F478977
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 748 | 342 | 748 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300048911|Ga0496108_0870309|Ga0496108_0870309_82_531 |
| Length | 149 |
| Sequence | MASTPELIRTAVERFQAEVPALAKLKLVFGLELRAKHDIQLYRVELPGPKITKDLAQDERVLVEIDRPQFNELAEKGTLKSYRRAAETGHIKANGDSNVVKLISQVVEKQEERNRLKKVHERRRRLSASIPLVTPRKSIVSGAAATTRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 108 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 200 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 201 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 284 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 285 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 286 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 289 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 337 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 338 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 341 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0.94 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.34 |
| Nodule | 0 |
| Rhizoplane | 9.49 |
| Rhizosphere | 84.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10000986 | 3300002239 | Bacteria | 3708 |
| 2 | JGI24742J22300_10001987 | 3300002244 | Bacteria | 3259 |
| 3 | JGI25404J52841_10005383 | 3300003659 | Bacteria | 2645 |
| 4 | Ga0070658_10761878 | 3300005327 | Bacteria | 841 |
| 5 | Ga0070683_100021012 | 3300005329 | Bacteria | 5821 |
| 6 | Ga0070683_100021782 | 3300005329 | Bacteria | 5721 |
| 7 | Ga0070683_100030699 | 3300005329 | Bacteria | 4882 |
| 8 | Ga0070683_100051279 | 3300005329 | Bacteria | 3820 |
| 9 | Ga0070683_100481941 | 3300005329 | Bacteria | 1184 |
| 10 | Ga0070683_100710386 | 3300005329 | Bacteria | 963 |
| 11 | Ga0070683_101635647 | 3300005329 | Unclassified | 619 |
| 12 | Ga0070690_100217573 | 3300005330 | Bacteria | 1337 |
| 13 | Ga0070670_100249805 | 3300005331 | Bacteria | 1545 |
| 14 | Ga0070677_10000022 | 3300005333 | Bacteria | 45355 |
| 15 | Ga0070666_10000484 | 3300005335 | Bacteria | 24081 |
| 16 | Ga0070666_10381580 | 3300005335 | Bacteria | 1012 |
| 17 | Ga0070680_100241753 | 3300005336 | Bacteria | 1526 |
| 18 | Ga0070682_100000099 | 3300005337 | Bacteria | 77574 |
| 19 | Ga0070682_100000150 | 3300005337 | Bacteria | 55238 |
| 20 | Ga0070682_100709049 | 3300005337 | Bacteria | 808 |
| 21 | Ga0068868_100002756 | 3300005338 | Bacteria | 12165 |
| 22 | Ga0068868_100006916 | 3300005338 | Bacteria | 8060 |
| 23 | Ga0070660_100366173 | 3300005339 | Bacteria | 1188 |
| 24 | Ga0070689_100597270 | 3300005340 | Bacteria | 956 |
| 25 | Ga0070691_10000032 | 3300005341 | Bacteria | 39570 |
| 26 | Ga0070691_10002218 | 3300005341 | Bacteria | 8594 |
| 27 | Ga0070691_10391580 | 3300005341 | Bacteria | 781 |
| 28 | Ga0070687_100515363 | 3300005343 | Bacteria | 808 |
| 29 | Ga0070661_100000102 | 3300005344 | Bacteria | 69941 |
| 30 | Ga0070668_100051947 | 3300005347 | Bacteria | 3159 |
| 31 | Ga0070668_100382805 | 3300005347 | Bacteria | 1197 |
| 32 | Ga0070669_101593969 | 3300005353 | Bacteria | 568 |
| 33 | Ga0070675_100000027 | 3300005354 | Bacteria | 106172 |
| 34 | Ga0070674_100000056 | 3300005356 | Bacteria | 49642 |
| 35 | Ga0070674_100000088 | 3300005356 | Bacteria | 42730 |
| 36 | Ga0070674_100713104 | 3300005356 | Bacteria | 859 |
| 37 | Ga0070673_100007829 | 3300005364 | Bacteria | 7078 |
| 38 | Ga0070688_100001250 | 3300005365 | Bacteria | 12681 |
| 39 | Ga0070688_100001531 | 3300005365 | Bacteria | 11553 |
| 40 | Ga0070688_100123262 | 3300005365 | Bacteria | 1739 |
| 41 | Ga0070659_100022916 | 3300005366 | Bacteria | 4773 |
| 42 | Ga0070659_100121688 | 3300005366 | Bacteria | 2114 |
| 43 | Ga0070667_100006153 | 3300005367 | Bacteria | 9974 |
| 44 | Ga0070667_100008220 | 3300005367 | Bacteria | 8649 |
| 45 | Ga0070667_100040138 | 3300005367 | Bacteria | 3924 |
| 46 | Ga0070667_100296404 | 3300005367 | Bacteria | 1455 |
| 47 | Ga0070667_101118584 | 3300005367 | Bacteria | 736 |
| 48 | Ga0070703_10366030 | 3300005406 | Bacteria | 619 |
| 49 | Ga0070714_100087123 | 3300005435 | Bacteria | 2730 |
| 50 | Ga0070713_100000085 | 3300005436 | Bacteria | 58902 |
| 51 | Ga0070713_101720364 | 3300005436 | Bacteria | 609 |
| 52 | Ga0070701_10467572 | 3300005438 | Bacteria | 812 |
| 53 | Ga0070711_100014274 | 3300005439 | Bacteria | 5001 |
| 54 | Ga0070711_100212262 | 3300005439 | Bacteria | 1500 |
| 55 | Ga0070700_100274997 | 3300005441 | Bacteria | 1219 |
| 56 | Ga0070700_100865574 | 3300005441 | Unclassified | 733 |
| 57 | Ga0070700_100930908 | 3300005441 | Bacteria | 710 |
| 58 | Ga0070663_100000073 | 3300005455 | Bacteria | 43743 |
| 59 | Ga0070663_100978723 | 3300005455 | Bacteria | 734 |
| 60 | Ga0070678_100011801 | 3300005456 | Bacteria | 5405 |
| 61 | Ga0070678_100377494 | 3300005456 | Bacteria | 1226 |
| 62 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 63 | Ga0070662_100610838 | 3300005457 | Bacteria | 918 |
| 64 | Ga0070681_10115322 | 3300005458 | Bacteria | 2624 |
| 65 | Ga0070681_10134847 | 3300005458 | Bacteria | 2400 |
| 66 | Ga0068867_100022123 | 3300005459 | Bacteria | 4543 |
| 67 | Ga0070685_10001410 | 3300005466 | Bacteria | 12591 |
| 68 | Ga0070685_10001719 | 3300005466 | Bacteria | 11497 |
| 69 | Ga0070685_10213984 | 3300005466 | Bacteria | 1259 |
| 70 | Ga0070685_11283907 | 3300005466 | Bacteria | 559 |
| 71 | Ga0070679_100000240 | 3300005530 | Bacteria | 45575 |
| 72 | Ga0070679_100037654 | 3300005530 | Bacteria | 4807 |
| 73 | Ga0070684_100010674 | 3300005535 | Bacteria | 7285 |
| 74 | Ga0070684_100039844 | 3300005535 | Bacteria | 4043 |
| 75 | Ga0070684_100560496 | 3300005535 | Bacteria | 1061 |
| 76 | Ga0070684_100660511 | 3300005535 | Bacteria | 973 |
| 77 | Ga0070684_101594046 | 3300005535 | Unclassified | 616 |
| 78 | Ga0070684_102109346 | 3300005535 | Bacteria | 532 |
| 79 | Ga0068853_100083884 | 3300005539 | Bacteria | 2792 |
| 80 | Ga0068853_100132587 | 3300005539 | Bacteria | 2232 |
| 81 | Ga0068853_100213494 | 3300005539 | Bacteria | 1760 |
| 82 | Ga0068853_100374102 | 3300005539 | Bacteria | 1329 |
| 83 | Ga0070672_100000293 | 3300005543 | Bacteria | 28247 |
| 84 | Ga0070686_100561225 | 3300005544 | Bacteria | 894 |
| 85 | Ga0070695_100355542 | 3300005545 | Bacteria | 1099 |
| 86 | Ga0070696_100909370 | 3300005546 | Bacteria | 731 |
| 87 | Ga0070693_101266764 | 3300005547 | Bacteria | 569 |
| 88 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 89 | Ga0070665_100001435 | 3300005548 | Bacteria | 27930 |
| 90 | Ga0070665_100012149 | 3300005548 | Bacteria | 8683 |
| 91 | Ga0070665_100017889 | 3300005548 | Bacteria | 7117 |
| 92 | Ga0070665_100048627 | 3300005548 | Bacteria | 4257 |
| 93 | Ga0070665_100139966 | 3300005548 | Bacteria | 2423 |
| 94 | Ga0070665_100299609 | 3300005548 | Bacteria | 1610 |
| 95 | Ga0070665_101626686 | 3300005548 | Bacteria | 654 |
| 96 | Ga0070704_100333123 | 3300005549 | Bacteria | 1276 |
| 97 | Ga0068855_100242003 | 3300005563 | Bacteria | 2016 |
| 98 | Ga0068855_100473624 | 3300005563 | Bacteria | 1364 |
| 99 | Ga0070664_100025344 | 3300005564 | Bacteria | 4915 |
| 100 | Ga0068857_100192498 | 3300005577 | Bacteria | 1858 |
| 101 | Ga0068857_101622644 | 3300005577 | Unclassified | 631 |
| 102 | Ga0068854_100000095 | 3300005578 | Bacteria | 61892 |
| 103 | Ga0068854_100022643 | 3300005578 | Bacteria | 4285 |
| 104 | Ga0068856_100008468 | 3300005614 | Bacteria | 10010 |
| 105 | Ga0068856_100026367 | 3300005614 | Bacteria | 5667 |
| 106 | Ga0068856_100076878 | 3300005614 | Bacteria | 3307 |
| 107 | Ga0068856_100320326 | 3300005614 | Bacteria | 1567 |
| 108 | Ga0068856_100509791 | 3300005614 | Unclassified | 1224 |
| 109 | Ga0068856_100851510 | 3300005614 | Bacteria | 931 |
| 110 | Ga0070702_100087262 | 3300005615 | Bacteria | 1884 |
| 111 | Ga0068852_100000006 | 3300005616 | Bacteria | 159569 |
| 112 | Ga0068852_101705344 | 3300005616 | Bacteria | 652 |
| 113 | Ga0068859_100549800 | 3300005617 | Bacteria | 1249 |
| 114 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 115 | Ga0068866_10000273 | 3300005718 | Bacteria | 24605 |
| 116 | Ga0068866_10530918 | 3300005718 | Bacteria | 783 |
| 117 | Ga0068861_100149280 | 3300005719 | Bacteria | 1916 |
| 118 | Ga0068861_100673012 | 3300005719 | Bacteria | 959 |
| 119 | Ga0068861_102404766 | 3300005719 | Bacteria | 530 |
| 120 | Ga0068851_10003531 | 3300005834 | Bacteria | 6955 |
| 121 | Ga0068851_10029447 | 3300005834 | Bacteria | 2718 |
| 122 | Ga0068870_10319764 | 3300005840 | Bacteria | 986 |
| 123 | Ga0068863_100000342 | 3300005841 | Bacteria | 47536 |
| 124 | Ga0068863_100039183 | 3300005841 | Bacteria | 4509 |
| 125 | Ga0068863_100380143 | 3300005841 | Bacteria | 1379 |
| 126 | Ga0068863_101010368 | 3300005841 | Bacteria | 834 |
| 127 | Ga0068863_101165486 | 3300005841 | Bacteria | 776 |
| 128 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 129 | Ga0068858_100000091 | 3300005842 | Bacteria | 93802 |
| 130 | Ga0068858_100097996 | 3300005842 | Bacteria | 2733 |
| 131 | Ga0068858_102318158 | 3300005842 | Bacteria | 531 |
| 132 | Ga0068858_102552791 | 3300005842 | Unclassified | 505 |
| 133 | Ga0068860_100008191 | 3300005843 | Bacteria | 10405 |
| 134 | Ga0068860_101338975 | 3300005843 | Bacteria | 737 |
| 135 | Ga0068860_101558293 | 3300005843 | Bacteria | 682 |
| 136 | Ga0068862_100000050 | 3300005844 | Bacteria | 145502 |
| 137 | Ga0081455_10012787 | 3300005937 | Bacteria | 8342 |
| 138 | Ga0081455_10056374 | 3300005937 | Bacteria | 3336 |
| 139 | Ga0081540_1000049 | 3300005983 | Bacteria | 127322 |
| 140 | Ga0081539_10001097 | 3300005985 | Bacteria | 49223 |
| 141 | Ga0075365_11049057 | 3300006038 | Bacteria | 574 |
| 142 | Ga0075365_11225240 | 3300006038 | Bacteria | 528 |
| 143 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 144 | Ga0070716_100446457 | 3300006173 | Bacteria | 942 |
| 145 | Ga0070712_100002529 | 3300006175 | Bacteria | 11290 |
| 146 | Ga0070712_100512501 | 3300006175 | Bacteria | 1007 |
| 147 | Ga0070712_101842455 | 3300006175 | Bacteria | 530 |
| 148 | Ga0097621_100195886 | 3300006237 | Bacteria | 1752 |
| 149 | Ga0097621_100792550 | 3300006237 | Bacteria | 877 |
| 150 | Ga0068871_100421524 | 3300006358 | Bacteria | 1192 |
| 151 | Ga0075430_100128424 | 3300006846 | Unclassified | 2113 |
| 152 | Ga0075433_10002122 | 3300006852 | Bacteria | 15030 |
| 153 | Ga0075433_10042449 | 3300006852 | Bacteria | 3946 |
| 154 | Ga0068865_100000023 | 3300006881 | Bacteria | 100785 |
| 155 | Ga0068865_100590369 | 3300006881 | Bacteria | 937 |
| 156 | Ga0097620_100549774 | 3300006931 | Bacteria | 1249 |
| 157 | Ga0075435_100198052 | 3300007076 | Bacteria | 1702 |
| 158 | Ga0105250_10121649 | 3300009092 | Bacteria | 1073 |
| 159 | Ga0105240_10514333 | 3300009093 | Bacteria | 1329 |
| 160 | Ga0105240_10653056 | 3300009093 | Bacteria | 1152 |
| 161 | Ga0105240_10808036 | 3300009093 | Bacteria | 1015 |
| 162 | Ga0105240_12283716 | 3300009093 | Bacteria | 560 |
| 163 | Ga0111539_12512243 | 3300009094 | Bacteria | 597 |
| 164 | Ga0105245_10000266 | 3300009098 | Bacteria | 49944 |
| 165 | Ga0105245_10001339 | 3300009098 | Bacteria | 22307 |
| 166 | Ga0105245_10095693 | 3300009098 | Bacteria | 2740 |
| 167 | Ga0105245_10251557 | 3300009098 | Bacteria | 1717 |
| 168 | Ga0105245_12572472 | 3300009098 | Bacteria | 562 |
| 169 | Ga0105247_10000316 | 3300009101 | Bacteria | 43374 |
| 170 | Ga0105247_10004636 | 3300009101 | Bacteria | 8763 |
| 171 | Ga0105247_10229738 | 3300009101 | Bacteria | 1259 |
| 172 | Ga0105247_10589126 | 3300009101 | Bacteria | 823 |
| 173 | Ga0105247_10929424 | 3300009101 | Bacteria | 674 |
| 174 | Ga0105247_11003398 | 3300009101 | Bacteria | 652 |
| 175 | Ga0105243_10003688 | 3300009148 | Bacteria | 12316 |
| 176 | Ga0105243_11191724 | 3300009148 | Bacteria | 774 |
| 177 | Ga0105243_11579662 | 3300009148 | Bacteria | 682 |
| 178 | Ga0105241_10471481 | 3300009174 | Bacteria | 1114 |
| 179 | Ga0105241_10799124 | 3300009174 | Bacteria | 869 |
| 180 | Ga0105242_10000032 | 3300009176 | Bacteria | 98198 |
| 181 | Ga0105242_10000454 | 3300009176 | Bacteria | 32662 |
| 182 | Ga0105242_10011362 | 3300009176 | Bacteria | 6844 |
| 183 | Ga0105242_10118359 | 3300009176 | Bacteria | 2269 |
| 184 | Ga0105242_10379023 | 3300009176 | Bacteria | 1314 |
| 185 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 186 | Ga0105248_11648337 | 3300009177 | Bacteria | 727 |
| 187 | Ga0105248_12733215 | 3300009177 | Bacteria | 563 |
| 188 | Ga0105237_10310600 | 3300009545 | Bacteria | 1580 |
| 189 | Ga0105237_10373385 | 3300009545 | Unclassified | 1431 |
| 190 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 191 | Ga0105238_11280917 | 3300009551 | Bacteria | 759 |
| 192 | Ga0105249_10000080 | 3300009553 | Bacteria | 138080 |
| 193 | Ga0105249_11467432 | 3300009553 | Bacteria | 754 |
| 194 | Ga0105239_10474610 | 3300010375 | Bacteria | 1421 |
| 195 | Ga0105239_10551321 | 3300010375 | Bacteria | 1313 |
| 196 | Ga0105239_12188673 | 3300010375 | Bacteria | 643 |
| 197 | Ga0105239_12427357 | 3300010375 | Bacteria | 611 |
| 198 | Ga0105246_10812260 | 3300011119 | Bacteria | 831 |
| 199 | Ga0105246_11311961 | 3300011119 | Bacteria | 671 |
| 200 | Ga0157371_10004749 | 3300013102 | Bacteria | 11723 |
| 201 | Ga0157370_10059766 | 3300013104 | Bacteria | 3621 |
| 202 | Ga0157370_10062901 | 3300013104 | Bacteria | 3518 |
| 203 | Ga0157370_10078808 | 3300013104 | Bacteria | 3102 |
| 204 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 205 | Ga0157374_10057293 | 3300013296 | Bacteria | 3639 |
| 206 | Ga0157374_10195547 | 3300013296 | Bacteria | 1979 |
| 207 | Ga0157374_11439274 | 3300013296 | Bacteria | 712 |
| 208 | Ga0157374_12009386 | 3300013296 | Unclassified | 604 |
| 209 | Ga0157378_10009985 | 3300013297 | Bacteria | 8277 |
| 210 | Ga0157378_10127991 | 3300013297 | Bacteria | 2348 |
| 211 | Ga0157378_10136142 | 3300013297 | Bacteria | 2278 |
| 212 | Ga0163162_12398389 | 3300013306 | Bacteria | 606 |
| 213 | Ga0163162_12536887 | 3300013306 | Bacteria | 590 |
| 214 | Ga0157372_10000112 | 3300013307 | Bacteria | 85902 |
| 215 | Ga0157372_10314251 | 3300013307 | Bacteria | 1824 |
| 216 | Ga0157375_10048495 | 3300013308 | Bacteria | 4155 |
| 217 | Ga0157375_10050351 | 3300013308 | Bacteria | 4086 |
| 218 | Ga0157375_10956266 | 3300013308 | Bacteria | 998 |
| 219 | Ga0157375_11117495 | 3300013308 | Bacteria | 923 |
| 220 | Ga0157375_11507555 | 3300013308 | Bacteria | 794 |
| 221 | Ga0157375_12056879 | 3300013308 | Bacteria | 679 |
| 222 | Ga0157375_12525181 | 3300013308 | Bacteria | 614 |
| 223 | Ga0163163_10092414 | 3300014325 | Bacteria | 3041 |
| 224 | Ga0163163_10706151 | 3300014325 | Bacteria | 1072 |
| 225 | Ga0163163_11388125 | 3300014325 | Unclassified | 764 |
| 226 | Ga0163163_11919745 | 3300014325 | Bacteria | 652 |
| 227 | Ga0163163_12464328 | 3300014325 | Bacteria | 578 |
| 228 | Ga0157380_10000091 | 3300014326 | Bacteria | 49188 |
| 229 | Ga0157380_10000253 | 3300014326 | Bacteria | 32008 |
| 230 | Ga0157380_10447944 | 3300014326 | Bacteria | 1239 |
| 231 | Ga0157380_10494203 | 3300014326 | Bacteria | 1187 |
| 232 | Ga0157379_10035232 | 3300014968 | Bacteria | 4463 |
| 233 | Ga0157379_10234529 | 3300014968 | Bacteria | 1664 |
| 234 | Ga0157379_10261552 | 3300014968 | Bacteria | 1572 |
| 235 | Ga0157376_10185540 | 3300014969 | Bacteria | 1904 |
| 236 | Ga0157376_11584587 | 3300014969 | Unclassified | 689 |
| 237 | Ga0163161_10006589 | 3300017792 | Bacteria | 8041 |
| 238 | Ga0163161_10093270 | 3300017792 | Bacteria | 2230 |
| 239 | Ga0163161_10501705 | 3300017792 | Bacteria | 988 |
| 240 | Ga0197907_10064860 | 3300020069 | Bacteria | 835 |
| 241 | Ga0206356_11109912 | 3300020070 | Bacteria | 2314 |
| 242 | Ga0206355_1070519 | 3300020076 | Unclassified | 509 |
| 243 | Ga0206351_10019693 | 3300020077 | Bacteria | 553 |
| 244 | Ga0206354_10838957 | 3300020081 | Bacteria | 643 |
| 245 | Ga0224712_10055809 | 3300022467 | Bacteria | 1555 |
| 246 | Ga0207656_10018770 | 3300025321 | Bacteria | 2727 |
| 247 | Ga0207656_10020609 | 3300025321 | Bacteria | 2622 |
| 248 | Ga0207653_10188232 | 3300025885 | Bacteria | 774 |
| 249 | Ga0207682_10000005 | 3300025893 | Bacteria | 95617 |
| 250 | Ga0207692_10181807 | 3300025898 | Bacteria | 1225 |
| 251 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 252 | Ga0207642_10001004 | 3300025899 | Bacteria | 8841 |
| 253 | Ga0207642_10601508 | 3300025899 | Bacteria | 684 |
| 254 | Ga0207710_10000239 | 3300025900 | Bacteria | 46663 |
| 255 | Ga0207710_10000458 | 3300025900 | Bacteria | 26155 |
| 256 | Ga0207710_10489544 | 3300025900 | Bacteria | 637 |
| 257 | Ga0207710_10713207 | 3300025900 | Bacteria | 526 |
| 258 | Ga0207680_10000901 | 3300025903 | Bacteria | 14044 |
| 259 | Ga0207680_10009305 | 3300025903 | Bacteria | 4868 |
| 260 | Ga0207685_10000027 | 3300025905 | Bacteria | 102101 |
| 261 | Ga0207654_10423534 | 3300025911 | Bacteria | 929 |
| 262 | Ga0207654_10858427 | 3300025911 | Archaea | 657 |
| 263 | Ga0207707_10107414 | 3300025912 | Bacteria | 2440 |
| 264 | Ga0207707_10218263 | 3300025912 | Bacteria | 1660 |
| 265 | Ga0207695_10542437 | 3300025913 | Bacteria | 1044 |
| 266 | Ga0207695_10674534 | 3300025913 | Bacteria | 914 |
| 267 | Ga0207671_10542704 | 3300025914 | Bacteria | 927 |
| 268 | Ga0207693_10478532 | 3300025915 | Bacteria | 972 |
| 269 | Ga0207663_10001546 | 3300025916 | Bacteria | 10768 |
| 270 | Ga0207663_10034771 | 3300025916 | Bacteria | 3017 |
| 271 | Ga0207660_10021949 | 3300025917 | Bacteria | 4297 |
| 272 | Ga0207662_10529436 | 3300025918 | Bacteria | 814 |
| 273 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 274 | Ga0207652_10000044 | 3300025921 | Bacteria | 127779 |
| 275 | Ga0207652_10005697 | 3300025921 | Bacteria | 10112 |
| 276 | Ga0207681_10244121 | 3300025923 | Bacteria | 1399 |
| 277 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 278 | Ga0207650_10110064 | 3300025925 | Bacteria | 2131 |
| 279 | Ga0207650_10608849 | 3300025925 | Bacteria | 919 |
| 280 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 281 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 282 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 283 | Ga0207687_10057875 | 3300025927 | Bacteria | 2724 |
| 284 | Ga0207687_10205045 | 3300025927 | Bacteria | 1544 |
| 285 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 286 | Ga0207700_10014365 | 3300025928 | Bacteria | 5187 |
| 287 | Ga0207664_10075635 | 3300025929 | Bacteria | 2723 |
| 288 | Ga0207644_10745221 | 3300025931 | Bacteria | 818 |
| 289 | Ga0207690_10008293 | 3300025932 | Bacteria | 6163 |
| 290 | Ga0207690_10021044 | 3300025932 | Bacteria | 4040 |
| 291 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 292 | Ga0207706_10541814 | 3300025933 | Bacteria | 1002 |
| 293 | Ga0207686_10000048 | 3300025934 | Bacteria | 115595 |
| 294 | Ga0207686_10000886 | 3300025934 | Bacteria | 18081 |
| 295 | Ga0207686_10021381 | 3300025934 | Bacteria | 3712 |
| 296 | Ga0207686_10060538 | 3300025934 | Bacteria | 2397 |
| 297 | Ga0207709_10013651 | 3300025935 | Bacteria | 4481 |
| 298 | Ga0207709_10627844 | 3300025935 | Bacteria | 853 |
| 299 | Ga0207670_10254855 | 3300025936 | Bacteria | 1358 |
| 300 | Ga0207669_10000018 | 3300025937 | Bacteria | 114254 |
| 301 | Ga0207669_10000090 | 3300025937 | Bacteria | 45953 |
| 302 | Ga0207704_10000159 | 3300025938 | Bacteria | 36005 |
| 303 | Ga0207704_10088099 | 3300025938 | Bacteria | 2030 |
| 304 | Ga0207665_10467204 | 3300025939 | Bacteria | 970 |
| 305 | Ga0207691_10000044 | 3300025940 | Bacteria | 100027 |
| 306 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 307 | Ga0207661_10000139 | 3300025944 | Bacteria | 45892 |
| 308 | Ga0207661_10003835 | 3300025944 | Bacteria | 10482 |
| 309 | Ga0207661_10005409 | 3300025944 | Bacteria | 8993 |
| 310 | Ga0207661_10042501 | 3300025944 | Bacteria | 3583 |
| 311 | Ga0207661_10393836 | 3300025944 | Bacteria | 1255 |
| 312 | Ga0207661_10487831 | 3300025944 | Bacteria | 1125 |
| 313 | Ga0207679_10029433 | 3300025945 | Bacteria | 3824 |
| 314 | Ga0207679_10106187 | 3300025945 | Bacteria | 2207 |
| 315 | Ga0207667_10732922 | 3300025949 | Bacteria | 989 |
| 316 | Ga0207651_10030338 | 3300025960 | Bacteria | 3441 |
| 317 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 318 | Ga0207668_10014280 | 3300025972 | Bacteria | 4914 |
| 319 | Ga0207668_10159363 | 3300025972 | Bacteria | 1756 |
| 320 | Ga0207640_10000038 | 3300025981 | Bacteria | 108630 |
| 321 | Ga0207640_10291704 | 3300025981 | Bacteria | 1286 |
| 322 | Ga0207658_10003939 | 3300025986 | Bacteria | 10434 |
| 323 | Ga0207658_10016682 | 3300025986 | Bacteria | 5054 |
| 324 | Ga0207658_10131195 | 3300025986 | Bacteria | 2013 |
| 325 | Ga0207658_10142777 | 3300025986 | Bacteria | 1940 |
| 326 | Ga0207658_11530894 | 3300025986 | Unclassified | 610 |
| 327 | Ga0207677_10000340 | 3300026023 | Bacteria | 33455 |
| 328 | Ga0207677_10001552 | 3300026023 | Bacteria | 12156 |
| 329 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 330 | Ga0207703_10002246 | 3300026035 | Bacteria | 16885 |
| 331 | Ga0207639_10011326 | 3300026041 | Bacteria | 6191 |
| 332 | Ga0207639_10130284 | 3300026041 | Bacteria | 2081 |
| 333 | Ga0207639_10344683 | 3300026041 | Bacteria | 1329 |
| 334 | Ga0207639_10590816 | 3300026041 | Bacteria | 1023 |
| 335 | Ga0207678_10000380 | 3300026067 | Bacteria | 40450 |
| 336 | Ga0207678_10121551 | 3300026067 | Bacteria | 2228 |
| 337 | Ga0207708_10117292 | 3300026075 | Bacteria | 2071 |
| 338 | Ga0207702_10000158 | 3300026078 | Bacteria | 79984 |
| 339 | Ga0207702_10004391 | 3300026078 | Bacteria | 12560 |
| 340 | Ga0207702_10020350 | 3300026078 | Bacteria | 5496 |
| 341 | Ga0207702_10604786 | 3300026078 | Bacteria | 1076 |
| 342 | Ga0207702_10715601 | 3300026078 | Bacteria | 987 |
| 343 | Ga0207702_10736633 | 3300026078 | Bacteria | 973 |
| 344 | Ga0207641_10003753 | 3300026088 | Bacteria | 13346 |
| 345 | Ga0207641_10009107 | 3300026088 | Bacteria | 8200 |
| 346 | Ga0207641_10466447 | 3300026088 | Bacteria | 1222 |
| 347 | Ga0207641_12239744 | 3300026088 | Bacteria | 546 |
| 348 | Ga0207648_10045789 | 3300026089 | Bacteria | 3836 |
| 349 | Ga0207676_10000094 | 3300026095 | Bacteria | 80575 |
| 350 | Ga0207674_10056052 | 3300026116 | Bacteria | 4004 |
| 351 | Ga0207674_11584883 | 3300026116 | Bacteria | 623 |
| 352 | Ga0207675_100324416 | 3300026118 | Bacteria | 1504 |
| 353 | Ga0207675_100330783 | 3300026118 | Unclassified | 1489 |
| 354 | Ga0207675_102636644 | 3300026118 | Bacteria | 512 |
| 355 | Ga0207683_10103707 | 3300026121 | Bacteria | 2541 |
| 356 | Ga0207683_10329652 | 3300026121 | Bacteria | 1399 |
| 357 | Ga0207683_11141100 | 3300026121 | Bacteria | 723 |
| 358 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 359 | Ga0207698_10341848 | 3300026142 | Bacteria | 1410 |
| 360 | Ga0207698_12450568 | 3300026142 | Bacteria | 532 |
| 361 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 362 | Ga0268266_10000640 | 3300028379 | Bacteria | 47545 |
| 363 | Ga0268266_10000822 | 3300028379 | Bacteria | 40636 |
| 364 | Ga0268266_10023216 | 3300028379 | Bacteria | 5282 |
| 365 | Ga0268266_10052672 | 3300028379 | Bacteria | 3495 |
| 366 | Ga0268266_10553470 | 3300028379 | Bacteria | 1102 |
| 367 | Ga0268266_11141332 | 3300028379 | Bacteria | 754 |
| 368 | Ga0268265_10001568 | 3300028380 | Bacteria | 18930 |
| 369 | Ga0268264_10033939 | 3300028381 | Bacteria | 4195 |
| 370 | Ga0268264_10246537 | 3300028381 | Bacteria | 1657 |
| 371 | Ga0268264_11079643 | 3300028381 | Bacteria | 811 |
| 372 | Ga0268264_11285526 | 3300028381 | Bacteria | 742 |
| 373 | Ga0265337_1000991 | 3300028556 | Bacteria | 14841 |
| 374 | Ga0265326_10000252 | 3300028558 | Bacteria | 25133 |
| 375 | Ga0265319_1000020 | 3300028563 | Bacteria | 153921 |
| 376 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 377 | Ga0265336_10020027 | 3300028666 | Bacteria | 2152 |
| 378 | Ga0265336_10064914 | 3300028666 | Bacteria | 1093 |
| 379 | Ga0265338_10001248 | 3300028800 | Bacteria | 41926 |
| 380 | Ga0265338_10079027 | 3300028800 | Bacteria | 2771 |
| 381 | Ga0265338_10706771 | 3300028800 | Bacteria | 695 |
| 382 | Ga0265324_10000498 | 3300029957 | Bacteria | 27248 |
| 383 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 384 | Ga0265325_10006673 | 3300031241 | Bacteria | 6984 |
| 385 | Ga0265329_10032012 | 3300031242 | Bacteria | 1705 |
| 386 | Ga0265331_10011308 | 3300031250 | Bacteria | 4892 |
| 387 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 388 | Ga0265316_10014310 | 3300031344 | Bacteria | 6991 |
| 389 | Ga0307513_10586254 | 3300031456 | Bacteria | 825 |
| 390 | Ga0265313_10066563 | 3300031595 | Bacteria | 1670 |
| 391 | Ga0265314_10000062 | 3300031711 | Bacteria | 159496 |
| 392 | Ga0265342_10068642 | 3300031712 | Bacteria | 2071 |
| 393 | Ga0307415_100028982 | 3300032126 | Bacteria | 3531 |
| 394 | Ga0373953_0185083 | 3300035117 | Unclassified | 899 |
| 395 | Ga0373955_0190629 | 3300035172 | Bacteria | 1219 |
| 396 | Ga0373955_0773905 | 3300035172 | Bacteria | 590 |
| 397 | Ga0373947_0620104 | 3300035725 | Bacteria | 737 |
| 398 | Ga0373937_0102350 | 3300036401 | Bacteria | 2659 |
| 399 | Ga0373937_1028551 | 3300036401 | Bacteria | 772 |
| 400 | Ga0451791_1087388 | 3300041451 | Bacteria | 721 |
| 401 | Ga0451795_1612883 | 3300041456 | Bacteria | 543 |
| 402 | Ga0451800_0223856 | 3300041459 | Bacteria | 954 |
| 403 | Ga0451800_1612225 | 3300041459 | Bacteria | 649 |
| 404 | Ga0451804_0761410 | 3300041463 | Unclassified | 642 |
| 405 | Ga0451804_1169606 | 3300041463 | Bacteria | 522 |
| 406 | Ga0451807_1367491 | 3300041486 | Bacteria | 640 |
| 407 | Ga0451833_0147399 | 3300041491 | Bacteria | 946 |
| 408 | Ga0451837_1335073 | 3300041494 | Bacteria | 576 |
| 409 | Ga0451845_0187233 | 3300041501 | Bacteria | 890 |
| 410 | Ga0451845_0826631 | 3300041501 | Bacteria | 647 |
| 411 | Ga0451849_0181530 | 3300041505 | Bacteria | 719 |
| 412 | Ga0451849_1137119 | 3300041505 | Unclassified | 620 |
| 413 | Ga0451853_3872250 | 3300041512 | Bacteria | 2861 |
| 414 | Ga0466963_0000153 | 3300044694 | Bacteria | 27553 |
| 415 | Ga0466963_0351274 | 3300044694 | Bacteria | 1038 |
| 416 | Ga0466963_0822093 | 3300044694 | Bacteria | 655 |
| 417 | Ga0466957_0009471 | 3300044842 | Bacteria | 5561 |
| 418 | Ga0466957_0305307 | 3300044842 | Bacteria | 1070 |
| 419 | Ga0466960_0075911 | 3300044901 | Bacteria | 1682 |
| 420 | Ga0466967_0000009 | 3300045976 | Bacteria | 122610 |
| 421 | Ga0466967_0046018 | 3300045976 | Bacteria | 3796 |
| 422 | Ga0466967_0325174 | 3300045976 | Bacteria | 1484 |
| 423 | Ga0466967_0749777 | 3300045976 | Bacteria | 968 |
| 424 | Ga0495592_0001452 | 3300046454 | Bacteria | 16469 |
| 425 | Ga0495592_0118102 | 3300046454 | Bacteria | 1869 |
| 426 | Ga0495592_0230867 | 3300046454 | Bacteria | 1232 |
| 427 | Ga0495592_0318931 | 3300046454 | Bacteria | 1005 |
| 428 | Ga0495592_0346556 | 3300046454 | Bacteria | 953 |
| 429 | Ga0495592_0433798 | 3300046454 | Bacteria | 826 |
| 430 | Ga0495603_0000016 | 3300046455 | Bacteria | 67399 |
| 431 | Ga0495603_0002944 | 3300046455 | Bacteria | 10072 |
| 432 | Ga0495603_0203251 | 3300046455 | Bacteria | 1145 |
| 433 | Ga0495629_0001726 | 3300046459 | Bacteria | 17147 |
| 434 | Ga0495629_0091023 | 3300046459 | Bacteria | 2128 |
| 435 | Ga0495629_0439386 | 3300046459 | Bacteria | 884 |
| 436 | Ga0495638_0033754 | 3300046460 | Bacteria | 3271 |
| 437 | Ga0495641_0000228 | 3300046461 | Bacteria | 43671 |
| 438 | Ga0495641_0026299 | 3300046461 | Bacteria | 2841 |
| 439 | Ga0495641_0026720 | 3300046461 | Bacteria | 2814 |
| 440 | Ga0495651_0033572 | 3300046462 | Bacteria | 4002 |
| 441 | Ga0495653_0103472 | 3300046463 | Bacteria | 2059 |
| 442 | Ga0495653_0195977 | 3300046463 | Bacteria | 1375 |
| 443 | Ga0495653_0376533 | 3300046463 | Bacteria | 907 |
| 444 | Ga0495653_0530752 | 3300046463 | Bacteria | 730 |
| 445 | Ga0495653_0743304 | 3300046463 | Unclassified | 593 |
| 446 | Ga0495582_0000081 | 3300046473 | Bacteria | 48557 |
| 447 | Ga0495662_0000019 | 3300046476 | Bacteria | 55148 |
| 448 | Ga0495662_0007799 | 3300046476 | Bacteria | 5271 |
| 449 | Ga0495664_0500003 | 3300046477 | Unclassified | 726 |
| 450 | Ga0495594_0000912 | 3300046499 | Bacteria | 15332 |
| 451 | Ga0495594_0230073 | 3300046499 | Bacteria | 1057 |
| 452 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 453 | Ga0495608_0000125 | 3300046511 | Bacteria | 54881 |
| 454 | Ga0495608_0036028 | 3300046511 | Bacteria | 3332 |
| 455 | Ga0495608_0050149 | 3300046511 | Bacteria | 2769 |
| 456 | Ga0495610_0067229 | 3300046512 | Bacteria | 1685 |
| 457 | Ga0495618_0008119 | 3300046514 | Bacteria | 6356 |
| 458 | Ga0495620_0000824 | 3300046515 | Bacteria | 19119 |
| 459 | Ga0495628_0000190 | 3300046516 | Bacteria | 53586 |
| 460 | Ga0495628_0026801 | 3300046516 | Bacteria | 4693 |
| 461 | Ga0495628_0083739 | 3300046516 | Bacteria | 2476 |
| 462 | Ga0495628_0118617 | 3300046516 | Bacteria | 2031 |
| 463 | Ga0495630_0000020 | 3300046517 | Bacteria | 176389 |
| 464 | Ga0495630_0038804 | 3300046517 | Bacteria | 3562 |
| 465 | Ga0495630_0104160 | 3300046517 | Bacteria | 2147 |
| 466 | Ga0495630_0325892 | 3300046517 | Bacteria | 1174 |
| 467 | Ga0495630_0354390 | 3300046517 | Bacteria | 1123 |
| 468 | Ga0495630_0721763 | 3300046517 | Bacteria | 762 |
| 469 | Ga0495637_0069030 | 3300046520 | Bacteria | 1431 |
| 470 | Ga0495643_0151731 | 3300046522 | Bacteria | 1147 |
| 471 | Ga0495644_0001670 | 3300046523 | Bacteria | 9012 |
| 472 | Ga0495652_0000546 | 3300046529 | Bacteria | 44003 |
| 473 | Ga0495652_0007337 | 3300046529 | Bacteria | 10166 |
| 474 | Ga0495652_0739639 | 3300046529 | Bacteria | 659 |
| 475 | Ga0495640_0051375 | 3300046533 | Bacteria | 2834 |
| 476 | Ga0495640_0159785 | 3300046533 | Bacteria | 1444 |
| 477 | Ga0495640_0364061 | 3300046533 | Bacteria | 891 |
| 478 | Ga0495586_0000161 | 3300046535 | Bacteria | 43544 |
| 479 | Ga0495586_0225639 | 3300046535 | Bacteria | 1065 |
| 480 | Ga0495587_0004792 | 3300046536 | Bacteria | 8884 |
| 481 | Ga0495587_0008810 | 3300046536 | Bacteria | 6475 |
| 482 | Ga0495587_0248222 | 3300046536 | Bacteria | 1001 |
| 483 | Ga0495609_0169701 | 3300046538 | Bacteria | 922 |
| 484 | Ga0495621_0020340 | 3300046539 | Bacteria | 2177 |
| 485 | Ga0495645_0069926 | 3300046543 | Bacteria | 2534 |
| 486 | Ga0495645_0215508 | 3300046543 | Bacteria | 1294 |
| 487 | Ga0495622_0000966 | 3300046557 | Bacteria | 15427 |
| 488 | Ga0495667_0000018 | 3300046559 | Bacteria | 188610 |
| 489 | Ga0495668_0124422 | 3300046616 | Bacteria | 1411 |
| 490 | Ga0495634_0000235 | 3300046642 | Bacteria | 51684 |
| 491 | Ga0495634_0024348 | 3300046642 | Bacteria | 4247 |
| 492 | Ga0495634_0071921 | 3300046642 | Bacteria | 2276 |
| 493 | Ga0495634_0844816 | 3300046642 | Unclassified | 520 |
| 494 | Ga0495625_0000756 | 3300046660 | Bacteria | 45145 |
| 495 | Ga0495625_0259088 | 3300046660 | Bacteria | 1126 |
| 496 | Ga0495635_0000044 | 3300046663 | Bacteria | 83945 |
| 497 | Ga0495635_0080583 | 3300046663 | Bacteria | 2228 |
| 498 | Ga0495588_0000134 | 3300046674 | Bacteria | 117581 |
| 499 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 500 | Ga0495657_0008510 | 3300046675 | Bacteria | 7844 |
| 501 | Ga0495599_0005863 | 3300046678 | Bacteria | 7379 |
| 502 | Ga0495623_0240779 | 3300046679 | Bacteria | 1022 |
| 503 | Ga0495646_0114920 | 3300046680 | Bacteria | 1529 |
| 504 | Ga0495646_0318782 | 3300046680 | Bacteria | 819 |
| 505 | Ga0495647_0000018 | 3300046681 | Bacteria | 81701 |
| 506 | Ga0495647_0009304 | 3300046681 | Bacteria | 3324 |
| 507 | Ga0495647_0026556 | 3300046681 | Bacteria | 2122 |
| 508 | Ga0495647_0312348 | 3300046681 | Bacteria | 710 |
| 509 | Ga0495658_0000034 | 3300046683 | Bacteria | 69176 |
| 510 | Ga0495669_0000033 | 3300046684 | Bacteria | 98629 |
| 511 | Ga0495669_0338946 | 3300046684 | Bacteria | 726 |
| 512 | Ga0495613_0000200 | 3300046689 | Bacteria | 58821 |
| 513 | Ga0495613_0000801 | 3300046689 | Bacteria | 24391 |
| 514 | Ga0495624_0000097 | 3300046690 | Bacteria | 58715 |
| 515 | Ga0495624_0000647 | 3300046690 | Bacteria | 27259 |
| 516 | Ga0495624_0066749 | 3300046690 | Bacteria | 2245 |
| 517 | Ga0495670_0012763 | 3300046691 | Bacteria | 4131 |
| 518 | Ga0495649_0011134 | 3300046694 | Bacteria | 5292 |
| 519 | Ga0495600_0008294 | 3300046809 | Bacteria | 6376 |
| 520 | Ga0495604_0000055 | 3300047317 | Bacteria | 100430 |
| 521 | Ga0495604_0000137 | 3300047317 | Bacteria | 62542 |
| 522 | Ga0495604_0134406 | 3300047317 | Bacteria | 1774 |
| 523 | Ga0495674_0000064 | 3300047319 | Bacteria | 71275 |
| 524 | Ga0495674_0966703 | 3300047319 | Bacteria | 654 |
| 525 | Ga0495672_0085884 | 3300047320 | Bacteria | 1742 |
| 526 | Ga0495672_0103061 | 3300047320 | Bacteria | 1544 |
| 527 | Ga0495676_0002521 | 3300047321 | Bacteria | 16308 |
| 528 | Ga0495676_0005015 | 3300047321 | Bacteria | 12143 |
| 529 | Ga0495676_0129577 | 3300047321 | Bacteria | 1823 |
| 530 | Ga0495676_0182608 | 3300047321 | Bacteria | 1469 |
| 531 | Ga0495676_0912442 | 3300047321 | Bacteria | 562 |
| 532 | Ga0495680_0001229 | 3300047322 | Bacteria | 28095 |
| 533 | Ga0495680_0003149 | 3300047322 | Bacteria | 16432 |
| 534 | Ga0495680_0064781 | 3300047322 | Bacteria | 2801 |
| 535 | Ga0495680_0161675 | 3300047322 | Bacteria | 1626 |
| 536 | Ga0495680_0173243 | 3300047322 | Bacteria | 1561 |
| 537 | Ga0495680_0222832 | 3300047322 | Bacteria | 1346 |
| 538 | Ga0495680_0689477 | 3300047322 | Unclassified | 676 |
| 539 | Ga0495675_0000842 | 3300047444 | Bacteria | 18758 |
| 540 | Ga0495679_052801 | 3300047446 | Bacteria | 1215 |
| 541 | Ga0495685_166614 | 3300047447 | Bacteria | 712 |
| 542 | Ga0495684_0062931 | 3300047471 | Bacteria | 2822 |
| 543 | Ga0495684_0261664 | 3300047471 | Bacteria | 1255 |
| 544 | Ga0495684_0721404 | 3300047471 | Bacteria | 659 |
| 545 | Ga0495686_0110686 | 3300047472 | Bacteria | 1647 |
| 546 | Ga0495593_0423071 | 3300047673 | Bacteria | 666 |
| 547 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 548 | Ga0495602_0001343 | 3300048088 | Bacteria | 24288 |
| 549 | Ga0495602_0073582 | 3300048088 | Bacteria | 2908 |
| 550 | Ga0495602_0196005 | 3300048088 | Bacteria | 1544 |
| 551 | Ga0495602_0238066 | 3300048088 | Bacteria | 1363 |
| 552 | Ga0495602_0943505 | 3300048088 | Bacteria | 572 |
| 553 | Ga0495614_0330026 | 3300048089 | Bacteria | 708 |
| 554 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 555 | Ga0496100_0013418 | 3300048903 | Bacteria | 4725 |
| 556 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 557 | Ga0496101_0000062 | 3300048904 | Bacteria | 126595 |
| 558 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 559 | Ga0496102_0039947 | 3300048905 | Bacteria | 4242 |
| 560 | Ga0496102_0913975 | 3300048905 | Bacteria | 799 |
| 561 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 562 | Ga0496103_0162091 | 3300048906 | Bacteria | 1434 |
| 563 | Ga0496103_0305146 | 3300048906 | Bacteria | 1024 |
| 564 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 565 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 566 | Ga0496104_0000257 | 3300048907 | Bacteria | 46964 |
| 567 | Ga0496104_0027266 | 3300048907 | Bacteria | 5287 |
| 568 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 569 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 570 | Ga0496105_0000174 | 3300048908 | Bacteria | 42932 |
| 571 | Ga0496105_0147700 | 3300048908 | Unclassified | 1933 |
| 572 | Ga0496105_0388642 | 3300048908 | Bacteria | 1109 |
| 573 | Ga0496106_0000084 | 3300048909 | Bacteria | 74135 |
| 574 | Ga0496106_0000122 | 3300048909 | Bacteria | 59816 |
| 575 | Ga0496106_0100801 | 3300048909 | Bacteria | 2239 |
| 576 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 577 | Ga0496107_0002178 | 3300048910 | Bacteria | 12583 |
| 578 | Ga0496107_0180671 | 3300048910 | Bacteria | 1566 |
| 579 | Ga0496107_0336461 | 3300048910 | Bacteria | 1123 |
| 580 | Ga0496107_0419227 | 3300048910 | Bacteria | 995 |
| 581 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 582 | Ga0496108_0000175 | 3300048911 | Bacteria | 59373 |
| 583 | Ga0496108_0000187 | 3300048911 | Bacteria | 57568 |
| 584 | Ga0496108_0056875 | 3300048911 | Bacteria | 3286 |
| 585 | Ga0496108_0870309 | 3300048911 | Bacteria | 775 |
| 586 | Ga0496108_1136530 | 3300048911 | Bacteria | 662 |
| 587 | Ga0496108_1529048 | 3300048911 | Bacteria | 554 |
| 588 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 589 | Ga0496109_0000121 | 3300048912 | Bacteria | 81487 |
| 590 | Ga0496109_0000611 | 3300048912 | Bacteria | 29848 |
| 591 | Ga0496109_0009604 | 3300048912 | Bacteria | 8250 |
| 592 | Ga0496109_0023749 | 3300048912 | Bacteria | 5442 |
| 593 | Ga0496109_0209551 | 3300048912 | Bacteria | 1833 |
| 594 | Ga0496109_0281350 | 3300048912 | Bacteria | 1568 |
| 595 | Ga0496109_1687520 | 3300048912 | Bacteria | 567 |
| 596 | Ga0496110_0001510 | 3300048913 | Bacteria | 16887 |
| 597 | Ga0496110_0067647 | 3300048913 | Bacteria | 3161 |
| 598 | Ga0496110_0080699 | 3300048913 | Bacteria | 2899 |
| 599 | Ga0496110_0333323 | 3300048913 | Bacteria | 1382 |
| 600 | Ga0496110_0816121 | 3300048913 | Bacteria | 837 |
| 601 | Ga0496110_0965365 | 3300048913 | Bacteria | 759 |
| 602 | Ga0496111_0000009 | 3300048914 | Bacteria | 93943 |
| 603 | Ga0496111_0274474 | 3300048914 | Bacteria | 1251 |
| 604 | Ga0496111_0669504 | 3300048914 | Bacteria | 756 |
| 605 | Ga0496111_0757278 | 3300048914 | Bacteria | 704 |
| 606 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 607 | Ga0496112_0010135 | 3300048915 | Bacteria | 8537 |
| 608 | Ga0496112_0568336 | 3300048915 | Unclassified | 1067 |
| 609 | Ga0496112_0587354 | 3300048915 | Bacteria | 1046 |
| 610 | Ga0496113_0000073 | 3300048916 | Bacteria | 44302 |
| 611 | Ga0496113_0124930 | 3300048916 | Bacteria | 2014 |
| 612 | Ga0496113_0636032 | 3300048916 | Bacteria | 853 |
| 613 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 614 | Ga0496114_0859474 | 3300048917 | Bacteria | 787 |
| 615 | Ga0496114_1001757 | 3300048917 | Bacteria | 719 |
| 616 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 617 | Ga0496115_0000920 | 3300048918 | Bacteria | 21370 |
| 618 | Ga0496117_0001988 | 3300048920 | Bacteria | 27154 |
| 619 | Ga0496117_0136149 | 3300048920 | Bacteria | 1479 |
| 620 | Ga0496118_0000373 | 3300048921 | Bacteria | 75473 |
| 621 | Ga0496118_0052458 | 3300048921 | Bacteria | 3110 |
| 622 | Ga0496118_0281467 | 3300048921 | Bacteria | 925 |
| 623 | Ga0496118_0479522 | 3300048921 | Bacteria | 624 |
| 624 | Ga0496119_0018509 | 3300048922 | Bacteria | 5179 |
| 625 | Ga0496119_0021841 | 3300048922 | Bacteria | 4607 |
| 626 | Ga0496119_0032630 | 3300048922 | Bacteria | 3467 |
| 627 | Ga0496120_0008890 | 3300048923 | Bacteria | 7194 |
| 628 | Ga0496121_0020360 | 3300048924 | Bacteria | 6574 |
| 629 | Ga0496121_0026490 | 3300048924 | Bacteria | 5461 |
| 630 | Ga0496121_0082975 | 3300048924 | Bacteria | 2531 |
| 631 | Ga0496121_0175748 | 3300048924 | Bacteria | 1550 |
| 632 | Ga0496121_0449362 | 3300048924 | Bacteria | 831 |
| 633 | Ga0496124_0202775 | 3300048927 | Bacteria | 1507 |
| 634 | Ga0496124_0303628 | 3300048927 | Bacteria | 1151 |
| 635 | Ga0496124_0809907 | 3300048927 | Bacteria | 579 |
| 636 | Ga0496125_0038435 | 3300048928 | Bacteria | 4142 |
| 637 | Ga0496125_0077358 | 3300048928 | Bacteria | 2565 |
| 638 | Ga0496125_0079512 | 3300048928 | Bacteria | 2515 |
| 639 | Ga0496126_0010117 | 3300048929 | Bacteria | 9937 |
| 640 | Ga0496126_0156978 | 3300048929 | Bacteria | 1946 |
| 641 | Ga0496126_0510065 | 3300048929 | Bacteria | 960 |
| 642 | Ga0501031_0005273 | 3300049568 | Bacteria | 8423 |
| 643 | Ga0501032_0006818 | 3300049569 | Bacteria | 8381 |
| 644 | Ga0501032_0782793 | 3300049569 | Unclassified | 603 |
| 645 | Ga0501033_0008144 | 3300049570 | Bacteria | 8116 |
| 646 | Ga0501034_0090987 | 3300049571 | Bacteria | 3049 |
| 647 | Ga0501036_0009217 | 3300049572 | Bacteria | 8113 |
| 648 | Ga0501036_1263342 | 3300049572 | Bacteria | 601 |
| 649 | Ga0501037_0036552 | 3300049573 | Bacteria | 3619 |
| 650 | Ga0501038_0010697 | 3300049574 | Bacteria | 8390 |
| 651 | Ga0501039_0020768 | 3300049575 | Bacteria | 5033 |
| 652 | Ga0501040_0005660 | 3300049576 | Bacteria | 8074 |
| 653 | Ga0501041_0620161 | 3300049577 | Unclassified | 691 |
| 654 | Ga0501042_0023246 | 3300049578 | Bacteria | 4336 |
| 655 | Ga0501042_0162121 | 3300049578 | Bacteria | 1613 |
| 656 | Ga0501042_0365913 | 3300049578 | Bacteria | 1043 |
| 657 | Ga0501043_0008404 | 3300049579 | Bacteria | 8130 |
| 658 | Ga0501043_0459610 | 3300049579 | Unclassified | 955 |
| 659 | Ga0501046_0003232 | 3300049580 | Bacteria | 14970 |
| 660 | Ga0501046_0502843 | 3300049580 | Bacteria | 868 |
| 661 | Ga0501047_0000715 | 3300049581 | Bacteria | 34573 |
| 662 | Ga0501047_0011367 | 3300049581 | Bacteria | 8426 |
| 663 | Ga0501047_0069611 | 3300049581 | Bacteria | 3388 |
| 664 | Ga0501047_0099334 | 3300049581 | Bacteria | 2789 |
| 665 | Ga0501047_0308165 | 3300049581 | Bacteria | 1424 |
| 666 | Ga0501048_0007912 | 3300049582 | Bacteria | 8050 |
| 667 | Ga0501067_0038047 | 3300049583 | Bacteria | 2672 |
| 668 | Ga0501068_0003782 | 3300049584 | Bacteria | 8200 |
| 669 | Ga0501068_0159424 | 3300049584 | Bacteria | 1422 |
| 670 | Ga0501069_0001977 | 3300049585 | Bacteria | 10249 |
| 671 | Ga0501069_0241161 | 3300049585 | Unclassified | 1053 |
| 672 | Ga0501069_0672843 | 3300049585 | Unclassified | 623 |
| 673 | Ga0501070_0000676 | 3300049586 | Bacteria | 31296 |
| 674 | Ga0501070_0009160 | 3300049586 | Bacteria | 8373 |
| 675 | Ga0501070_0067838 | 3300049586 | Bacteria | 2954 |
| 676 | Ga0501070_0204705 | 3300049586 | Bacteria | 1620 |
| 677 | Ga0501070_0246197 | 3300049586 | Bacteria | 1463 |
| 678 | Ga0501070_0859228 | 3300049586 | Bacteria | 709 |
| 679 | Ga0501070_1469361 | 3300049586 | Bacteria | 516 |
| 680 | Ga0501071_0045682 | 3300049587 | Bacteria | 3144 |
| 681 | Ga0501071_1418727 | 3300049587 | Unclassified | 536 |
| 682 | Ga0501072_0356704 | 3300049588 | Bacteria | 1161 |
| 683 | Ga0501072_1520938 | 3300049588 | Unclassified | 516 |
| 684 | Ga0501073_0008844 | 3300049589 | Bacteria | 7447 |
| 685 | Ga0501074_0007273 | 3300049590 | Bacteria | 8002 |
| 686 | Ga0501074_0074544 | 3300049590 | Bacteria | 2436 |
| 687 | Ga0501075_0006281 | 3300049591 | Bacteria | 8166 |
| 688 | Ga0501076_0932483 | 3300049592 | Unclassified | 716 |
| 689 | Ga0501079_0007770 | 3300049741 | Bacteria | 8118 |
| 690 | Ga0501079_0015295 | 3300049741 | Bacteria | 5854 |
| 691 | Ga0501079_1120633 | 3300049741 | Unclassified | 620 |
| 692 | Ga0501080_0020947 | 3300049742 | Bacteria | 6051 |
| 693 | Ga0501081_0073889 | 3300049743 | Bacteria | 2378 |
| 694 | Ga0501083_0001648 | 3300049744 | Bacteria | 15232 |
| 695 | Ga0501083_0011652 | 3300049744 | Bacteria | 6168 |
| 696 | Ga0501083_0021931 | 3300049744 | Bacteria | 4434 |
| 697 | Ga0501035_0000571 | 3300049822 | Bacteria | 40766 |
| 698 | Ga0501035_0246910 | 3300049822 | Unclassified | 1517 |
| 699 | Ga0501035_1248753 | 3300049822 | Bacteria | 575 |
| 700 | Ga0501044_0004142 | 3300049823 | Bacteria | 16282 |
| 701 | Ga0501044_0014768 | 3300049823 | Bacteria | 8419 |
| 702 | Ga0501044_0097325 | 3300049823 | Bacteria | 2964 |
| 703 | Ga0501044_1155353 | 3300049823 | Bacteria | 643 |
| 704 | Ga0501045_0724333 | 3300049824 | Unclassified | 734 |
| 705 | nmdc:mga0yw44_209692_c1 | 3300050492 | Bacteria | 1288 |
| 706 | nmdc:mga0qj67_116694_c1 | 3300050509 | Unclassified | 2157 |
| 707 | nmdc:mga0rr50_122227_c1 | 3300050513 | Bacteria | 2074 |
| 708 | nmdc:mga0a205_273_c2 | 3300050515 | Bacteria | 15047 |
| 709 | nmdc:mga0a205_6183_c1 | 3300050515 | Bacteria | 9940 |
| 710 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 711 | Ga0495601_0000264 | 3300053077 | Bacteria | 28275 |
| 712 | Ga0495601_0038283 | 3300053077 | Bacteria | 2998 |
| 713 | Ga0495601_0095157 | 3300053077 | Unclassified | 1920 |
| 714 | Ga0495601_0175811 | 3300053077 | Bacteria | 1399 |
| 715 | Ga0495601_0195114 | 3300053077 | Bacteria | 1323 |
| 716 | Ga0495601_0316438 | 3300053077 | Bacteria | 1016 |
| 717 | Ga0495601_0363817 | 3300053077 | Bacteria | 940 |
| 718 | Ga0495612_0000060 | 3300053078 | Bacteria | 49047 |
| 719 | Ga0495612_0022469 | 3300053078 | Bacteria | 2527 |
| 720 | Ga0495612_0033638 | 3300053078 | Bacteria | 2075 |
| 721 | Ga0495612_0038282 | 3300053078 | Bacteria | 1949 |
| 722 | Ga0495612_0046299 | 3300053078 | Bacteria | 1781 |
| 723 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 724 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 725 | Ga0495595_0000053 | 3300053084 | Bacteria | 59851 |
| 726 | Ga0495595_0067347 | 3300053084 | Bacteria | 1687 |
| 727 | Ga0495595_0390017 | 3300053084 | Bacteria | 705 |
| 728 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 729 | Ga0495619_0000116 | 3300053085 | Bacteria | 58748 |
| 730 | Ga0495619_0000782 | 3300053085 | Bacteria | 20846 |
| 731 | Ga0495619_0001012 | 3300053085 | Bacteria | 18401 |
| 732 | Ga0495619_0001275 | 3300053085 | Bacteria | 16532 |
| 733 | Ga0495619_0004173 | 3300053085 | Bacteria | 9228 |
| 734 | Ga0495619_0005899 | 3300053085 | Bacteria | 7761 |
| 735 | Ga0495619_0161980 | 3300053085 | Viruses | 1545 |
| 736 | Ga0500566_0007596 | 3300053094 | Bacteria | 6424 |
| 737 | Ga0500641_0003883 | 3300053096 | Bacteria | 5283 |
| 738 | Ga0500650_0179394 | 3300053098 | Bacteria | 971 |
| 739 | Ga0500595_040628 | 3300053119 | Bacteria | 1499 |
| 740 | Ga0500614_000451 | 3300053123 | Bacteria | 10624 |
| 741 | Ga0500628_000010 | 3300053129 | Bacteria | 122210 |
| 742 | Ga0500658_0130638 | 3300053134 | Bacteria | 1120 |
| 743 | Ga0501084_0493860 | 3300054114 | Unclassified | 1034 |
| 744 | Ga0590077_023859 | 3300059426 | Bacteria | 1312 |
| 745 | Ga0587092_018905 | 3300059512 | Bacteria | 1045 |
| 746 | Ga0501082_0072467 | 3300060353 | Bacteria | 2967 |
| 747 | Ga0501082_0310180 | 3300060353 | Bacteria | 1374 |
| 748 | Ga0501082_1894819 | 3300060353 | Unclassified | 520 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006175 | Ga0070712_100002529 | Ga0070712_1000025296 | 118 |
| 2 | 3300005441 | Ga0070700_100274997 | Ga0070700_1002749971 | 119 |
| 3 | 3300049578 | Ga0501042_0365913 | Ga0501042_0365913_400_762 | 119 |
| 4 | 3300002239 | JGI24034J26672_10000986 | JGI24034J26672_100009864 | 120 |
| 5 | 3300002244 | JGI24742J22300_10001987 | JGI24742J22300_100019874 | 120 |
| 6 | 3300003659 | JGI25404J52841_10005383 | JGI25404J52841_100053832 | 120 |
| 7 | 3300005327 | Ga0070658_10761878 | Ga0070658_107618782 | 120 |
| 8 | 3300005329 | Ga0070683_100021012 | Ga0070683_1000210122 | 120 |
| 9 | 3300005329 | Ga0070683_100021782 | Ga0070683_1000217827 | 120 |
| 10 | 3300005329 | Ga0070683_100030699 | Ga0070683_1000306994 | 120 |
| 11 | 3300005329 | Ga0070683_100051279 | Ga0070683_1000512793 | 120 |
| 12 | 3300005329 | Ga0070683_100481941 | Ga0070683_1004819412 | 120 |
| 13 | 3300005329 | Ga0070683_100710386 | Ga0070683_1007103862 | 120 |
| 14 | 3300005329 | Ga0070683_101635647 | Ga0070683_1016356471 | 120 |
| 15 | 3300005330 | Ga0070690_100217573 | Ga0070690_1002175732 | 120 |
| 16 | 3300005331 | Ga0070670_100249805 | Ga0070670_1002498052 | 120 |
| 17 | 3300005333 | Ga0070677_10000022 | Ga0070677_1000002219 | 120 |
| 18 | 3300005335 | Ga0070666_10000484 | Ga0070666_1000048415 | 120 |
| 19 | 3300005335 | Ga0070666_10381580 | Ga0070666_103815801 | 120 |
| 20 | 3300005336 | Ga0070680_100241753 | Ga0070680_1002417532 | 120 |
| 21 | 3300005337 | Ga0070682_100000099 | Ga0070682_100000099103 | 120 |
| 22 | 3300005337 | Ga0070682_100000150 | Ga0070682_10000015061 | 120 |
| 23 | 3300005337 | Ga0070682_100709049 | Ga0070682_1007090492 | 120 |
| 24 | 3300005338 | Ga0068868_100002756 | Ga0068868_1000027562 | 120 |
| 25 | 3300005338 | Ga0068868_100006916 | Ga0068868_1000069166 | 120 |
| 26 | 3300005339 | Ga0070660_100366173 | Ga0070660_1003661732 | 120 |
| 27 | 3300005340 | Ga0070689_100597270 | Ga0070689_1005972701 | 120 |
| 28 | 3300005341 | Ga0070691_10000032 | Ga0070691_1000003218 | 120 |
| 29 | 3300005341 | Ga0070691_10002218 | Ga0070691_100022182 | 120 |
| 30 | 3300005341 | Ga0070691_10391580 | Ga0070691_103915802 | 120 |
| 31 | 3300005343 | Ga0070687_100515363 | Ga0070687_1005153632 | 120 |
| 32 | 3300005344 | Ga0070661_100000102 | Ga0070661_1000001026 | 120 |
| 33 | 3300005347 | Ga0070668_100051947 | Ga0070668_1000519473 | 120 |
| 34 | 3300005347 | Ga0070668_100382805 | Ga0070668_1003828052 | 120 |
| 35 | 3300005353 | Ga0070669_101593969 | Ga0070669_1015939691 | 120 |
| 36 | 3300005354 | Ga0070675_100000027 | Ga0070675_10000002711 | 120 |
| 37 | 3300005356 | Ga0070674_100000056 | Ga0070674_10000005639 | 120 |
| 38 | 3300005356 | Ga0070674_100000088 | Ga0070674_10000008837 | 120 |
| 39 | 3300005356 | Ga0070674_100713104 | Ga0070674_1007131042 | 120 |
| 40 | 3300005364 | Ga0070673_100007829 | Ga0070673_1000078294 | 120 |
| 41 | 3300005365 | Ga0070688_100001250 | Ga0070688_1000012502 | 120 |
| 42 | 3300005365 | Ga0070688_100001531 | Ga0070688_10000153111 | 120 |
| 43 | 3300005365 | Ga0070688_100123262 | Ga0070688_1001232622 | 120 |
| 44 | 3300005366 | Ga0070659_100022916 | Ga0070659_1000229162 | 120 |
| 45 | 3300005366 | Ga0070659_100121688 | Ga0070659_1001216883 | 120 |
| 46 | 3300005367 | Ga0070667_100006153 | Ga0070667_1000061537 | 120 |
| 47 | 3300005367 | Ga0070667_100008220 | Ga0070667_1000082205 | 120 |
| 48 | 3300005367 | Ga0070667_100040138 | Ga0070667_1000401383 | 120 |
| 49 | 3300005367 | Ga0070667_100296404 | Ga0070667_1002964042 | 120 |
| 50 | 3300005367 | Ga0070667_101118584 | Ga0070667_1011185842 | 120 |
| 51 | 3300005406 | Ga0070703_10366030 | Ga0070703_103660301 | 120 |
| 52 | 3300005435 | Ga0070714_100087123 | Ga0070714_1000871232 | 120 |
| 53 | 3300005436 | Ga0070713_100000085 | Ga0070713_1000000852 | 120 |
| 54 | 3300005436 | Ga0070713_101720364 | Ga0070713_1017203642 | 120 |
| 55 | 3300005438 | Ga0070701_10467572 | Ga0070701_104675722 | 120 |
| 56 | 3300005439 | Ga0070711_100014274 | Ga0070711_1000142742 | 120 |
| 57 | 3300005439 | Ga0070711_100212262 | Ga0070711_1002122622 | 120 |
| 58 | 3300005441 | Ga0070700_100865574 | Ga0070700_1008655742 | 120 |
| 59 | 3300005441 | Ga0070700_100930908 | Ga0070700_1009309082 | 120 |
| 60 | 3300005455 | Ga0070663_100000073 | Ga0070663_10000007319 | 120 |
| 61 | 3300005455 | Ga0070663_100978723 | Ga0070663_1009787232 | 120 |
| 62 | 3300005456 | Ga0070678_100011801 | Ga0070678_1000118015 | 120 |
| 63 | 3300005456 | Ga0070678_100377494 | Ga0070678_1003774942 | 120 |
| 64 | 3300005457 | Ga0070662_100000004 | Ga0070662_100000004119 | 120 |
| 65 | 3300005457 | Ga0070662_100610838 | Ga0070662_1006108382 | 120 |
| 66 | 3300005458 | Ga0070681_10115322 | Ga0070681_101153221 | 120 |
| 67 | 3300005458 | Ga0070681_10134847 | Ga0070681_101348472 | 120 |
| 68 | 3300005459 | Ga0068867_100022123 | Ga0068867_1000221232 | 120 |
| 69 | 3300005466 | Ga0070685_10001410 | Ga0070685_100014102 | 120 |
| 70 | 3300005466 | Ga0070685_10001719 | Ga0070685_100017192 | 120 |
| 71 | 3300005466 | Ga0070685_10213984 | Ga0070685_102139842 | 120 |
| 72 | 3300005466 | Ga0070685_11283907 | Ga0070685_112839071 | 120 |
| 73 | 3300005530 | Ga0070679_100000240 | Ga0070679_10000024021 | 120 |
| 74 | 3300005530 | Ga0070679_100037654 | Ga0070679_1000376546 | 120 |
| 75 | 3300005535 | Ga0070684_100010674 | Ga0070684_1000106745 | 120 |
| 76 | 3300005535 | Ga0070684_100039844 | Ga0070684_1000398443 | 120 |
| 77 | 3300005535 | Ga0070684_100560496 | Ga0070684_1005604961 | 120 |
| 78 | 3300005535 | Ga0070684_100660511 | Ga0070684_1006605112 | 120 |
| 79 | 3300005535 | Ga0070684_101594046 | Ga0070684_1015940462 | 120 |
| 80 | 3300005535 | Ga0070684_102109346 | Ga0070684_1021093461 | 120 |
| 81 | 3300005539 | Ga0068853_100083884 | Ga0068853_1000838842 | 120 |
| 82 | 3300005539 | Ga0068853_100132587 | Ga0068853_1001325873 | 120 |
| 83 | 3300005539 | Ga0068853_100213494 | Ga0068853_1002134942 | 120 |
| 84 | 3300005539 | Ga0068853_100374102 | Ga0068853_1003741022 | 120 |
| 85 | 3300005543 | Ga0070672_100000293 | Ga0070672_1000002932 | 120 |
| 86 | 3300005544 | Ga0070686_100561225 | Ga0070686_1005612252 | 120 |
| 87 | 3300005545 | Ga0070695_100355542 | Ga0070695_1003555422 | 120 |
| 88 | 3300005546 | Ga0070696_100909370 | Ga0070696_1009093702 | 120 |
| 89 | 3300005547 | Ga0070693_101266764 | Ga0070693_1012667641 | 120 |
| 90 | 3300005548 | Ga0070665_100000106 | Ga0070665_10000010633 | 120 |
| 91 | 3300005548 | Ga0070665_100001435 | Ga0070665_1000014352 | 120 |
| 92 | 3300005548 | Ga0070665_100012149 | Ga0070665_1000121496 | 120 |
| 93 | 3300005548 | Ga0070665_100017889 | Ga0070665_1000178893 | 120 |
| 94 | 3300005548 | Ga0070665_100048627 | Ga0070665_1000486272 | 120 |
| 95 | 3300005548 | Ga0070665_100139966 | Ga0070665_1001399663 | 120 |
| 96 | 3300005548 | Ga0070665_100299609 | Ga0070665_1002996092 | 120 |
| 97 | 3300005548 | Ga0070665_101626686 | Ga0070665_1016266861 | 120 |
| 98 | 3300005549 | Ga0070704_100333123 | Ga0070704_1003331232 | 120 |
| 99 | 3300005563 | Ga0068855_100242003 | Ga0068855_1002420033 | 120 |
| 100 | 3300005563 | Ga0068855_100473624 | Ga0068855_1004736242 | 120 |
| 101 | 3300005564 | Ga0070664_100025344 | Ga0070664_1000253442 | 120 |
| 102 | 3300005577 | Ga0068857_100192498 | Ga0068857_1001924982 | 120 |
| 103 | 3300005577 | Ga0068857_101622644 | Ga0068857_1016226441 | 120 |
| 104 | 3300005578 | Ga0068854_100000095 | Ga0068854_10000009549 | 120 |
| 105 | 3300005578 | Ga0068854_100022643 | Ga0068854_1000226434 | 120 |
| 106 | 3300005614 | Ga0068856_100008468 | Ga0068856_10000846812 | 120 |
| 107 | 3300005614 | Ga0068856_100026367 | Ga0068856_1000263673 | 120 |
| 108 | 3300005614 | Ga0068856_100076878 | Ga0068856_1000768782 | 120 |
| 109 | 3300005614 | Ga0068856_100320326 | Ga0068856_1003203262 | 120 |
| 110 | 3300005614 | Ga0068856_100509791 | Ga0068856_1005097912 | 120 |
| 111 | 3300005614 | Ga0068856_100851510 | Ga0068856_1008515101 | 120 |
| 112 | 3300005615 | Ga0070702_100087262 | Ga0070702_1000872622 | 120 |
| 113 | 3300005616 | Ga0068852_100000006 | Ga0068852_100000006158 | 120 |
| 114 | 3300005616 | Ga0068852_101705344 | Ga0068852_1017053442 | 120 |
| 115 | 3300005617 | Ga0068859_100549800 | Ga0068859_1005498002 | 120 |
| 116 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001404 | 120 |
| 117 | 3300005718 | Ga0068866_10000273 | Ga0068866_100002735 | 120 |
| 118 | 3300005718 | Ga0068866_10530918 | Ga0068866_105309182 | 120 |
| 119 | 3300005719 | Ga0068861_100149280 | Ga0068861_1001492803 | 120 |
| 120 | 3300005719 | Ga0068861_100673012 | Ga0068861_1006730122 | 120 |
| 121 | 3300005719 | Ga0068861_102404766 | Ga0068861_1024047662 | 120 |
| 122 | 3300005834 | Ga0068851_10003531 | Ga0068851_100035315 | 120 |
| 123 | 3300005834 | Ga0068851_10029447 | Ga0068851_100294473 | 120 |
| 124 | 3300005840 | Ga0068870_10319764 | Ga0068870_103197642 | 120 |
| 125 | 3300005841 | Ga0068863_100000342 | Ga0068863_10000034259 | 120 |
| 126 | 3300005841 | Ga0068863_100039183 | Ga0068863_1000391836 | 120 |
| 127 | 3300005841 | Ga0068863_100380143 | Ga0068863_1003801431 | 120 |
| 128 | 3300005841 | Ga0068863_101010368 | Ga0068863_1010103682 | 120 |
| 129 | 3300005841 | Ga0068863_101165486 | Ga0068863_1011654861 | 120 |
| 130 | 3300005842 | Ga0068858_100000009 | Ga0068858_100000009188 | 120 |
| 131 | 3300005842 | Ga0068858_100000091 | Ga0068858_10000009187 | 120 |
| 132 | 3300005842 | Ga0068858_100097996 | Ga0068858_1000979963 | 120 |
| 133 | 3300005842 | Ga0068858_102318158 | Ga0068858_1023181581 | 120 |
| 134 | 3300005842 | Ga0068858_102552791 | Ga0068858_1025527911 | 120 |
| 135 | 3300005843 | Ga0068860_100008191 | Ga0068860_1000081915 | 120 |
| 136 | 3300005843 | Ga0068860_101338975 | Ga0068860_1013389752 | 120 |
| 137 | 3300005843 | Ga0068860_101558293 | Ga0068860_1015582932 | 120 |
| 138 | 3300005844 | Ga0068862_100000050 | Ga0068862_100000050130 | 120 |
| 139 | 3300005937 | Ga0081455_10012787 | Ga0081455_100127874 | 120 |
| 140 | 3300005937 | Ga0081455_10056374 | Ga0081455_100563742 | 120 |
| 141 | 3300005983 | Ga0081540_1000049 | Ga0081540_100004925 | 120 |
| 142 | 3300005985 | Ga0081539_10001097 | Ga0081539_1000109738 | 120 |
| 143 | 3300006038 | Ga0075365_11049057 | Ga0075365_110490571 | 120 |
| 144 | 3300006038 | Ga0075365_11225240 | Ga0075365_112252402 | 120 |
| 145 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001372 | 120 |
| 146 | 3300006173 | Ga0070716_100446457 | Ga0070716_1004464572 | 120 |
| 147 | 3300006175 | Ga0070712_100512501 | Ga0070712_1005125012 | 120 |
| 148 | 3300006175 | Ga0070712_101842455 | Ga0070712_1018424552 | 120 |
| 149 | 3300006237 | Ga0097621_100195886 | Ga0097621_1001958862 | 120 |
| 150 | 3300006237 | Ga0097621_100792550 | Ga0097621_1007925502 | 120 |
| 151 | 3300006358 | Ga0068871_100421524 | Ga0068871_1004215242 | 120 |
| 152 | 3300006846 | Ga0075430_100128424 | Ga0075430_1001284242 | 120 |
| 153 | 3300006852 | Ga0075433_10002122 | Ga0075433_1000212211 | 120 |
| 154 | 3300006852 | Ga0075433_10042449 | Ga0075433_100424492 | 120 |
| 155 | 3300006881 | Ga0068865_100000023 | Ga0068865_100000023104 | 120 |
| 156 | 3300006881 | Ga0068865_100590369 | Ga0068865_1005903691 | 120 |
| 157 | 3300006931 | Ga0097620_100549774 | Ga0097620_1005497742 | 120 |
| 158 | 3300007076 | Ga0075435_100198052 | Ga0075435_1001980522 | 120 |
| 159 | 3300009092 | Ga0105250_10121649 | Ga0105250_101216492 | 120 |
| 160 | 3300009093 | Ga0105240_10514333 | Ga0105240_105143332 | 120 |
| 161 | 3300009093 | Ga0105240_10653056 | Ga0105240_106530562 | 120 |
| 162 | 3300009093 | Ga0105240_10808036 | Ga0105240_108080362 | 120 |
| 163 | 3300009093 | Ga0105240_12283716 | Ga0105240_122837161 | 120 |
| 164 | 3300009094 | Ga0111539_12512243 | Ga0111539_125122431 | 120 |
| 165 | 3300009098 | Ga0105245_10000266 | Ga0105245_100002665 | 120 |
| 166 | 3300009098 | Ga0105245_10001339 | Ga0105245_100013393 | 120 |
| 167 | 3300009098 | Ga0105245_10095693 | Ga0105245_100956932 | 120 |
| 168 | 3300009098 | Ga0105245_10251557 | Ga0105245_102515572 | 120 |
| 169 | 3300009098 | Ga0105245_12572472 | Ga0105245_125724721 | 120 |
| 170 | 3300009101 | Ga0105247_10000316 | Ga0105247_1000031647 | 120 |
| 171 | 3300009101 | Ga0105247_10004636 | Ga0105247_100046362 | 120 |
| 172 | 3300009101 | Ga0105247_10229738 | Ga0105247_102297382 | 120 |
| 173 | 3300009101 | Ga0105247_10589126 | Ga0105247_105891262 | 120 |
| 174 | 3300009101 | Ga0105247_10929424 | Ga0105247_109294241 | 120 |
| 175 | 3300009101 | Ga0105247_11003398 | Ga0105247_110033981 | 120 |
| 176 | 3300009148 | Ga0105243_10003688 | Ga0105243_1000368810 | 120 |
| 177 | 3300009148 | Ga0105243_11191724 | Ga0105243_111917241 | 120 |
| 178 | 3300009148 | Ga0105243_11579662 | Ga0105243_115796621 | 120 |
| 179 | 3300009174 | Ga0105241_10471481 | Ga0105241_104714812 | 120 |
| 180 | 3300009174 | Ga0105241_10799124 | Ga0105241_107991242 | 120 |
| 181 | 3300009176 | Ga0105242_10000032 | Ga0105242_1000003263 | 120 |
| 182 | 3300009176 | Ga0105242_10000454 | Ga0105242_1000045424 | 120 |
| 183 | 3300009176 | Ga0105242_10011362 | Ga0105242_100113626 | 120 |
| 184 | 3300009176 | Ga0105242_10118359 | Ga0105242_101183592 | 120 |
| 185 | 3300009176 | Ga0105242_10379023 | Ga0105242_103790232 | 120 |
| 186 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008317 | 120 |
| 187 | 3300009177 | Ga0105248_11648337 | Ga0105248_116483372 | 120 |
| 188 | 3300009177 | Ga0105248_12733215 | Ga0105248_127332151 | 120 |
| 189 | 3300009545 | Ga0105237_10310600 | Ga0105237_103106002 | 120 |
| 190 | 3300009545 | Ga0105237_10373385 | Ga0105237_103733852 | 120 |
| 191 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011203 | 120 |
| 192 | 3300009551 | Ga0105238_11280917 | Ga0105238_112809172 | 120 |
| 193 | 3300009553 | Ga0105249_10000080 | Ga0105249_1000008020 | 120 |
| 194 | 3300009553 | Ga0105249_11467432 | Ga0105249_114674322 | 120 |
| 195 | 3300010375 | Ga0105239_10474610 | Ga0105239_104746102 | 120 |
| 196 | 3300010375 | Ga0105239_10551321 | Ga0105239_105513212 | 120 |
| 197 | 3300010375 | Ga0105239_12188673 | Ga0105239_121886732 | 120 |
| 198 | 3300010375 | Ga0105239_12427357 | Ga0105239_124273572 | 120 |
| 199 | 3300011119 | Ga0105246_10812260 | Ga0105246_108122602 | 120 |
| 200 | 3300011119 | Ga0105246_11311961 | Ga0105246_113119611 | 120 |
| 201 | 3300013102 | Ga0157371_10004749 | Ga0157371_100047492 | 120 |
| 202 | 3300013104 | Ga0157370_10059766 | Ga0157370_100597663 | 120 |
| 203 | 3300013104 | Ga0157370_10062901 | Ga0157370_100629013 | 120 |
| 204 | 3300013104 | Ga0157370_10078808 | Ga0157370_100788083 | 120 |
| 205 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020201 | 120 |
| 206 | 3300013296 | Ga0157374_10057293 | Ga0157374_100572934 | 120 |
| 207 | 3300013296 | Ga0157374_10195547 | Ga0157374_101955474 | 120 |
| 208 | 3300013296 | Ga0157374_11439274 | Ga0157374_114392741 | 120 |
| 209 | 3300013296 | Ga0157374_12009386 | Ga0157374_120093862 | 120 |
| 210 | 3300013297 | Ga0157378_10009985 | Ga0157378_100099853 | 120 |
| 211 | 3300013297 | Ga0157378_10127991 | Ga0157378_101279911 | 120 |
| 212 | 3300013297 | Ga0157378_10136142 | Ga0157378_101361422 | 120 |
| 213 | 3300013306 | Ga0163162_12398389 | Ga0163162_123983891 | 120 |
| 214 | 3300013306 | Ga0163162_12536887 | Ga0163162_125368872 | 120 |
| 215 | 3300013307 | Ga0157372_10000112 | Ga0157372_1000011259 | 120 |
| 216 | 3300013307 | Ga0157372_10314251 | Ga0157372_103142512 | 120 |
| 217 | 3300013308 | Ga0157375_10048495 | Ga0157375_100484952 | 120 |
| 218 | 3300013308 | Ga0157375_10050351 | Ga0157375_100503512 | 120 |
| 219 | 3300013308 | Ga0157375_10956266 | Ga0157375_109562662 | 120 |
| 220 | 3300013308 | Ga0157375_11117495 | Ga0157375_111174951 | 120 |
| 221 | 3300013308 | Ga0157375_11507555 | Ga0157375_115075552 | 120 |
| 222 | 3300013308 | Ga0157375_12056879 | Ga0157375_120568792 | 120 |
| 223 | 3300013308 | Ga0157375_12525181 | Ga0157375_125251811 | 120 |
| 224 | 3300014325 | Ga0163163_10092414 | Ga0163163_100924144 | 120 |
| 225 | 3300014325 | Ga0163163_10706151 | Ga0163163_107061512 | 120 |
| 226 | 3300014325 | Ga0163163_11388125 | Ga0163163_113881251 | 120 |
| 227 | 3300014325 | Ga0163163_11919745 | Ga0163163_119197452 | 120 |
| 228 | 3300014325 | Ga0163163_12464328 | Ga0163163_124643282 | 120 |
| 229 | 3300014326 | Ga0157380_10000091 | Ga0157380_1000009136 | 120 |
| 230 | 3300014326 | Ga0157380_10000253 | Ga0157380_1000025327 | 120 |
| 231 | 3300014326 | Ga0157380_10447944 | Ga0157380_104479442 | 120 |
| 232 | 3300014326 | Ga0157380_10494203 | Ga0157380_104942032 | 120 |
| 233 | 3300014968 | Ga0157379_10035232 | Ga0157379_100352322 | 120 |
| 234 | 3300014968 | Ga0157379_10234529 | Ga0157379_102345292 | 120 |
| 235 | 3300014968 | Ga0157379_10261552 | Ga0157379_102615522 | 120 |
| 236 | 3300014969 | Ga0157376_10185540 | Ga0157376_101855402 | 120 |
| 237 | 3300014969 | Ga0157376_11584587 | Ga0157376_115845872 | 120 |
| 238 | 3300017792 | Ga0163161_10006589 | Ga0163161_100065892 | 120 |
| 239 | 3300017792 | Ga0163161_10093270 | Ga0163161_100932702 | 120 |
| 240 | 3300017792 | Ga0163161_10501705 | Ga0163161_105017052 | 120 |
| 241 | 3300020069 | Ga0197907_10064860 | Ga0197907_100648602 | 120 |
| 242 | 3300020070 | Ga0206356_11109912 | Ga0206356_111099122 | 120 |
| 243 | 3300020076 | Ga0206355_1070519 | Ga0206355_10705191 | 120 |
| 244 | 3300020077 | Ga0206351_10019693 | Ga0206351_100196931 | 120 |
| 245 | 3300020081 | Ga0206354_10838957 | Ga0206354_108389571 | 120 |
| 246 | 3300022467 | Ga0224712_10055809 | Ga0224712_100558092 | 120 |
| 247 | 3300025321 | Ga0207656_10018770 | Ga0207656_100187702 | 120 |
| 248 | 3300025321 | Ga0207656_10020609 | Ga0207656_100206092 | 120 |
| 249 | 3300025885 | Ga0207653_10188232 | Ga0207653_101882322 | 120 |
| 250 | 3300025893 | Ga0207682_10000005 | Ga0207682_1000000528 | 120 |
| 251 | 3300025898 | Ga0207692_10181807 | Ga0207692_101818072 | 120 |
| 252 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002123 | 120 |
| 253 | 3300025899 | Ga0207642_10001004 | Ga0207642_100010045 | 120 |
| 254 | 3300025899 | Ga0207642_10601508 | Ga0207642_106015082 | 120 |
| 255 | 3300025900 | Ga0207710_10000239 | Ga0207710_100002392 | 120 |
| 256 | 3300025900 | Ga0207710_10000458 | Ga0207710_1000045827 | 120 |
| 257 | 3300025900 | Ga0207710_10489544 | Ga0207710_104895441 | 120 |
| 258 | 3300025900 | Ga0207710_10713207 | Ga0207710_107132071 | 120 |
| 259 | 3300025903 | Ga0207680_10000901 | Ga0207680_100009012 | 120 |
| 260 | 3300025903 | Ga0207680_10009305 | Ga0207680_100093052 | 120 |
| 261 | 3300025905 | Ga0207685_10000027 | Ga0207685_1000002764 | 120 |
| 262 | 3300025911 | Ga0207654_10423534 | Ga0207654_104235342 | 120 |
| 263 | 3300025911 | Ga0207654_10858427 | Ga0207654_108584271 | 120 |
| 264 | 3300025912 | Ga0207707_10107414 | Ga0207707_101074142 | 120 |
| 265 | 3300025912 | Ga0207707_10218263 | Ga0207707_102182631 | 120 |
| 266 | 3300025913 | Ga0207695_10542437 | Ga0207695_105424372 | 120 |
| 267 | 3300025913 | Ga0207695_10674534 | Ga0207695_106745342 | 120 |
| 268 | 3300025914 | Ga0207671_10542704 | Ga0207671_105427042 | 120 |
| 269 | 3300025915 | Ga0207693_10478532 | Ga0207693_104785322 | 120 |
| 270 | 3300025916 | Ga0207663_10001546 | Ga0207663_100015468 | 120 |
| 271 | 3300025916 | Ga0207663_10034771 | Ga0207663_100347712 | 120 |
| 272 | 3300025917 | Ga0207660_10021949 | Ga0207660_100219492 | 120 |
| 273 | 3300025918 | Ga0207662_10529436 | Ga0207662_105294362 | 120 |
| 274 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009246 | 120 |
| 275 | 3300025921 | Ga0207652_10000044 | Ga0207652_1000004472 | 120 |
| 276 | 3300025921 | Ga0207652_10005697 | Ga0207652_100056972 | 120 |
| 277 | 3300025923 | Ga0207681_10244121 | Ga0207681_102441212 | 120 |
| 278 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004419 | 120 |
| 279 | 3300025925 | Ga0207650_10110064 | Ga0207650_101100642 | 120 |
| 280 | 3300025925 | Ga0207650_10608849 | Ga0207650_106088491 | 120 |
| 281 | 3300025926 | Ga0207659_10000010 | Ga0207659_1000001088 | 120 |
| 282 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007423 | 120 |
| 283 | 3300025927 | Ga0207687_10000013 | Ga0207687_1000001341 | 120 |
| 284 | 3300025927 | Ga0207687_10057875 | Ga0207687_100578752 | 120 |
| 285 | 3300025927 | Ga0207687_10205045 | Ga0207687_102050452 | 120 |
| 286 | 3300025928 | Ga0207700_10000027 | Ga0207700_1000002764 | 120 |
| 287 | 3300025928 | Ga0207700_10014365 | Ga0207700_100143654 | 120 |
| 288 | 3300025929 | Ga0207664_10075635 | Ga0207664_100756352 | 120 |
| 289 | 3300025931 | Ga0207644_10745221 | Ga0207644_107452212 | 120 |
| 290 | 3300025932 | Ga0207690_10008293 | Ga0207690_100082936 | 120 |
| 291 | 3300025932 | Ga0207690_10021044 | Ga0207690_100210443 | 120 |
| 292 | 3300025933 | Ga0207706_10000012 | Ga0207706_1000001299 | 120 |
| 293 | 3300025933 | Ga0207706_10541814 | Ga0207706_105418142 | 120 |
| 294 | 3300025934 | Ga0207686_10000048 | Ga0207686_1000004863 | 120 |
| 295 | 3300025934 | Ga0207686_10000886 | Ga0207686_100008865 | 120 |
| 296 | 3300025934 | Ga0207686_10021381 | Ga0207686_100213812 | 120 |
| 297 | 3300025934 | Ga0207686_10060538 | Ga0207686_100605382 | 120 |
| 298 | 3300025935 | Ga0207709_10013651 | Ga0207709_100136512 | 120 |
| 299 | 3300025935 | Ga0207709_10627844 | Ga0207709_106278442 | 120 |
| 300 | 3300025936 | Ga0207670_10254855 | Ga0207670_102548552 | 120 |
| 301 | 3300025937 | Ga0207669_10000018 | Ga0207669_1000001823 | 120 |
| 302 | 3300025937 | Ga0207669_10000090 | Ga0207669_1000009023 | 120 |
| 303 | 3300025938 | Ga0207704_10000159 | Ga0207704_100001596 | 120 |
| 304 | 3300025938 | Ga0207704_10088099 | Ga0207704_100880992 | 120 |
| 305 | 3300025939 | Ga0207665_10467204 | Ga0207665_104672042 | 120 |
| 306 | 3300025940 | Ga0207691_10000044 | Ga0207691_1000004425 | 120 |
| 307 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006711 | 120 |
| 308 | 3300025944 | Ga0207661_10000139 | Ga0207661_1000013933 | 120 |
| 309 | 3300025944 | Ga0207661_10003835 | Ga0207661_100038353 | 120 |
| 310 | 3300025944 | Ga0207661_10005409 | Ga0207661_100054094 | 120 |
| 311 | 3300025944 | Ga0207661_10042501 | Ga0207661_100425012 | 120 |
| 312 | 3300025944 | Ga0207661_10393836 | Ga0207661_103938362 | 120 |
| 313 | 3300025944 | Ga0207661_10487831 | Ga0207661_104878312 | 120 |
| 314 | 3300025945 | Ga0207679_10029433 | Ga0207679_100294335 | 120 |
| 315 | 3300025945 | Ga0207679_10106187 | Ga0207679_101061872 | 120 |
| 316 | 3300025949 | Ga0207667_10732922 | Ga0207667_107329222 | 120 |
| 317 | 3300025960 | Ga0207651_10030338 | Ga0207651_100303383 | 120 |
| 318 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007414 | 120 |
| 319 | 3300025972 | Ga0207668_10014280 | Ga0207668_100142805 | 120 |
| 320 | 3300025972 | Ga0207668_10159363 | Ga0207668_101593632 | 120 |
| 321 | 3300025981 | Ga0207640_10000038 | Ga0207640_1000003864 | 120 |
| 322 | 3300025981 | Ga0207640_10291704 | Ga0207640_102917042 | 120 |
| 323 | 3300025986 | Ga0207658_10003939 | Ga0207658_100039398 | 120 |
| 324 | 3300025986 | Ga0207658_10016682 | Ga0207658_100166824 | 120 |
| 325 | 3300025986 | Ga0207658_10131195 | Ga0207658_101311952 | 120 |
| 326 | 3300025986 | Ga0207658_10142777 | Ga0207658_101427772 | 120 |
| 327 | 3300025986 | Ga0207658_11530894 | Ga0207658_115308942 | 120 |
| 328 | 3300026023 | Ga0207677_10000340 | Ga0207677_100003406 | 120 |
| 329 | 3300026023 | Ga0207677_10001552 | Ga0207677_1000155212 | 120 |
| 330 | 3300026035 | Ga0207703_10000023 | Ga0207703_1000002395 | 120 |
| 331 | 3300026035 | Ga0207703_10002246 | Ga0207703_100022462 | 120 |
| 332 | 3300026041 | Ga0207639_10011326 | Ga0207639_100113267 | 120 |
| 333 | 3300026041 | Ga0207639_10130284 | Ga0207639_101302842 | 120 |
| 334 | 3300026041 | Ga0207639_10344683 | Ga0207639_103446832 | 120 |
| 335 | 3300026041 | Ga0207639_10590816 | Ga0207639_105908162 | 120 |
| 336 | 3300026067 | Ga0207678_10000380 | Ga0207678_1000038022 | 120 |
| 337 | 3300026067 | Ga0207678_10121551 | Ga0207678_101215513 | 120 |
| 338 | 3300026075 | Ga0207708_10117292 | Ga0207708_101172923 | 120 |
| 339 | 3300026078 | Ga0207702_10000158 | Ga0207702_1000015888 | 120 |
| 340 | 3300026078 | Ga0207702_10004391 | Ga0207702_100043915 | 120 |
| 341 | 3300026078 | Ga0207702_10020350 | Ga0207702_100203502 | 120 |
| 342 | 3300026078 | Ga0207702_10604786 | Ga0207702_106047862 | 120 |
| 343 | 3300026078 | Ga0207702_10715601 | Ga0207702_107156012 | 120 |
| 344 | 3300026078 | Ga0207702_10736633 | Ga0207702_107366332 | 120 |
| 345 | 3300026088 | Ga0207641_10003753 | Ga0207641_100037535 | 120 |
| 346 | 3300026088 | Ga0207641_10009107 | Ga0207641_100091076 | 120 |
| 347 | 3300026088 | Ga0207641_10466447 | Ga0207641_104664471 | 120 |
| 348 | 3300026088 | Ga0207641_12239744 | Ga0207641_122397441 | 120 |
| 349 | 3300026089 | Ga0207648_10045789 | Ga0207648_100457896 | 120 |
| 350 | 3300026095 | Ga0207676_10000094 | Ga0207676_100000942 | 120 |
| 351 | 3300026116 | Ga0207674_10056052 | Ga0207674_100560522 | 120 |
| 352 | 3300026116 | Ga0207674_11584883 | Ga0207674_115848832 | 120 |
| 353 | 3300026118 | Ga0207675_100324416 | Ga0207675_1003244161 | 120 |
| 354 | 3300026118 | Ga0207675_100330783 | Ga0207675_1003307831 | 120 |
| 355 | 3300026118 | Ga0207675_102636644 | Ga0207675_1026366441 | 120 |
| 356 | 3300026121 | Ga0207683_10103707 | Ga0207683_101037073 | 120 |
| 357 | 3300026121 | Ga0207683_10329652 | Ga0207683_103296522 | 120 |
| 358 | 3300026121 | Ga0207683_11141100 | Ga0207683_111411002 | 120 |
| 359 | 3300026142 | Ga0207698_10000013 | Ga0207698_1000001331 | 120 |
| 360 | 3300026142 | Ga0207698_10341848 | Ga0207698_103418481 | 120 |
| 361 | 3300026142 | Ga0207698_12450568 | Ga0207698_124505681 | 120 |
| 362 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047185 | 120 |
| 363 | 3300028379 | Ga0268266_10000640 | Ga0268266_1000064033 | 120 |
| 364 | 3300028379 | Ga0268266_10000822 | Ga0268266_1000082236 | 120 |
| 365 | 3300028379 | Ga0268266_10023216 | Ga0268266_100232163 | 120 |
| 366 | 3300028379 | Ga0268266_10052672 | Ga0268266_100526722 | 120 |
| 367 | 3300028379 | Ga0268266_10553470 | Ga0268266_105534701 | 120 |
| 368 | 3300028379 | Ga0268266_11141332 | Ga0268266_111413322 | 120 |
| 369 | 3300028380 | Ga0268265_10001568 | Ga0268265_100015684 | 120 |
| 370 | 3300028381 | Ga0268264_10033939 | Ga0268264_100339393 | 120 |
| 371 | 3300028381 | Ga0268264_10246537 | Ga0268264_102465373 | 120 |
| 372 | 3300028381 | Ga0268264_11079643 | Ga0268264_110796432 | 120 |
| 373 | 3300028381 | Ga0268264_11285526 | Ga0268264_112855262 | 120 |
| 374 | 3300028556 | Ga0265337_1000991 | Ga0265337_10009914 | 120 |
| 375 | 3300028558 | Ga0265326_10000252 | Ga0265326_1000025226 | 120 |
| 376 | 3300028563 | Ga0265319_1000020 | Ga0265319_1000020175 | 120 |
| 377 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001358 | 120 |
| 378 | 3300028666 | Ga0265336_10020027 | Ga0265336_100200273 | 120 |
| 379 | 3300028666 | Ga0265336_10064914 | Ga0265336_100649143 | 120 |
| 380 | 3300028800 | Ga0265338_10001248 | Ga0265338_1000124838 | 120 |
| 381 | 3300028800 | Ga0265338_10079027 | Ga0265338_100790271 | 120 |
| 382 | 3300028800 | Ga0265338_10706771 | Ga0265338_107067712 | 120 |
| 383 | 3300029957 | Ga0265324_10000498 | Ga0265324_1000049816 | 120 |
| 384 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002357 | 120 |
| 385 | 3300031241 | Ga0265325_10006673 | Ga0265325_100066738 | 120 |
| 386 | 3300031242 | Ga0265329_10032012 | Ga0265329_100320122 | 120 |
| 387 | 3300031250 | Ga0265331_10011308 | Ga0265331_100113084 | 120 |
| 388 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011357 | 120 |
| 389 | 3300031344 | Ga0265316_10014310 | Ga0265316_100143102 | 120 |
| 390 | 3300031456 | Ga0307513_10586254 | Ga0307513_105862542 | 120 |
| 391 | 3300031595 | Ga0265313_10066563 | Ga0265313_100665632 | 120 |
| 392 | 3300031711 | Ga0265314_10000062 | Ga0265314_1000006291 | 120 |
| 393 | 3300031712 | Ga0265342_10068642 | Ga0265342_100686423 | 120 |
| 394 | 3300032126 | Ga0307415_100028982 | Ga0307415_1000289824 | 120 |
| 395 | 3300035117 | Ga0373953_0185083 | Ga0373953_0185083_485_850 | 120 |
| 396 | 3300035172 | Ga0373955_0190629 | Ga0373955_0190629_120_485 | 120 |
| 397 | 3300035172 | Ga0373955_0773905 | Ga0373955_0773905_10_372 | 120 |
| 398 | 3300035725 | Ga0373947_0620104 | Ga0373947_0620104_221_583 | 120 |
| 399 | 3300036401 | Ga0373937_0102350 | Ga0373937_0102350_1257_1619 | 120 |
| 400 | 3300036401 | Ga0373937_1028551 | Ga0373937_1028551_286_648 | 120 |
| 401 | 3300041451 | Ga0451791_1087388 | Ga0451791_1087388_256_618 | 120 |
| 402 | 3300041456 | Ga0451795_1612883 | Ga0451795_1612883_98_460 | 120 |
| 403 | 3300041459 | Ga0451800_0223856 | Ga0451800_0223856_341_703 | 120 |
| 404 | 3300041459 | Ga0451800_1612225 | Ga0451800_1612225_67_429 | 120 |
| 405 | 3300041463 | Ga0451804_0761410 | Ga0451804_0761410_44_406 | 120 |
| 406 | 3300041463 | Ga0451804_1169606 | Ga0451804_1169606_140_502 | 120 |
| 407 | 3300041486 | Ga0451807_1367491 | Ga0451807_1367491_20_382 | 120 |
| 408 | 3300041491 | Ga0451833_0147399 | Ga0451833_0147399_341_703 | 120 |
| 409 | 3300041494 | Ga0451837_1335073 | Ga0451837_1335073_100_462 | 120 |
| 410 | 3300041501 | Ga0451845_0187233 | Ga0451845_0187233_47_409 | 120 |
| 411 | 3300041501 | Ga0451845_0826631 | Ga0451845_0826631_203_568 | 120 |
| 412 | 3300041505 | Ga0451849_0181530 | Ga0451849_0181530_64_426 | 120 |
| 413 | 3300041505 | Ga0451849_1137119 | Ga0451849_1137119_43_405 | 120 |
| 414 | 3300041512 | Ga0451853_3872250 | Ga0451853_3872250_379_741 | 120 |
| 415 | 3300044694 | Ga0466963_0000153 | Ga0466963_0000153_24396_24758 | 120 |
| 416 | 3300044694 | Ga0466963_0351274 | Ga0466963_0351274_193_555 | 120 |
| 417 | 3300044694 | Ga0466963_0822093 | Ga0466963_0822093_234_596 | 120 |
| 418 | 3300044842 | Ga0466957_0009471 | Ga0466957_0009471_4458_4820 | 120 |
| 419 | 3300044842 | Ga0466957_0305307 | Ga0466957_0305307_660_1022 | 120 |
| 420 | 3300044901 | Ga0466960_0075911 | Ga0466960_0075911_324_686 | 120 |
| 421 | 3300045976 | Ga0466967_0000009 | Ga0466967_0000009_71306_71668 | 120 |
| 422 | 3300045976 | Ga0466967_0046018 | Ga0466967_0046018_1700_2062 | 120 |
| 423 | 3300045976 | Ga0466967_0325174 | Ga0466967_0325174_398_766 | 120 |
| 424 | 3300045976 | Ga0466967_0749777 | Ga0466967_0749777_387_749 | 120 |
| 425 | 3300046454 | Ga0495592_0001452 | Ga0495592_0001452_2646_3008 | 120 |
| 426 | 3300046454 | Ga0495592_0118102 | Ga0495592_0118102_227_589 | 120 |
| 427 | 3300046454 | Ga0495592_0230867 | Ga0495592_0230867_347_709 | 120 |
| 428 | 3300046454 | Ga0495592_0318931 | Ga0495592_0318931_552_914 | 120 |
| 429 | 3300046454 | Ga0495592_0346556 | Ga0495592_0346556_392_754 | 120 |
| 430 | 3300046454 | Ga0495592_0433798 | Ga0495592_0433798_260_622 | 120 |
| 431 | 3300046455 | Ga0495603_0000016 | Ga0495603_0000016_7851_8213 | 120 |
| 432 | 3300046455 | Ga0495603_0002944 | Ga0495603_0002944_1558_1920 | 120 |
| 433 | 3300046455 | Ga0495603_0203251 | Ga0495603_0203251_650_1012 | 120 |
| 434 | 3300046459 | Ga0495629_0001726 | Ga0495629_0001726_2156_2518 | 120 |
| 435 | 3300046459 | Ga0495629_0091023 | Ga0495629_0091023_917_1279 | 120 |
| 436 | 3300046459 | Ga0495629_0439386 | Ga0495629_0439386_367_729 | 120 |
| 437 | 3300046460 | Ga0495638_0033754 | Ga0495638_0033754_1701_2063 | 120 |
| 438 | 3300046461 | Ga0495641_0000228 | Ga0495641_0000228_299_661 | 120 |
| 439 | 3300046461 | Ga0495641_0026299 | Ga0495641_0026299_1843_2205 | 120 |
| 440 | 3300046461 | Ga0495641_0026720 | Ga0495641_0026720_1950_2312 | 120 |
| 441 | 3300046462 | Ga0495651_0033572 | Ga0495651_0033572_3451_3813 | 120 |
| 442 | 3300046463 | Ga0495653_0103472 | Ga0495653_0103472_1525_1887 | 120 |
| 443 | 3300046463 | Ga0495653_0195977 | Ga0495653_0195977_596_958 | 120 |
| 444 | 3300046463 | Ga0495653_0376533 | Ga0495653_0376533_522_884 | 120 |
| 445 | 3300046463 | Ga0495653_0530752 | Ga0495653_0530752_270_635 | 120 |
| 446 | 3300046463 | Ga0495653_0743304 | Ga0495653_0743304_149_514 | 120 |
| 447 | 3300046473 | Ga0495582_0000081 | Ga0495582_0000081_30156_30518 | 120 |
| 448 | 3300046476 | Ga0495662_0000019 | Ga0495662_0000019_40328_40690 | 120 |
| 449 | 3300046476 | Ga0495662_0007799 | Ga0495662_0007799_2766_3128 | 120 |
| 450 | 3300046477 | Ga0495664_0500003 | Ga0495664_0500003_198_563 | 120 |
| 451 | 3300046499 | Ga0495594_0000912 | Ga0495594_0000912_14697_15059 | 120 |
| 452 | 3300046499 | Ga0495594_0230073 | Ga0495594_0230073_296_658 | 120 |
| 453 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_2148_2510 | 120 |
| 454 | 3300046511 | Ga0495608_0000125 | Ga0495608_0000125_40179_40541 | 120 |
| 455 | 3300046511 | Ga0495608_0036028 | Ga0495608_0036028_1044_1406 | 120 |
| 456 | 3300046511 | Ga0495608_0050149 | Ga0495608_0050149_846_1208 | 120 |
| 457 | 3300046512 | Ga0495610_0067229 | Ga0495610_0067229_195_557 | 120 |
| 458 | 3300046514 | Ga0495618_0008119 | Ga0495618_0008119_316_678 | 120 |
| 459 | 3300046515 | Ga0495620_0000824 | Ga0495620_0000824_934_1296 | 120 |
| 460 | 3300046516 | Ga0495628_0000190 | Ga0495628_0000190_25570_25932 | 120 |
| 461 | 3300046516 | Ga0495628_0026801 | Ga0495628_0026801_204_566 | 120 |
| 462 | 3300046516 | Ga0495628_0083739 | Ga0495628_0083739_1935_2300 | 120 |
| 463 | 3300046516 | Ga0495628_0118617 | Ga0495628_0118617_1486_1848 | 120 |
| 464 | 3300046517 | Ga0495630_0000020 | Ga0495630_0000020_41219_41581 | 120 |
| 465 | 3300046517 | Ga0495630_0038804 | Ga0495630_0038804_740_1102 | 120 |
| 466 | 3300046517 | Ga0495630_0104160 | Ga0495630_0104160_180_542 | 120 |
| 467 | 3300046517 | Ga0495630_0325892 | Ga0495630_0325892_151_513 | 120 |
| 468 | 3300046517 | Ga0495630_0354390 | Ga0495630_0354390_679_1041 | 120 |
| 469 | 3300046517 | Ga0495630_0721763 | Ga0495630_0721763_370_732 | 120 |
| 470 | 3300046520 | Ga0495637_0069030 | Ga0495637_0069030_882_1244 | 120 |
| 471 | 3300046522 | Ga0495643_0151731 | Ga0495643_0151731_662_1024 | 120 |
| 472 | 3300046523 | Ga0495644_0001670 | Ga0495644_0001670_1948_2310 | 120 |
| 473 | 3300046529 | Ga0495652_0000546 | Ga0495652_0000546_13686_14048 | 120 |
| 474 | 3300046529 | Ga0495652_0007337 | Ga0495652_0007337_938_1300 | 120 |
| 475 | 3300046529 | Ga0495652_0739639 | Ga0495652_0739639_94_459 | 120 |
| 476 | 3300046533 | Ga0495640_0051375 | Ga0495640_0051375_2282_2644 | 120 |
| 477 | 3300046533 | Ga0495640_0159785 | Ga0495640_0159785_155_517 | 120 |
| 478 | 3300046533 | Ga0495640_0364061 | Ga0495640_0364061_44_409 | 120 |
| 479 | 3300046535 | Ga0495586_0000161 | Ga0495586_0000161_9971_10333 | 120 |
| 480 | 3300046535 | Ga0495586_0225639 | Ga0495586_0225639_615_980 | 120 |
| 481 | 3300046536 | Ga0495587_0004792 | Ga0495587_0004792_638_1000 | 120 |
| 482 | 3300046536 | Ga0495587_0008810 | Ga0495587_0008810_760_1122 | 120 |
| 483 | 3300046536 | Ga0495587_0248222 | Ga0495587_0248222_19_381 | 120 |
| 484 | 3300046538 | Ga0495609_0169701 | Ga0495609_0169701_238_600 | 120 |
| 485 | 3300046539 | Ga0495621_0020340 | Ga0495621_0020340_1018_1380 | 120 |
| 486 | 3300046543 | Ga0495645_0069926 | Ga0495645_0069926_828_1190 | 120 |
| 487 | 3300046543 | Ga0495645_0215508 | Ga0495645_0215508_19_381 | 120 |
| 488 | 3300046557 | Ga0495622_0000966 | Ga0495622_0000966_14704_15066 | 120 |
| 489 | 3300046559 | Ga0495667_0000018 | Ga0495667_0000018_78470_78832 | 120 |
| 490 | 3300046616 | Ga0495668_0124422 | Ga0495668_0124422_1004_1366 | 120 |
| 491 | 3300046642 | Ga0495634_0000235 | Ga0495634_0000235_18662_19024 | 120 |
| 492 | 3300046642 | Ga0495634_0024348 | Ga0495634_0024348_2953_3315 | 120 |
| 493 | 3300046642 | Ga0495634_0071921 | Ga0495634_0071921_494_856 | 120 |
| 494 | 3300046642 | Ga0495634_0844816 | Ga0495634_0844816_92_454 | 120 |
| 495 | 3300046660 | Ga0495625_0000756 | Ga0495625_0000756_43009_43374 | 120 |
| 496 | 3300046660 | Ga0495625_0259088 | Ga0495625_0259088_453_815 | 120 |
| 497 | 3300046663 | Ga0495635_0000044 | Ga0495635_0000044_66866_67228 | 120 |
| 498 | 3300046663 | Ga0495635_0080583 | Ga0495635_0080583_951_1313 | 120 |
| 499 | 3300046674 | Ga0495588_0000134 | Ga0495588_0000134_3648_4010 | 120 |
| 500 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_163600_163962 | 120 |
| 501 | 3300046675 | Ga0495657_0008510 | Ga0495657_0008510_6352_6714 | 120 |
| 502 | 3300046678 | Ga0495599_0005863 | Ga0495599_0005863_4763_5125 | 120 |
| 503 | 3300046679 | Ga0495623_0240779 | Ga0495623_0240779_107_469 | 120 |
| 504 | 3300046680 | Ga0495646_0114920 | Ga0495646_0114920_345_707 | 120 |
| 505 | 3300046680 | Ga0495646_0318782 | Ga0495646_0318782_165_527 | 120 |
| 506 | 3300046681 | Ga0495647_0000018 | Ga0495647_0000018_63807_64169 | 120 |
| 507 | 3300046681 | Ga0495647_0009304 | Ga0495647_0009304_1788_2150 | 120 |
| 508 | 3300046681 | Ga0495647_0026556 | Ga0495647_0026556_1670_2032 | 120 |
| 509 | 3300046681 | Ga0495647_0312348 | Ga0495647_0312348_298_660 | 120 |
| 510 | 3300046683 | Ga0495658_0000034 | Ga0495658_0000034_32656_33018 | 120 |
| 511 | 3300046684 | Ga0495669_0000033 | Ga0495669_0000033_78711_79073 | 120 |
| 512 | 3300046684 | Ga0495669_0338946 | Ga0495669_0338946_114_476 | 120 |
| 513 | 3300046689 | Ga0495613_0000200 | Ga0495613_0000200_25188_25550 | 120 |
| 514 | 3300046689 | Ga0495613_0000801 | Ga0495613_0000801_963_1325 | 120 |
| 515 | 3300046690 | Ga0495624_0000097 | Ga0495624_0000097_47568_47930 | 120 |
| 516 | 3300046690 | Ga0495624_0000647 | Ga0495624_0000647_24707_25069 | 120 |
| 517 | 3300046690 | Ga0495624_0066749 | Ga0495624_0066749_287_649 | 120 |
| 518 | 3300046691 | Ga0495670_0012763 | Ga0495670_0012763_1501_1863 | 120 |
| 519 | 3300046694 | Ga0495649_0011134 | Ga0495649_0011134_4027_4389 | 120 |
| 520 | 3300046809 | Ga0495600_0008294 | Ga0495600_0008294_5696_6058 | 120 |
| 521 | 3300047317 | Ga0495604_0000055 | Ga0495604_0000055_47359_47721 | 120 |
| 522 | 3300047317 | Ga0495604_0000137 | Ga0495604_0000137_39252_39614 | 120 |
| 523 | 3300047317 | Ga0495604_0134406 | Ga0495604_0134406_726_1091 | 120 |
| 524 | 3300047319 | Ga0495674_0000064 | Ga0495674_0000064_22593_22955 | 120 |
| 525 | 3300047319 | Ga0495674_0966703 | Ga0495674_0966703_139_501 | 120 |
| 526 | 3300047320 | Ga0495672_0085884 | Ga0495672_0085884_851_1213 | 120 |
| 527 | 3300047320 | Ga0495672_0103061 | Ga0495672_0103061_945_1307 | 120 |
| 528 | 3300047321 | Ga0495676_0002521 | Ga0495676_0002521_1454_1816 | 120 |
| 529 | 3300047321 | Ga0495676_0005015 | Ga0495676_0005015_2593_2955 | 120 |
| 530 | 3300047321 | Ga0495676_0129577 | Ga0495676_0129577_453_815 | 120 |
| 531 | 3300047321 | Ga0495676_0182608 | Ga0495676_0182608_1070_1432 | 120 |
| 532 | 3300047321 | Ga0495676_0912442 | Ga0495676_0912442_150_512 | 120 |
| 533 | 3300047322 | Ga0495680_0001229 | Ga0495680_0001229_5311_5673 | 120 |
| 534 | 3300047322 | Ga0495680_0003149 | Ga0495680_0003149_10809_11171 | 120 |
| 535 | 3300047322 | Ga0495680_0064781 | Ga0495680_0064781_1076_1438 | 120 |
| 536 | 3300047322 | Ga0495680_0161675 | Ga0495680_0161675_612_974 | 120 |
| 537 | 3300047322 | Ga0495680_0173243 | Ga0495680_0173243_1121_1483 | 120 |
| 538 | 3300047322 | Ga0495680_0222832 | Ga0495680_0222832_267_632 | 120 |
| 539 | 3300047322 | Ga0495680_0689477 | Ga0495680_0689477_278_640 | 120 |
| 540 | 3300047444 | Ga0495675_0000842 | Ga0495675_0000842_2169_2531 | 120 |
| 541 | 3300047446 | Ga0495679_052801 | Ga0495679_052801_801_1163 | 120 |
| 542 | 3300047447 | Ga0495685_166614 | Ga0495685_166614_22_384 | 120 |
| 543 | 3300047471 | Ga0495684_0062931 | Ga0495684_0062931_1644_2006 | 120 |
| 544 | 3300047471 | Ga0495684_0261664 | Ga0495684_0261664_322_684 | 120 |
| 545 | 3300047471 | Ga0495684_0721404 | Ga0495684_0721404_180_542 | 120 |
| 546 | 3300047472 | Ga0495686_0110686 | Ga0495686_0110686_858_1220 | 120 |
| 547 | 3300047673 | Ga0495593_0423071 | Ga0495593_0423071_76_438 | 120 |
| 548 | 3300048088 | Ga0495602_0000041 | Ga0495602_0000041_85877_86239 | 120 |
| 549 | 3300048088 | Ga0495602_0001343 | Ga0495602_0001343_13908_14270 | 120 |
| 550 | 3300048088 | Ga0495602_0073582 | Ga0495602_0073582_90_452 | 120 |
| 551 | 3300048088 | Ga0495602_0196005 | Ga0495602_0196005_74_436 | 120 |
| 552 | 3300048088 | Ga0495602_0238066 | Ga0495602_0238066_914_1276 | 120 |
| 553 | 3300048088 | Ga0495602_0943505 | Ga0495602_0943505_46_408 | 120 |
| 554 | 3300048089 | Ga0495614_0330026 | Ga0495614_0330026_151_513 | 120 |
| 555 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_416074_416436 | 120 |
| 556 | 3300048903 | Ga0496100_0013418 | Ga0496100_0013418_2155_2520 | 120 |
| 557 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_416074_416436 | 120 |
| 558 | 3300048904 | Ga0496101_0000062 | Ga0496101_0000062_2184_2549 | 120 |
| 559 | 3300048905 | Ga0496102_0000039 | Ga0496102_0000039_5766_6128 | 120 |
| 560 | 3300048905 | Ga0496102_0039947 | Ga0496102_0039947_676_1038 | 120 |
| 561 | 3300048905 | Ga0496102_0913975 | Ga0496102_0913975_406_768 | 120 |
| 562 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_127021_127383 | 120 |
| 563 | 3300048906 | Ga0496103_0162091 | Ga0496103_0162091_670_1032 | 120 |
| 564 | 3300048906 | Ga0496103_0305146 | Ga0496103_0305146_495_857 | 120 |
| 565 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_336792_337154 | 120 |
| 566 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_279243_279605 | 120 |
| 567 | 3300048907 | Ga0496104_0000257 | Ga0496104_0000257_39477_39839 | 120 |
| 568 | 3300048907 | Ga0496104_0027266 | Ga0496104_0027266_4248_4610 | 120 |
| 569 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_304677_305039 | 120 |
| 570 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_208451_208813 | 120 |
| 571 | 3300048908 | Ga0496105_0000174 | Ga0496105_0000174_7126_7488 | 120 |
| 572 | 3300048908 | Ga0496105_0147700 | Ga0496105_0147700_1191_1553 | 120 |
| 573 | 3300048908 | Ga0496105_0388642 | Ga0496105_0388642_153_515 | 120 |
| 574 | 3300048909 | Ga0496106_0000084 | Ga0496106_0000084_72594_72956 | 120 |
| 575 | 3300048909 | Ga0496106_0000122 | Ga0496106_0000122_8158_8523 | 120 |
| 576 | 3300048909 | Ga0496106_0100801 | Ga0496106_0100801_1021_1383 | 120 |
| 577 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_64817_65179 | 120 |
| 578 | 3300048910 | Ga0496107_0002178 | Ga0496107_0002178_982_1347 | 120 |
| 579 | 3300048910 | Ga0496107_0180671 | Ga0496107_0180671_997_1359 | 120 |
| 580 | 3300048910 | Ga0496107_0336461 | Ga0496107_0336461_670_1032 | 120 |
| 581 | 3300048910 | Ga0496107_0419227 | Ga0496107_0419227_386_748 | 120 |
| 582 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_715287_715649 | 120 |
| 583 | 3300048911 | Ga0496108_0000175 | Ga0496108_0000175_18064_18426 | 120 |
| 584 | 3300048911 | Ga0496108_0000187 | Ga0496108_0000187_1060_1422 | 120 |
| 585 | 3300048911 | Ga0496108_0056875 | Ga0496108_0056875_1995_2357 | 120 |
| 586 | 3300048911 | Ga0496108_0870309 | Ga0496108_0870309_82_531 | 120 |
| 587 | 3300048911 | Ga0496108_1136530 | Ga0496108_1136530_185_547 | 120 |
| 588 | 3300048911 | Ga0496108_1529048 | Ga0496108_1529048_45_407 | 120 |
| 589 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_389833_390195 | 120 |
| 590 | 3300048912 | Ga0496109_0000121 | Ga0496109_0000121_18056_18418 | 120 |
| 591 | 3300048912 | Ga0496109_0000611 | Ga0496109_0000611_28640_29002 | 120 |
| 592 | 3300048912 | Ga0496109_0009604 | Ga0496109_0009604_7765_8127 | 120 |
| 593 | 3300048912 | Ga0496109_0023749 | Ga0496109_0023749_4014_4376 | 120 |
| 594 | 3300048912 | Ga0496109_0209551 | Ga0496109_0209551_1131_1496 | 120 |
| 595 | 3300048912 | Ga0496109_0281350 | Ga0496109_0281350_119_481 | 120 |
| 596 | 3300048912 | Ga0496109_1687520 | Ga0496109_1687520_158_520 | 120 |
| 597 | 3300048913 | Ga0496110_0001510 | Ga0496110_0001510_14342_14704 | 120 |
| 598 | 3300048913 | Ga0496110_0067647 | Ga0496110_0067647_900_1265 | 120 |
| 599 | 3300048913 | Ga0496110_0080699 | Ga0496110_0080699_2184_2546 | 120 |
| 600 | 3300048913 | Ga0496110_0333323 | Ga0496110_0333323_717_1079 | 120 |
| 601 | 3300048913 | Ga0496110_0816121 | Ga0496110_0816121_437_799 | 120 |
| 602 | 3300048913 | Ga0496110_0965365 | Ga0496110_0965365_120_482 | 120 |
| 603 | 3300048914 | Ga0496111_0000009 | Ga0496111_0000009_91434_91796 | 120 |
| 604 | 3300048914 | Ga0496111_0274474 | Ga0496111_0274474_249_611 | 120 |
| 605 | 3300048914 | Ga0496111_0669504 | Ga0496111_0669504_21_383 | 120 |
| 606 | 3300048914 | Ga0496111_0757278 | Ga0496111_0757278_168_530 | 120 |
| 607 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_310788_311150 | 120 |
| 608 | 3300048915 | Ga0496112_0010135 | Ga0496112_0010135_3782_4144 | 120 |
| 609 | 3300048915 | Ga0496112_0568336 | Ga0496112_0568336_611_976 | 120 |
| 610 | 3300048915 | Ga0496112_0587354 | Ga0496112_0587354_338_700 | 120 |
| 611 | 3300048916 | Ga0496113_0000073 | Ga0496113_0000073_37078_37440 | 120 |
| 612 | 3300048916 | Ga0496113_0124930 | Ga0496113_0124930_647_1009 | 120 |
| 613 | 3300048916 | Ga0496113_0636032 | Ga0496113_0636032_135_503 | 120 |
| 614 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_282286_282651 | 120 |
| 615 | 3300048917 | Ga0496114_0859474 | Ga0496114_0859474_122_484 | 120 |
| 616 | 3300048917 | Ga0496114_1001757 | Ga0496114_1001757_100_462 | 120 |
| 617 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_155518_155883 | 120 |
| 618 | 3300048918 | Ga0496115_0000920 | Ga0496115_0000920_5297_5662 | 120 |
| 619 | 3300048920 | Ga0496117_0001988 | Ga0496117_0001988_23522_23884 | 120 |
| 620 | 3300048920 | Ga0496117_0136149 | Ga0496117_0136149_160_522 | 120 |
| 621 | 3300048921 | Ga0496118_0000373 | Ga0496118_0000373_48852_49214 | 120 |
| 622 | 3300048921 | Ga0496118_0052458 | Ga0496118_0052458_2471_2833 | 120 |
| 623 | 3300048921 | Ga0496118_0281467 | Ga0496118_0281467_356_721 | 120 |
| 624 | 3300048921 | Ga0496118_0479522 | Ga0496118_0479522_202_564 | 120 |
| 625 | 3300048922 | Ga0496119_0018509 | Ga0496119_0018509_3672_4034 | 120 |
| 626 | 3300048922 | Ga0496119_0021841 | Ga0496119_0021841_2061_2423 | 120 |
| 627 | 3300048922 | Ga0496119_0032630 | Ga0496119_0032630_2678_3040 | 120 |
| 628 | 3300048923 | Ga0496120_0008890 | Ga0496120_0008890_5542_5904 | 120 |
| 629 | 3300048924 | Ga0496121_0020360 | Ga0496121_0020360_5499_5861 | 120 |
| 630 | 3300048924 | Ga0496121_0026490 | Ga0496121_0026490_2938_3300 | 120 |
| 631 | 3300048924 | Ga0496121_0082975 | Ga0496121_0082975_1799_2161 | 120 |
| 632 | 3300048924 | Ga0496121_0175748 | Ga0496121_0175748_122_484 | 120 |
| 633 | 3300048924 | Ga0496121_0449362 | Ga0496121_0449362_129_491 | 120 |
| 634 | 3300048927 | Ga0496124_0202775 | Ga0496124_0202775_486_848 | 120 |
| 635 | 3300048927 | Ga0496124_0303628 | Ga0496124_0303628_599_961 | 120 |
| 636 | 3300048927 | Ga0496124_0809907 | Ga0496124_0809907_15_377 | 120 |
| 637 | 3300048928 | Ga0496125_0038435 | Ga0496125_0038435_359_721 | 120 |
| 638 | 3300048928 | Ga0496125_0077358 | Ga0496125_0077358_975_1337 | 120 |
| 639 | 3300048928 | Ga0496125_0079512 | Ga0496125_0079512_231_593 | 120 |
| 640 | 3300048929 | Ga0496126_0010117 | Ga0496126_0010117_1498_1860 | 120 |
| 641 | 3300048929 | Ga0496126_0156978 | Ga0496126_0156978_638_1000 | 120 |
| 642 | 3300048929 | Ga0496126_0510065 | Ga0496126_0510065_402_764 | 120 |
| 643 | 3300049568 | Ga0501031_0005273 | Ga0501031_0005273_417_779 | 120 |
| 644 | 3300049569 | Ga0501032_0006818 | Ga0501032_0006818_411_773 | 120 |
| 645 | 3300049569 | Ga0501032_0782793 | Ga0501032_0782793_93_455 | 120 |
| 646 | 3300049570 | Ga0501033_0008144 | Ga0501033_0008144_7629_7991 | 120 |
| 647 | 3300049571 | Ga0501034_0090987 | Ga0501034_0090987_1960_2322 | 120 |
| 648 | 3300049572 | Ga0501036_0009217 | Ga0501036_0009217_7652_8014 | 120 |
| 649 | 3300049572 | Ga0501036_1263342 | Ga0501036_1263342_222_584 | 120 |
| 650 | 3300049573 | Ga0501037_0036552 | Ga0501037_0036552_746_1108 | 120 |
| 651 | 3300049574 | Ga0501038_0010697 | Ga0501038_0010697_383_745 | 120 |
| 652 | 3300049575 | Ga0501039_0020768 | Ga0501039_0020768_4596_4958 | 120 |
| 653 | 3300049576 | Ga0501040_0005660 | Ga0501040_0005660_108_470 | 120 |
| 654 | 3300049577 | Ga0501041_0620161 | Ga0501041_0620161_18_383 | 120 |
| 655 | 3300049578 | Ga0501042_0023246 | Ga0501042_0023246_3778_4140 | 120 |
| 656 | 3300049578 | Ga0501042_0162121 | Ga0501042_0162121_960_1322 | 120 |
| 657 | 3300049579 | Ga0501043_0008404 | Ga0501043_0008404_7608_7970 | 120 |
| 658 | 3300049579 | Ga0501043_0459610 | Ga0501043_0459610_547_909 | 120 |
| 659 | 3300049580 | Ga0501046_0003232 | Ga0501046_0003232_72_434 | 120 |
| 660 | 3300049580 | Ga0501046_0502843 | Ga0501046_0502843_335_697 | 120 |
| 661 | 3300049581 | Ga0501047_0000715 | Ga0501047_0000715_9265_9627 | 120 |
| 662 | 3300049581 | Ga0501047_0011367 | Ga0501047_0011367_7625_7987 | 120 |
| 663 | 3300049581 | Ga0501047_0069611 | Ga0501047_0069611_1972_2334 | 120 |
| 664 | 3300049581 | Ga0501047_0099334 | Ga0501047_0099334_609_971 | 120 |
| 665 | 3300049581 | Ga0501047_0308165 | Ga0501047_0308165_538_900 | 120 |
| 666 | 3300049582 | Ga0501048_0007912 | Ga0501048_0007912_7622_7984 | 120 |
| 667 | 3300049583 | Ga0501067_0038047 | Ga0501067_0038047_462_824 | 120 |
| 668 | 3300049584 | Ga0501068_0003782 | Ga0501068_0003782_391_753 | 120 |
| 669 | 3300049584 | Ga0501068_0159424 | Ga0501068_0159424_411_773 | 120 |
| 670 | 3300049585 | Ga0501069_0001977 | Ga0501069_0001977_6705_7067 | 120 |
| 671 | 3300049585 | Ga0501069_0241161 | Ga0501069_0241161_119_481 | 120 |
| 672 | 3300049585 | Ga0501069_0672843 | Ga0501069_0672843_80_442 | 120 |
| 673 | 3300049586 | Ga0501070_0000676 | Ga0501070_0000676_3945_4307 | 120 |
| 674 | 3300049586 | Ga0501070_0009160 | Ga0501070_0009160_7627_7989 | 120 |
| 675 | 3300049586 | Ga0501070_0067838 | Ga0501070_0067838_2070_2432 | 120 |
| 676 | 3300049586 | Ga0501070_0204705 | Ga0501070_0204705_450_812 | 120 |
| 677 | 3300049586 | Ga0501070_0246197 | Ga0501070_0246197_971_1333 | 120 |
| 678 | 3300049586 | Ga0501070_0859228 | Ga0501070_0859228_198_560 | 120 |
| 679 | 3300049586 | Ga0501070_1469361 | Ga0501070_1469361_75_437 | 120 |
| 680 | 3300049587 | Ga0501071_0045682 | Ga0501071_0045682_568_930 | 120 |
| 681 | 3300049587 | Ga0501071_1418727 | Ga0501071_1418727_43_405 | 120 |
| 682 | 3300049588 | Ga0501072_0356704 | Ga0501072_0356704_127_489 | 120 |
| 683 | 3300049588 | Ga0501072_1520938 | Ga0501072_1520938_60_422 | 120 |
| 684 | 3300049589 | Ga0501073_0008844 | Ga0501073_0008844_6996_7358 | 120 |
| 685 | 3300049590 | Ga0501074_0007273 | Ga0501074_0007273_126_488 | 120 |
| 686 | 3300049590 | Ga0501074_0074544 | Ga0501074_0074544_624_986 | 120 |
| 687 | 3300049591 | Ga0501075_0006281 | Ga0501075_0006281_4540_4902 | 120 |
| 688 | 3300049592 | Ga0501076_0932483 | Ga0501076_0932483_156_521 | 120 |
| 689 | 3300049741 | Ga0501079_0007770 | Ga0501079_0007770_7636_7998 | 120 |
| 690 | 3300049741 | Ga0501079_0015295 | Ga0501079_0015295_654_1016 | 120 |
| 691 | 3300049741 | Ga0501079_1120633 | Ga0501079_1120633_46_408 | 120 |
| 692 | 3300049742 | Ga0501080_0020947 | Ga0501080_0020947_890_1252 | 120 |
| 693 | 3300049743 | Ga0501081_0073889 | Ga0501081_0073889_1413_1775 | 120 |
| 694 | 3300049744 | Ga0501083_0001648 | Ga0501083_0001648_5144_5506 | 120 |
| 695 | 3300049744 | Ga0501083_0011652 | Ga0501083_0011652_5672_6034 | 120 |
| 696 | 3300049744 | Ga0501083_0021931 | Ga0501083_0021931_3417_3779 | 120 |
| 697 | 3300049822 | Ga0501035_0000571 | Ga0501035_0000571_40026_40388 | 120 |
| 698 | 3300049822 | Ga0501035_0246910 | Ga0501035_0246910_1021_1383 | 120 |
| 699 | 3300049822 | Ga0501035_1248753 | Ga0501035_1248753_17_379 | 120 |
| 700 | 3300049823 | Ga0501044_0004142 | Ga0501044_0004142_558_920 | 120 |
| 701 | 3300049823 | Ga0501044_0014768 | Ga0501044_0014768_432_794 | 120 |
| 702 | 3300049823 | Ga0501044_0097325 | Ga0501044_0097325_800_1162 | 120 |
| 703 | 3300049823 | Ga0501044_1155353 | Ga0501044_1155353_86_448 | 120 |
| 704 | 3300049824 | Ga0501045_0724333 | Ga0501045_0724333_290_652 | 120 |
| 705 | 3300050492 | nmdc:mga0yw44_209692_c1 | nmdc:mga0yw44_209692_c1_913_1275 | 120 |
| 706 | 3300050509 | nmdc:mga0qj67_116694_c1 | nmdc:mga0qj67_116694_c1_218_583 | 120 |
| 707 | 3300050513 | nmdc:mga0rr50_122227_c1 | nmdc:mga0rr50_122227_c1_89_451 | 120 |
| 708 | 3300050515 | nmdc:mga0a205_273_c2 | nmdc:mga0a205_273_c2_11462_11824 | 120 |
| 709 | 3300050515 | nmdc:mga0a205_6183_c1 | nmdc:mga0a205_6183_c1_7830_8192 | 120 |
| 710 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_43705_44067 | 120 |
| 711 | 3300053077 | Ga0495601_0000264 | Ga0495601_0000264_27194_27556 | 120 |
| 712 | 3300053077 | Ga0495601_0038283 | Ga0495601_0038283_2430_2792 | 120 |
| 713 | 3300053077 | Ga0495601_0095157 | Ga0495601_0095157_930_1295 | 120 |
| 714 | 3300053077 | Ga0495601_0175811 | Ga0495601_0175811_220_582 | 120 |
| 715 | 3300053077 | Ga0495601_0195114 | Ga0495601_0195114_701_1063 | 120 |
| 716 | 3300053077 | Ga0495601_0316438 | Ga0495601_0316438_380_742 | 120 |
| 717 | 3300053077 | Ga0495601_0363817 | Ga0495601_0363817_526_888 | 120 |
| 718 | 3300053078 | Ga0495612_0000060 | Ga0495612_0000060_46201_46566 | 120 |
| 719 | 3300053078 | Ga0495612_0022469 | Ga0495612_0022469_1368_1730 | 120 |
| 720 | 3300053078 | Ga0495612_0033638 | Ga0495612_0033638_66_428 | 120 |
| 721 | 3300053078 | Ga0495612_0038282 | Ga0495612_0038282_857_1219 | 120 |
| 722 | 3300053078 | Ga0495612_0046299 | Ga0495612_0046299_1342_1704 | 120 |
| 723 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_243015_243377 | 120 |
| 724 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_163600_163962 | 120 |
| 725 | 3300053084 | Ga0495595_0000053 | Ga0495595_0000053_6558_6920 | 120 |
| 726 | 3300053084 | Ga0495595_0067347 | Ga0495595_0067347_1091_1453 | 120 |
| 727 | 3300053084 | Ga0495595_0390017 | Ga0495595_0390017_238_600 | 120 |
| 728 | 3300053085 | Ga0495619_0000025 | Ga0495619_0000025_82042_82404 | 120 |
| 729 | 3300053085 | Ga0495619_0000116 | Ga0495619_0000116_10367_10729 | 120 |
| 730 | 3300053085 | Ga0495619_0000782 | Ga0495619_0000782_20296_20658 | 120 |
| 731 | 3300053085 | Ga0495619_0001012 | Ga0495619_0001012_11665_12027 | 120 |
| 732 | 3300053085 | Ga0495619_0001275 | Ga0495619_0001275_1537_1899 | 120 |
| 733 | 3300053085 | Ga0495619_0004173 | Ga0495619_0004173_4192_4554 | 120 |
| 734 | 3300053085 | Ga0495619_0005899 | Ga0495619_0005899_6552_6914 | 120 |
| 735 | 3300053085 | Ga0495619_0161980 | Ga0495619_0161980_273_638 | 120 |
| 736 | 3300053094 | Ga0500566_0007596 | Ga0500566_0007596_4291_4653 | 120 |
| 737 | 3300053096 | Ga0500641_0003883 | Ga0500641_0003883_4695_5057 | 120 |
| 738 | 3300053098 | Ga0500650_0179394 | Ga0500650_0179394_522_884 | 120 |
| 739 | 3300053119 | Ga0500595_040628 | Ga0500595_040628_1019_1381 | 120 |
| 740 | 3300053123 | Ga0500614_000451 | Ga0500614_000451_9527_9889 | 120 |
| 741 | 3300053129 | Ga0500628_000010 | Ga0500628_000010_117216_117578 | 120 |
| 742 | 3300053134 | Ga0500658_0130638 | Ga0500658_0130638_309_671 | 120 |
| 743 | 3300054114 | Ga0501084_0493860 | Ga0501084_0493860_598_960 | 120 |
| 744 | 3300059426 | Ga0590077_023859 | Ga0590077_023859_812_1174 | 120 |
| 745 | 3300059512 | Ga0587092_018905 | Ga0587092_018905_72_434 | 120 |
| 746 | 3300060353 | Ga0501082_0072467 | Ga0501082_0072467_95_457 | 120 |
| 747 | 3300060353 | Ga0501082_0310180 | Ga0501082_0310180_562_924 | 120 |
| 748 | 3300060353 | Ga0501082_1894819 | Ga0501082_1894819_48_410 | 120 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iz9-assembly1.cif.gz_A-2 | crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese | 0.7511 | 26 | 51 |
| 3sk3-assembly1.cif.gz_B | crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface | 0.7492 | 25 | 51 |
| 7fgm-assembly1.cif.gz_B | the complex crystals structure of the faf1 ubl1_l-hsp70 nbd with adp and phosphate | 0.7467 | 28 | 45 |
| 3zx3-assembly2.cif.gz_C | crystal structure and domain rotation of ntpdase1 cd39 | 0.7295 | 27 | 52 |
| 7pub-assembly1.cif.gz_CK | late assembly intermediate of the trypanosoma brucei mitoribosomal small subunit | 0.7266 | 26 | 51 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8RWY4_738_822_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.8281 | 28 | 44 | 3.10.20.90 |
| af_Q5ANI6_290_379_3.30.160.60 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger | 0.8203 | 28 | 55 | 3.30.160.60 |
| af_P0A6V8_2_105_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8145 | 28 | 52 | 3.30.420.40 |
| af_X1WH23_7_262_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7796 | 26 | 52 | 3.30.420.40 |
| 1sz2A01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7731 | 28 | 52 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0S2R3-F1-model_v4 | SCP2 domain-containing protein | 0.9407 | 1 | 118 |
|
| AF-A0A7W0MUA7-F1-model_v4 | SCP2 domain-containing protein | 0.9317 | 1 | 118 |
|
| AF-A0A7V9CG26-F1-model_v4 | SCP2 domain-containing protein | 0.9303 | 1 | 118 |
|
| AF-A0A6J4T321-F1-model_v4 | SCP2 domain-containing protein | 0.9284 | 1 | 117 |
|
| AF-A0A7W0LIQ7-F1-model_v4 | SCP2 domain-containing protein | 0.9206 | 3 | 113 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar