F478977

General Info

Members Datasets Scaffolds Average Seq Length
748 342 748 120

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0870309|Ga0496108_0870309_82_531
Length 149
Sequence MASTPELIRTAVERFQAEVPALAKLKLVFGLELRAKHDIQLYRVELPGPKITKDLAQDERVLVEIDRPQFNELAEKGTLKSYRRAAETGHIKANGDSNVVKLISQVVEKQEERNRLKKVHERRRRLSASIPLVTPRKSIVSGAAATTRS

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
108 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
173 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
174 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
200 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
201 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
333 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
334 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
335 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
336 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
337 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
338 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
341 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 9.49
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 4.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000986 3300002239 Bacteria 3708
2 JGI24742J22300_10001987 3300002244 Bacteria 3259
3 JGI25404J52841_10005383 3300003659 Bacteria 2645
4 Ga0070658_10761878 3300005327 Bacteria 841
5 Ga0070683_100021012 3300005329 Bacteria 5821
6 Ga0070683_100021782 3300005329 Bacteria 5721
7 Ga0070683_100030699 3300005329 Bacteria 4882
8 Ga0070683_100051279 3300005329 Bacteria 3820
9 Ga0070683_100481941 3300005329 Bacteria 1184
10 Ga0070683_100710386 3300005329 Bacteria 963
11 Ga0070683_101635647 3300005329 Unclassified 619
12 Ga0070690_100217573 3300005330 Bacteria 1337
13 Ga0070670_100249805 3300005331 Bacteria 1545
14 Ga0070677_10000022 3300005333 Bacteria 45355
15 Ga0070666_10000484 3300005335 Bacteria 24081
16 Ga0070666_10381580 3300005335 Bacteria 1012
17 Ga0070680_100241753 3300005336 Bacteria 1526
18 Ga0070682_100000099 3300005337 Bacteria 77574
19 Ga0070682_100000150 3300005337 Bacteria 55238
20 Ga0070682_100709049 3300005337 Bacteria 808
21 Ga0068868_100002756 3300005338 Bacteria 12165
22 Ga0068868_100006916 3300005338 Bacteria 8060
23 Ga0070660_100366173 3300005339 Bacteria 1188
24 Ga0070689_100597270 3300005340 Bacteria 956
25 Ga0070691_10000032 3300005341 Bacteria 39570
26 Ga0070691_10002218 3300005341 Bacteria 8594
27 Ga0070691_10391580 3300005341 Bacteria 781
28 Ga0070687_100515363 3300005343 Bacteria 808
29 Ga0070661_100000102 3300005344 Bacteria 69941
30 Ga0070668_100051947 3300005347 Bacteria 3159
31 Ga0070668_100382805 3300005347 Bacteria 1197
32 Ga0070669_101593969 3300005353 Bacteria 568
33 Ga0070675_100000027 3300005354 Bacteria 106172
34 Ga0070674_100000056 3300005356 Bacteria 49642
35 Ga0070674_100000088 3300005356 Bacteria 42730
36 Ga0070674_100713104 3300005356 Bacteria 859
37 Ga0070673_100007829 3300005364 Bacteria 7078
38 Ga0070688_100001250 3300005365 Bacteria 12681
39 Ga0070688_100001531 3300005365 Bacteria 11553
40 Ga0070688_100123262 3300005365 Bacteria 1739
41 Ga0070659_100022916 3300005366 Bacteria 4773
42 Ga0070659_100121688 3300005366 Bacteria 2114
43 Ga0070667_100006153 3300005367 Bacteria 9974
44 Ga0070667_100008220 3300005367 Bacteria 8649
45 Ga0070667_100040138 3300005367 Bacteria 3924
46 Ga0070667_100296404 3300005367 Bacteria 1455
47 Ga0070667_101118584 3300005367 Bacteria 736
48 Ga0070703_10366030 3300005406 Bacteria 619
49 Ga0070714_100087123 3300005435 Bacteria 2730
50 Ga0070713_100000085 3300005436 Bacteria 58902
51 Ga0070713_101720364 3300005436 Bacteria 609
52 Ga0070701_10467572 3300005438 Bacteria 812
53 Ga0070711_100014274 3300005439 Bacteria 5001
54 Ga0070711_100212262 3300005439 Bacteria 1500
55 Ga0070700_100274997 3300005441 Bacteria 1219
56 Ga0070700_100865574 3300005441 Unclassified 733
57 Ga0070700_100930908 3300005441 Bacteria 710
58 Ga0070663_100000073 3300005455 Bacteria 43743
59 Ga0070663_100978723 3300005455 Bacteria 734
60 Ga0070678_100011801 3300005456 Bacteria 5405
61 Ga0070678_100377494 3300005456 Bacteria 1226
62 Ga0070662_100000004 3300005457 Bacteria 195534
63 Ga0070662_100610838 3300005457 Bacteria 918
64 Ga0070681_10115322 3300005458 Bacteria 2624
65 Ga0070681_10134847 3300005458 Bacteria 2400
66 Ga0068867_100022123 3300005459 Bacteria 4543
67 Ga0070685_10001410 3300005466 Bacteria 12591
68 Ga0070685_10001719 3300005466 Bacteria 11497
69 Ga0070685_10213984 3300005466 Bacteria 1259
70 Ga0070685_11283907 3300005466 Bacteria 559
71 Ga0070679_100000240 3300005530 Bacteria 45575
72 Ga0070679_100037654 3300005530 Bacteria 4807
73 Ga0070684_100010674 3300005535 Bacteria 7285
74 Ga0070684_100039844 3300005535 Bacteria 4043
75 Ga0070684_100560496 3300005535 Bacteria 1061
76 Ga0070684_100660511 3300005535 Bacteria 973
77 Ga0070684_101594046 3300005535 Unclassified 616
78 Ga0070684_102109346 3300005535 Bacteria 532
79 Ga0068853_100083884 3300005539 Bacteria 2792
80 Ga0068853_100132587 3300005539 Bacteria 2232
81 Ga0068853_100213494 3300005539 Bacteria 1760
82 Ga0068853_100374102 3300005539 Bacteria 1329
83 Ga0070672_100000293 3300005543 Bacteria 28247
84 Ga0070686_100561225 3300005544 Bacteria 894
85 Ga0070695_100355542 3300005545 Bacteria 1099
86 Ga0070696_100909370 3300005546 Bacteria 731
87 Ga0070693_101266764 3300005547 Bacteria 569
88 Ga0070665_100000106 3300005548 Bacteria 157315
89 Ga0070665_100001435 3300005548 Bacteria 27930
90 Ga0070665_100012149 3300005548 Bacteria 8683
91 Ga0070665_100017889 3300005548 Bacteria 7117
92 Ga0070665_100048627 3300005548 Bacteria 4257
93 Ga0070665_100139966 3300005548 Bacteria 2423
94 Ga0070665_100299609 3300005548 Bacteria 1610
95 Ga0070665_101626686 3300005548 Bacteria 654
96 Ga0070704_100333123 3300005549 Bacteria 1276
97 Ga0068855_100242003 3300005563 Bacteria 2016
98 Ga0068855_100473624 3300005563 Bacteria 1364
99 Ga0070664_100025344 3300005564 Bacteria 4915
100 Ga0068857_100192498 3300005577 Bacteria 1858
101 Ga0068857_101622644 3300005577 Unclassified 631
102 Ga0068854_100000095 3300005578 Bacteria 61892
103 Ga0068854_100022643 3300005578 Bacteria 4285
104 Ga0068856_100008468 3300005614 Bacteria 10010
105 Ga0068856_100026367 3300005614 Bacteria 5667
106 Ga0068856_100076878 3300005614 Bacteria 3307
107 Ga0068856_100320326 3300005614 Bacteria 1567
108 Ga0068856_100509791 3300005614 Unclassified 1224
109 Ga0068856_100851510 3300005614 Bacteria 931
110 Ga0070702_100087262 3300005615 Bacteria 1884
111 Ga0068852_100000006 3300005616 Bacteria 159569
112 Ga0068852_101705344 3300005616 Bacteria 652
113 Ga0068859_100549800 3300005617 Bacteria 1249
114 Ga0068866_10000001 3300005718 Bacteria 519680
115 Ga0068866_10000273 3300005718 Bacteria 24605
116 Ga0068866_10530918 3300005718 Bacteria 783
117 Ga0068861_100149280 3300005719 Bacteria 1916
118 Ga0068861_100673012 3300005719 Bacteria 959
119 Ga0068861_102404766 3300005719 Bacteria 530
120 Ga0068851_10003531 3300005834 Bacteria 6955
121 Ga0068851_10029447 3300005834 Bacteria 2718
122 Ga0068870_10319764 3300005840 Bacteria 986
123 Ga0068863_100000342 3300005841 Bacteria 47536
124 Ga0068863_100039183 3300005841 Bacteria 4509
125 Ga0068863_100380143 3300005841 Bacteria 1379
126 Ga0068863_101010368 3300005841 Bacteria 834
127 Ga0068863_101165486 3300005841 Bacteria 776
128 Ga0068858_100000009 3300005842 Bacteria 237748
129 Ga0068858_100000091 3300005842 Bacteria 93802
130 Ga0068858_100097996 3300005842 Bacteria 2733
131 Ga0068858_102318158 3300005842 Bacteria 531
132 Ga0068858_102552791 3300005842 Unclassified 505
133 Ga0068860_100008191 3300005843 Bacteria 10405
134 Ga0068860_101338975 3300005843 Bacteria 737
135 Ga0068860_101558293 3300005843 Bacteria 682
136 Ga0068862_100000050 3300005844 Bacteria 145502
137 Ga0081455_10012787 3300005937 Bacteria 8342
138 Ga0081455_10056374 3300005937 Bacteria 3336
139 Ga0081540_1000049 3300005983 Bacteria 127322
140 Ga0081539_10001097 3300005985 Bacteria 49223
141 Ga0075365_11049057 3300006038 Bacteria 574
142 Ga0075365_11225240 3300006038 Bacteria 528
143 Ga0070715_10000001 3300006163 Bacteria 693690
144 Ga0070716_100446457 3300006173 Bacteria 942
145 Ga0070712_100002529 3300006175 Bacteria 11290
146 Ga0070712_100512501 3300006175 Bacteria 1007
147 Ga0070712_101842455 3300006175 Bacteria 530
148 Ga0097621_100195886 3300006237 Bacteria 1752
149 Ga0097621_100792550 3300006237 Bacteria 877
150 Ga0068871_100421524 3300006358 Bacteria 1192
151 Ga0075430_100128424 3300006846 Unclassified 2113
152 Ga0075433_10002122 3300006852 Bacteria 15030
153 Ga0075433_10042449 3300006852 Bacteria 3946
154 Ga0068865_100000023 3300006881 Bacteria 100785
155 Ga0068865_100590369 3300006881 Bacteria 937
156 Ga0097620_100549774 3300006931 Bacteria 1249
157 Ga0075435_100198052 3300007076 Bacteria 1702
158 Ga0105250_10121649 3300009092 Bacteria 1073
159 Ga0105240_10514333 3300009093 Bacteria 1329
160 Ga0105240_10653056 3300009093 Bacteria 1152
161 Ga0105240_10808036 3300009093 Bacteria 1015
162 Ga0105240_12283716 3300009093 Bacteria 560
163 Ga0111539_12512243 3300009094 Bacteria 597
164 Ga0105245_10000266 3300009098 Bacteria 49944
165 Ga0105245_10001339 3300009098 Bacteria 22307
166 Ga0105245_10095693 3300009098 Bacteria 2740
167 Ga0105245_10251557 3300009098 Bacteria 1717
168 Ga0105245_12572472 3300009098 Bacteria 562
169 Ga0105247_10000316 3300009101 Bacteria 43374
170 Ga0105247_10004636 3300009101 Bacteria 8763
171 Ga0105247_10229738 3300009101 Bacteria 1259
172 Ga0105247_10589126 3300009101 Bacteria 823
173 Ga0105247_10929424 3300009101 Bacteria 674
174 Ga0105247_11003398 3300009101 Bacteria 652
175 Ga0105243_10003688 3300009148 Bacteria 12316
176 Ga0105243_11191724 3300009148 Bacteria 774
177 Ga0105243_11579662 3300009148 Bacteria 682
178 Ga0105241_10471481 3300009174 Bacteria 1114
179 Ga0105241_10799124 3300009174 Bacteria 869
180 Ga0105242_10000032 3300009176 Bacteria 98198
181 Ga0105242_10000454 3300009176 Bacteria 32662
182 Ga0105242_10011362 3300009176 Bacteria 6844
183 Ga0105242_10118359 3300009176 Bacteria 2269
184 Ga0105242_10379023 3300009176 Bacteria 1314
185 Ga0105248_10000008 3300009177 Bacteria 403910
186 Ga0105248_11648337 3300009177 Bacteria 727
187 Ga0105248_12733215 3300009177 Bacteria 563
188 Ga0105237_10310600 3300009545 Bacteria 1580
189 Ga0105237_10373385 3300009545 Unclassified 1431
190 Ga0105238_10000011 3300009551 Bacteria 261080
191 Ga0105238_11280917 3300009551 Bacteria 759
192 Ga0105249_10000080 3300009553 Bacteria 138080
193 Ga0105249_11467432 3300009553 Bacteria 754
194 Ga0105239_10474610 3300010375 Bacteria 1421
195 Ga0105239_10551321 3300010375 Bacteria 1313
196 Ga0105239_12188673 3300010375 Bacteria 643
197 Ga0105239_12427357 3300010375 Bacteria 611
198 Ga0105246_10812260 3300011119 Bacteria 831
199 Ga0105246_11311961 3300011119 Bacteria 671
200 Ga0157371_10004749 3300013102 Bacteria 11723
201 Ga0157370_10059766 3300013104 Bacteria 3621
202 Ga0157370_10062901 3300013104 Bacteria 3518
203 Ga0157370_10078808 3300013104 Bacteria 3102
204 Ga0157369_10000020 3300013105 Bacteria 241679
205 Ga0157374_10057293 3300013296 Bacteria 3639
206 Ga0157374_10195547 3300013296 Bacteria 1979
207 Ga0157374_11439274 3300013296 Bacteria 712
208 Ga0157374_12009386 3300013296 Unclassified 604
209 Ga0157378_10009985 3300013297 Bacteria 8277
210 Ga0157378_10127991 3300013297 Bacteria 2348
211 Ga0157378_10136142 3300013297 Bacteria 2278
212 Ga0163162_12398389 3300013306 Bacteria 606
213 Ga0163162_12536887 3300013306 Bacteria 590
214 Ga0157372_10000112 3300013307 Bacteria 85902
215 Ga0157372_10314251 3300013307 Bacteria 1824
216 Ga0157375_10048495 3300013308 Bacteria 4155
217 Ga0157375_10050351 3300013308 Bacteria 4086
218 Ga0157375_10956266 3300013308 Bacteria 998
219 Ga0157375_11117495 3300013308 Bacteria 923
220 Ga0157375_11507555 3300013308 Bacteria 794
221 Ga0157375_12056879 3300013308 Bacteria 679
222 Ga0157375_12525181 3300013308 Bacteria 614
223 Ga0163163_10092414 3300014325 Bacteria 3041
224 Ga0163163_10706151 3300014325 Bacteria 1072
225 Ga0163163_11388125 3300014325 Unclassified 764
226 Ga0163163_11919745 3300014325 Bacteria 652
227 Ga0163163_12464328 3300014325 Bacteria 578
228 Ga0157380_10000091 3300014326 Bacteria 49188
229 Ga0157380_10000253 3300014326 Bacteria 32008
230 Ga0157380_10447944 3300014326 Bacteria 1239
231 Ga0157380_10494203 3300014326 Bacteria 1187
232 Ga0157379_10035232 3300014968 Bacteria 4463
233 Ga0157379_10234529 3300014968 Bacteria 1664
234 Ga0157379_10261552 3300014968 Bacteria 1572
235 Ga0157376_10185540 3300014969 Bacteria 1904
236 Ga0157376_11584587 3300014969 Unclassified 689
237 Ga0163161_10006589 3300017792 Bacteria 8041
238 Ga0163161_10093270 3300017792 Bacteria 2230
239 Ga0163161_10501705 3300017792 Bacteria 988
240 Ga0197907_10064860 3300020069 Bacteria 835
241 Ga0206356_11109912 3300020070 Bacteria 2314
242 Ga0206355_1070519 3300020076 Unclassified 509
243 Ga0206351_10019693 3300020077 Bacteria 553
244 Ga0206354_10838957 3300020081 Bacteria 643
245 Ga0224712_10055809 3300022467 Bacteria 1555
246 Ga0207656_10018770 3300025321 Bacteria 2727
247 Ga0207656_10020609 3300025321 Bacteria 2622
248 Ga0207653_10188232 3300025885 Bacteria 774
249 Ga0207682_10000005 3300025893 Bacteria 95617
250 Ga0207692_10181807 3300025898 Bacteria 1225
251 Ga0207642_10000002 3300025899 Bacteria 658166
252 Ga0207642_10001004 3300025899 Bacteria 8841
253 Ga0207642_10601508 3300025899 Bacteria 684
254 Ga0207710_10000239 3300025900 Bacteria 46663
255 Ga0207710_10000458 3300025900 Bacteria 26155
256 Ga0207710_10489544 3300025900 Bacteria 637
257 Ga0207710_10713207 3300025900 Bacteria 526
258 Ga0207680_10000901 3300025903 Bacteria 14044
259 Ga0207680_10009305 3300025903 Bacteria 4868
260 Ga0207685_10000027 3300025905 Bacteria 102101
261 Ga0207654_10423534 3300025911 Bacteria 929
262 Ga0207654_10858427 3300025911 Archaea 657
263 Ga0207707_10107414 3300025912 Bacteria 2440
264 Ga0207707_10218263 3300025912 Bacteria 1660
265 Ga0207695_10542437 3300025913 Bacteria 1044
266 Ga0207695_10674534 3300025913 Bacteria 914
267 Ga0207671_10542704 3300025914 Bacteria 927
268 Ga0207693_10478532 3300025915 Bacteria 972
269 Ga0207663_10001546 3300025916 Bacteria 10768
270 Ga0207663_10034771 3300025916 Bacteria 3017
271 Ga0207660_10021949 3300025917 Bacteria 4297
272 Ga0207662_10529436 3300025918 Bacteria 814
273 Ga0207649_10000009 3300025920 Bacteria 295544
274 Ga0207652_10000044 3300025921 Bacteria 127779
275 Ga0207652_10005697 3300025921 Bacteria 10112
276 Ga0207681_10244121 3300025923 Bacteria 1399
277 Ga0207694_10000004 3300025924 Bacteria 967075
278 Ga0207650_10110064 3300025925 Bacteria 2131
279 Ga0207650_10608849 3300025925 Bacteria 919
280 Ga0207659_10000010 3300025926 Bacteria 286639
281 Ga0207687_10000007 3300025927 Bacteria 604185
282 Ga0207687_10000013 3300025927 Bacteria 299826
283 Ga0207687_10057875 3300025927 Bacteria 2724
284 Ga0207687_10205045 3300025927 Bacteria 1544
285 Ga0207700_10000027 3300025928 Bacteria 137708
286 Ga0207700_10014365 3300025928 Bacteria 5187
287 Ga0207664_10075635 3300025929 Bacteria 2723
288 Ga0207644_10745221 3300025931 Bacteria 818
289 Ga0207690_10008293 3300025932 Bacteria 6163
290 Ga0207690_10021044 3300025932 Bacteria 4040
291 Ga0207706_10000012 3300025933 Bacteria 195475
292 Ga0207706_10541814 3300025933 Bacteria 1002
293 Ga0207686_10000048 3300025934 Bacteria 115595
294 Ga0207686_10000886 3300025934 Bacteria 18081
295 Ga0207686_10021381 3300025934 Bacteria 3712
296 Ga0207686_10060538 3300025934 Bacteria 2397
297 Ga0207709_10013651 3300025935 Bacteria 4481
298 Ga0207709_10627844 3300025935 Bacteria 853
299 Ga0207670_10254855 3300025936 Bacteria 1358
300 Ga0207669_10000018 3300025937 Bacteria 114254
301 Ga0207669_10000090 3300025937 Bacteria 45953
302 Ga0207704_10000159 3300025938 Bacteria 36005
303 Ga0207704_10088099 3300025938 Bacteria 2030
304 Ga0207665_10467204 3300025939 Bacteria 970
305 Ga0207691_10000044 3300025940 Bacteria 100027
306 Ga0207711_10000006 3300025941 Bacteria 792692
307 Ga0207661_10000139 3300025944 Bacteria 45892
308 Ga0207661_10003835 3300025944 Bacteria 10482
309 Ga0207661_10005409 3300025944 Bacteria 8993
310 Ga0207661_10042501 3300025944 Bacteria 3583
311 Ga0207661_10393836 3300025944 Bacteria 1255
312 Ga0207661_10487831 3300025944 Bacteria 1125
313 Ga0207679_10029433 3300025945 Bacteria 3824
314 Ga0207679_10106187 3300025945 Bacteria 2207
315 Ga0207667_10732922 3300025949 Bacteria 989
316 Ga0207651_10030338 3300025960 Bacteria 3441
317 Ga0207712_10000007 3300025961 Bacteria 539589
318 Ga0207668_10014280 3300025972 Bacteria 4914
319 Ga0207668_10159363 3300025972 Bacteria 1756
320 Ga0207640_10000038 3300025981 Bacteria 108630
321 Ga0207640_10291704 3300025981 Bacteria 1286
322 Ga0207658_10003939 3300025986 Bacteria 10434
323 Ga0207658_10016682 3300025986 Bacteria 5054
324 Ga0207658_10131195 3300025986 Bacteria 2013
325 Ga0207658_10142777 3300025986 Bacteria 1940
326 Ga0207658_11530894 3300025986 Unclassified 610
327 Ga0207677_10000340 3300026023 Bacteria 33455
328 Ga0207677_10001552 3300026023 Bacteria 12156
329 Ga0207703_10000023 3300026035 Bacteria 222018
330 Ga0207703_10002246 3300026035 Bacteria 16885
331 Ga0207639_10011326 3300026041 Bacteria 6191
332 Ga0207639_10130284 3300026041 Bacteria 2081
333 Ga0207639_10344683 3300026041 Bacteria 1329
334 Ga0207639_10590816 3300026041 Bacteria 1023
335 Ga0207678_10000380 3300026067 Bacteria 40450
336 Ga0207678_10121551 3300026067 Bacteria 2228
337 Ga0207708_10117292 3300026075 Bacteria 2071
338 Ga0207702_10000158 3300026078 Bacteria 79984
339 Ga0207702_10004391 3300026078 Bacteria 12560
340 Ga0207702_10020350 3300026078 Bacteria 5496
341 Ga0207702_10604786 3300026078 Bacteria 1076
342 Ga0207702_10715601 3300026078 Bacteria 987
343 Ga0207702_10736633 3300026078 Bacteria 973
344 Ga0207641_10003753 3300026088 Bacteria 13346
345 Ga0207641_10009107 3300026088 Bacteria 8200
346 Ga0207641_10466447 3300026088 Bacteria 1222
347 Ga0207641_12239744 3300026088 Bacteria 546
348 Ga0207648_10045789 3300026089 Bacteria 3836
349 Ga0207676_10000094 3300026095 Bacteria 80575
350 Ga0207674_10056052 3300026116 Bacteria 4004
351 Ga0207674_11584883 3300026116 Bacteria 623
352 Ga0207675_100324416 3300026118 Bacteria 1504
353 Ga0207675_100330783 3300026118 Unclassified 1489
354 Ga0207675_102636644 3300026118 Bacteria 512
355 Ga0207683_10103707 3300026121 Bacteria 2541
356 Ga0207683_10329652 3300026121 Bacteria 1399
357 Ga0207683_11141100 3300026121 Bacteria 723
358 Ga0207698_10000013 3300026142 Bacteria 255414
359 Ga0207698_10341848 3300026142 Bacteria 1410
360 Ga0207698_12450568 3300026142 Bacteria 532
361 Ga0268266_10000047 3300028379 Bacteria 310996
362 Ga0268266_10000640 3300028379 Bacteria 47545
363 Ga0268266_10000822 3300028379 Bacteria 40636
364 Ga0268266_10023216 3300028379 Bacteria 5282
365 Ga0268266_10052672 3300028379 Bacteria 3495
366 Ga0268266_10553470 3300028379 Bacteria 1102
367 Ga0268266_11141332 3300028379 Bacteria 754
368 Ga0268265_10001568 3300028380 Bacteria 18930
369 Ga0268264_10033939 3300028381 Bacteria 4195
370 Ga0268264_10246537 3300028381 Bacteria 1657
371 Ga0268264_11079643 3300028381 Bacteria 811
372 Ga0268264_11285526 3300028381 Bacteria 742
373 Ga0265337_1000991 3300028556 Bacteria 14841
374 Ga0265326_10000252 3300028558 Bacteria 25133
375 Ga0265319_1000020 3300028563 Bacteria 153921
376 Ga0265322_10000001 3300028654 Bacteria 543854
377 Ga0265336_10020027 3300028666 Bacteria 2152
378 Ga0265336_10064914 3300028666 Bacteria 1093
379 Ga0265338_10001248 3300028800 Bacteria 41926
380 Ga0265338_10079027 3300028800 Bacteria 2771
381 Ga0265338_10706771 3300028800 Bacteria 695
382 Ga0265324_10000498 3300029957 Bacteria 27248
383 Ga0265320_10000002 3300031240 Bacteria 542875
384 Ga0265325_10006673 3300031241 Bacteria 6984
385 Ga0265329_10032012 3300031242 Bacteria 1705
386 Ga0265331_10011308 3300031250 Bacteria 4892
387 Ga0265327_10000011 3300031251 Bacteria 543807
388 Ga0265316_10014310 3300031344 Bacteria 6991
389 Ga0307513_10586254 3300031456 Bacteria 825
390 Ga0265313_10066563 3300031595 Bacteria 1670
391 Ga0265314_10000062 3300031711 Bacteria 159496
392 Ga0265342_10068642 3300031712 Bacteria 2071
393 Ga0307415_100028982 3300032126 Bacteria 3531
394 Ga0373953_0185083 3300035117 Unclassified 899
395 Ga0373955_0190629 3300035172 Bacteria 1219
396 Ga0373955_0773905 3300035172 Bacteria 590
397 Ga0373947_0620104 3300035725 Bacteria 737
398 Ga0373937_0102350 3300036401 Bacteria 2659
399 Ga0373937_1028551 3300036401 Bacteria 772
400 Ga0451791_1087388 3300041451 Bacteria 721
401 Ga0451795_1612883 3300041456 Bacteria 543
402 Ga0451800_0223856 3300041459 Bacteria 954
403 Ga0451800_1612225 3300041459 Bacteria 649
404 Ga0451804_0761410 3300041463 Unclassified 642
405 Ga0451804_1169606 3300041463 Bacteria 522
406 Ga0451807_1367491 3300041486 Bacteria 640
407 Ga0451833_0147399 3300041491 Bacteria 946
408 Ga0451837_1335073 3300041494 Bacteria 576
409 Ga0451845_0187233 3300041501 Bacteria 890
410 Ga0451845_0826631 3300041501 Bacteria 647
411 Ga0451849_0181530 3300041505 Bacteria 719
412 Ga0451849_1137119 3300041505 Unclassified 620
413 Ga0451853_3872250 3300041512 Bacteria 2861
414 Ga0466963_0000153 3300044694 Bacteria 27553
415 Ga0466963_0351274 3300044694 Bacteria 1038
416 Ga0466963_0822093 3300044694 Bacteria 655
417 Ga0466957_0009471 3300044842 Bacteria 5561
418 Ga0466957_0305307 3300044842 Bacteria 1070
419 Ga0466960_0075911 3300044901 Bacteria 1682
420 Ga0466967_0000009 3300045976 Bacteria 122610
421 Ga0466967_0046018 3300045976 Bacteria 3796
422 Ga0466967_0325174 3300045976 Bacteria 1484
423 Ga0466967_0749777 3300045976 Bacteria 968
424 Ga0495592_0001452 3300046454 Bacteria 16469
425 Ga0495592_0118102 3300046454 Bacteria 1869
426 Ga0495592_0230867 3300046454 Bacteria 1232
427 Ga0495592_0318931 3300046454 Bacteria 1005
428 Ga0495592_0346556 3300046454 Bacteria 953
429 Ga0495592_0433798 3300046454 Bacteria 826
430 Ga0495603_0000016 3300046455 Bacteria 67399
431 Ga0495603_0002944 3300046455 Bacteria 10072
432 Ga0495603_0203251 3300046455 Bacteria 1145
433 Ga0495629_0001726 3300046459 Bacteria 17147
434 Ga0495629_0091023 3300046459 Bacteria 2128
435 Ga0495629_0439386 3300046459 Bacteria 884
436 Ga0495638_0033754 3300046460 Bacteria 3271
437 Ga0495641_0000228 3300046461 Bacteria 43671
438 Ga0495641_0026299 3300046461 Bacteria 2841
439 Ga0495641_0026720 3300046461 Bacteria 2814
440 Ga0495651_0033572 3300046462 Bacteria 4002
441 Ga0495653_0103472 3300046463 Bacteria 2059
442 Ga0495653_0195977 3300046463 Bacteria 1375
443 Ga0495653_0376533 3300046463 Bacteria 907
444 Ga0495653_0530752 3300046463 Bacteria 730
445 Ga0495653_0743304 3300046463 Unclassified 593
446 Ga0495582_0000081 3300046473 Bacteria 48557
447 Ga0495662_0000019 3300046476 Bacteria 55148
448 Ga0495662_0007799 3300046476 Bacteria 5271
449 Ga0495664_0500003 3300046477 Unclassified 726
450 Ga0495594_0000912 3300046499 Bacteria 15332
451 Ga0495594_0230073 3300046499 Bacteria 1057
452 Ga0495606_0000072 3300046507 Bacteria 173678
453 Ga0495608_0000125 3300046511 Bacteria 54881
454 Ga0495608_0036028 3300046511 Bacteria 3332
455 Ga0495608_0050149 3300046511 Bacteria 2769
456 Ga0495610_0067229 3300046512 Bacteria 1685
457 Ga0495618_0008119 3300046514 Bacteria 6356
458 Ga0495620_0000824 3300046515 Bacteria 19119
459 Ga0495628_0000190 3300046516 Bacteria 53586
460 Ga0495628_0026801 3300046516 Bacteria 4693
461 Ga0495628_0083739 3300046516 Bacteria 2476
462 Ga0495628_0118617 3300046516 Bacteria 2031
463 Ga0495630_0000020 3300046517 Bacteria 176389
464 Ga0495630_0038804 3300046517 Bacteria 3562
465 Ga0495630_0104160 3300046517 Bacteria 2147
466 Ga0495630_0325892 3300046517 Bacteria 1174
467 Ga0495630_0354390 3300046517 Bacteria 1123
468 Ga0495630_0721763 3300046517 Bacteria 762
469 Ga0495637_0069030 3300046520 Bacteria 1431
470 Ga0495643_0151731 3300046522 Bacteria 1147
471 Ga0495644_0001670 3300046523 Bacteria 9012
472 Ga0495652_0000546 3300046529 Bacteria 44003
473 Ga0495652_0007337 3300046529 Bacteria 10166
474 Ga0495652_0739639 3300046529 Bacteria 659
475 Ga0495640_0051375 3300046533 Bacteria 2834
476 Ga0495640_0159785 3300046533 Bacteria 1444
477 Ga0495640_0364061 3300046533 Bacteria 891
478 Ga0495586_0000161 3300046535 Bacteria 43544
479 Ga0495586_0225639 3300046535 Bacteria 1065
480 Ga0495587_0004792 3300046536 Bacteria 8884
481 Ga0495587_0008810 3300046536 Bacteria 6475
482 Ga0495587_0248222 3300046536 Bacteria 1001
483 Ga0495609_0169701 3300046538 Bacteria 922
484 Ga0495621_0020340 3300046539 Bacteria 2177
485 Ga0495645_0069926 3300046543 Bacteria 2534
486 Ga0495645_0215508 3300046543 Bacteria 1294
487 Ga0495622_0000966 3300046557 Bacteria 15427
488 Ga0495667_0000018 3300046559 Bacteria 188610
489 Ga0495668_0124422 3300046616 Bacteria 1411
490 Ga0495634_0000235 3300046642 Bacteria 51684
491 Ga0495634_0024348 3300046642 Bacteria 4247
492 Ga0495634_0071921 3300046642 Bacteria 2276
493 Ga0495634_0844816 3300046642 Unclassified 520
494 Ga0495625_0000756 3300046660 Bacteria 45145
495 Ga0495625_0259088 3300046660 Bacteria 1126
496 Ga0495635_0000044 3300046663 Bacteria 83945
497 Ga0495635_0080583 3300046663 Bacteria 2228
498 Ga0495588_0000134 3300046674 Bacteria 117581
499 Ga0495657_0000004 3300046675 Bacteria 266465
500 Ga0495657_0008510 3300046675 Bacteria 7844
501 Ga0495599_0005863 3300046678 Bacteria 7379
502 Ga0495623_0240779 3300046679 Bacteria 1022
503 Ga0495646_0114920 3300046680 Bacteria 1529
504 Ga0495646_0318782 3300046680 Bacteria 819
505 Ga0495647_0000018 3300046681 Bacteria 81701
506 Ga0495647_0009304 3300046681 Bacteria 3324
507 Ga0495647_0026556 3300046681 Bacteria 2122
508 Ga0495647_0312348 3300046681 Bacteria 710
509 Ga0495658_0000034 3300046683 Bacteria 69176
510 Ga0495669_0000033 3300046684 Bacteria 98629
511 Ga0495669_0338946 3300046684 Bacteria 726
512 Ga0495613_0000200 3300046689 Bacteria 58821
513 Ga0495613_0000801 3300046689 Bacteria 24391
514 Ga0495624_0000097 3300046690 Bacteria 58715
515 Ga0495624_0000647 3300046690 Bacteria 27259
516 Ga0495624_0066749 3300046690 Bacteria 2245
517 Ga0495670_0012763 3300046691 Bacteria 4131
518 Ga0495649_0011134 3300046694 Bacteria 5292
519 Ga0495600_0008294 3300046809 Bacteria 6376
520 Ga0495604_0000055 3300047317 Bacteria 100430
521 Ga0495604_0000137 3300047317 Bacteria 62542
522 Ga0495604_0134406 3300047317 Bacteria 1774
523 Ga0495674_0000064 3300047319 Bacteria 71275
524 Ga0495674_0966703 3300047319 Bacteria 654
525 Ga0495672_0085884 3300047320 Bacteria 1742
526 Ga0495672_0103061 3300047320 Bacteria 1544
527 Ga0495676_0002521 3300047321 Bacteria 16308
528 Ga0495676_0005015 3300047321 Bacteria 12143
529 Ga0495676_0129577 3300047321 Bacteria 1823
530 Ga0495676_0182608 3300047321 Bacteria 1469
531 Ga0495676_0912442 3300047321 Bacteria 562
532 Ga0495680_0001229 3300047322 Bacteria 28095
533 Ga0495680_0003149 3300047322 Bacteria 16432
534 Ga0495680_0064781 3300047322 Bacteria 2801
535 Ga0495680_0161675 3300047322 Bacteria 1626
536 Ga0495680_0173243 3300047322 Bacteria 1561
537 Ga0495680_0222832 3300047322 Bacteria 1346
538 Ga0495680_0689477 3300047322 Unclassified 676
539 Ga0495675_0000842 3300047444 Bacteria 18758
540 Ga0495679_052801 3300047446 Bacteria 1215
541 Ga0495685_166614 3300047447 Bacteria 712
542 Ga0495684_0062931 3300047471 Bacteria 2822
543 Ga0495684_0261664 3300047471 Bacteria 1255
544 Ga0495684_0721404 3300047471 Bacteria 659
545 Ga0495686_0110686 3300047472 Bacteria 1647
546 Ga0495593_0423071 3300047673 Bacteria 666
547 Ga0495602_0000041 3300048088 Bacteria 126954
548 Ga0495602_0001343 3300048088 Bacteria 24288
549 Ga0495602_0073582 3300048088 Bacteria 2908
550 Ga0495602_0196005 3300048088 Bacteria 1544
551 Ga0495602_0238066 3300048088 Bacteria 1363
552 Ga0495602_0943505 3300048088 Bacteria 572
553 Ga0495614_0330026 3300048089 Bacteria 708
554 Ga0496100_0000002 3300048903 Bacteria 489057
555 Ga0496100_0013418 3300048903 Bacteria 4725
556 Ga0496101_0000001 3300048904 Bacteria 489057
557 Ga0496101_0000062 3300048904 Bacteria 126595
558 Ga0496102_0000039 3300048905 Bacteria 198306
559 Ga0496102_0039947 3300048905 Bacteria 4242
560 Ga0496102_0913975 3300048905 Bacteria 799
561 Ga0496103_0000008 3300048906 Bacteria 340474
562 Ga0496103_0162091 3300048906 Bacteria 1434
563 Ga0496103_0305146 3300048906 Bacteria 1024
564 Ga0496104_0000004 3300048907 Bacteria 641830
565 Ga0496104_0000009 3300048907 Bacteria 488055
566 Ga0496104_0000257 3300048907 Bacteria 46964
567 Ga0496104_0027266 3300048907 Bacteria 5287
568 Ga0496105_0000001 3300048908 Bacteria 1328178
569 Ga0496105_0000007 3300048908 Bacteria 339658
570 Ga0496105_0000174 3300048908 Bacteria 42932
571 Ga0496105_0147700 3300048908 Unclassified 1933
572 Ga0496105_0388642 3300048908 Bacteria 1109
573 Ga0496106_0000084 3300048909 Bacteria 74135
574 Ga0496106_0000122 3300048909 Bacteria 59816
575 Ga0496106_0100801 3300048909 Bacteria 2239
576 Ga0496107_0000003 3300048910 Bacteria 304038
577 Ga0496107_0002178 3300048910 Bacteria 12583
578 Ga0496107_0180671 3300048910 Bacteria 1566
579 Ga0496107_0336461 3300048910 Bacteria 1123
580 Ga0496107_0419227 3300048910 Bacteria 995
581 Ga0496108_0000001 3300048911 Bacteria 919044
582 Ga0496108_0000175 3300048911 Bacteria 59373
583 Ga0496108_0000187 3300048911 Bacteria 57568
584 Ga0496108_0056875 3300048911 Bacteria 3286
585 Ga0496108_0870309 3300048911 Bacteria 775
586 Ga0496108_1136530 3300048911 Bacteria 662
587 Ga0496108_1529048 3300048911 Bacteria 554
588 Ga0496109_0000003 3300048912 Bacteria 420862
589 Ga0496109_0000121 3300048912 Bacteria 81487
590 Ga0496109_0000611 3300048912 Bacteria 29848
591 Ga0496109_0009604 3300048912 Bacteria 8250
592 Ga0496109_0023749 3300048912 Bacteria 5442
593 Ga0496109_0209551 3300048912 Bacteria 1833
594 Ga0496109_0281350 3300048912 Bacteria 1568
595 Ga0496109_1687520 3300048912 Bacteria 567
596 Ga0496110_0001510 3300048913 Bacteria 16887
597 Ga0496110_0067647 3300048913 Bacteria 3161
598 Ga0496110_0080699 3300048913 Bacteria 2899
599 Ga0496110_0333323 3300048913 Bacteria 1382
600 Ga0496110_0816121 3300048913 Bacteria 837
601 Ga0496110_0965365 3300048913 Bacteria 759
602 Ga0496111_0000009 3300048914 Bacteria 93943
603 Ga0496111_0274474 3300048914 Bacteria 1251
604 Ga0496111_0669504 3300048914 Bacteria 756
605 Ga0496111_0757278 3300048914 Bacteria 704
606 Ga0496112_0000006 3300048915 Bacteria 365227
607 Ga0496112_0010135 3300048915 Bacteria 8537
608 Ga0496112_0568336 3300048915 Unclassified 1067
609 Ga0496112_0587354 3300048915 Bacteria 1046
610 Ga0496113_0000073 3300048916 Bacteria 44302
611 Ga0496113_0124930 3300048916 Bacteria 2014
612 Ga0496113_0636032 3300048916 Bacteria 853
613 Ga0496114_0000014 3300048917 Bacteria 297902
614 Ga0496114_0859474 3300048917 Bacteria 787
615 Ga0496114_1001757 3300048917 Bacteria 719
616 Ga0496115_0000003 3300048918 Bacteria 354994
617 Ga0496115_0000920 3300048918 Bacteria 21370
618 Ga0496117_0001988 3300048920 Bacteria 27154
619 Ga0496117_0136149 3300048920 Bacteria 1479
620 Ga0496118_0000373 3300048921 Bacteria 75473
621 Ga0496118_0052458 3300048921 Bacteria 3110
622 Ga0496118_0281467 3300048921 Bacteria 925
623 Ga0496118_0479522 3300048921 Bacteria 624
624 Ga0496119_0018509 3300048922 Bacteria 5179
625 Ga0496119_0021841 3300048922 Bacteria 4607
626 Ga0496119_0032630 3300048922 Bacteria 3467
627 Ga0496120_0008890 3300048923 Bacteria 7194
628 Ga0496121_0020360 3300048924 Bacteria 6574
629 Ga0496121_0026490 3300048924 Bacteria 5461
630 Ga0496121_0082975 3300048924 Bacteria 2531
631 Ga0496121_0175748 3300048924 Bacteria 1550
632 Ga0496121_0449362 3300048924 Bacteria 831
633 Ga0496124_0202775 3300048927 Bacteria 1507
634 Ga0496124_0303628 3300048927 Bacteria 1151
635 Ga0496124_0809907 3300048927 Bacteria 579
636 Ga0496125_0038435 3300048928 Bacteria 4142
637 Ga0496125_0077358 3300048928 Bacteria 2565
638 Ga0496125_0079512 3300048928 Bacteria 2515
639 Ga0496126_0010117 3300048929 Bacteria 9937
640 Ga0496126_0156978 3300048929 Bacteria 1946
641 Ga0496126_0510065 3300048929 Bacteria 960
642 Ga0501031_0005273 3300049568 Bacteria 8423
643 Ga0501032_0006818 3300049569 Bacteria 8381
644 Ga0501032_0782793 3300049569 Unclassified 603
645 Ga0501033_0008144 3300049570 Bacteria 8116
646 Ga0501034_0090987 3300049571 Bacteria 3049
647 Ga0501036_0009217 3300049572 Bacteria 8113
648 Ga0501036_1263342 3300049572 Bacteria 601
649 Ga0501037_0036552 3300049573 Bacteria 3619
650 Ga0501038_0010697 3300049574 Bacteria 8390
651 Ga0501039_0020768 3300049575 Bacteria 5033
652 Ga0501040_0005660 3300049576 Bacteria 8074
653 Ga0501041_0620161 3300049577 Unclassified 691
654 Ga0501042_0023246 3300049578 Bacteria 4336
655 Ga0501042_0162121 3300049578 Bacteria 1613
656 Ga0501042_0365913 3300049578 Bacteria 1043
657 Ga0501043_0008404 3300049579 Bacteria 8130
658 Ga0501043_0459610 3300049579 Unclassified 955
659 Ga0501046_0003232 3300049580 Bacteria 14970
660 Ga0501046_0502843 3300049580 Bacteria 868
661 Ga0501047_0000715 3300049581 Bacteria 34573
662 Ga0501047_0011367 3300049581 Bacteria 8426
663 Ga0501047_0069611 3300049581 Bacteria 3388
664 Ga0501047_0099334 3300049581 Bacteria 2789
665 Ga0501047_0308165 3300049581 Bacteria 1424
666 Ga0501048_0007912 3300049582 Bacteria 8050
667 Ga0501067_0038047 3300049583 Bacteria 2672
668 Ga0501068_0003782 3300049584 Bacteria 8200
669 Ga0501068_0159424 3300049584 Bacteria 1422
670 Ga0501069_0001977 3300049585 Bacteria 10249
671 Ga0501069_0241161 3300049585 Unclassified 1053
672 Ga0501069_0672843 3300049585 Unclassified 623
673 Ga0501070_0000676 3300049586 Bacteria 31296
674 Ga0501070_0009160 3300049586 Bacteria 8373
675 Ga0501070_0067838 3300049586 Bacteria 2954
676 Ga0501070_0204705 3300049586 Bacteria 1620
677 Ga0501070_0246197 3300049586 Bacteria 1463
678 Ga0501070_0859228 3300049586 Bacteria 709
679 Ga0501070_1469361 3300049586 Bacteria 516
680 Ga0501071_0045682 3300049587 Bacteria 3144
681 Ga0501071_1418727 3300049587 Unclassified 536
682 Ga0501072_0356704 3300049588 Bacteria 1161
683 Ga0501072_1520938 3300049588 Unclassified 516
684 Ga0501073_0008844 3300049589 Bacteria 7447
685 Ga0501074_0007273 3300049590 Bacteria 8002
686 Ga0501074_0074544 3300049590 Bacteria 2436
687 Ga0501075_0006281 3300049591 Bacteria 8166
688 Ga0501076_0932483 3300049592 Unclassified 716
689 Ga0501079_0007770 3300049741 Bacteria 8118
690 Ga0501079_0015295 3300049741 Bacteria 5854
691 Ga0501079_1120633 3300049741 Unclassified 620
692 Ga0501080_0020947 3300049742 Bacteria 6051
693 Ga0501081_0073889 3300049743 Bacteria 2378
694 Ga0501083_0001648 3300049744 Bacteria 15232
695 Ga0501083_0011652 3300049744 Bacteria 6168
696 Ga0501083_0021931 3300049744 Bacteria 4434
697 Ga0501035_0000571 3300049822 Bacteria 40766
698 Ga0501035_0246910 3300049822 Unclassified 1517
699 Ga0501035_1248753 3300049822 Bacteria 575
700 Ga0501044_0004142 3300049823 Bacteria 16282
701 Ga0501044_0014768 3300049823 Bacteria 8419
702 Ga0501044_0097325 3300049823 Bacteria 2964
703 Ga0501044_1155353 3300049823 Bacteria 643
704 Ga0501045_0724333 3300049824 Unclassified 734
705 nmdc:mga0yw44_209692_c1 3300050492 Bacteria 1288
706 nmdc:mga0qj67_116694_c1 3300050509 Unclassified 2157
707 nmdc:mga0rr50_122227_c1 3300050513 Bacteria 2074
708 nmdc:mga0a205_273_c2 3300050515 Bacteria 15047
709 nmdc:mga0a205_6183_c1 3300050515 Bacteria 9940
710 Ga0495601_0000013 3300053077 Bacteria 226476
711 Ga0495601_0000264 3300053077 Bacteria 28275
712 Ga0495601_0038283 3300053077 Bacteria 2998
713 Ga0495601_0095157 3300053077 Unclassified 1920
714 Ga0495601_0175811 3300053077 Bacteria 1399
715 Ga0495601_0195114 3300053077 Bacteria 1323
716 Ga0495601_0316438 3300053077 Bacteria 1016
717 Ga0495601_0363817 3300053077 Bacteria 940
718 Ga0495612_0000060 3300053078 Bacteria 49047
719 Ga0495612_0022469 3300053078 Bacteria 2527
720 Ga0495612_0033638 3300053078 Bacteria 2075
721 Ga0495612_0038282 3300053078 Bacteria 1949
722 Ga0495612_0046299 3300053078 Bacteria 1781
723 Ga0495655_0000001 3300053083 Bacteria 419518
724 Ga0495595_0000003 3300053084 Bacteria 266465
725 Ga0495595_0000053 3300053084 Bacteria 59851
726 Ga0495595_0067347 3300053084 Bacteria 1687
727 Ga0495595_0390017 3300053084 Bacteria 705
728 Ga0495619_0000025 3300053085 Bacteria 167905
729 Ga0495619_0000116 3300053085 Bacteria 58748
730 Ga0495619_0000782 3300053085 Bacteria 20846
731 Ga0495619_0001012 3300053085 Bacteria 18401
732 Ga0495619_0001275 3300053085 Bacteria 16532
733 Ga0495619_0004173 3300053085 Bacteria 9228
734 Ga0495619_0005899 3300053085 Bacteria 7761
735 Ga0495619_0161980 3300053085 Viruses 1545
736 Ga0500566_0007596 3300053094 Bacteria 6424
737 Ga0500641_0003883 3300053096 Bacteria 5283
738 Ga0500650_0179394 3300053098 Bacteria 971
739 Ga0500595_040628 3300053119 Bacteria 1499
740 Ga0500614_000451 3300053123 Bacteria 10624
741 Ga0500628_000010 3300053129 Bacteria 122210
742 Ga0500658_0130638 3300053134 Bacteria 1120
743 Ga0501084_0493860 3300054114 Unclassified 1034
744 Ga0590077_023859 3300059426 Bacteria 1312
745 Ga0587092_018905 3300059512 Bacteria 1045
746 Ga0501082_0072467 3300060353 Bacteria 2967
747 Ga0501082_0310180 3300060353 Bacteria 1374
748 Ga0501082_1894819 3300060353 Unclassified 520

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100002529 Ga0070712_1000025296 118
2 3300005441 Ga0070700_100274997 Ga0070700_1002749971 119
3 3300049578 Ga0501042_0365913 Ga0501042_0365913_400_762 119
4 3300002239 JGI24034J26672_10000986 JGI24034J26672_100009864 120
5 3300002244 JGI24742J22300_10001987 JGI24742J22300_100019874 120
6 3300003659 JGI25404J52841_10005383 JGI25404J52841_100053832 120
7 3300005327 Ga0070658_10761878 Ga0070658_107618782 120
8 3300005329 Ga0070683_100021012 Ga0070683_1000210122 120
9 3300005329 Ga0070683_100021782 Ga0070683_1000217827 120
10 3300005329 Ga0070683_100030699 Ga0070683_1000306994 120
11 3300005329 Ga0070683_100051279 Ga0070683_1000512793 120
12 3300005329 Ga0070683_100481941 Ga0070683_1004819412 120
13 3300005329 Ga0070683_100710386 Ga0070683_1007103862 120
14 3300005329 Ga0070683_101635647 Ga0070683_1016356471 120
15 3300005330 Ga0070690_100217573 Ga0070690_1002175732 120
16 3300005331 Ga0070670_100249805 Ga0070670_1002498052 120
17 3300005333 Ga0070677_10000022 Ga0070677_1000002219 120
18 3300005335 Ga0070666_10000484 Ga0070666_1000048415 120
19 3300005335 Ga0070666_10381580 Ga0070666_103815801 120
20 3300005336 Ga0070680_100241753 Ga0070680_1002417532 120
21 3300005337 Ga0070682_100000099 Ga0070682_100000099103 120
22 3300005337 Ga0070682_100000150 Ga0070682_10000015061 120
23 3300005337 Ga0070682_100709049 Ga0070682_1007090492 120
24 3300005338 Ga0068868_100002756 Ga0068868_1000027562 120
25 3300005338 Ga0068868_100006916 Ga0068868_1000069166 120
26 3300005339 Ga0070660_100366173 Ga0070660_1003661732 120
27 3300005340 Ga0070689_100597270 Ga0070689_1005972701 120
28 3300005341 Ga0070691_10000032 Ga0070691_1000003218 120
29 3300005341 Ga0070691_10002218 Ga0070691_100022182 120
30 3300005341 Ga0070691_10391580 Ga0070691_103915802 120
31 3300005343 Ga0070687_100515363 Ga0070687_1005153632 120
32 3300005344 Ga0070661_100000102 Ga0070661_1000001026 120
33 3300005347 Ga0070668_100051947 Ga0070668_1000519473 120
34 3300005347 Ga0070668_100382805 Ga0070668_1003828052 120
35 3300005353 Ga0070669_101593969 Ga0070669_1015939691 120
36 3300005354 Ga0070675_100000027 Ga0070675_10000002711 120
37 3300005356 Ga0070674_100000056 Ga0070674_10000005639 120
38 3300005356 Ga0070674_100000088 Ga0070674_10000008837 120
39 3300005356 Ga0070674_100713104 Ga0070674_1007131042 120
40 3300005364 Ga0070673_100007829 Ga0070673_1000078294 120
41 3300005365 Ga0070688_100001250 Ga0070688_1000012502 120
42 3300005365 Ga0070688_100001531 Ga0070688_10000153111 120
43 3300005365 Ga0070688_100123262 Ga0070688_1001232622 120
44 3300005366 Ga0070659_100022916 Ga0070659_1000229162 120
45 3300005366 Ga0070659_100121688 Ga0070659_1001216883 120
46 3300005367 Ga0070667_100006153 Ga0070667_1000061537 120
47 3300005367 Ga0070667_100008220 Ga0070667_1000082205 120
48 3300005367 Ga0070667_100040138 Ga0070667_1000401383 120
49 3300005367 Ga0070667_100296404 Ga0070667_1002964042 120
50 3300005367 Ga0070667_101118584 Ga0070667_1011185842 120
51 3300005406 Ga0070703_10366030 Ga0070703_103660301 120
52 3300005435 Ga0070714_100087123 Ga0070714_1000871232 120
53 3300005436 Ga0070713_100000085 Ga0070713_1000000852 120
54 3300005436 Ga0070713_101720364 Ga0070713_1017203642 120
55 3300005438 Ga0070701_10467572 Ga0070701_104675722 120
56 3300005439 Ga0070711_100014274 Ga0070711_1000142742 120
57 3300005439 Ga0070711_100212262 Ga0070711_1002122622 120
58 3300005441 Ga0070700_100865574 Ga0070700_1008655742 120
59 3300005441 Ga0070700_100930908 Ga0070700_1009309082 120
60 3300005455 Ga0070663_100000073 Ga0070663_10000007319 120
61 3300005455 Ga0070663_100978723 Ga0070663_1009787232 120
62 3300005456 Ga0070678_100011801 Ga0070678_1000118015 120
63 3300005456 Ga0070678_100377494 Ga0070678_1003774942 120
64 3300005457 Ga0070662_100000004 Ga0070662_100000004119 120
65 3300005457 Ga0070662_100610838 Ga0070662_1006108382 120
66 3300005458 Ga0070681_10115322 Ga0070681_101153221 120
67 3300005458 Ga0070681_10134847 Ga0070681_101348472 120
68 3300005459 Ga0068867_100022123 Ga0068867_1000221232 120
69 3300005466 Ga0070685_10001410 Ga0070685_100014102 120
70 3300005466 Ga0070685_10001719 Ga0070685_100017192 120
71 3300005466 Ga0070685_10213984 Ga0070685_102139842 120
72 3300005466 Ga0070685_11283907 Ga0070685_112839071 120
73 3300005530 Ga0070679_100000240 Ga0070679_10000024021 120
74 3300005530 Ga0070679_100037654 Ga0070679_1000376546 120
75 3300005535 Ga0070684_100010674 Ga0070684_1000106745 120
76 3300005535 Ga0070684_100039844 Ga0070684_1000398443 120
77 3300005535 Ga0070684_100560496 Ga0070684_1005604961 120
78 3300005535 Ga0070684_100660511 Ga0070684_1006605112 120
79 3300005535 Ga0070684_101594046 Ga0070684_1015940462 120
80 3300005535 Ga0070684_102109346 Ga0070684_1021093461 120
81 3300005539 Ga0068853_100083884 Ga0068853_1000838842 120
82 3300005539 Ga0068853_100132587 Ga0068853_1001325873 120
83 3300005539 Ga0068853_100213494 Ga0068853_1002134942 120
84 3300005539 Ga0068853_100374102 Ga0068853_1003741022 120
85 3300005543 Ga0070672_100000293 Ga0070672_1000002932 120
86 3300005544 Ga0070686_100561225 Ga0070686_1005612252 120
87 3300005545 Ga0070695_100355542 Ga0070695_1003555422 120
88 3300005546 Ga0070696_100909370 Ga0070696_1009093702 120
89 3300005547 Ga0070693_101266764 Ga0070693_1012667641 120
90 3300005548 Ga0070665_100000106 Ga0070665_10000010633 120
91 3300005548 Ga0070665_100001435 Ga0070665_1000014352 120
92 3300005548 Ga0070665_100012149 Ga0070665_1000121496 120
93 3300005548 Ga0070665_100017889 Ga0070665_1000178893 120
94 3300005548 Ga0070665_100048627 Ga0070665_1000486272 120
95 3300005548 Ga0070665_100139966 Ga0070665_1001399663 120
96 3300005548 Ga0070665_100299609 Ga0070665_1002996092 120
97 3300005548 Ga0070665_101626686 Ga0070665_1016266861 120
98 3300005549 Ga0070704_100333123 Ga0070704_1003331232 120
99 3300005563 Ga0068855_100242003 Ga0068855_1002420033 120
100 3300005563 Ga0068855_100473624 Ga0068855_1004736242 120
101 3300005564 Ga0070664_100025344 Ga0070664_1000253442 120
102 3300005577 Ga0068857_100192498 Ga0068857_1001924982 120
103 3300005577 Ga0068857_101622644 Ga0068857_1016226441 120
104 3300005578 Ga0068854_100000095 Ga0068854_10000009549 120
105 3300005578 Ga0068854_100022643 Ga0068854_1000226434 120
106 3300005614 Ga0068856_100008468 Ga0068856_10000846812 120
107 3300005614 Ga0068856_100026367 Ga0068856_1000263673 120
108 3300005614 Ga0068856_100076878 Ga0068856_1000768782 120
109 3300005614 Ga0068856_100320326 Ga0068856_1003203262 120
110 3300005614 Ga0068856_100509791 Ga0068856_1005097912 120
111 3300005614 Ga0068856_100851510 Ga0068856_1008515101 120
112 3300005615 Ga0070702_100087262 Ga0070702_1000872622 120
113 3300005616 Ga0068852_100000006 Ga0068852_100000006158 120
114 3300005616 Ga0068852_101705344 Ga0068852_1017053442 120
115 3300005617 Ga0068859_100549800 Ga0068859_1005498002 120
116 3300005718 Ga0068866_10000001 Ga0068866_10000001404 120
117 3300005718 Ga0068866_10000273 Ga0068866_100002735 120
118 3300005718 Ga0068866_10530918 Ga0068866_105309182 120
119 3300005719 Ga0068861_100149280 Ga0068861_1001492803 120
120 3300005719 Ga0068861_100673012 Ga0068861_1006730122 120
121 3300005719 Ga0068861_102404766 Ga0068861_1024047662 120
122 3300005834 Ga0068851_10003531 Ga0068851_100035315 120
123 3300005834 Ga0068851_10029447 Ga0068851_100294473 120
124 3300005840 Ga0068870_10319764 Ga0068870_103197642 120
125 3300005841 Ga0068863_100000342 Ga0068863_10000034259 120
126 3300005841 Ga0068863_100039183 Ga0068863_1000391836 120
127 3300005841 Ga0068863_100380143 Ga0068863_1003801431 120
128 3300005841 Ga0068863_101010368 Ga0068863_1010103682 120
129 3300005841 Ga0068863_101165486 Ga0068863_1011654861 120
130 3300005842 Ga0068858_100000009 Ga0068858_100000009188 120
131 3300005842 Ga0068858_100000091 Ga0068858_10000009187 120
132 3300005842 Ga0068858_100097996 Ga0068858_1000979963 120
133 3300005842 Ga0068858_102318158 Ga0068858_1023181581 120
134 3300005842 Ga0068858_102552791 Ga0068858_1025527911 120
135 3300005843 Ga0068860_100008191 Ga0068860_1000081915 120
136 3300005843 Ga0068860_101338975 Ga0068860_1013389752 120
137 3300005843 Ga0068860_101558293 Ga0068860_1015582932 120
138 3300005844 Ga0068862_100000050 Ga0068862_100000050130 120
139 3300005937 Ga0081455_10012787 Ga0081455_100127874 120
140 3300005937 Ga0081455_10056374 Ga0081455_100563742 120
141 3300005983 Ga0081540_1000049 Ga0081540_100004925 120
142 3300005985 Ga0081539_10001097 Ga0081539_1000109738 120
143 3300006038 Ga0075365_11049057 Ga0075365_110490571 120
144 3300006038 Ga0075365_11225240 Ga0075365_112252402 120
145 3300006163 Ga0070715_10000001 Ga0070715_10000001372 120
146 3300006173 Ga0070716_100446457 Ga0070716_1004464572 120
147 3300006175 Ga0070712_100512501 Ga0070712_1005125012 120
148 3300006175 Ga0070712_101842455 Ga0070712_1018424552 120
149 3300006237 Ga0097621_100195886 Ga0097621_1001958862 120
150 3300006237 Ga0097621_100792550 Ga0097621_1007925502 120
151 3300006358 Ga0068871_100421524 Ga0068871_1004215242 120
152 3300006846 Ga0075430_100128424 Ga0075430_1001284242 120
153 3300006852 Ga0075433_10002122 Ga0075433_1000212211 120
154 3300006852 Ga0075433_10042449 Ga0075433_100424492 120
155 3300006881 Ga0068865_100000023 Ga0068865_100000023104 120
156 3300006881 Ga0068865_100590369 Ga0068865_1005903691 120
157 3300006931 Ga0097620_100549774 Ga0097620_1005497742 120
158 3300007076 Ga0075435_100198052 Ga0075435_1001980522 120
159 3300009092 Ga0105250_10121649 Ga0105250_101216492 120
160 3300009093 Ga0105240_10514333 Ga0105240_105143332 120
161 3300009093 Ga0105240_10653056 Ga0105240_106530562 120
162 3300009093 Ga0105240_10808036 Ga0105240_108080362 120
163 3300009093 Ga0105240_12283716 Ga0105240_122837161 120
164 3300009094 Ga0111539_12512243 Ga0111539_125122431 120
165 3300009098 Ga0105245_10000266 Ga0105245_100002665 120
166 3300009098 Ga0105245_10001339 Ga0105245_100013393 120
167 3300009098 Ga0105245_10095693 Ga0105245_100956932 120
168 3300009098 Ga0105245_10251557 Ga0105245_102515572 120
169 3300009098 Ga0105245_12572472 Ga0105245_125724721 120
170 3300009101 Ga0105247_10000316 Ga0105247_1000031647 120
171 3300009101 Ga0105247_10004636 Ga0105247_100046362 120
172 3300009101 Ga0105247_10229738 Ga0105247_102297382 120
173 3300009101 Ga0105247_10589126 Ga0105247_105891262 120
174 3300009101 Ga0105247_10929424 Ga0105247_109294241 120
175 3300009101 Ga0105247_11003398 Ga0105247_110033981 120
176 3300009148 Ga0105243_10003688 Ga0105243_1000368810 120
177 3300009148 Ga0105243_11191724 Ga0105243_111917241 120
178 3300009148 Ga0105243_11579662 Ga0105243_115796621 120
179 3300009174 Ga0105241_10471481 Ga0105241_104714812 120
180 3300009174 Ga0105241_10799124 Ga0105241_107991242 120
181 3300009176 Ga0105242_10000032 Ga0105242_1000003263 120
182 3300009176 Ga0105242_10000454 Ga0105242_1000045424 120
183 3300009176 Ga0105242_10011362 Ga0105242_100113626 120
184 3300009176 Ga0105242_10118359 Ga0105242_101183592 120
185 3300009176 Ga0105242_10379023 Ga0105242_103790232 120
186 3300009177 Ga0105248_10000008 Ga0105248_10000008317 120
187 3300009177 Ga0105248_11648337 Ga0105248_116483372 120
188 3300009177 Ga0105248_12733215 Ga0105248_127332151 120
189 3300009545 Ga0105237_10310600 Ga0105237_103106002 120
190 3300009545 Ga0105237_10373385 Ga0105237_103733852 120
191 3300009551 Ga0105238_10000011 Ga0105238_10000011203 120
192 3300009551 Ga0105238_11280917 Ga0105238_112809172 120
193 3300009553 Ga0105249_10000080 Ga0105249_1000008020 120
194 3300009553 Ga0105249_11467432 Ga0105249_114674322 120
195 3300010375 Ga0105239_10474610 Ga0105239_104746102 120
196 3300010375 Ga0105239_10551321 Ga0105239_105513212 120
197 3300010375 Ga0105239_12188673 Ga0105239_121886732 120
198 3300010375 Ga0105239_12427357 Ga0105239_124273572 120
199 3300011119 Ga0105246_10812260 Ga0105246_108122602 120
200 3300011119 Ga0105246_11311961 Ga0105246_113119611 120
201 3300013102 Ga0157371_10004749 Ga0157371_100047492 120
202 3300013104 Ga0157370_10059766 Ga0157370_100597663 120
203 3300013104 Ga0157370_10062901 Ga0157370_100629013 120
204 3300013104 Ga0157370_10078808 Ga0157370_100788083 120
205 3300013105 Ga0157369_10000020 Ga0157369_10000020201 120
206 3300013296 Ga0157374_10057293 Ga0157374_100572934 120
207 3300013296 Ga0157374_10195547 Ga0157374_101955474 120
208 3300013296 Ga0157374_11439274 Ga0157374_114392741 120
209 3300013296 Ga0157374_12009386 Ga0157374_120093862 120
210 3300013297 Ga0157378_10009985 Ga0157378_100099853 120
211 3300013297 Ga0157378_10127991 Ga0157378_101279911 120
212 3300013297 Ga0157378_10136142 Ga0157378_101361422 120
213 3300013306 Ga0163162_12398389 Ga0163162_123983891 120
214 3300013306 Ga0163162_12536887 Ga0163162_125368872 120
215 3300013307 Ga0157372_10000112 Ga0157372_1000011259 120
216 3300013307 Ga0157372_10314251 Ga0157372_103142512 120
217 3300013308 Ga0157375_10048495 Ga0157375_100484952 120
218 3300013308 Ga0157375_10050351 Ga0157375_100503512 120
219 3300013308 Ga0157375_10956266 Ga0157375_109562662 120
220 3300013308 Ga0157375_11117495 Ga0157375_111174951 120
221 3300013308 Ga0157375_11507555 Ga0157375_115075552 120
222 3300013308 Ga0157375_12056879 Ga0157375_120568792 120
223 3300013308 Ga0157375_12525181 Ga0157375_125251811 120
224 3300014325 Ga0163163_10092414 Ga0163163_100924144 120
225 3300014325 Ga0163163_10706151 Ga0163163_107061512 120
226 3300014325 Ga0163163_11388125 Ga0163163_113881251 120
227 3300014325 Ga0163163_11919745 Ga0163163_119197452 120
228 3300014325 Ga0163163_12464328 Ga0163163_124643282 120
229 3300014326 Ga0157380_10000091 Ga0157380_1000009136 120
230 3300014326 Ga0157380_10000253 Ga0157380_1000025327 120
231 3300014326 Ga0157380_10447944 Ga0157380_104479442 120
232 3300014326 Ga0157380_10494203 Ga0157380_104942032 120
233 3300014968 Ga0157379_10035232 Ga0157379_100352322 120
234 3300014968 Ga0157379_10234529 Ga0157379_102345292 120
235 3300014968 Ga0157379_10261552 Ga0157379_102615522 120
236 3300014969 Ga0157376_10185540 Ga0157376_101855402 120
237 3300014969 Ga0157376_11584587 Ga0157376_115845872 120
238 3300017792 Ga0163161_10006589 Ga0163161_100065892 120
239 3300017792 Ga0163161_10093270 Ga0163161_100932702 120
240 3300017792 Ga0163161_10501705 Ga0163161_105017052 120
241 3300020069 Ga0197907_10064860 Ga0197907_100648602 120
242 3300020070 Ga0206356_11109912 Ga0206356_111099122 120
243 3300020076 Ga0206355_1070519 Ga0206355_10705191 120
244 3300020077 Ga0206351_10019693 Ga0206351_100196931 120
245 3300020081 Ga0206354_10838957 Ga0206354_108389571 120
246 3300022467 Ga0224712_10055809 Ga0224712_100558092 120
247 3300025321 Ga0207656_10018770 Ga0207656_100187702 120
248 3300025321 Ga0207656_10020609 Ga0207656_100206092 120
249 3300025885 Ga0207653_10188232 Ga0207653_101882322 120
250 3300025893 Ga0207682_10000005 Ga0207682_1000000528 120
251 3300025898 Ga0207692_10181807 Ga0207692_101818072 120
252 3300025899 Ga0207642_10000002 Ga0207642_10000002123 120
253 3300025899 Ga0207642_10001004 Ga0207642_100010045 120
254 3300025899 Ga0207642_10601508 Ga0207642_106015082 120
255 3300025900 Ga0207710_10000239 Ga0207710_100002392 120
256 3300025900 Ga0207710_10000458 Ga0207710_1000045827 120
257 3300025900 Ga0207710_10489544 Ga0207710_104895441 120
258 3300025900 Ga0207710_10713207 Ga0207710_107132071 120
259 3300025903 Ga0207680_10000901 Ga0207680_100009012 120
260 3300025903 Ga0207680_10009305 Ga0207680_100093052 120
261 3300025905 Ga0207685_10000027 Ga0207685_1000002764 120
262 3300025911 Ga0207654_10423534 Ga0207654_104235342 120
263 3300025911 Ga0207654_10858427 Ga0207654_108584271 120
264 3300025912 Ga0207707_10107414 Ga0207707_101074142 120
265 3300025912 Ga0207707_10218263 Ga0207707_102182631 120
266 3300025913 Ga0207695_10542437 Ga0207695_105424372 120
267 3300025913 Ga0207695_10674534 Ga0207695_106745342 120
268 3300025914 Ga0207671_10542704 Ga0207671_105427042 120
269 3300025915 Ga0207693_10478532 Ga0207693_104785322 120
270 3300025916 Ga0207663_10001546 Ga0207663_100015468 120
271 3300025916 Ga0207663_10034771 Ga0207663_100347712 120
272 3300025917 Ga0207660_10021949 Ga0207660_100219492 120
273 3300025918 Ga0207662_10529436 Ga0207662_105294362 120
274 3300025920 Ga0207649_10000009 Ga0207649_10000009246 120
275 3300025921 Ga0207652_10000044 Ga0207652_1000004472 120
276 3300025921 Ga0207652_10005697 Ga0207652_100056972 120
277 3300025923 Ga0207681_10244121 Ga0207681_102441212 120
278 3300025924 Ga0207694_10000004 Ga0207694_10000004419 120
279 3300025925 Ga0207650_10110064 Ga0207650_101100642 120
280 3300025925 Ga0207650_10608849 Ga0207650_106088491 120
281 3300025926 Ga0207659_10000010 Ga0207659_1000001088 120
282 3300025927 Ga0207687_10000007 Ga0207687_10000007423 120
283 3300025927 Ga0207687_10000013 Ga0207687_1000001341 120
284 3300025927 Ga0207687_10057875 Ga0207687_100578752 120
285 3300025927 Ga0207687_10205045 Ga0207687_102050452 120
286 3300025928 Ga0207700_10000027 Ga0207700_1000002764 120
287 3300025928 Ga0207700_10014365 Ga0207700_100143654 120
288 3300025929 Ga0207664_10075635 Ga0207664_100756352 120
289 3300025931 Ga0207644_10745221 Ga0207644_107452212 120
290 3300025932 Ga0207690_10008293 Ga0207690_100082936 120
291 3300025932 Ga0207690_10021044 Ga0207690_100210443 120
292 3300025933 Ga0207706_10000012 Ga0207706_1000001299 120
293 3300025933 Ga0207706_10541814 Ga0207706_105418142 120
294 3300025934 Ga0207686_10000048 Ga0207686_1000004863 120
295 3300025934 Ga0207686_10000886 Ga0207686_100008865 120
296 3300025934 Ga0207686_10021381 Ga0207686_100213812 120
297 3300025934 Ga0207686_10060538 Ga0207686_100605382 120
298 3300025935 Ga0207709_10013651 Ga0207709_100136512 120
299 3300025935 Ga0207709_10627844 Ga0207709_106278442 120
300 3300025936 Ga0207670_10254855 Ga0207670_102548552 120
301 3300025937 Ga0207669_10000018 Ga0207669_1000001823 120
302 3300025937 Ga0207669_10000090 Ga0207669_1000009023 120
303 3300025938 Ga0207704_10000159 Ga0207704_100001596 120
304 3300025938 Ga0207704_10088099 Ga0207704_100880992 120
305 3300025939 Ga0207665_10467204 Ga0207665_104672042 120
306 3300025940 Ga0207691_10000044 Ga0207691_1000004425 120
307 3300025941 Ga0207711_10000006 Ga0207711_10000006711 120
308 3300025944 Ga0207661_10000139 Ga0207661_1000013933 120
309 3300025944 Ga0207661_10003835 Ga0207661_100038353 120
310 3300025944 Ga0207661_10005409 Ga0207661_100054094 120
311 3300025944 Ga0207661_10042501 Ga0207661_100425012 120
312 3300025944 Ga0207661_10393836 Ga0207661_103938362 120
313 3300025944 Ga0207661_10487831 Ga0207661_104878312 120
314 3300025945 Ga0207679_10029433 Ga0207679_100294335 120
315 3300025945 Ga0207679_10106187 Ga0207679_101061872 120
316 3300025949 Ga0207667_10732922 Ga0207667_107329222 120
317 3300025960 Ga0207651_10030338 Ga0207651_100303383 120
318 3300025961 Ga0207712_10000007 Ga0207712_10000007414 120
319 3300025972 Ga0207668_10014280 Ga0207668_100142805 120
320 3300025972 Ga0207668_10159363 Ga0207668_101593632 120
321 3300025981 Ga0207640_10000038 Ga0207640_1000003864 120
322 3300025981 Ga0207640_10291704 Ga0207640_102917042 120
323 3300025986 Ga0207658_10003939 Ga0207658_100039398 120
324 3300025986 Ga0207658_10016682 Ga0207658_100166824 120
325 3300025986 Ga0207658_10131195 Ga0207658_101311952 120
326 3300025986 Ga0207658_10142777 Ga0207658_101427772 120
327 3300025986 Ga0207658_11530894 Ga0207658_115308942 120
328 3300026023 Ga0207677_10000340 Ga0207677_100003406 120
329 3300026023 Ga0207677_10001552 Ga0207677_1000155212 120
330 3300026035 Ga0207703_10000023 Ga0207703_1000002395 120
331 3300026035 Ga0207703_10002246 Ga0207703_100022462 120
332 3300026041 Ga0207639_10011326 Ga0207639_100113267 120
333 3300026041 Ga0207639_10130284 Ga0207639_101302842 120
334 3300026041 Ga0207639_10344683 Ga0207639_103446832 120
335 3300026041 Ga0207639_10590816 Ga0207639_105908162 120
336 3300026067 Ga0207678_10000380 Ga0207678_1000038022 120
337 3300026067 Ga0207678_10121551 Ga0207678_101215513 120
338 3300026075 Ga0207708_10117292 Ga0207708_101172923 120
339 3300026078 Ga0207702_10000158 Ga0207702_1000015888 120
340 3300026078 Ga0207702_10004391 Ga0207702_100043915 120
341 3300026078 Ga0207702_10020350 Ga0207702_100203502 120
342 3300026078 Ga0207702_10604786 Ga0207702_106047862 120
343 3300026078 Ga0207702_10715601 Ga0207702_107156012 120
344 3300026078 Ga0207702_10736633 Ga0207702_107366332 120
345 3300026088 Ga0207641_10003753 Ga0207641_100037535 120
346 3300026088 Ga0207641_10009107 Ga0207641_100091076 120
347 3300026088 Ga0207641_10466447 Ga0207641_104664471 120
348 3300026088 Ga0207641_12239744 Ga0207641_122397441 120
349 3300026089 Ga0207648_10045789 Ga0207648_100457896 120
350 3300026095 Ga0207676_10000094 Ga0207676_100000942 120
351 3300026116 Ga0207674_10056052 Ga0207674_100560522 120
352 3300026116 Ga0207674_11584883 Ga0207674_115848832 120
353 3300026118 Ga0207675_100324416 Ga0207675_1003244161 120
354 3300026118 Ga0207675_100330783 Ga0207675_1003307831 120
355 3300026118 Ga0207675_102636644 Ga0207675_1026366441 120
356 3300026121 Ga0207683_10103707 Ga0207683_101037073 120
357 3300026121 Ga0207683_10329652 Ga0207683_103296522 120
358 3300026121 Ga0207683_11141100 Ga0207683_111411002 120
359 3300026142 Ga0207698_10000013 Ga0207698_1000001331 120
360 3300026142 Ga0207698_10341848 Ga0207698_103418481 120
361 3300026142 Ga0207698_12450568 Ga0207698_124505681 120
362 3300028379 Ga0268266_10000047 Ga0268266_10000047185 120
363 3300028379 Ga0268266_10000640 Ga0268266_1000064033 120
364 3300028379 Ga0268266_10000822 Ga0268266_1000082236 120
365 3300028379 Ga0268266_10023216 Ga0268266_100232163 120
366 3300028379 Ga0268266_10052672 Ga0268266_100526722 120
367 3300028379 Ga0268266_10553470 Ga0268266_105534701 120
368 3300028379 Ga0268266_11141332 Ga0268266_111413322 120
369 3300028380 Ga0268265_10001568 Ga0268265_100015684 120
370 3300028381 Ga0268264_10033939 Ga0268264_100339393 120
371 3300028381 Ga0268264_10246537 Ga0268264_102465373 120
372 3300028381 Ga0268264_11079643 Ga0268264_110796432 120
373 3300028381 Ga0268264_11285526 Ga0268264_112855262 120
374 3300028556 Ga0265337_1000991 Ga0265337_10009914 120
375 3300028558 Ga0265326_10000252 Ga0265326_1000025226 120
376 3300028563 Ga0265319_1000020 Ga0265319_1000020175 120
377 3300028654 Ga0265322_10000001 Ga0265322_10000001358 120
378 3300028666 Ga0265336_10020027 Ga0265336_100200273 120
379 3300028666 Ga0265336_10064914 Ga0265336_100649143 120
380 3300028800 Ga0265338_10001248 Ga0265338_1000124838 120
381 3300028800 Ga0265338_10079027 Ga0265338_100790271 120
382 3300028800 Ga0265338_10706771 Ga0265338_107067712 120
383 3300029957 Ga0265324_10000498 Ga0265324_1000049816 120
384 3300031240 Ga0265320_10000002 Ga0265320_10000002357 120
385 3300031241 Ga0265325_10006673 Ga0265325_100066738 120
386 3300031242 Ga0265329_10032012 Ga0265329_100320122 120
387 3300031250 Ga0265331_10011308 Ga0265331_100113084 120
388 3300031251 Ga0265327_10000011 Ga0265327_10000011357 120
389 3300031344 Ga0265316_10014310 Ga0265316_100143102 120
390 3300031456 Ga0307513_10586254 Ga0307513_105862542 120
391 3300031595 Ga0265313_10066563 Ga0265313_100665632 120
392 3300031711 Ga0265314_10000062 Ga0265314_1000006291 120
393 3300031712 Ga0265342_10068642 Ga0265342_100686423 120
394 3300032126 Ga0307415_100028982 Ga0307415_1000289824 120
395 3300035117 Ga0373953_0185083 Ga0373953_0185083_485_850 120
396 3300035172 Ga0373955_0190629 Ga0373955_0190629_120_485 120
397 3300035172 Ga0373955_0773905 Ga0373955_0773905_10_372 120
398 3300035725 Ga0373947_0620104 Ga0373947_0620104_221_583 120
399 3300036401 Ga0373937_0102350 Ga0373937_0102350_1257_1619 120
400 3300036401 Ga0373937_1028551 Ga0373937_1028551_286_648 120
401 3300041451 Ga0451791_1087388 Ga0451791_1087388_256_618 120
402 3300041456 Ga0451795_1612883 Ga0451795_1612883_98_460 120
403 3300041459 Ga0451800_0223856 Ga0451800_0223856_341_703 120
404 3300041459 Ga0451800_1612225 Ga0451800_1612225_67_429 120
405 3300041463 Ga0451804_0761410 Ga0451804_0761410_44_406 120
406 3300041463 Ga0451804_1169606 Ga0451804_1169606_140_502 120
407 3300041486 Ga0451807_1367491 Ga0451807_1367491_20_382 120
408 3300041491 Ga0451833_0147399 Ga0451833_0147399_341_703 120
409 3300041494 Ga0451837_1335073 Ga0451837_1335073_100_462 120
410 3300041501 Ga0451845_0187233 Ga0451845_0187233_47_409 120
411 3300041501 Ga0451845_0826631 Ga0451845_0826631_203_568 120
412 3300041505 Ga0451849_0181530 Ga0451849_0181530_64_426 120
413 3300041505 Ga0451849_1137119 Ga0451849_1137119_43_405 120
414 3300041512 Ga0451853_3872250 Ga0451853_3872250_379_741 120
415 3300044694 Ga0466963_0000153 Ga0466963_0000153_24396_24758 120
416 3300044694 Ga0466963_0351274 Ga0466963_0351274_193_555 120
417 3300044694 Ga0466963_0822093 Ga0466963_0822093_234_596 120
418 3300044842 Ga0466957_0009471 Ga0466957_0009471_4458_4820 120
419 3300044842 Ga0466957_0305307 Ga0466957_0305307_660_1022 120
420 3300044901 Ga0466960_0075911 Ga0466960_0075911_324_686 120
421 3300045976 Ga0466967_0000009 Ga0466967_0000009_71306_71668 120
422 3300045976 Ga0466967_0046018 Ga0466967_0046018_1700_2062 120
423 3300045976 Ga0466967_0325174 Ga0466967_0325174_398_766 120
424 3300045976 Ga0466967_0749777 Ga0466967_0749777_387_749 120
425 3300046454 Ga0495592_0001452 Ga0495592_0001452_2646_3008 120
426 3300046454 Ga0495592_0118102 Ga0495592_0118102_227_589 120
427 3300046454 Ga0495592_0230867 Ga0495592_0230867_347_709 120
428 3300046454 Ga0495592_0318931 Ga0495592_0318931_552_914 120
429 3300046454 Ga0495592_0346556 Ga0495592_0346556_392_754 120
430 3300046454 Ga0495592_0433798 Ga0495592_0433798_260_622 120
431 3300046455 Ga0495603_0000016 Ga0495603_0000016_7851_8213 120
432 3300046455 Ga0495603_0002944 Ga0495603_0002944_1558_1920 120
433 3300046455 Ga0495603_0203251 Ga0495603_0203251_650_1012 120
434 3300046459 Ga0495629_0001726 Ga0495629_0001726_2156_2518 120
435 3300046459 Ga0495629_0091023 Ga0495629_0091023_917_1279 120
436 3300046459 Ga0495629_0439386 Ga0495629_0439386_367_729 120
437 3300046460 Ga0495638_0033754 Ga0495638_0033754_1701_2063 120
438 3300046461 Ga0495641_0000228 Ga0495641_0000228_299_661 120
439 3300046461 Ga0495641_0026299 Ga0495641_0026299_1843_2205 120
440 3300046461 Ga0495641_0026720 Ga0495641_0026720_1950_2312 120
441 3300046462 Ga0495651_0033572 Ga0495651_0033572_3451_3813 120
442 3300046463 Ga0495653_0103472 Ga0495653_0103472_1525_1887 120
443 3300046463 Ga0495653_0195977 Ga0495653_0195977_596_958 120
444 3300046463 Ga0495653_0376533 Ga0495653_0376533_522_884 120
445 3300046463 Ga0495653_0530752 Ga0495653_0530752_270_635 120
446 3300046463 Ga0495653_0743304 Ga0495653_0743304_149_514 120
447 3300046473 Ga0495582_0000081 Ga0495582_0000081_30156_30518 120
448 3300046476 Ga0495662_0000019 Ga0495662_0000019_40328_40690 120
449 3300046476 Ga0495662_0007799 Ga0495662_0007799_2766_3128 120
450 3300046477 Ga0495664_0500003 Ga0495664_0500003_198_563 120
451 3300046499 Ga0495594_0000912 Ga0495594_0000912_14697_15059 120
452 3300046499 Ga0495594_0230073 Ga0495594_0230073_296_658 120
453 3300046507 Ga0495606_0000072 Ga0495606_0000072_2148_2510 120
454 3300046511 Ga0495608_0000125 Ga0495608_0000125_40179_40541 120
455 3300046511 Ga0495608_0036028 Ga0495608_0036028_1044_1406 120
456 3300046511 Ga0495608_0050149 Ga0495608_0050149_846_1208 120
457 3300046512 Ga0495610_0067229 Ga0495610_0067229_195_557 120
458 3300046514 Ga0495618_0008119 Ga0495618_0008119_316_678 120
459 3300046515 Ga0495620_0000824 Ga0495620_0000824_934_1296 120
460 3300046516 Ga0495628_0000190 Ga0495628_0000190_25570_25932 120
461 3300046516 Ga0495628_0026801 Ga0495628_0026801_204_566 120
462 3300046516 Ga0495628_0083739 Ga0495628_0083739_1935_2300 120
463 3300046516 Ga0495628_0118617 Ga0495628_0118617_1486_1848 120
464 3300046517 Ga0495630_0000020 Ga0495630_0000020_41219_41581 120
465 3300046517 Ga0495630_0038804 Ga0495630_0038804_740_1102 120
466 3300046517 Ga0495630_0104160 Ga0495630_0104160_180_542 120
467 3300046517 Ga0495630_0325892 Ga0495630_0325892_151_513 120
468 3300046517 Ga0495630_0354390 Ga0495630_0354390_679_1041 120
469 3300046517 Ga0495630_0721763 Ga0495630_0721763_370_732 120
470 3300046520 Ga0495637_0069030 Ga0495637_0069030_882_1244 120
471 3300046522 Ga0495643_0151731 Ga0495643_0151731_662_1024 120
472 3300046523 Ga0495644_0001670 Ga0495644_0001670_1948_2310 120
473 3300046529 Ga0495652_0000546 Ga0495652_0000546_13686_14048 120
474 3300046529 Ga0495652_0007337 Ga0495652_0007337_938_1300 120
475 3300046529 Ga0495652_0739639 Ga0495652_0739639_94_459 120
476 3300046533 Ga0495640_0051375 Ga0495640_0051375_2282_2644 120
477 3300046533 Ga0495640_0159785 Ga0495640_0159785_155_517 120
478 3300046533 Ga0495640_0364061 Ga0495640_0364061_44_409 120
479 3300046535 Ga0495586_0000161 Ga0495586_0000161_9971_10333 120
480 3300046535 Ga0495586_0225639 Ga0495586_0225639_615_980 120
481 3300046536 Ga0495587_0004792 Ga0495587_0004792_638_1000 120
482 3300046536 Ga0495587_0008810 Ga0495587_0008810_760_1122 120
483 3300046536 Ga0495587_0248222 Ga0495587_0248222_19_381 120
484 3300046538 Ga0495609_0169701 Ga0495609_0169701_238_600 120
485 3300046539 Ga0495621_0020340 Ga0495621_0020340_1018_1380 120
486 3300046543 Ga0495645_0069926 Ga0495645_0069926_828_1190 120
487 3300046543 Ga0495645_0215508 Ga0495645_0215508_19_381 120
488 3300046557 Ga0495622_0000966 Ga0495622_0000966_14704_15066 120
489 3300046559 Ga0495667_0000018 Ga0495667_0000018_78470_78832 120
490 3300046616 Ga0495668_0124422 Ga0495668_0124422_1004_1366 120
491 3300046642 Ga0495634_0000235 Ga0495634_0000235_18662_19024 120
492 3300046642 Ga0495634_0024348 Ga0495634_0024348_2953_3315 120
493 3300046642 Ga0495634_0071921 Ga0495634_0071921_494_856 120
494 3300046642 Ga0495634_0844816 Ga0495634_0844816_92_454 120
495 3300046660 Ga0495625_0000756 Ga0495625_0000756_43009_43374 120
496 3300046660 Ga0495625_0259088 Ga0495625_0259088_453_815 120
497 3300046663 Ga0495635_0000044 Ga0495635_0000044_66866_67228 120
498 3300046663 Ga0495635_0080583 Ga0495635_0080583_951_1313 120
499 3300046674 Ga0495588_0000134 Ga0495588_0000134_3648_4010 120
500 3300046675 Ga0495657_0000004 Ga0495657_0000004_163600_163962 120
501 3300046675 Ga0495657_0008510 Ga0495657_0008510_6352_6714 120
502 3300046678 Ga0495599_0005863 Ga0495599_0005863_4763_5125 120
503 3300046679 Ga0495623_0240779 Ga0495623_0240779_107_469 120
504 3300046680 Ga0495646_0114920 Ga0495646_0114920_345_707 120
505 3300046680 Ga0495646_0318782 Ga0495646_0318782_165_527 120
506 3300046681 Ga0495647_0000018 Ga0495647_0000018_63807_64169 120
507 3300046681 Ga0495647_0009304 Ga0495647_0009304_1788_2150 120
508 3300046681 Ga0495647_0026556 Ga0495647_0026556_1670_2032 120
509 3300046681 Ga0495647_0312348 Ga0495647_0312348_298_660 120
510 3300046683 Ga0495658_0000034 Ga0495658_0000034_32656_33018 120
511 3300046684 Ga0495669_0000033 Ga0495669_0000033_78711_79073 120
512 3300046684 Ga0495669_0338946 Ga0495669_0338946_114_476 120
513 3300046689 Ga0495613_0000200 Ga0495613_0000200_25188_25550 120
514 3300046689 Ga0495613_0000801 Ga0495613_0000801_963_1325 120
515 3300046690 Ga0495624_0000097 Ga0495624_0000097_47568_47930 120
516 3300046690 Ga0495624_0000647 Ga0495624_0000647_24707_25069 120
517 3300046690 Ga0495624_0066749 Ga0495624_0066749_287_649 120
518 3300046691 Ga0495670_0012763 Ga0495670_0012763_1501_1863 120
519 3300046694 Ga0495649_0011134 Ga0495649_0011134_4027_4389 120
520 3300046809 Ga0495600_0008294 Ga0495600_0008294_5696_6058 120
521 3300047317 Ga0495604_0000055 Ga0495604_0000055_47359_47721 120
522 3300047317 Ga0495604_0000137 Ga0495604_0000137_39252_39614 120
523 3300047317 Ga0495604_0134406 Ga0495604_0134406_726_1091 120
524 3300047319 Ga0495674_0000064 Ga0495674_0000064_22593_22955 120
525 3300047319 Ga0495674_0966703 Ga0495674_0966703_139_501 120
526 3300047320 Ga0495672_0085884 Ga0495672_0085884_851_1213 120
527 3300047320 Ga0495672_0103061 Ga0495672_0103061_945_1307 120
528 3300047321 Ga0495676_0002521 Ga0495676_0002521_1454_1816 120
529 3300047321 Ga0495676_0005015 Ga0495676_0005015_2593_2955 120
530 3300047321 Ga0495676_0129577 Ga0495676_0129577_453_815 120
531 3300047321 Ga0495676_0182608 Ga0495676_0182608_1070_1432 120
532 3300047321 Ga0495676_0912442 Ga0495676_0912442_150_512 120
533 3300047322 Ga0495680_0001229 Ga0495680_0001229_5311_5673 120
534 3300047322 Ga0495680_0003149 Ga0495680_0003149_10809_11171 120
535 3300047322 Ga0495680_0064781 Ga0495680_0064781_1076_1438 120
536 3300047322 Ga0495680_0161675 Ga0495680_0161675_612_974 120
537 3300047322 Ga0495680_0173243 Ga0495680_0173243_1121_1483 120
538 3300047322 Ga0495680_0222832 Ga0495680_0222832_267_632 120
539 3300047322 Ga0495680_0689477 Ga0495680_0689477_278_640 120
540 3300047444 Ga0495675_0000842 Ga0495675_0000842_2169_2531 120
541 3300047446 Ga0495679_052801 Ga0495679_052801_801_1163 120
542 3300047447 Ga0495685_166614 Ga0495685_166614_22_384 120
543 3300047471 Ga0495684_0062931 Ga0495684_0062931_1644_2006 120
544 3300047471 Ga0495684_0261664 Ga0495684_0261664_322_684 120
545 3300047471 Ga0495684_0721404 Ga0495684_0721404_180_542 120
546 3300047472 Ga0495686_0110686 Ga0495686_0110686_858_1220 120
547 3300047673 Ga0495593_0423071 Ga0495593_0423071_76_438 120
548 3300048088 Ga0495602_0000041 Ga0495602_0000041_85877_86239 120
549 3300048088 Ga0495602_0001343 Ga0495602_0001343_13908_14270 120
550 3300048088 Ga0495602_0073582 Ga0495602_0073582_90_452 120
551 3300048088 Ga0495602_0196005 Ga0495602_0196005_74_436 120
552 3300048088 Ga0495602_0238066 Ga0495602_0238066_914_1276 120
553 3300048088 Ga0495602_0943505 Ga0495602_0943505_46_408 120
554 3300048089 Ga0495614_0330026 Ga0495614_0330026_151_513 120
555 3300048903 Ga0496100_0000002 Ga0496100_0000002_416074_416436 120
556 3300048903 Ga0496100_0013418 Ga0496100_0013418_2155_2520 120
557 3300048904 Ga0496101_0000001 Ga0496101_0000001_416074_416436 120
558 3300048904 Ga0496101_0000062 Ga0496101_0000062_2184_2549 120
559 3300048905 Ga0496102_0000039 Ga0496102_0000039_5766_6128 120
560 3300048905 Ga0496102_0039947 Ga0496102_0039947_676_1038 120
561 3300048905 Ga0496102_0913975 Ga0496102_0913975_406_768 120
562 3300048906 Ga0496103_0000008 Ga0496103_0000008_127021_127383 120
563 3300048906 Ga0496103_0162091 Ga0496103_0162091_670_1032 120
564 3300048906 Ga0496103_0305146 Ga0496103_0305146_495_857 120
565 3300048907 Ga0496104_0000004 Ga0496104_0000004_336792_337154 120
566 3300048907 Ga0496104_0000009 Ga0496104_0000009_279243_279605 120
567 3300048907 Ga0496104_0000257 Ga0496104_0000257_39477_39839 120
568 3300048907 Ga0496104_0027266 Ga0496104_0027266_4248_4610 120
569 3300048908 Ga0496105_0000001 Ga0496105_0000001_304677_305039 120
570 3300048908 Ga0496105_0000007 Ga0496105_0000007_208451_208813 120
571 3300048908 Ga0496105_0000174 Ga0496105_0000174_7126_7488 120
572 3300048908 Ga0496105_0147700 Ga0496105_0147700_1191_1553 120
573 3300048908 Ga0496105_0388642 Ga0496105_0388642_153_515 120
574 3300048909 Ga0496106_0000084 Ga0496106_0000084_72594_72956 120
575 3300048909 Ga0496106_0000122 Ga0496106_0000122_8158_8523 120
576 3300048909 Ga0496106_0100801 Ga0496106_0100801_1021_1383 120
577 3300048910 Ga0496107_0000003 Ga0496107_0000003_64817_65179 120
578 3300048910 Ga0496107_0002178 Ga0496107_0002178_982_1347 120
579 3300048910 Ga0496107_0180671 Ga0496107_0180671_997_1359 120
580 3300048910 Ga0496107_0336461 Ga0496107_0336461_670_1032 120
581 3300048910 Ga0496107_0419227 Ga0496107_0419227_386_748 120
582 3300048911 Ga0496108_0000001 Ga0496108_0000001_715287_715649 120
583 3300048911 Ga0496108_0000175 Ga0496108_0000175_18064_18426 120
584 3300048911 Ga0496108_0000187 Ga0496108_0000187_1060_1422 120
585 3300048911 Ga0496108_0056875 Ga0496108_0056875_1995_2357 120
586 3300048911 Ga0496108_0870309 Ga0496108_0870309_82_531 120
587 3300048911 Ga0496108_1136530 Ga0496108_1136530_185_547 120
588 3300048911 Ga0496108_1529048 Ga0496108_1529048_45_407 120
589 3300048912 Ga0496109_0000003 Ga0496109_0000003_389833_390195 120
590 3300048912 Ga0496109_0000121 Ga0496109_0000121_18056_18418 120
591 3300048912 Ga0496109_0000611 Ga0496109_0000611_28640_29002 120
592 3300048912 Ga0496109_0009604 Ga0496109_0009604_7765_8127 120
593 3300048912 Ga0496109_0023749 Ga0496109_0023749_4014_4376 120
594 3300048912 Ga0496109_0209551 Ga0496109_0209551_1131_1496 120
595 3300048912 Ga0496109_0281350 Ga0496109_0281350_119_481 120
596 3300048912 Ga0496109_1687520 Ga0496109_1687520_158_520 120
597 3300048913 Ga0496110_0001510 Ga0496110_0001510_14342_14704 120
598 3300048913 Ga0496110_0067647 Ga0496110_0067647_900_1265 120
599 3300048913 Ga0496110_0080699 Ga0496110_0080699_2184_2546 120
600 3300048913 Ga0496110_0333323 Ga0496110_0333323_717_1079 120
601 3300048913 Ga0496110_0816121 Ga0496110_0816121_437_799 120
602 3300048913 Ga0496110_0965365 Ga0496110_0965365_120_482 120
603 3300048914 Ga0496111_0000009 Ga0496111_0000009_91434_91796 120
604 3300048914 Ga0496111_0274474 Ga0496111_0274474_249_611 120
605 3300048914 Ga0496111_0669504 Ga0496111_0669504_21_383 120
606 3300048914 Ga0496111_0757278 Ga0496111_0757278_168_530 120
607 3300048915 Ga0496112_0000006 Ga0496112_0000006_310788_311150 120
608 3300048915 Ga0496112_0010135 Ga0496112_0010135_3782_4144 120
609 3300048915 Ga0496112_0568336 Ga0496112_0568336_611_976 120
610 3300048915 Ga0496112_0587354 Ga0496112_0587354_338_700 120
611 3300048916 Ga0496113_0000073 Ga0496113_0000073_37078_37440 120
612 3300048916 Ga0496113_0124930 Ga0496113_0124930_647_1009 120
613 3300048916 Ga0496113_0636032 Ga0496113_0636032_135_503 120
614 3300048917 Ga0496114_0000014 Ga0496114_0000014_282286_282651 120
615 3300048917 Ga0496114_0859474 Ga0496114_0859474_122_484 120
616 3300048917 Ga0496114_1001757 Ga0496114_1001757_100_462 120
617 3300048918 Ga0496115_0000003 Ga0496115_0000003_155518_155883 120
618 3300048918 Ga0496115_0000920 Ga0496115_0000920_5297_5662 120
619 3300048920 Ga0496117_0001988 Ga0496117_0001988_23522_23884 120
620 3300048920 Ga0496117_0136149 Ga0496117_0136149_160_522 120
621 3300048921 Ga0496118_0000373 Ga0496118_0000373_48852_49214 120
622 3300048921 Ga0496118_0052458 Ga0496118_0052458_2471_2833 120
623 3300048921 Ga0496118_0281467 Ga0496118_0281467_356_721 120
624 3300048921 Ga0496118_0479522 Ga0496118_0479522_202_564 120
625 3300048922 Ga0496119_0018509 Ga0496119_0018509_3672_4034 120
626 3300048922 Ga0496119_0021841 Ga0496119_0021841_2061_2423 120
627 3300048922 Ga0496119_0032630 Ga0496119_0032630_2678_3040 120
628 3300048923 Ga0496120_0008890 Ga0496120_0008890_5542_5904 120
629 3300048924 Ga0496121_0020360 Ga0496121_0020360_5499_5861 120
630 3300048924 Ga0496121_0026490 Ga0496121_0026490_2938_3300 120
631 3300048924 Ga0496121_0082975 Ga0496121_0082975_1799_2161 120
632 3300048924 Ga0496121_0175748 Ga0496121_0175748_122_484 120
633 3300048924 Ga0496121_0449362 Ga0496121_0449362_129_491 120
634 3300048927 Ga0496124_0202775 Ga0496124_0202775_486_848 120
635 3300048927 Ga0496124_0303628 Ga0496124_0303628_599_961 120
636 3300048927 Ga0496124_0809907 Ga0496124_0809907_15_377 120
637 3300048928 Ga0496125_0038435 Ga0496125_0038435_359_721 120
638 3300048928 Ga0496125_0077358 Ga0496125_0077358_975_1337 120
639 3300048928 Ga0496125_0079512 Ga0496125_0079512_231_593 120
640 3300048929 Ga0496126_0010117 Ga0496126_0010117_1498_1860 120
641 3300048929 Ga0496126_0156978 Ga0496126_0156978_638_1000 120
642 3300048929 Ga0496126_0510065 Ga0496126_0510065_402_764 120
643 3300049568 Ga0501031_0005273 Ga0501031_0005273_417_779 120
644 3300049569 Ga0501032_0006818 Ga0501032_0006818_411_773 120
645 3300049569 Ga0501032_0782793 Ga0501032_0782793_93_455 120
646 3300049570 Ga0501033_0008144 Ga0501033_0008144_7629_7991 120
647 3300049571 Ga0501034_0090987 Ga0501034_0090987_1960_2322 120
648 3300049572 Ga0501036_0009217 Ga0501036_0009217_7652_8014 120
649 3300049572 Ga0501036_1263342 Ga0501036_1263342_222_584 120
650 3300049573 Ga0501037_0036552 Ga0501037_0036552_746_1108 120
651 3300049574 Ga0501038_0010697 Ga0501038_0010697_383_745 120
652 3300049575 Ga0501039_0020768 Ga0501039_0020768_4596_4958 120
653 3300049576 Ga0501040_0005660 Ga0501040_0005660_108_470 120
654 3300049577 Ga0501041_0620161 Ga0501041_0620161_18_383 120
655 3300049578 Ga0501042_0023246 Ga0501042_0023246_3778_4140 120
656 3300049578 Ga0501042_0162121 Ga0501042_0162121_960_1322 120
657 3300049579 Ga0501043_0008404 Ga0501043_0008404_7608_7970 120
658 3300049579 Ga0501043_0459610 Ga0501043_0459610_547_909 120
659 3300049580 Ga0501046_0003232 Ga0501046_0003232_72_434 120
660 3300049580 Ga0501046_0502843 Ga0501046_0502843_335_697 120
661 3300049581 Ga0501047_0000715 Ga0501047_0000715_9265_9627 120
662 3300049581 Ga0501047_0011367 Ga0501047_0011367_7625_7987 120
663 3300049581 Ga0501047_0069611 Ga0501047_0069611_1972_2334 120
664 3300049581 Ga0501047_0099334 Ga0501047_0099334_609_971 120
665 3300049581 Ga0501047_0308165 Ga0501047_0308165_538_900 120
666 3300049582 Ga0501048_0007912 Ga0501048_0007912_7622_7984 120
667 3300049583 Ga0501067_0038047 Ga0501067_0038047_462_824 120
668 3300049584 Ga0501068_0003782 Ga0501068_0003782_391_753 120
669 3300049584 Ga0501068_0159424 Ga0501068_0159424_411_773 120
670 3300049585 Ga0501069_0001977 Ga0501069_0001977_6705_7067 120
671 3300049585 Ga0501069_0241161 Ga0501069_0241161_119_481 120
672 3300049585 Ga0501069_0672843 Ga0501069_0672843_80_442 120
673 3300049586 Ga0501070_0000676 Ga0501070_0000676_3945_4307 120
674 3300049586 Ga0501070_0009160 Ga0501070_0009160_7627_7989 120
675 3300049586 Ga0501070_0067838 Ga0501070_0067838_2070_2432 120
676 3300049586 Ga0501070_0204705 Ga0501070_0204705_450_812 120
677 3300049586 Ga0501070_0246197 Ga0501070_0246197_971_1333 120
678 3300049586 Ga0501070_0859228 Ga0501070_0859228_198_560 120
679 3300049586 Ga0501070_1469361 Ga0501070_1469361_75_437 120
680 3300049587 Ga0501071_0045682 Ga0501071_0045682_568_930 120
681 3300049587 Ga0501071_1418727 Ga0501071_1418727_43_405 120
682 3300049588 Ga0501072_0356704 Ga0501072_0356704_127_489 120
683 3300049588 Ga0501072_1520938 Ga0501072_1520938_60_422 120
684 3300049589 Ga0501073_0008844 Ga0501073_0008844_6996_7358 120
685 3300049590 Ga0501074_0007273 Ga0501074_0007273_126_488 120
686 3300049590 Ga0501074_0074544 Ga0501074_0074544_624_986 120
687 3300049591 Ga0501075_0006281 Ga0501075_0006281_4540_4902 120
688 3300049592 Ga0501076_0932483 Ga0501076_0932483_156_521 120
689 3300049741 Ga0501079_0007770 Ga0501079_0007770_7636_7998 120
690 3300049741 Ga0501079_0015295 Ga0501079_0015295_654_1016 120
691 3300049741 Ga0501079_1120633 Ga0501079_1120633_46_408 120
692 3300049742 Ga0501080_0020947 Ga0501080_0020947_890_1252 120
693 3300049743 Ga0501081_0073889 Ga0501081_0073889_1413_1775 120
694 3300049744 Ga0501083_0001648 Ga0501083_0001648_5144_5506 120
695 3300049744 Ga0501083_0011652 Ga0501083_0011652_5672_6034 120
696 3300049744 Ga0501083_0021931 Ga0501083_0021931_3417_3779 120
697 3300049822 Ga0501035_0000571 Ga0501035_0000571_40026_40388 120
698 3300049822 Ga0501035_0246910 Ga0501035_0246910_1021_1383 120
699 3300049822 Ga0501035_1248753 Ga0501035_1248753_17_379 120
700 3300049823 Ga0501044_0004142 Ga0501044_0004142_558_920 120
701 3300049823 Ga0501044_0014768 Ga0501044_0014768_432_794 120
702 3300049823 Ga0501044_0097325 Ga0501044_0097325_800_1162 120
703 3300049823 Ga0501044_1155353 Ga0501044_1155353_86_448 120
704 3300049824 Ga0501045_0724333 Ga0501045_0724333_290_652 120
705 3300050492 nmdc:mga0yw44_209692_c1 nmdc:mga0yw44_209692_c1_913_1275 120
706 3300050509 nmdc:mga0qj67_116694_c1 nmdc:mga0qj67_116694_c1_218_583 120
707 3300050513 nmdc:mga0rr50_122227_c1 nmdc:mga0rr50_122227_c1_89_451 120
708 3300050515 nmdc:mga0a205_273_c2 nmdc:mga0a205_273_c2_11462_11824 120
709 3300050515 nmdc:mga0a205_6183_c1 nmdc:mga0a205_6183_c1_7830_8192 120
710 3300053077 Ga0495601_0000013 Ga0495601_0000013_43705_44067 120
711 3300053077 Ga0495601_0000264 Ga0495601_0000264_27194_27556 120
712 3300053077 Ga0495601_0038283 Ga0495601_0038283_2430_2792 120
713 3300053077 Ga0495601_0095157 Ga0495601_0095157_930_1295 120
714 3300053077 Ga0495601_0175811 Ga0495601_0175811_220_582 120
715 3300053077 Ga0495601_0195114 Ga0495601_0195114_701_1063 120
716 3300053077 Ga0495601_0316438 Ga0495601_0316438_380_742 120
717 3300053077 Ga0495601_0363817 Ga0495601_0363817_526_888 120
718 3300053078 Ga0495612_0000060 Ga0495612_0000060_46201_46566 120
719 3300053078 Ga0495612_0022469 Ga0495612_0022469_1368_1730 120
720 3300053078 Ga0495612_0033638 Ga0495612_0033638_66_428 120
721 3300053078 Ga0495612_0038282 Ga0495612_0038282_857_1219 120
722 3300053078 Ga0495612_0046299 Ga0495612_0046299_1342_1704 120
723 3300053083 Ga0495655_0000001 Ga0495655_0000001_243015_243377 120
724 3300053084 Ga0495595_0000003 Ga0495595_0000003_163600_163962 120
725 3300053084 Ga0495595_0000053 Ga0495595_0000053_6558_6920 120
726 3300053084 Ga0495595_0067347 Ga0495595_0067347_1091_1453 120
727 3300053084 Ga0495595_0390017 Ga0495595_0390017_238_600 120
728 3300053085 Ga0495619_0000025 Ga0495619_0000025_82042_82404 120
729 3300053085 Ga0495619_0000116 Ga0495619_0000116_10367_10729 120
730 3300053085 Ga0495619_0000782 Ga0495619_0000782_20296_20658 120
731 3300053085 Ga0495619_0001012 Ga0495619_0001012_11665_12027 120
732 3300053085 Ga0495619_0001275 Ga0495619_0001275_1537_1899 120
733 3300053085 Ga0495619_0004173 Ga0495619_0004173_4192_4554 120
734 3300053085 Ga0495619_0005899 Ga0495619_0005899_6552_6914 120
735 3300053085 Ga0495619_0161980 Ga0495619_0161980_273_638 120
736 3300053094 Ga0500566_0007596 Ga0500566_0007596_4291_4653 120
737 3300053096 Ga0500641_0003883 Ga0500641_0003883_4695_5057 120
738 3300053098 Ga0500650_0179394 Ga0500650_0179394_522_884 120
739 3300053119 Ga0500595_040628 Ga0500595_040628_1019_1381 120
740 3300053123 Ga0500614_000451 Ga0500614_000451_9527_9889 120
741 3300053129 Ga0500628_000010 Ga0500628_000010_117216_117578 120
742 3300053134 Ga0500658_0130638 Ga0500658_0130638_309_671 120
743 3300054114 Ga0501084_0493860 Ga0501084_0493860_598_960 120
744 3300059426 Ga0590077_023859 Ga0590077_023859_812_1174 120
745 3300059512 Ga0587092_018905 Ga0587092_018905_72_434 120
746 3300060353 Ga0501082_0072467 Ga0501082_0072467_95_457 120
747 3300060353 Ga0501082_0310180 Ga0501082_0310180_562_924 120
748 3300060353 Ga0501082_1894819 Ga0501082_1894819_48_410 120

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iz9-assembly1.cif.gz_A-2 crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese 0.7511 26 51
3sk3-assembly1.cif.gz_B crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface 0.7492 25 51
7fgm-assembly1.cif.gz_B the complex crystals structure of the faf1 ubl1_l-hsp70 nbd with adp and phosphate 0.7467 28 45
3zx3-assembly2.cif.gz_C crystal structure and domain rotation of ntpdase1 cd39 0.7295 27 52
7pub-assembly1.cif.gz_CK late assembly intermediate of the trypanosoma brucei mitoribosomal small subunit 0.7266 26 51
ID Description Score Start End Superfamily
af_Q8RWY4_738_822_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8281 28 44 3.10.20.90
af_Q5ANI6_290_379_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.8203 28 55 3.30.160.60
af_P0A6V8_2_105_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8145 28 52 3.30.420.40
af_X1WH23_7_262_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7796 26 52 3.30.420.40
1sz2A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7731 28 52 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7K0S2R3-F1-model_v4 SCP2 domain-containing protein 0.9407 1 118
AF-A0A7W0MUA7-F1-model_v4 SCP2 domain-containing protein 0.9317 1 118
AF-A0A7V9CG26-F1-model_v4 SCP2 domain-containing protein 0.9303 1 118
AF-A0A6J4T321-F1-model_v4 SCP2 domain-containing protein 0.9284 1 117
AF-A0A7W0LIQ7-F1-model_v4 SCP2 domain-containing protein 0.9206 3 113

Feature Viewer

pLDDT pTM Quality
80.74 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map