc:mga0yw44_74181_c1_861_1742 | 278 |
| 205 | 3300050496 | nmdc:mga07m45_70944_c1 | nmdc:mga07m45_70944_c1_909_1790 | 278 |
| 206 | 3300053104 | Ga0500556_0010818 | Ga0500556_0010818_760_1623 | 278 |
| 207 | 3300053178 | Ga0500637_0213776 | Ga0500637_0213776_140_988 | 278 |
| 208 | iso_pu_bacteria | 2842888712 | 2842889788 | 279 |
| 209 | 3300005438 | Ga0070701_10124622 | Ga0070701_101246221 | 280 |
| 210 | 3300006038 | Ga0075365_10036397 | Ga0075365_100363973 | 280 |
| 211 | 3300006051 | Ga0075364_10019822 | Ga0075364_100198223 | 280 |
| 212 | 3300042876 | Ga0451577_0060150 | Ga0451577_0060150_1497_2360 | 280 |
| 213 | 3300048914 | Ga0496111_0274357 | Ga0496111_0274357_367_1230 | 280 |
| 214 | 3300050491 | nmdc:mga00v17_12297_c1 | nmdc:mga00v17_12297_c1_2667_3557 | 280 |
| 215 | 3300053079 | Ga0500610_0000753 | Ga0500610_0000753_6133_7002 | 280 |
| 216 | iso_pu_bacteria | 2643221715 | 2644639666 | 281 |
| 217 | iso_pu_bacteria | 2902810491 | 2902814313 | 281 |
| 218 | 3300009147 | Ga0114129_10254944 | Ga0114129_102549443 | 282 |
| 219 | 3300028794 | Ga0307515_10000192 | Ga0307515_1000019231 | 282 |
| 220 | 3300046474 | Ga0495605_0000040 | Ga0495605_0000040_118348_119226 | 282 |
| 221 | 3300048906 | Ga0496103_0274922 | Ga0496103_0274922_11_868 | 282 |
| 222 | 3300048920 | Ga0496117_0191466 | Ga0496117_0191466_23_880 | 282 |
| 223 | 3300048921 | Ga0496118_0000160 | Ga0496118_0000160_46289_47146 | 282 |
| 224 | iso_pu_bacteria | 2939582691 | 2939584050 | 282 |
| 225 | 3300005347 | Ga0070668_100002295 | Ga0070668_10000229512 | 283 |
| 226 | 3300005435 | Ga0070714_100320280 | Ga0070714_1003202802 | 283 |
| 227 | 3300025972 | Ga0207668_10000532 | Ga0207668_100005329 | 283 |
| 228 | 3300035171 | Ga0373946_0122760 | Ga0373946_0122760_89_967 | 283 |
| 229 | 3300036647 | Ga0316582_0457587 | Ga0316582_0457587_17_868 | 283 |
| 230 | 3300049823 | Ga0501044_0111165 | Ga0501044_0111165_851_1711 | 283 |
| 231 | iso_pu_bacteria | 2643221687 | 2644491414 | 283 |
| 232 | iso_pu_bacteria | 2902837492 | 2902842585 | 283 |
| 233 | 3300007265 | Ga0099794_10009175 | Ga0099794_100091753 | 284 |
| 234 | 3300031616 | Ga0307508_10065510 | Ga0307508_100655102 | 284 |
| 235 | 3300031730 | Ga0307516_10087317 | Ga0307516_100873173 | 284 |
| 236 | 3300046543 | Ga0495645_0098639 | Ga0495645_0098639_1150_2025 | 284 |
| 237 | 3300050514 | nmdc:mga08x19_128680_c1 | nmdc:mga08x19_128680_c1_123_1001 | 284 |
| 238 | iso_pu_bacteria | 2643221692 | 2644515702 | 284 |
| 239 | 3300005440 | Ga0070705_100350016 | Ga0070705_1003500161 | 285 |
| 240 | 3300005546 | Ga0070696_100025465 | Ga0070696_1000254655 | 285 |
| 241 | 3300006051 | Ga0075364_10002829 | Ga0075364_100028297 | 285 |
| 242 | 3300006051 | Ga0075364_10212586 | Ga0075364_102125862 | 285 |
| 243 | 3300006358 | Ga0068871_100177072 | Ga0068871_1001770722 | 285 |
| 244 | 3300006852 | Ga0075433_10499350 | Ga0075433_104993502 | 285 |
| 245 | 3300006871 | Ga0075434_100007704 | Ga0075434_1000077048 | 285 |
| 246 | 3300007076 | Ga0075435_100265708 | Ga0075435_1002657081 | 285 |
| 247 | 3300009101 | Ga0105247_10242311 | Ga0105247_102423111 | 285 |
| 248 | 3300014969 | Ga0157376_10242606 | Ga0157376_102426061 | 285 |
| 249 | 3300025916 | Ga0207663_10011400 | Ga0207663_100114001 | 285 |
| 250 | 3300025928 | Ga0207700_10017422 | Ga0207700_100174222 | 285 |
| 251 | 3300025936 | Ga0207670_10326006 | Ga0207670_103260061 | 285 |
| 252 | 3300028786 | Ga0307517_10061247 | Ga0307517_100612473 | 285 |
| 253 | 3300034817 | Ga0373948_0003054 | Ga0373948_0003054_425_1306 | 285 |
| 254 | 3300035085 | Ga0373929_0010430 | Ga0373929_0010430_414_1295 | 285 |
| 255 | 3300035090 | Ga0373949_0002005 | Ga0373949_0002005_1950_2831 | 285 |
| 256 | 3300035691 | Ga0373931_0004902 | Ga0373931_0004902_4565_5446 | 285 |
| 257 | 3300035695 | Ga0373927_0179805 | Ga0373927_0179805_299_1180 | 285 |
| 258 | 3300041411 | Ga0439466_0029215 | Ga0439466_0029215_534_1406 | 285 |
| 259 | 3300041413 | Ga0439465_0051285 | Ga0439465_0051285_374_1246 | 285 |
| 260 | 3300046461 | Ga0495641_0068738 | Ga0495641_0068738_87_968 | 285 |
| 261 | 3300046463 | Ga0495653_0174319 | Ga0495653_0174319_72_953 | 285 |
| 262 | 3300046472 | Ga0495580_0028064 | Ga0495580_0028064_1373_2254 | 285 |
| 263 | 3300046473 | Ga0495582_0043826 | Ga0495582_0043826_1166_2047 | 285 |
| 264 | 3300046476 | Ga0495662_0045114 | Ga0495662_0045114_346_1227 | 285 |
| 265 | 3300046517 | Ga0495630_0156008 | Ga0495630_0156008_316_1197 | 285 |
| 266 | 3300046526 | Ga0495666_0036890 | Ga0495666_0036890_28_909 | 285 |
| 267 | 3300046533 | Ga0495640_0241210 | Ga0495640_0241210_234_1115 | 285 |
| 268 | 3300046663 | Ga0495635_0204247 | Ga0495635_0204247_125_1006 | 285 |
| 269 | 3300046679 | Ga0495623_0045035 | Ga0495623_0045035_1246_2127 | 285 |
| 270 | 3300046681 | Ga0495647_0028697 | Ga0495647_0028697_1104_1985 | 285 |
| 271 | 3300046683 | Ga0495658_0058766 | Ga0495658_0058766_1019_1900 | 285 |
| 272 | 3300047322 | Ga0495680_0230909 | Ga0495680_0230909_304_1185 | 285 |
| 273 | 3300047444 | Ga0495675_0061410 | Ga0495675_0061410_1113_1994 | 285 |
| 274 | 3300048904 | Ga0496101_0027213 | Ga0496101_0027213_1151_2032 | 285 |
| 275 | 3300048905 | Ga0496102_0080777 | Ga0496102_0080777_1876_2757 | 285 |
| 276 | 3300048908 | Ga0496105_0016141 | Ga0496105_0016141_3499_4380 | 285 |
| 277 | 3300048908 | Ga0496105_0332728 | Ga0496105_0332728_156_1037 | 285 |
| 278 | 3300048909 | Ga0496106_0023966 | Ga0496106_0023966_2739_3620 | 285 |
| 279 | 3300048910 | Ga0496107_0077672 | Ga0496107_0077672_1438_2319 | 285 |
| 280 | 3300048911 | Ga0496108_0160034 | Ga0496108_0160034_315_1196 | 285 |
| 281 | 3300048913 | Ga0496110_0435983 | Ga0496110_0435983_190_1071 | 285 |
| 282 | 3300048915 | Ga0496112_0102848 | Ga0496112_0102848_1376_2257 | 285 |
| 283 | 3300048916 | Ga0496113_0152888 | Ga0496113_0152888_721_1602 | 285 |
| 284 | 3300048917 | Ga0496114_0041906 | Ga0496114_0041906_1557_2438 | 285 |
| 285 | 3300048918 | Ga0496115_0044952 | Ga0496115_0044952_1041_1922 | 285 |
| 286 | 3300050513 | nmdc:mga0rr50_8456_c1 | nmdc:mga0rr50_8456_c1_5418_6299 | 285 |
| 287 | 3300050515 | nmdc:mga0a205_332362_c1 | nmdc:mga0a205_332362_c1_329_1210 | 285 |
| 288 | iso_pu_bacteria | 2565956761 | 2566995971 | 285 |
| 289 | iso_pu_bacteria | 2738541308 | 2738891574 | 285 |
| 290 | iso_pu_bacteria | 2738543005 | 2739204754 | 285 |
| 291 | iso_pu_bacteria | 2738543011 | 2739240457 | 285 |
| 292 | iso_pu_bacteria | 2889300758 | 2889303778 | 285 |
| 293 | iso_pu_bacteria | 2904535858 | 2904540607 | 285 |
| 294 | iso_pu_bacteria | 2922554459 | 2922554692 | 285 |
| 295 | iso_pu_bacteria | 2928142448 | 2928147338 | 285 |
| 296 | iso_pu_bacteria | 2939743619 | 2939747562 | 285 |
| 297 | 3300035086 | Ga0373934_0026775 | Ga0373934_0026775_475_1380 | 286 |
| 298 | 3300035116 | Ga0373945_0042784 | Ga0373945_0042784_405_1310 | 286 |
| 299 | 3300035120 | Ga0373957_0017035 | Ga0373957_0017035_536_1441 | 286 |
| 300 | 3300035171 | Ga0373946_0042188 | Ga0373946_0042188_300_1205 | 286 |
| 301 | 3300035692 | Ga0373935_0268394 | Ga0373935_0268394_122_1027 | 286 |
| 302 | 3300035724 | Ga0373933_0003594 | Ga0373933_0003594_6339_7244 | 286 |
| 303 | 3300044658 | Ga0466972_0026501 | Ga0466972_0026501_1007_1894 | 286 |
| 304 | 3300044683 | Ga0466965_0000989 | Ga0466965_0000989_4804_5691 | 286 |
| 305 | 3300044901 | Ga0466960_0000322 | Ga0466960_0000322_7362_8249 | 286 |
| 306 | 3300046454 | Ga0495592_0036341 | Ga0495592_0036341_1541_2446 | 286 |
| 307 | 3300046455 | Ga0495603_0279058 | Ga0495603_0279058_13_918 | 286 |
| 308 | 3300046461 | Ga0495641_0039940 | Ga0495641_0039940_772_1677 | 286 |
| 309 | 3300046462 | Ga0495651_0114139 | Ga0495651_0114139_386_1291 | 286 |
| 310 | 3300046475 | Ga0495639_0046080 | Ga0495639_0046080_480_1385 | 286 |
| 311 | 3300046477 | Ga0495664_0096191 | Ga0495664_0096191_515_1420 | 286 |
| 312 | 3300046511 | Ga0495608_0009916 | Ga0495608_0009916_5261_6166 | 286 |
| 313 | 3300046516 | Ga0495628_0080917 | Ga0495628_0080917_983_1888 | 286 |
| 314 | 3300046536 | Ga0495587_0024741 | Ga0495587_0024741_1187_2092 | 286 |
| 315 | 3300046559 | Ga0495667_0043456 | Ga0495667_0043456_1569_2474 | 286 |
| 316 | 3300046642 | Ga0495634_0026821 | Ga0495634_0026821_378_1283 | 286 |
| 317 | 3300046663 | Ga0495635_0056149 | Ga0495635_0056149_555_1460 | 286 |
| 318 | 3300046675 | Ga0495657_0075232 | Ga0495657_0075232_961_1866 | 286 |
| 319 | 3300046683 | Ga0495658_0050333 | Ga0495658_0050333_1195_2100 | 286 |
| 320 | 3300046689 | Ga0495613_0114048 | Ga0495613_0114048_467_1372 | 286 |
| 321 | 3300046694 | Ga0495649_0096652 | Ga0495649_0096652_529_1413 | 286 |
| 322 | 3300047322 | Ga0495680_0007513 | Ga0495680_0007513_7508_8413 | 286 |
| 323 | 3300047471 | Ga0495684_0093617 | Ga0495684_0093617_649_1554 | 286 |
| 324 | 3300048088 | Ga0495602_0164958 | Ga0495602_0164958_457_1362 | 286 |
| 325 | 3300049569 | Ga0501032_0000658 | Ga0501032_0000658_13838_14713 | 286 |
| 326 | 3300049571 | Ga0501034_0021557 | Ga0501034_0021557_3980_4855 | 286 |
| 327 | 3300049572 | Ga0501036_0016193 | Ga0501036_0016193_1393_2268 | 286 |
| 328 | 3300049573 | Ga0501037_0000252 | Ga0501037_0000252_40090_40965 | 286 |
| 329 | 3300049574 | Ga0501038_0002661 | Ga0501038_0002661_5890_6765 | 286 |
| 330 | 3300049575 | Ga0501039_0000203 | Ga0501039_0000203_26745_27620 | 286 |
| 331 | 3300049579 | Ga0501043_0001559 | Ga0501043_0001559_13325_14200 | 286 |
| 332 | 3300049581 | Ga0501047_0382496 | Ga0501047_0382496_130_1005 | 286 |
| 333 | 3300049586 | Ga0501070_0031096 | Ga0501070_0031096_2501_3376 | 286 |
| 334 | 3300049742 | Ga0501080_0266438 | Ga0501080_0266438_605_1474 | 286 |
| 335 | 3300049823 | Ga0501044_0008362 | Ga0501044_0008362_9414_10289 | 286 |
| 336 | 3300053077 | Ga0495601_0129730 | Ga0495601_0129730_151_1056 | 286 |
| 337 | 3300053084 | Ga0495595_0005323 | Ga0495595_0005323_3544_4449 | 286 |
| 338 | 3300053085 | Ga0495619_0050635 | Ga0495619_0050635_970_1875 | 286 |
| 339 | 3300003792 | Ga0055540_1000060 | Ga0055540_100006092 | 287 |
| 340 | 3300003792 | Ga0055540_1000332 | Ga0055540_100033240 | 287 |
| 341 | 3300003792 | Ga0055540_1010383 | Ga0055540_10103832 | 287 |
| 342 | 3300005335 | Ga0070666_10152896 | Ga0070666_101528962 | 287 |
| 343 | 3300005353 | Ga0070669_100005151 | Ga0070669_1000051512 | 287 |
| 344 | 3300005367 | Ga0070667_100000220 | Ga0070667_10000022051 | 287 |
| 345 | 3300005367 | Ga0070667_100035411 | Ga0070667_1000354112 | 287 |
| 346 | 3300005548 | Ga0070665_100029853 | Ga0070665_1000298533 | 287 |
| 347 | 3300005617 | Ga0068859_100001001 | Ga0068859_10000100127 | 287 |
| 348 | 3300005841 | Ga0068863_100004423 | Ga0068863_1000044232 | 287 |
| 349 | 3300005842 | Ga0068858_100024463 | Ga0068858_1000244635 | 287 |
| 350 | 3300005843 | Ga0068860_100000150 | Ga0068860_10000015052 | 287 |
| 351 | 3300005844 | Ga0068862_100000078 | Ga0068862_10000007868 | 287 |
| 352 | 3300006186 | Ga0075369_10004514 | Ga0075369_100045146 | 287 |
| 353 | 3300006186 | Ga0075369_10105734 | Ga0075369_101057342 | 287 |
| 354 | 3300006931 | Ga0097620_100001001 | Ga0097620_10000100127 | 287 |
| 355 | 3300009101 | Ga0105247_10000074 | Ga0105247_1000007465 | 287 |
| 356 | 3300009177 | Ga0105248_10000077 | Ga0105248_1000007750 | 287 |
| 357 | 3300009553 | Ga0105249_10000111 | Ga0105249_1000011150 | 287 |
| 358 | 3300014325 | Ga0163163_10045801 | Ga0163163_100458013 | 287 |
| 359 | 3300025273 | Ga0209673_1004584 | Ga0209673_10045845 | 287 |
| 360 | 3300025303 | Ga0209051_1000149 | Ga0209051_100014947 | 287 |
| 361 | 3300025303 | Ga0209051_1000557 | Ga0209051_100055727 | 287 |
| 362 | 3300025303 | Ga0209051_1001535 | Ga0209051_100153515 | 287 |
| 363 | 3300025303 | Ga0209051_1003218 | Ga0209051_10032185 | 287 |
| 364 | 3300025900 | Ga0207710_10000086 | Ga0207710_1000008666 | 287 |
| 365 | 3300025923 | Ga0207681_10003701 | Ga0207681_100037019 | 287 |
| 366 | 3300025941 | Ga0207711_10000577 | Ga0207711_1000057721 | 287 |
| 367 | 3300025961 | Ga0207712_10000162 | Ga0207712_1000016261 | 287 |
| 368 | 3300025986 | Ga0207658_10000314 | Ga0207658_1000031415 | 287 |
| 369 | 3300026067 | Ga0207678_10108381 | Ga0207678_101083813 | 287 |
| 370 | 3300026088 | Ga0207641_10147343 | Ga0207641_101473432 | 287 |
| 371 | 3300028379 | Ga0268266_10057105 | Ga0268266_100571053 | 287 |
| 372 | 3300028380 | Ga0268265_10000012 | Ga0268265_1000001250 | 287 |
| 373 | 3300028381 | Ga0268264_10000104 | Ga0268264_10000104167 | 287 |
| 374 | 3300039437 | Ga0436365_1317649 | Ga0436365_1317649_445_1317 | 287 |
| 375 | 3300041452 | Ga0451793_0265482 | Ga0451793_0265482_429_1292 | 287 |
| 376 | 3300041456 | Ga0451795_0137542 | Ga0451795_0137542_624_1487 | 287 |
| 377 | 3300044683 | Ga0466965_0087420 | Ga0466965_0087420_53_916 | 287 |
| 378 | 3300048903 | Ga0496100_0000021 | Ga0496100_0000021_6009_6872 | 287 |
| 379 | 3300048903 | Ga0496100_0001990 | Ga0496100_0001990_190_1053 | 287 |
| 380 | 3300048904 | Ga0496101_0000190 | Ga0496101_0000190_12662_13525 | 287 |
| 381 | 3300048904 | Ga0496101_0051230 | Ga0496101_0051230_1080_1943 | 287 |
| 382 | 3300048905 | Ga0496102_0000214 | Ga0496102_0000214_10201_11064 | 287 |
| 383 | 3300048906 | Ga0496103_0003083 | Ga0496103_0003083_4423_5286 | 287 |
| 384 | 3300048906 | Ga0496103_0005460 | Ga0496103_0005460_1409_2272 | 287 |
| 385 | 3300048909 | Ga0496106_0001314 | Ga0496106_0001314_16960_17823 | 287 |
| 386 | 3300048910 | Ga0496107_0012527 | Ga0496107_0012527_431_1294 | 287 |
| 387 | 3300048911 | Ga0496108_0001179 | Ga0496108_0001179_8790_9653 | 287 |
| 388 | 3300048912 | Ga0496109_0000042 | Ga0496109_0000042_113447_114310 | 287 |
| 389 | 3300048913 | Ga0496110_0007684 | Ga0496110_0007684_5085_5948 | 287 |
| 390 | 3300048914 | Ga0496111_0001504 | Ga0496111_0001504_10278_11141 | 287 |
| 391 | 3300048914 | Ga0496111_0217875 | Ga0496111_0217875_454_1317 | 287 |
| 392 | 3300048915 | Ga0496112_0008556 | Ga0496112_0008556_3502_4365 | 287 |
| 393 | 3300048916 | Ga0496113_0003392 | Ga0496113_0003392_3702_4565 | 287 |
| 394 | 3300048917 | Ga0496114_0030357 | Ga0496114_0030357_2839_3702 | 287 |
| 395 | 3300048918 | Ga0496115_0015699 | Ga0496115_0015699_445_1308 | 287 |
| 396 | 3300048919 | Ga0496116_0004063 | Ga0496116_0004063_2813_3676 | 287 |
| 397 | 3300048919 | Ga0496116_0027718 | Ga0496116_0027718_2999_3862 | 287 |
| 398 | 3300048921 | Ga0496118_0000331 | Ga0496118_0000331_23818_24681 | 287 |
| 399 | 3300048921 | Ga0496118_0008109 | Ga0496118_0008109_5550_6413 | 287 |
| 400 | 3300048922 | Ga0496119_0007205 | Ga0496119_0007205_4448_5311 | 287 |
| 401 | 3300048922 | Ga0496119_0018795 | Ga0496119_0018795_462_1325 | 287 |
| 402 | 3300048923 | Ga0496120_0005219 | Ga0496120_0005219_7250_8113 | 287 |
| 403 | 3300048923 | Ga0496120_0068628 | Ga0496120_0068628_951_1814 | 287 |
| 404 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_286031_286894 | 287 |
| 405 | 3300048924 | Ga0496121_0002221 | Ga0496121_0002221_7068_7931 | 287 |
| 406 | 3300048925 | Ga0496122_0000048 | Ga0496122_0000048_244477_245340 | 287 |
| 407 | 3300048925 | Ga0496122_0120269 | Ga0496122_0120269_486_1349 | 287 |
| 408 | 3300048926 | Ga0496123_0005503 | Ga0496123_0005503_9329_10192 | 287 |
| 409 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_1207695_1208558 | 287 |
| 410 | 3300048927 | Ga0496124_0027611 | Ga0496124_0027611_3954_4817 | 287 |
| 411 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_286031_286894 | 287 |
| 412 | 3300048928 | Ga0496125_0027310 | Ga0496125_0027310_2644_3507 | 287 |
| 413 | 3300048929 | Ga0496126_0000009 | Ga0496126_0000009_463457_464320 | 287 |
| 414 | 3300048929 | Ga0496126_0002432 | Ga0496126_0002432_5988_6851 | 287 |
| 415 | 3300048929 | Ga0496126_0024434 | Ga0496126_0024434_3619_4482 | 287 |
| 416 | 3300050496 | nmdc:mga07m45_95634_c1 | nmdc:mga07m45_95634_c1_520_1404 | 287 |
| 417 | 3300050516 | nmdc:mga0sz30_21985_c1 | nmdc:mga0sz30_21985_c1_1469_2353 | 287 |
| 418 | 3300005937 | Ga0081455_10027109 | Ga0081455_100271096 | 288 |
| 419 | 3300006028 | Ga0070717_10038636 | Ga0070717_100386362 | 288 |
| 420 | 3300021384 | Ga0213876_10049126 | Ga0213876_100491262 | 288 |
| 421 | 3300021388 | Ga0213875_10007594 | Ga0213875_100075943 | 288 |
| 422 | 3300037853 | Ga0436364_0506337 | Ga0436364_0506337_2495_3361 | 288 |
| 423 | 3300037853 | Ga0436364_1383012 | Ga0436364_1383012_4060_4944 | 288 |
| 424 | 3300039437 | Ga0436365_0123515 | Ga0436365_0123515_13203_14087 | 288 |
| 425 | 3300039437 | Ga0436365_1820296 | Ga0436365_1820296_1061_1945 | 288 |
| 426 | 3300039447 | Ga0436361_0031463 | Ga0436361_0031463_65_940 | 288 |
| 427 | 3300039450 | Ga0436363_0404252 | Ga0436363_0404252_6918_7784 | 288 |
| 428 | 3300042436 | Ga0439435_0055240 | Ga0439435_0055240_113_979 | 288 |
| 429 | 3300044719 | Ga0466971_0056090 | Ga0466971_0056090_420_1298 | 288 |
| 430 | 3300044735 | Ga0466968_0009276 | Ga0466968_0009276_777_1652 | 288 |
| 431 | 3300047320 | Ga0495672_0045977 | Ga0495672_0045977_1221_2087 | 288 |
| 432 | 3300049571 | Ga0501034_0240850 | Ga0501034_0240850_342_1208 | 288 |
| 433 | 3300050516 | nmdc:mga0sz30_41463_c1 | nmdc:mga0sz30_41463_c1_1000_1866 | 288 |
| 434 | 3300061719 | Ga0466962_0043468 | Ga0466962_0043468_499_1377 | 288 |
| 435 | iso_pu_bacteria | 2919713450 | 2919718006 | 288 |
| 436 | 3300005456 | Ga0070678_100454047 | Ga0070678_1004540472 | 289 |
| 437 | 3300005617 | Ga0068859_100293508 | Ga0068859_1002935082 | 289 |
| 438 | 3300006048 | Ga0075363_100038058 | Ga0075363_1000380583 | 289 |
| 439 | 3300006931 | Ga0097620_100293519 | Ga0097620_1002935192 | 289 |
| 440 | 3300009148 | Ga0105243_10000320 | Ga0105243_1000032023 | 289 |
| 441 | 3300009177 | Ga0105248_10837816 | Ga0105248_108378162 | 289 |
| 442 | 3300013308 | Ga0157375_10180065 | Ga0157375_101800652 | 289 |
| 443 | 3300025935 | Ga0207709_10027010 | Ga0207709_100270102 | 289 |
| 444 | 3300026121 | Ga0207683_10475557 | Ga0207683_104755571 | 289 |
| 445 | 3300031247 | Ga0265340_10002821 | Ga0265340_100028214 | 289 |
| 446 | 3300046531 | Ga0495665_0037779 | Ga0495665_0037779_880_1758 | 289 |
| 447 | 3300046535 | Ga0495586_0054860 | Ga0495586_0054860_1030_2025 | 289 |
| 448 | 3300046616 | Ga0495668_0009011 | Ga0495668_0009011_26_904 | 289 |
| 449 | 3300046694 | Ga0495649_0102202 | Ga0495649_0102202_183_1052 | 289 |
| 450 | 3300047471 | Ga0495684_0275602 | Ga0495684_0275602_91_1086 | 289 |
| 451 | 3300048905 | Ga0496102_0008173 | Ga0496102_0008173_4247_5119 | 289 |
| 452 | 3300048905 | Ga0496102_0043702 | Ga0496102_0043702_343_1212 | 289 |
| 453 | 3300048909 | Ga0496106_0017053 | Ga0496106_0017053_852_1724 | 289 |
| 454 | 3300048910 | Ga0496107_0123829 | Ga0496107_0123829_857_1729 | 289 |
| 455 | 3300048928 | Ga0496125_0058856 | Ga0496125_0058856_1129_2007 | 289 |
| 456 | 3300050490 | nmdc:mga03n38_33556_c1 | nmdc:mga03n38_33556_c1_1202_2080 | 289 |
| 457 | 3300050496 | nmdc:mga07m45_39517_c1 | nmdc:mga07m45_39517_c1_784_1662 | 289 |
| 458 | 3300041512 | Ga0451853_2277362 | Ga0451853_2277362_2060_2938 | 290 |
| 459 | iso_pu_bacteria | 2929212328 | 2929218082 | 290 |
| 460 | 3300025303 | Ga0209051_1035491 | Ga0209051_10354912 | 291 |
| 461 | 3300031903 | Ga0307407_10165441 | Ga0307407_101654412 | 291 |
| 462 | 3300046501 | Ga0495607_0010791 | Ga0495607_0010791_2029_2910 | 291 |
| 463 | iso_pu_bacteria | 2547132424 | 2548692765 | 291 |
| 464 | 3300005563 | Ga0068855_100638286 | Ga0068855_1006382861 | 292 |
| 465 | 3300009545 | Ga0105237_10004421 | Ga0105237_1000442116 | 292 |
| 466 | 3300010375 | Ga0105239_10073784 | Ga0105239_100737843 | 292 |
| 467 | 3300025914 | Ga0207671_10016244 | Ga0207671_100162442 | 292 |
| 468 | 3300025949 | Ga0207667_10432568 | Ga0207667_104325682 | 292 |
| 469 | 3300032002 | Ga0307416_100468423 | Ga0307416_1004684232 | 292 |
| 470 | 3300048907 | Ga0496104_0469961 | Ga0496104_0469961_231_1121 | 292 |
| 471 | 3300048929 | Ga0496126_0100879 | Ga0496126_0100879_526_1404 | 292 |
| 472 | iso_pu_bacteria | 2738541274 | 2738703528 | 292 |
| 473 | iso_pu_bacteria | 2738543028 | 2739329011 | 292 |
| 474 | iso_pu_bacteria | 2842134933 | 2842136503 | 292 |
| 475 | iso_pu_bacteria | 2902792274 | 2902795664 | 292 |
| 476 | 3300005456 | Ga0070678_100159194 | Ga0070678_1001591942 | 293 |
| 477 | 3300005841 | Ga0068863_100191821 | Ga0068863_1001918212 | 293 |
| 478 | 3300013306 | Ga0163162_10062325 | Ga0163162_100623254 | 293 |
| 479 | 3300014968 | Ga0157379_10504016 | Ga0157379_105040162 | 293 |
| 480 | 3300026121 | Ga0207683_10131617 | Ga0207683_101316172 | 293 |
| 481 | 3300041452 | Ga0451793_0168371 | Ga0451793_0168371_150_1031 | 293 |
| 482 | 3300046463 | Ga0495653_0208135 | Ga0495653_0208135_179_1069 | 293 |
| 483 | 3300048904 | Ga0496101_0000155 | Ga0496101_0000155_40382_41263 | 293 |
| 484 | 3300048907 | Ga0496104_0003271 | Ga0496104_0003271_10326_11207 | 293 |
| 485 | 3300048908 | Ga0496105_0004580 | Ga0496105_0004580_187_1068 | 293 |
| 486 | 3300048909 | Ga0496106_0016857 | Ga0496106_0016857_1712_2593 | 293 |
| 487 | 3300048910 | Ga0496107_0008155 | Ga0496107_0008155_2702_3583 | 293 |
| 488 | 3300048917 | Ga0496114_0012474 | Ga0496114_0012474_3381_4262 | 293 |
| 489 | 3300048918 | Ga0496115_0420549 | Ga0496115_0420549_133_1014 | 293 |
| 490 | 3300006038 | Ga0075365_10005534 | Ga0075365_100055345 | 294 |
| 491 | 3300006048 | Ga0075363_100003677 | Ga0075363_1000036773 | 294 |
| 492 | 3300006051 | Ga0075364_10001016 | Ga0075364_1000101613 | 294 |
| 493 | 3300006051 | Ga0075364_10004336 | Ga0075364_100043362 | 294 |
| 494 | 3300006178 | Ga0075367_10017486 | Ga0075367_100174862 | 294 |
| 495 | 3300006186 | Ga0075369_10017960 | Ga0075369_100179602 | 294 |
| 496 | 3300031824 | Ga0307413_10192035 | Ga0307413_101920352 | 294 |
| 497 | 3300048088 | Ga0495602_0213332 | Ga0495602_0213332_29_913 | 294 |
| 498 | 3300050491 | nmdc:mga00v17_6174_c1 | nmdc:mga00v17_6174_c1_2696_3580 | 294 |
| 499 | 3300050492 | nmdc:mga0yw44_12379_c1 | nmdc:mga0yw44_12379_c1_1916_2800 | 294 |
| 500 | 3300050494 | nmdc:mga06z11_17556_c1 | nmdc:mga06z11_17556_c1_453_1337 | 294 |
| 501 | 3300050496 | nmdc:mga07m45_11739_c1 | nmdc:mga07m45_11739_c1_1886_2770 | 294 |
| 502 | 3300050516 | nmdc:mga0sz30_15042_c1 | nmdc:mga0sz30_15042_c1_1140_2024 | 294 |
| 503 | 3300011119 | Ga0105246_10156418 | Ga0105246_101564182 | 295 |
| 504 | 3300048911 | Ga0496108_0167476 | Ga0496108_0167476_251_1147 | 295 |
| 505 | 3300053080 | Ga0500635_0043082 | Ga0500635_0043082_166_1062 | 295 |
| 506 | 3300053131 | Ga0500652_004525 | Ga0500652_004525_2985_3881 | 295 |
| 507 | 3300005337 | Ga0070682_100011802 | Ga0070682_1000118023 | 296 |
| 508 | 3300005338 | Ga0068868_100356701 | Ga0068868_1003567011 | 296 |
| 509 | 3300005355 | Ga0070671_100000491 | Ga0070671_10000049119 | 296 |
| 510 | 3300005455 | Ga0070663_100016151 | Ga0070663_1000161512 | 296 |
| 511 | 3300005548 | Ga0070665_100020724 | Ga0070665_1000207244 | 296 |
| 512 | 3300005548 | Ga0070665_100585264 | Ga0070665_1005852642 | 296 |
| 513 | 3300005841 | Ga0068863_100002617 | Ga0068863_10000261715 | 296 |
| 514 | 3300005842 | Ga0068858_100712778 | Ga0068858_1007127781 | 296 |
| 515 | 3300006048 | Ga0075363_100006977 | Ga0075363_1000069773 | 296 |
| 516 | 3300006048 | Ga0075363_100007827 | Ga0075363_1000078274 | 296 |
| 517 | 3300006048 | Ga0075363_100020922 | Ga0075363_1000209222 | 296 |
| 518 | 3300006051 | Ga0075364_10040100 | Ga0075364_100401003 | 296 |
| 519 | 3300006051 | Ga0075364_10060205 | Ga0075364_100602052 | 296 |
| 520 | 3300006051 | Ga0075364_10202868 | Ga0075364_102028682 | 296 |
| 521 | 3300006177 | Ga0075362_10074568 | Ga0075362_100745682 | 296 |
| 522 | 3300006178 | Ga0075367_10006961 | Ga0075367_100069612 | 296 |
| 523 | 3300006178 | Ga0075367_10024095 | Ga0075367_100240953 | 296 |
| 524 | 3300006186 | Ga0075369_10025789 | Ga0075369_100257892 | 296 |
| 525 | 3300006186 | Ga0075369_10035050 | Ga0075369_100350502 | 296 |
| 526 | 3300006186 | Ga0075369_10135147 | Ga0075369_101351472 | 296 |
| 527 | 3300006353 | Ga0075370_10005056 | Ga0075370_100050563 | 296 |
| 528 | 3300006353 | Ga0075370_10009925 | Ga0075370_100099251 | 296 |
| 529 | 3300006844 | Ga0075428_100053494 | Ga0075428_1000534946 | 296 |
| 530 | 3300006847 | Ga0075431_100141517 | Ga0075431_1001415172 | 296 |
| 531 | 3300009147 | Ga0114129_10290825 | Ga0114129_102908252 | 296 |
| 532 | 3300009176 | Ga0105242_10293937 | Ga0105242_102939371 | 296 |
| 533 | 3300009551 | Ga0105238_10042391 | Ga0105238_100423914 | 296 |
| 534 | 3300009553 | Ga0105249_10090677 | Ga0105249_100906774 | 296 |
| 535 | 3300010375 | Ga0105239_10235464 | Ga0105239_102354642 | 296 |
| 536 | 3300013296 | Ga0157374_10393745 | Ga0157374_103937452 | 296 |
| 537 | 3300013297 | Ga0157378_10473530 | Ga0157378_104735301 | 296 |
| 538 | 3300014325 | Ga0163163_10162680 | Ga0163163_101626803 | 296 |
| 539 | 3300025931 | Ga0207644_10053739 | Ga0207644_100537393 | 296 |
| 540 | 3300026023 | Ga0207677_10563503 | Ga0207677_105635031 | 296 |
| 541 | 3300026035 | Ga0207703_10602452 | Ga0207703_106024522 | 296 |
| 542 | 3300026067 | Ga0207678_10005983 | Ga0207678_100059833 | 296 |
| 543 | 3300026075 | Ga0207708_10170298 | Ga0207708_101702982 | 296 |
| 544 | 3300026088 | Ga0207641_10005441 | Ga0207641_100054419 | 296 |
| 545 | 3300028379 | Ga0268266_10002797 | Ga0268266_100027976 | 296 |
| 546 | 3300028379 | Ga0268266_10316207 | Ga0268266_103162072 | 296 |
| 547 | 3300028381 | Ga0268264_10300279 | Ga0268264_103002792 | 296 |
| 548 | 3300041453 | Ga0451797_1187442 | Ga0451797_1187442_29_931 | 296 |
| 549 | 3300042002 | Ga0439442_007232 | Ga0439442_007232_189_1079 | 296 |
| 550 | 3300044658 | Ga0466972_0014989 | Ga0466972_0014989_1427_2317 | 296 |
| 551 | 3300044683 | Ga0466965_0011498 | Ga0466965_0011498_276_1166 | 296 |
| 552 | 3300044693 | Ga0466961_0006085 | Ga0466961_0006085_1811_2710 | 296 |
| 553 | 3300044706 | Ga0466964_0009079 | Ga0466964_0009079_712_1611 | 296 |
| 554 | 3300044719 | Ga0466971_0008238 | Ga0466971_0008238_1881_2780 | 296 |
| 555 | 3300044765 | Ga0466970_0010388 | Ga0466970_0010388_2188_3078 | 296 |
| 556 | 3300044842 | Ga0466957_0028986 | Ga0466957_0028986_1980_2870 | 296 |
| 557 | 3300044842 | Ga0466957_0279618 | Ga0466957_0279618_180_1070 | 296 |
| 558 | 3300044901 | Ga0466960_0000833 | Ga0466960_0000833_1948_2838 | 296 |
| 559 | 3300044901 | Ga0466960_0017734 | Ga0466960_0017734_1379_2269 | 296 |
| 560 | 3300045049 | Ga0466959_0001337 | Ga0466959_0001337_59_958 | 296 |
| 561 | 3300045049 | Ga0466959_0001896 | Ga0466959_0001896_969_1859 | 296 |
| 562 | 3300045836 | Ga0466958_0005688 | Ga0466958_0005688_669_1568 | 296 |
| 563 | 3300045976 | Ga0466967_0017264 | Ga0466967_0017264_4136_5056 | 296 |
| 564 | 3300045976 | Ga0466967_0020526 | Ga0466967_0020526_1812_2702 | 296 |
| 565 | 3300045976 | Ga0466967_0237093 | Ga0466967_0237093_474_1364 | 296 |
| 566 | 3300046460 | Ga0495638_0001699 | Ga0495638_0001699_15586_16476 | 296 |
| 567 | 3300046524 | Ga0495648_0003145 | Ga0495648_0003145_13253_14143 | 296 |
| 568 | 3300046692 | Ga0495671_0131620 | Ga0495671_0131620_270_1160 | 296 |
| 569 | 3300047320 | Ga0495672_0002466 | Ga0495672_0002466_1068_1958 | 296 |
| 570 | 3300047320 | Ga0495672_0036464 | Ga0495672_0036464_799_1689 | 296 |
| 571 | 3300047469 | Ga0495673_0000617 | Ga0495673_0000617_14057_14947 | 296 |
| 572 | 3300048904 | Ga0496101_0228302 | Ga0496101_0228302_58_960 | 296 |
| 573 | 3300048905 | Ga0496102_0000919 | Ga0496102_0000919_23286_24185 | 296 |
| 574 | 3300048905 | Ga0496102_0386744 | Ga0496102_0386744_308_1207 | 296 |
| 575 | 3300048906 | Ga0496103_0006962 | Ga0496103_0006962_4979_5878 | 296 |
| 576 | 3300048908 | Ga0496105_0027113 | Ga0496105_0027113_1910_2809 | 296 |
| 577 | 3300048911 | Ga0496108_0012383 | Ga0496108_0012383_2435_3337 | 296 |
| 578 | 3300048912 | Ga0496109_0017818 | Ga0496109_0017818_3420_4322 | 296 |
| 579 | 3300048912 | Ga0496109_0142578 | Ga0496109_0142578_264_1163 | 296 |
| 580 | 3300048913 | Ga0496110_0018421 | Ga0496110_0018421_822_1721 | 296 |
| 581 | 3300048913 | Ga0496110_0078907 | Ga0496110_0078907_631_1533 | 296 |
| 582 | 3300048914 | Ga0496111_0084080 | Ga0496111_0084080_938_1840 | 296 |
| 583 | 3300048915 | Ga0496112_0045839 | Ga0496112_0045839_387_1277 | 296 |
| 584 | 3300048915 | Ga0496112_0058420 | Ga0496112_0058420_1130_2032 | 296 |
| 585 | 3300048918 | Ga0496115_0243854 | Ga0496115_0243854_195_1085 | 296 |
| 586 | 3300048928 | Ga0496125_0039009 | Ga0496125_0039009_1371_2261 | 296 |
| 587 | 3300048929 | Ga0496126_0017163 | Ga0496126_0017163_2578_3468 | 296 |
| 588 | 3300050490 | nmdc:mga03n38_188_c1 | nmdc:mga03n38_188_c1_1475_2365 | 296 |
| 589 | 3300050490 | nmdc:mga03n38_47961_c1 | nmdc:mga03n38_47961_c1_890_1792 | 296 |
| 590 | 3300050491 | nmdc:mga00v17_28359_c1 | nmdc:mga00v17_28359_c1_1489_2379 | 296 |
| 591 | 3300050491 | nmdc:mga00v17_292133_c1 | nmdc:mga00v17_292133_c1_17_907 | 296 |
| 592 | 3300050491 | nmdc:mga00v17_31762_c1 | nmdc:mga00v17_31762_c1_702_1592 | 296 |
| 593 | 3300050491 | nmdc:mga00v17_329663_c1 | nmdc:mga00v17_329663_c1_14_904 | 296 |
| 594 | 3300050492 | nmdc:mga0yw44_5694_c1 | nmdc:mga0yw44_5694_c1_3706_4596 | 296 |
| 595 | 3300050494 | nmdc:mga06z11_37020_c1 | nmdc:mga06z11_37020_c1_1022_1912 | 296 |
| 596 | 3300050496 | nmdc:mga07m45_198456_c1 | nmdc:mga07m45_198456_c1_112_1002 | 296 |
| 597 | 3300050496 | nmdc:mga07m45_2412_c1 | nmdc:mga07m45_2412_c1_3779_4669 | 296 |
| 598 | 3300050509 | nmdc:mga0qj67_23128_c1 | nmdc:mga0qj67_23128_c1_2308_3198 | 296 |
| 599 | 3300050510 | nmdc:mga06r32_357433_c1 | nmdc:mga06r32_357433_c1_145_1035 | 296 |
| 600 | 3300050511 | nmdc:mga08y16_698372_c1 | nmdc:mga08y16_698372_c1_40_939 | 296 |
| 601 | 3300050516 | nmdc:mga0sz30_14375_c1 | nmdc:mga0sz30_14375_c1_107_997 | 296 |
| 602 | 3300050516 | nmdc:mga0sz30_16955_c1 | nmdc:mga0sz30_16955_c1_1923_2813 | 296 |
| 603 | 3300050516 | nmdc:mga0sz30_23486_c1 | nmdc:mga0sz30_23486_c1_69_959 | 296 |
| 604 | 3300050516 | nmdc:mga0sz30_92573_c1 | nmdc:mga0sz30_92573_c1_284_1174 | 296 |
| 605 | 3300053087 | Ga0500643_008420 | Ga0500643_008420_766_1656 | 296 |
| 606 | 3300053087 | Ga0500643_015183 | Ga0500643_015183_1239_2129 | 296 |
| 607 | 3300053122 | Ga0500608_042595 | Ga0500608_042595_268_1158 | 296 |
| 608 | 3300053134 | Ga0500658_0055681 | Ga0500658_0055681_213_1103 | 296 |
| 609 | 3300053158 | Ga0500627_0001734 | Ga0500627_0001734_2064_2954 | 296 |
| 610 | 3300053730 | Ga0500645_000020 | Ga0500645_000020_9625_10515 | 296 |
| 611 | 3300053153 | Ga0500616_0008482 | Ga0500616_0008482_3099_3992 | 297 |
| 612 | 3300002073 | JGI24745J21846_1000594 | JGI24745J21846_10005943 | 298 |
| 613 | 3300002077 | JGI24744J21845_10000552 | JGI24744J21845_100005525 | 298 |
| 614 | 3300002239 | JGI24034J26672_10000794 | JGI24034J26672_100007944 | 298 |
| 615 | 3300002244 | JGI24742J22300_10000392 | JGI24742J22300_100003923 | 298 |
| 616 | 3300005338 | Ga0068868_100002906 | Ga0068868_10000290610 | 298 |
| 617 | 3300005340 | Ga0070689_100002306 | Ga0070689_1000023069 | 298 |
| 618 | 3300005347 | Ga0070668_100006108 | Ga0070668_1000061085 | 298 |
| 619 | 3300005364 | Ga0070673_100075803 | Ga0070673_1000758032 | 298 |
| 620 | 3300005365 | Ga0070688_100005614 | Ga0070688_1000056144 | 298 |
| 621 | 3300005366 | Ga0070659_100028696 | Ga0070659_1000286964 | 298 |
| 622 | 3300005367 | Ga0070667_100004618 | Ga0070667_1000046188 | 298 |
| 623 | 3300005434 | Ga0070709_10028515 | Ga0070709_100285153 | 298 |
| 624 | 3300005437 | Ga0070710_10000613 | Ga0070710_100006138 | 298 |
| 625 | 3300005438 | Ga0070701_10002866 | Ga0070701_100028662 | 298 |
| 626 | 3300005440 | Ga0070705_100018275 | Ga0070705_1000182753 | 298 |
| 627 | 3300005455 | Ga0070663_100002179 | Ga0070663_1000021796 | 298 |
| 628 | 3300005539 | Ga0068853_100007614 | Ga0068853_1000076144 | 298 |
| 629 | 3300005543 | Ga0070672_100020487 | Ga0070672_1000204876 | 298 |
| 630 | 3300005545 | Ga0070695_100053980 | Ga0070695_1000539802 | 298 |
| 631 | 3300005547 | Ga0070693_100011974 | Ga0070693_1000119744 | 298 |
| 632 | 3300005578 | Ga0068854_100008114 | Ga0068854_1000081145 | 298 |
| 633 | 3300005615 | Ga0070702_100000779 | Ga0070702_1000007797 | 298 |
| 634 | 3300005617 | Ga0068859_100007711 | Ga0068859_1000077117 | 298 |
| 635 | 3300005718 | Ga0068866_10001053 | Ga0068866_1000105316 | 298 |
| 636 | 3300005842 | Ga0068858_100015127 | Ga0068858_1000151278 | 298 |
| 637 | 3300005843 | Ga0068860_100007160 | Ga0068860_1000071607 | 298 |
| 638 | 3300005844 | Ga0068862_100003622 | Ga0068862_10000362216 | 298 |
| 639 | 3300006173 | Ga0070716_100001586 | Ga0070716_1000015864 | 298 |
| 640 | 3300006175 | Ga0070712_100002517 | Ga0070712_1000025177 | 298 |
| 641 | 3300006237 | Ga0097621_100276089 | Ga0097621_1002760892 | 298 |
| 642 | 3300006931 | Ga0097620_100007711 | Ga0097620_1000077114 | 298 |
| 643 | 3300009092 | Ga0105250_10012535 | Ga0105250_100125353 | 298 |
| 644 | 3300009098 | Ga0105245_10020738 | Ga0105245_100207384 | 298 |
| 645 | 3300009101 | Ga0105247_10000600 | Ga0105247_1000060022 | 298 |
| 646 | 3300009174 | Ga0105241_10026241 | Ga0105241_100262414 | 298 |
| 647 | 3300009176 | Ga0105242_10001286 | Ga0105242_1000128616 | 298 |
| 648 | 3300009177 | Ga0105248_10012868 | Ga0105248_100128683 | 298 |
| 649 | 3300009545 | Ga0105237_10019639 | Ga0105237_100196399 | 298 |
| 650 | 3300010375 | Ga0105239_10030311 | Ga0105239_100303114 | 298 |
| 651 | 3300011119 | Ga0105246_10190703 | Ga0105246_101907032 | 298 |
| 652 | 3300013297 | Ga0157378_10005317 | Ga0157378_100053176 | 298 |
| 653 | 3300013306 | Ga0163162_10003832 | Ga0163162_100038325 | 298 |
| 654 | 3300013307 | Ga0157372_10008077 | Ga0157372_100080777 | 298 |
| 655 | 3300013308 | Ga0157375_10001203 | Ga0157375_100012036 | 298 |
| 656 | 3300014326 | Ga0157380_10007981 | Ga0157380_100079818 | 298 |
| 657 | 3300014745 | Ga0157377_10004027 | Ga0157377_100040273 | 298 |
| 658 | 3300014968 | Ga0157379_10000746 | Ga0157379_1000074627 | 298 |
| 659 | 3300014969 | Ga0157376_10095301 | Ga0157376_100953012 | 298 |
| 660 | 3300017792 | Ga0163161_10001220 | Ga0163161_1000122016 | 298 |
| 661 | 3300025898 | Ga0207692_10003062 | Ga0207692_100030624 | 298 |
| 662 | 3300025899 | Ga0207642_10000883 | Ga0207642_100008836 | 298 |
| 663 | 3300025900 | Ga0207710_10002512 | Ga0207710_100025126 | 298 |
| 664 | 3300025901 | Ga0207688_10003514 | Ga0207688_100035143 | 298 |
| 665 | 3300025915 | Ga0207693_10000380 | Ga0207693_1000038030 | 298 |
| 666 | 3300025916 | Ga0207663_10000829 | Ga0207663_100008296 | 298 |
| 667 | 3300025933 | Ga0207706_10006853 | Ga0207706_100068539 | 298 |
| 668 | 3300025934 | Ga0207686_10002784 | Ga0207686_100027844 | 298 |
| 669 | 3300025937 | Ga0207669_10003512 | Ga0207669_100035125 | 298 |
| 670 | 3300025940 | Ga0207691_10047834 | Ga0207691_100478345 | 298 |
| 671 | 3300025942 | Ga0207689_10013555 | Ga0207689_100135556 | 298 |
| 672 | 3300025961 | Ga0207712_10010674 | Ga0207712_100106745 | 298 |
| 673 | 3300026089 | Ga0207648_10000899 | Ga0207648_1000089930 | 298 |
| 674 | 3300026118 | Ga0207675_100000475 | Ga0207675_10000047516 | 298 |
| 675 | 3300026121 | Ga0207683_10000256 | Ga0207683_1000025622 | 298 |
| 676 | 3300028381 | Ga0268264_10004698 | Ga0268264_100046987 | 298 |
| 677 | 3300035242 | Ga0373962_0008802 | Ga0373962_0008802_1097_2002 | 298 |
| 678 | 3300035691 | Ga0373931_0043696 | Ga0373931_0043696_615_1520 | 298 |
| 679 | 3300046507 | Ga0495606_0037881 | Ga0495606_0037881_1510_2406 | 298 |
| 680 | 3300048903 | Ga0496100_0001410 | Ga0496100_0001410_5559_6464 | 298 |
| 681 | 3300048904 | Ga0496101_0008179 | Ga0496101_0008179_3175_4080 | 298 |
| 682 | 3300048906 | Ga0496103_0002031 | Ga0496103_0002031_8884_9789 | 298 |
| 683 | 3300048909 | Ga0496106_0000744 | Ga0496106_0000744_5893_6798 | 298 |
| 684 | 3300048910 | Ga0496107_0004639 | Ga0496107_0004639_6333_7238 | 298 |
| 685 | 3300048917 | Ga0496114_0018548 | Ga0496114_0018548_1310_2215 | 298 |
| 686 | 3300048918 | Ga0496115_0004929 | Ga0496115_0004929_2894_3799 | 298 |
| 687 | 3300026041 | Ga0207639_10048415 | Ga0207639_100484152 | 300 |
| 688 | 3300031995 | Ga0307409_100147981 | Ga0307409_1001479812 | 300 |
| 689 | 3300032002 | Ga0307416_100102641 | Ga0307416_1001026412 | 300 |
| 690 | 3300032126 | Ga0307415_100002557 | Ga0307415_1000025573 | 300 |
| 691 | 3300047472 | Ga0495686_0001752 | Ga0495686_0001752_10115_11017 | 300 |
| 692 | 3300001977 | JGI24746J21847_1011962 | JGI24746J21847_10119622 | 301 |
| 693 | 3300001991 | JGI24743J22301_10002008 | JGI24743J22301_100020082 | 301 |
| 694 | 3300005338 | Ga0068868_100106291 | Ga0068868_1001062912 | 301 |
| 695 | 3300005339 | Ga0070660_100087808 | Ga0070660_1000878082 | 301 |
| 696 | 3300005340 | Ga0070689_100074150 | Ga0070689_1000741502 | 301 |
| 697 | 3300005366 | Ga0070659_100383093 | Ga0070659_1003830932 | 301 |
| 698 | 3300005439 | Ga0070711_100005893 | Ga0070711_1000058931 | 301 |
| 699 | 3300005546 | Ga0070696_100247563 | Ga0070696_1002475631 | 301 |
| 700 | 3300005563 | Ga0068855_100336667 | Ga0068855_1003366672 | 301 |
| 701 | 3300005578 | Ga0068854_100233326 | Ga0068854_1002333262 | 301 |
| 702 | 3300005616 | Ga0068852_100076831 | Ga0068852_1000768312 | 301 |
| 703 | 3300005844 | Ga0068862_100165692 | Ga0068862_1001656923 | 301 |
| 704 | 3300006173 | Ga0070716_100048737 | Ga0070716_1000487372 | 301 |
| 705 | 3300006237 | Ga0097621_100097790 | Ga0097621_1000977902 | 301 |
| 706 | 3300006881 | Ga0068865_100090625 | Ga0068865_1000906252 | 301 |
| 707 | 3300009551 | Ga0105238_10232276 | Ga0105238_102322762 | 301 |
| 708 | 3300011119 | Ga0105246_10262243 | Ga0105246_102622432 | 301 |
| 709 | 3300013296 | Ga0157374_10057850 | Ga0157374_100578502 | 301 |
| 710 | 3300013297 | Ga0157378_10268840 | Ga0157378_102688402 | 301 |
| 711 | 3300014325 | Ga0163163_10668042 | Ga0163163_106680422 | 301 |
| 712 | 3300014326 | Ga0157380_10046880 | Ga0157380_100468805 | 301 |
| 713 | 3300014745 | Ga0157377_10005407 | Ga0157377_100054072 | 301 |
| 714 | 3300014968 | Ga0157379_10157414 | Ga0157379_101574142 | 301 |
| 715 | 3300025901 | Ga0207688_10000239 | Ga0207688_100002392 | 301 |
| 716 | 3300025904 | Ga0207647_10110616 | Ga0207647_101106162 | 301 |
| 717 | 3300025915 | Ga0207693_10006585 | Ga0207693_100065858 | 301 |
| 718 | 3300025915 | Ga0207693_10422270 | Ga0207693_104222701 | 301 |
| 719 | 3300025918 | Ga0207662_10030839 | Ga0207662_100308394 | 301 |
| 720 | 3300025919 | Ga0207657_10197006 | Ga0207657_101970062 | 301 |
| 721 | 3300025926 | Ga0207659_10078511 | Ga0207659_100785111 | 301 |
| 722 | 3300025932 | Ga0207690_10242750 | Ga0207690_102427502 | 301 |
| 723 | 3300025933 | Ga0207706_10023033 | Ga0207706_100230334 | 301 |
| 724 | 3300025939 | Ga0207665_10032126 | Ga0207665_100321261 | 301 |
| 725 | 3300025940 | Ga0207691_10067442 | Ga0207691_100674422 | 301 |
| 726 | 3300025942 | Ga0207689_10090857 | Ga0207689_100908572 | 301 |
| 727 | 3300025960 | Ga0207651_10125761 | Ga0207651_101257612 | 301 |
| 728 | 3300025961 | Ga0207712_10192537 | Ga0207712_101925372 | 301 |
| 729 | 3300025981 | Ga0207640_10210342 | Ga0207640_102103422 | 301 |
| 730 | 3300026067 | Ga0207678_10045640 | Ga0207678_100456406 | 301 |
| 731 | 3300026075 | Ga0207708_10007259 | Ga0207708_100072597 | 301 |
| 732 | 3300026088 | Ga0207641_10141708 | Ga0207641_101417082 | 301 |
| 733 | 3300026095 | Ga0207676_10103194 | Ga0207676_101031942 | 301 |
| 734 | 3300026142 | Ga0207698_10102746 | Ga0207698_101027462 | 301 |
| 735 | 3300028379 | Ga0268266_10011939 | Ga0268266_100119393 | 301 |
| 736 | 3300035725 | Ga0373947_0293945 | Ga0373947_0293945_63_968 | 301 |
| 737 | 3300047315 | Ga0495581_0018190 | Ga0495581_0018190_2223_3128 | 301 |
| 738 | 3300047319 | Ga0495674_0103240 | Ga0495674_0103240_1064_1969 | 301 |
| 739 | 3300047321 | Ga0495676_0059373 | Ga0495676_0059373_1234_2139 | 301 |
| 740 | 3300048905 | Ga0496102_0169638 | Ga0496102_0169638_839_1744 | 301 |
| 741 | 3300048906 | Ga0496103_0044848 | Ga0496103_0044848_833_1738 | 301 |
| 742 | 3300048907 | Ga0496104_0139908 | Ga0496104_0139908_1245_2150 | 301 |
| 743 | 3300048911 | Ga0496108_0000636 | Ga0496108_0000636_116_1021 | 301 |
| 744 | 3300048912 | Ga0496109_0004114 | Ga0496109_0004114_3649_4554 | 301 |
| 745 | 3300048914 | Ga0496111_0095534 | Ga0496111_0095534_1014_1919 | 301 |
| 746 | 3300048915 | Ga0496112_0028965 | Ga0496112_0028965_2660_3565 | 301 |
| 747 | 3300048916 | Ga0496113_0087693 | Ga0496113_0087693_798_1703 | 301 |
| 748 | 3300053087 | Ga0500643_025423 | Ga0500643_025423_802_1716 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wue-assembly1.cif.gz_A | crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopoda | 0.9857 | 15 | 293 |
| 5jz9-assembly1.cif.gz_A | crystal structure of hsad bound to 3,5-dichloro-4-hydroxybenzenesulphonic acid | 0.9832 | 15 | 295 |
| 5jz9-assembly1.cif.gz_A | crystal structure of hsad bound to 3,5-dichloro-4-hydroxybenzenesulphonic acid | 0.9695 | 15 | 295 |
| 2wue-assembly1.cif.gz_A | crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopoda | 0.9685 | 15 | 293 |
| 3v1l-assembly1.cif.gz_A | crystal structure of the s112a/h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400 | 0.9393 | 15 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vf2B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.983 | 15 | 295 | 3.40.50.1820 |
| 2vf2B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9693 | 15 | 295 | 3.40.50.1820 |
| 2puhA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9374 | 15 | 295 | 3.40.50.1820 |
| 2puhA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9277 | 15 | 295 | 3.40.50.1820 |
| 1j1iA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8954 | 20 | 292 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X8F4D1-F1-model_v4 | deleted | 0.9809 | 141 | 296 |
|
| AF-A0A7X6NYU1-F1-model_v4 | Alpha/beta fold hydrolase | 0.9715 | 15 | 292 |
GO:0016787
|
| AF-A0A516WZS3-F1-model_v4 | Alpha/beta fold hydrolase | 0.969 | 8 | 296 |
GO:0016020
GO:0016787 |
| AF-X8F4D1-F1-model_v4 | deleted | 0.9686 | 141 | 296 |
|
| AF-A0A6I2FVD2-F1-model_v4 | Alpha/beta fold hydrolase | 0.9609 | 15 | 294 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar