F478992

General Info

Members Datasets Scaffolds Average Seq Length
749 334 749 92

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_101534050|Ga0070661_1015340502
Length 112
Sequence MGEGLFSPQVDFICKLEEVCMSVRVRVPTPLRKYTQGADEVNAQGSNVKSLVDDLEKNYPGIRERICDETGKVRRFVNVYVNGDDIRFLQNLDTTLKEGDSISIVPAIAGGA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
112 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
113 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
114 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
206 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
207 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
228 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
229 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
247 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
275 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
276 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
302 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
303 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
304 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
305 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
306 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
307 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
308 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
314 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
315 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 2.94
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214753862 2209111006 Bacteria 872
2 ARcpr5yngRDRAFT_c025608 3300000043 Unclassified 506
3 JGI25407J50210_10154818 3300003373 Bacteria 564
4 JGI25405J52794_10001086 3300003911 Unclassified 4350
5 Ga0058859_10042614 3300004798 Unclassified 2815
6 Ga0058860_10067954 3300004801 Unclassified 1429
7 Ga0058860_11489369 3300004801 Bacteria 826
8 Ga0058862_12422882 3300004803 Bacteria 1488
9 Ga0065704_10079869 3300005289 Bacteria 4060
10 Ga0065704_10431775 3300005289 Bacteria 722
11 Ga0065712_10068895 3300005290 Bacteria 8628
12 Ga0065712_10218390 3300005290 Unclassified 1037
13 Ga0065715_10003569 3300005293 Bacteria 3954
14 Ga0065715_10007065 3300005293 Bacteria 3964
15 Ga0065707_10001176 3300005295 Bacteria 7922
16 Ga0065707_10107261 3300005295 Bacteria 2562
17 Ga0065707_10139404 3300005295 Unclassified 1792
18 Ga0065707_10264351 3300005295 Bacteria 1053
19 Ga0065707_10340060 3300005295 Unclassified 935
20 Ga0070658_10024687 3300005327 Unclassified 4820
21 Ga0070676_10006899 3300005328 Bacteria 6079
22 Ga0070683_101028336 3300005329 Unclassified 791
23 Ga0070690_100098550 3300005330 Unclassified 1935
24 Ga0070670_101631036 3300005331 Unclassified 593
25 Ga0070677_10647053 3300005333 Unclassified 590
26 Ga0068869_100065762 3300005334 Unclassified 2670
27 Ga0070666_10159846 3300005335 Bacteria 1574
28 Ga0070666_10200666 3300005335 Unclassified 1403
29 Ga0070666_10259902 3300005335 Bacteria 1231
30 Ga0070680_100071012 3300005336 Bacteria 2860
31 Ga0070680_100949868 3300005336 Bacteria 742
32 Ga0070682_100528189 3300005337 Unclassified 919
33 Ga0070682_100743405 3300005337 Bacteria 791
34 Ga0070682_100977146 3300005337 Bacteria 701
35 Ga0068868_100939490 3300005338 Bacteria 788
36 Ga0070660_100471801 3300005339 Bacteria 1042
37 Ga0070689_100135951 3300005340 Bacteria 1974
38 Ga0070689_101102391 3300005340 Unclassified 710
39 Ga0070691_10003549 3300005341 Bacteria 7034
40 Ga0070687_100102261 3300005343 Unclassified 1606
41 Ga0070687_100162251 3300005343 Bacteria 1322
42 Ga0070661_100003230 3300005344 Bacteria 11233
43 Ga0070661_101534050 3300005344 Unclassified 562
44 Ga0070692_10606446 3300005345 Unclassified 725
45 Ga0070692_10934193 3300005345 Unclassified 602
46 Ga0070692_11034244 3300005345 Bacteria 576
47 Ga0070668_100084803 3300005347 Unclassified 2489
48 Ga0070668_100176391 3300005347 Bacteria 1743
49 Ga0070669_100368340 3300005353 Unclassified 1170
50 Ga0070669_100832543 3300005353 Bacteria 785
51 Ga0070669_101285220 3300005353 Unclassified 633
52 Ga0070675_101063953 3300005354 Unclassified 743
53 Ga0070675_101540764 3300005354 Bacteria 613
54 Ga0070674_100983338 3300005356 Unclassified 740
55 Ga0070673_100578113 3300005364 Unclassified 1023
56 Ga0070688_100050255 3300005365 Unclassified 2597
57 Ga0070688_101275695 3300005365 Unclassified 592
58 Ga0070659_100275851 3300005366 Unclassified 1398
59 Ga0070667_100061802 3300005367 Unclassified 3171
60 Ga0070703_10113611 3300005406 Bacteria 972
61 Ga0070709_10358089 3300005434 Unclassified 1080
62 Ga0070713_100666896 3300005436 Bacteria 991
63 Ga0070713_100950439 3300005436 Bacteria 828
64 Ga0070701_10051673 3300005438 Bacteria 2133
65 Ga0070711_101508951 3300005439 Unclassified 586
66 Ga0070705_100125548 3300005440 Unclassified 1665
67 Ga0070705_100975446 3300005440 Archaea 686
68 Ga0070694_100007677 3300005444 Bacteria 6583
69 Ga0070694_100581013 3300005444 Bacteria 900
70 Ga0070694_100911016 3300005444 Bacteria 726
71 Ga0070708_100045418 3300005445 Bacteria 3869
72 Ga0070708_100496844 3300005445 Unclassified 1151
73 Ga0070708_101576292 3300005445 Unclassified 611
74 Ga0070663_100966176 3300005455 Bacteria 739
75 Ga0070663_101512430 3300005455 Bacteria 597
76 Ga0070678_100860693 3300005456 Unclassified 826
77 Ga0070662_100113587 3300005457 Unclassified 2067
78 Ga0070662_100136288 3300005457 Unclassified 1898
79 Ga0070662_100217850 3300005457 Bacteria 1522
80 Ga0070662_101637156 3300005457 Unclassified 556
81 Ga0070681_10001307 3300005458 Bacteria 21746
82 Ga0070685_10049255 3300005466 Bacteria 2429
83 Ga0070706_100060250 3300005467 Bacteria 3503
84 Ga0070706_100266187 3300005467 Bacteria 1600
85 Ga0070706_100268101 3300005467 Bacteria 1593
86 Ga0070706_101317738 3300005467 Bacteria 662
87 Ga0070707_100141449 3300005468 Bacteria 2342
88 Ga0070707_100251340 3300005468 Bacteria 1721
89 Ga0070707_100401878 3300005468 Bacteria 1330
90 Ga0070707_101509806 3300005468 Bacteria 639
91 Ga0070707_101874645 3300005468 Unclassified 567
92 Ga0070698_100071111 3300005471 Bacteria 3490
93 Ga0070698_100346817 3300005471 Bacteria 1416
94 Ga0070698_101762902 3300005471 Unclassified 572
95 Ga0070698_101960263 3300005471 Unclassified 539
96 Ga0070699_100872608 3300005518 Bacteria 824
97 Ga0070679_100007207 3300005530 Bacteria 10385
98 Ga0070684_100160227 3300005535 Bacteria 2041
99 Ga0070697_100157425 3300005536 Bacteria 1918
100 Ga0070697_100279298 3300005536 Bacteria 1433
101 Ga0070697_100324722 3300005536 Bacteria 1326
102 Ga0070697_100562388 3300005536 Unclassified 1000
103 Ga0070672_100042151 3300005543 Unclassified 3513
104 Ga0070686_100013641 3300005544 Bacteria 4660
105 Ga0070686_100016472 3300005544 Unclassified 4301
106 Ga0070686_101582768 3300005544 Bacteria 554
107 Ga0070695_100048397 3300005545 Unclassified 2719
108 Ga0070695_100156746 3300005545 Unclassified 1594
109 Ga0070696_100008790 3300005546 Bacteria 6759
110 Ga0070696_100049596 3300005546 Bacteria 2916
111 Ga0070696_101008779 3300005546 Bacteria 696
112 Ga0070696_101161107 3300005546 Unclassified 651
113 Ga0070696_101765074 3300005546 Unclassified 534
114 Ga0070693_100042793 3300005547 Bacteria 2554
115 Ga0070665_100899942 3300005548 Bacteria 898
116 Ga0070704_100023530 3300005549 Bacteria 4027
117 Ga0070704_100559202 3300005549 Bacteria 1000
118 Ga0070704_100713696 3300005549 Unclassified 890
119 Ga0070704_102023605 3300005549 Unclassified 535
120 Ga0070664_100006377 3300005564 Bacteria 9518
121 Ga0070664_100163699 3300005564 Bacteria 1969
122 Ga0068857_100037201 3300005577 Bacteria 4311
123 Ga0068857_100127961 3300005577 Bacteria 2289
124 Ga0068854_100447931 3300005578 Unclassified 1078
125 Ga0068854_101892294 3300005578 Bacteria 548
126 Ga0068856_100019729 3300005614 Bacteria 6543
127 Ga0070702_100035331 3300005615 Unclassified 2761
128 Ga0068859_100009654 3300005617 Bacteria 9743
129 Ga0068859_100553075 3300005617 Bacteria 1245
130 Ga0068859_101686294 3300005617 Unclassified 700
131 Ga0068859_102973101 3300005617 Unclassified 518
132 Ga0068864_100155949 3300005618 Bacteria 2072
133 Ga0068864_100216130 3300005618 Bacteria 1767
134 Ga0068864_100605724 3300005618 Bacteria 1063
135 Ga0068864_100941925 3300005618 Bacteria 854
136 Ga0068866_10054935 3300005718 Unclassified 2043
137 Ga0068861_100101787 3300005719 Unclassified 2286
138 Ga0068861_100670450 3300005719 Unclassified 960
139 Ga0068861_101821462 3300005719 Bacteria 604
140 Ga0068861_101906499 3300005719 Bacteria 591
141 Ga0068870_10477936 3300005840 Bacteria 826
142 Ga0068870_10711867 3300005840 Unclassified 694
143 Ga0068863_100343623 3300005841 Bacteria 1452
144 Ga0068858_100038180 3300005842 Bacteria 4454
145 Ga0068858_101146667 3300005842 Unclassified 764
146 Ga0068862_100274102 3300005844 Bacteria 1544
147 Ga0068862_101040683 3300005844 Bacteria 811
148 Ga0081455_10000223 3300005937 Bacteria 73038
149 Ga0081538_10004812 3300005981 Bacteria 12305
150 Ga0081538_10046498 3300005981 Bacteria 2675
151 Ga0081538_10107300 3300005981 Bacteria 1383
152 Ga0081540_1176263 3300005983 Unclassified 807
153 Ga0081539_10000597 3300005985 Bacteria 73805
154 Ga0081539_10092386 3300005985 Bacteria 1561
155 Ga0070717_10373601 3300006028 Bacteria 1278
156 Ga0070717_11425243 3300006028 Bacteria 629
157 Ga0075432_10077026 3300006058 Bacteria 1205
158 Ga0075432_10141853 3300006058 Bacteria 917
159 Ga0070715_10557010 3300006163 Unclassified 665
160 Ga0070716_100106218 3300006173 Bacteria 1731
161 Ga0070716_100114765 3300006173 Bacteria 1675
162 Ga0070716_100115355 3300006173 Bacteria 1672
163 Ga0070716_100807279 3300006173 Unclassified 727
164 Ga0070712_100433833 3300006175 Bacteria 1091
165 Ga0075427_10006155 3300006194 Bacteria 1731
166 Ga0097621_100248783 3300006237 Bacteria 1556
167 Ga0068871_100030902 3300006358 Unclassified 4221
168 Ga0068871_102262809 3300006358 Unclassified 518
169 Ga0075428_100035445 3300006844 Bacteria 5501
170 Ga0075428_100058926 3300006844 Bacteria 4205
171 Ga0075428_100127230 3300006844 Bacteria 2772
172 Ga0075428_100155465 3300006844 Bacteria 2485
173 Ga0075428_100498440 3300006844 Unclassified 1303
174 Ga0075428_100824216 3300006844 Bacteria 986
175 Ga0075428_101564951 3300006844 Unclassified 690
176 Ga0075430_100056524 3300006846 Unclassified 3300
177 Ga0075430_100058839 3300006846 Unclassified 3230
178 Ga0075430_100111961 3300006846 Bacteria 2275
179 Ga0075430_100266972 3300006846 Bacteria 1417
180 Ga0075430_100332148 3300006846 Unclassified 1256
181 Ga0075430_100491428 3300006846 Unclassified 1013
182 Ga0075430_100516308 3300006846 Bacteria 986
183 Ga0075431_100021111 3300006847 Bacteria 6655
184 Ga0075431_100046181 3300006847 Unclassified 4490
185 Ga0075431_100102716 3300006847 Bacteria 2950
186 Ga0075431_100118579 3300006847 Bacteria 2731
187 Ga0075431_100133852 3300006847 Bacteria 2555
188 Ga0075431_101072477 3300006847 Bacteria 771
189 Ga0075431_101272885 3300006847 Unclassified 697
190 Ga0075433_10001943 3300006852 Bacteria 15545
191 Ga0075433_10005393 3300006852 Bacteria 10049
192 Ga0075433_10066778 3300006852 Bacteria 3156
193 Ga0075433_10068418 3300006852 Bacteria 3118
194 Ga0075433_10339588 3300006852 Bacteria 1328
195 Ga0075433_10344405 3300006852 Unclassified 1317
196 Ga0075433_10650776 3300006852 Bacteria 924
197 Ga0075433_10986088 3300006852 Bacteria 734
198 Ga0075433_11295867 3300006852 Bacteria 631
199 Ga0075434_100003172 3300006871 Bacteria 14660
200 Ga0075434_100005178 3300006871 Bacteria 11839
201 Ga0075434_100023983 3300006871 Bacteria 5956
202 Ga0075434_100059166 3300006871 Bacteria 3809
203 Ga0075434_100110008 3300006871 Bacteria 2766
204 Ga0075434_100312167 3300006871 Bacteria 1593
205 Ga0075434_100359477 3300006871 Bacteria 1477
206 Ga0075434_100360861 3300006871 Bacteria 1474
207 Ga0075434_100415459 3300006871 Bacteria 1366
208 Ga0075434_100741250 3300006871 Unclassified 999
209 Ga0075434_100909133 3300006871 Bacteria 895
210 Ga0075434_101122572 3300006871 Unclassified 799
211 Ga0075434_101313373 3300006871 Bacteria 734
212 Ga0075429_100036332 3300006880 Unclassified 4284
213 Ga0075429_100303923 3300006880 Bacteria 1397
214 Ga0075429_100772052 3300006880 Unclassified 842
215 Ga0075429_100774631 3300006880 Bacteria 840
216 Ga0068865_100400304 3300006881 Bacteria 1124
217 Ga0068865_100561325 3300006881 Bacteria 960
218 Ga0068865_101093992 3300006881 Unclassified 702
219 Ga0075436_100041107 3300006914 Bacteria 3190
220 Ga0075436_100066639 3300006914 Bacteria 2489
221 Ga0075436_100149506 3300006914 Bacteria 1643
222 Ga0075436_100453473 3300006914 Bacteria 934
223 Ga0075436_100547589 3300006914 Unclassified 849
224 Ga0075436_100644735 3300006914 Unclassified 782
225 Ga0097620_100009653 3300006931 Bacteria 9743
226 Ga0097620_100553081 3300006931 Bacteria 1245
227 Ga0097620_101686114 3300006931 Unclassified 700
228 Ga0097620_102971720 3300006931 Unclassified 518
229 Ga0075435_100010907 3300007076 Bacteria 6658
230 Ga0075435_100034480 3300007076 Unclassified 4011
231 Ga0075435_100089378 3300007076 Bacteria 2540
232 Ga0075435_100091020 3300007076 Bacteria 2517
233 Ga0075435_101070694 3300007076 Unclassified 705
234 Ga0075435_101336622 3300007076 Unclassified 628
235 Ga0075435_101511012 3300007076 Bacteria 589
236 Ga0105250_10564329 3300009092 Unclassified 524
237 Ga0105240_10344208 3300009093 Bacteria 1693
238 Ga0105240_11763762 3300009093 Unclassified 645
239 Ga0111539_10018416 3300009094 Bacteria 8651
240 Ga0111539_10130618 3300009094 Unclassified 2941
241 Ga0111539_10419206 3300009094 Bacteria 1559
242 Ga0111539_10703303 3300009094 Unclassified 1176
243 Ga0105245_10179305 3300009098 Bacteria 2023
244 Ga0105245_10241543 3300009098 Bacteria 1751
245 Ga0114129_10007068 3300009147 Bacteria 15976
246 Ga0114129_10009779 3300009147 Bacteria 13677
247 Ga0114129_10044906 3300009147 Bacteria 6214
248 Ga0114129_10067938 3300009147 Bacteria 4970
249 Ga0114129_10141733 3300009147 Bacteria 3294
250 Ga0114129_10155601 3300009147 Bacteria 3126
251 Ga0114129_10253892 3300009147 Bacteria 2359
252 Ga0114129_10261868 3300009147 Bacteria 2317
253 Ga0114129_11448455 3300009147 Bacteria 846
254 Ga0105243_10362271 3300009148 Bacteria 1335
255 Ga0105241_10023686 3300009174 Unclassified 4555
256 Ga0105242_10023246 3300009176 Unclassified 4887
257 Ga0105242_10082027 3300009176 Bacteria 2698
258 Ga0105242_10326011 3300009176 Bacteria 1410
259 Ga0105237_10268052 3300009545 Bacteria 1711
260 Ga0105237_12183156 3300009545 Unclassified 563
261 Ga0105249_10174231 3300009553 Bacteria 2088
262 Ga0105249_10213838 3300009553 Bacteria 1893
263 Ga0105249_10668698 3300009553 Archaea 1097
264 Ga0105249_11229734 3300009553 Unclassified 820
265 Ga0105239_12642740 3300010375 Bacteria 586
266 Ga0105246_10007585 3300011119 Bacteria 6655
267 Ga0105246_10105267 3300011119 Bacteria 2062
268 Ga0157319_1012023 3300012497 Unclassified 724
269 Ga0157314_1008434 3300012500 Bacteria 851
270 Ga0157324_1009637 3300012506 Bacteria 802
271 Ga0157316_1022501 3300012510 Bacteria 701
272 Ga0157373_10131015 3300013100 Unclassified 1764
273 Ga0157371_10011208 3300013102 Bacteria 6928
274 Ga0157374_11512624 3300013296 Unclassified 695
275 Ga0157378_10048977 3300013297 Unclassified 3758
276 Ga0157378_10225070 3300013297 Unclassified 1785
277 Ga0157378_12483680 3300013297 Unclassified 570
278 Ga0163162_10013962 3300013306 Bacteria 7850
279 Ga0163162_10042632 3300013306 Unclassified 4543
280 Ga0163162_10174841 3300013306 Bacteria 2272
281 Ga0157372_10090284 3300013307 Bacteria 3483
282 Ga0157372_11100783 3300013307 Bacteria 919
283 Ga0157375_10052750 3300013308 Unclassified 3999
284 Ga0157375_10353274 3300013308 Bacteria 1636
285 Ga0163163_10178538 3300014325 Bacteria 2170
286 Ga0157380_10326792 3300014326 Bacteria 1424
287 Ga0157380_10418420 3300014326 Bacteria 1277
288 Ga0157380_11378432 3300014326 Unclassified 755
289 Ga0157379_10023228 3300014968 Bacteria 5501
290 Ga0157379_10062159 3300014968 Unclassified 3340
291 Ga0157376_10185167 3300014969 Bacteria 1906
292 Ga0157376_10968581 3300014969 Bacteria 872
293 Ga0182006_1108679 3300015261 Unclassified 976
294 Ga0182007_10074613 3300015262 Bacteria 1111
295 Ga0163161_10030861 3300017792 Bacteria 3816
296 Ga0163161_10750676 3300017792 Unclassified 816
297 Ga0163161_10905466 3300017792 Bacteria 748
298 Ga0197907_10944092 3300020069 Bacteria 769
299 Ga0206355_1129667 3300020076 Bacteria 563
300 Ga0206350_11056752 3300020080 Unclassified 1370
301 Ga0206350_11297399 3300020080 Unclassified 822
302 Ga0224712_10271339 3300022467 Unclassified 788
303 Ga0224712_10286009 3300022467 Bacteria 768
304 Ga0207666_1021083 3300025271 Bacteria 959
305 Ga0207697_10047695 3300025315 Bacteria 1766
306 Ga0207642_10051569 3300025899 Unclassified 1862
307 Ga0207688_10047865 3300025901 Unclassified 2388
308 Ga0207680_10887648 3300025903 Unclassified 639
309 Ga0207680_11234623 3300025903 Bacteria 532
310 Ga0207647_10309254 3300025904 Unclassified 899
311 Ga0207645_10000465 3300025907 Bacteria 33565
312 Ga0207643_10211056 3300025908 Bacteria 1185
313 Ga0207705_10107232 3300025909 Unclassified 2061
314 Ga0207684_10169248 3300025910 Bacteria 1883
315 Ga0207684_10492016 3300025910 Bacteria 1052
316 Ga0207684_11662582 3300025910 Bacteria 515
317 Ga0207654_10300342 3300025911 Unclassified 1092
318 Ga0207707_10030527 3300025912 Unclassified 4715
319 Ga0207695_10491490 3300025913 Bacteria 1109
320 Ga0207671_11518179 3300025914 Unclassified 517
321 Ga0207693_10174017 3300025915 Bacteria 1694
322 Ga0207660_10497105 3300025917 Bacteria 989
323 Ga0207660_10506524 3300025917 Bacteria 980
324 Ga0207662_10183460 3300025918 Bacteria 1347
325 Ga0207662_10575740 3300025918 Bacteria 782
326 Ga0207657_10012781 3300025919 Bacteria 8264
327 Ga0207649_10681461 3300025920 Bacteria 796
328 Ga0207652_10173731 3300025921 Unclassified 1934
329 Ga0207646_10036121 3300025922 Bacteria 4461
330 Ga0207646_10302171 3300025922 Bacteria 1446
331 Ga0207646_10378907 3300025922 Bacteria 1278
332 Ga0207646_11530895 3300025922 Bacteria 577
333 Ga0207681_10620692 3300025923 Unclassified 895
334 Ga0207681_10645160 3300025923 Bacteria 877
335 Ga0207650_10317075 3300025925 Bacteria 1276
336 Ga0207659_10021423 3300025926 Unclassified 4290
337 Ga0207687_11746698 3300025927 Unclassified 533
338 Ga0207700_10710984 3300025928 Bacteria 897
339 Ga0207664_11950612 3300025929 Bacteria 510
340 Ga0207644_10169451 3300025931 Bacteria 1703
341 Ga0207690_10237728 3300025932 Unclassified 1402
342 Ga0207690_10422089 3300025932 Bacteria 1067
343 Ga0207690_11145291 3300025932 Unclassified 649
344 Ga0207706_10007890 3300025933 Bacteria 9824
345 Ga0207706_10209758 3300025933 Unclassified 1708
346 Ga0207686_10132402 3300025934 Bacteria 1712
347 Ga0207709_10323719 3300025935 Bacteria 1155
348 Ga0207670_10015115 3300025936 Unclassified 4603
349 Ga0207670_10146756 3300025936 Unclassified 1745
350 Ga0207670_10182196 3300025936 Bacteria 1583
351 Ga0207669_10028665 3300025937 Unclassified 3066
352 Ga0207704_10778113 3300025938 Bacteria 798
353 Ga0207665_10196172 3300025939 Bacteria 1469
354 Ga0207665_10233379 3300025939 Bacteria 1353
355 Ga0207665_10248950 3300025939 Bacteria 1312
356 Ga0207691_10005743 3300025940 Bacteria 12003
357 Ga0207689_10028906 3300025942 Unclassified 4634
358 Ga0207661_11349896 3300025944 Bacteria 655
359 Ga0207661_11959567 3300025944 Bacteria 532
360 Ga0207679_10303920 3300025945 Bacteria 1376
361 Ga0207651_10258509 3300025960 Bacteria 1428
362 Ga0207712_11291703 3300025961 Unclassified 652
363 Ga0207668_10116801 3300025972 Unclassified 2013
364 Ga0207640_10243392 3300025981 Bacteria 1391
365 Ga0207658_10102992 3300025986 Unclassified 2240
366 Ga0207677_10852842 3300026023 Unclassified 819
367 Ga0207703_10149979 3300026035 Bacteria 2032
368 Ga0207703_10249996 3300026035 Bacteria 1597
369 Ga0207639_11211674 3300026041 Unclassified 708
370 Ga0207678_10187347 3300026067 Bacteria 1768
371 Ga0207678_10239874 3300026067 Bacteria 1553
372 Ga0207678_10626048 3300026067 Bacteria 944
373 Ga0207708_10052305 3300026075 Unclassified 3111
374 Ga0207708_11750909 3300026075 Bacteria 545
375 Ga0207702_11570938 3300026078 Unclassified 651
376 Ga0207641_10266556 3300026088 Unclassified 1606
377 Ga0207648_10015387 3300026089 Bacteria 7039
378 Ga0207676_10773304 3300026095 Unclassified 935
379 Ga0207676_11164414 3300026095 Bacteria 763
380 Ga0207674_10062280 3300026116 Bacteria 3768
381 Ga0207674_10068699 3300026116 Bacteria 3565
382 Ga0207674_10093403 3300026116 Bacteria 2997
383 Ga0207675_100152977 3300026118 Unclassified 2197
384 Ga0207675_100365763 3300026118 Bacteria 1416
385 Ga0207675_102438671 3300026118 Bacteria 535
386 Ga0207683_10001178 3300026121 Bacteria 23644
387 Ga0209969_1071640 3300027360 Unclassified 551
388 Ga0209984_1005624 3300027424 Bacteria 1512
389 Ga0209968_1013318 3300027526 Bacteria 1289
390 Ga0209982_1010436 3300027552 Bacteria 1376
391 Ga0209970_1006749 3300027614 Bacteria 1885
392 Ga0210002_1006859 3300027617 Bacteria 1722
393 Ga0209971_1023839 3300027682 Bacteria 1460
394 Ga0209971_1039155 3300027682 Bacteria 1141
395 Ga0209998_10011102 3300027717 Bacteria 1864
396 Ga0209974_10054370 3300027876 Bacteria 1349
397 Ga0209974_10193602 3300027876 Bacteria 749
398 Ga0209974_10207156 3300027876 Unclassified 726
399 Ga0207428_10011568 3300027907 Bacteria 7793
400 Ga0207428_10143986 3300027907 Bacteria 1817
401 Ga0207428_11238066 3300027907 Bacteria 518
402 Ga0268266_10062867 3300028379 Bacteria 3205
403 Ga0268266_10816402 3300028379 Bacteria 901
404 Ga0268265_11027186 3300028380 Unclassified 815
405 Ga0268265_11444613 3300028380 Unclassified 690
406 Ga0268264_10106498 3300028381 Bacteria 2448
407 Ga0265330_10006523 3300031235 Bacteria 5769
408 Ga0265332_10000445 3300031238 Bacteria 29097
409 Ga0265328_10004623 3300031239 Bacteria 5959
410 Ga0265320_10166742 3300031240 Unclassified 990
411 Ga0265329_10020192 3300031242 Unclassified 2252
412 Ga0265331_10000076 3300031250 Bacteria 145884
413 Ga0265327_10194101 3300031251 Unclassified 923
414 Ga0265316_10000006 3300031344 Bacteria 289686
415 Ga0307408_100115535 3300031548 Bacteria 2070
416 Ga0307408_100134193 3300031548 Unclassified 1935
417 Ga0307408_100137852 3300031548 Bacteria 1911
418 Ga0307408_100148744 3300031548 Bacteria 1847
419 Ga0307408_100463945 3300031548 Bacteria 1101
420 Ga0307408_100612483 3300031548 Bacteria 969
421 Ga0307408_100666189 3300031548 Bacteria 932
422 Ga0307408_100836110 3300031548 Bacteria 838
423 Ga0265314_10000056 3300031711 Bacteria 171647
424 Ga0265342_10020657 3300031712 Unclassified 4218
425 Ga0307405_10037651 3300031731 Bacteria 2909
426 Ga0307405_10067889 3300031731 Bacteria 2280
427 Ga0307405_10177362 3300031731 Unclassified 1526
428 Ga0307405_10361429 3300031731 Bacteria 1123
429 Ga0307413_10017383 3300031824 Bacteria 3743
430 Ga0307413_10095602 3300031824 Unclassified 1948
431 Ga0307413_10117210 3300031824 Bacteria 1796
432 Ga0307413_10332317 3300031824 Bacteria 1165
433 Ga0307410_10028316 3300031852 Bacteria 3552
434 Ga0307410_10180000 3300031852 Bacteria 1600
435 Ga0307410_10199381 3300031852 Bacteria 1527
436 Ga0307410_10218337 3300031852 Bacteria 1465
437 Ga0307410_11600752 3300031852 Bacteria 576
438 Ga0307406_10053549 3300031901 Bacteria 2571
439 Ga0307406_10080743 3300031901 Bacteria 2160
440 Ga0307406_10092885 3300031901 Bacteria 2036
441 Ga0307406_10932272 3300031901 Bacteria 741
442 Ga0307406_11580362 3300031901 Bacteria 579
443 Ga0307407_10181062 3300031903 Bacteria 1397
444 Ga0307407_10234502 3300031903 Unclassified 1248
445 Ga0307407_10756595 3300031903 Bacteria 736
446 Ga0307407_11671827 3300031903 Bacteria 506
447 Ga0307412_10151209 3300031911 Bacteria 1713
448 Ga0307412_10159134 3300031911 Unclassified 1676
449 Ga0307412_10189641 3300031911 Unclassified 1553
450 Ga0307412_10192147 3300031911 Bacteria 1544
451 Ga0307412_10800421 3300031911 Bacteria 818
452 Ga0307412_11238252 3300031911 Bacteria 670
453 Ga0307409_100094868 3300031995 Bacteria 2456
454 Ga0307409_100170434 3300031995 Bacteria 1915
455 Ga0307409_100201133 3300031995 Bacteria 1782
456 Ga0307409_100288170 3300031995 Unclassified 1521
457 Ga0307409_100690940 3300031995 Bacteria 1019
458 Ga0307409_101037167 3300031995 Unclassified 839
459 Ga0307409_101124717 3300031995 Bacteria 807
460 Ga0307409_101358948 3300031995 Bacteria 736
461 Ga0307409_101472470 3300031995 Bacteria 708
462 Ga0307416_100009283 3300032002 Bacteria 6428
463 Ga0307416_100011010 3300032002 Bacteria 6007
464 Ga0307416_100033248 3300032002 Bacteria 3907
465 Ga0307416_100125019 3300032002 Bacteria 2302
466 Ga0307416_100144042 3300032002 Bacteria 2172
467 Ga0307416_100268741 3300032002 Bacteria 1672
468 Ga0307416_100391102 3300032002 Bacteria 1424
469 Ga0307416_100543350 3300032002 Bacteria 1234
470 Ga0307416_100699935 3300032002 Unclassified 1102
471 Ga0307416_103790921 3300032002 Bacteria 506
472 Ga0307414_10156300 3300032004 Bacteria 1806
473 Ga0307414_10503101 3300032004 Bacteria 1072
474 Ga0307414_10889152 3300032004 Bacteria 816
475 Ga0307414_11468748 3300032004 Bacteria 634
476 Ga0307414_12133792 3300032004 Bacteria 523
477 Ga0307411_10007627 3300032005 Bacteria 5535
478 Ga0307411_10033546 3300032005 Bacteria 3185
479 Ga0307411_10049595 3300032005 Bacteria 2729
480 Ga0307411_10226066 3300032005 Bacteria 1455
481 Ga0307411_10243631 3300032005 Bacteria 1409
482 Ga0307411_10383243 3300032005 Bacteria 1157
483 Ga0307411_10407390 3300032005 Bacteria 1126
484 Ga0307411_11205581 3300032005 Bacteria 686
485 Ga0307415_100026491 3300032126 Bacteria 3658
486 Ga0307415_100042278 3300032126 Bacteria 3032
487 Ga0307415_100058195 3300032126 Bacteria 2660
488 Ga0307415_100179284 3300032126 Bacteria 1660
489 Ga0307415_101142399 3300032126 Bacteria 731
490 Ga0307415_101585566 3300032126 Bacteria 628
491 Ga0307415_102513617 3300032126 Bacteria 507
492 Ga0373938_0080501 3300034957 Bacteria 792
493 Ga0373926_0066467 3300035083 Bacteria 1320
494 Ga0373928_0108399 3300035084 Unclassified 732
495 Ga0373929_0171620 3300035085 Unclassified 593
496 Ga0373951_0023590 3300035091 Bacteria 1422
497 Ga0373951_0033190 3300035091 Bacteria 1223
498 Ga0373932_0027302 3300035112 Bacteria 1561
499 Ga0373936_0056982 3300035113 Bacteria 1589
500 Ga0373939_0043450 3300035114 Bacteria 1364
501 Ga0373941_0062561 3300035115 Bacteria 1215
502 Ga0373941_0243667 3300035115 Unclassified 699
503 Ga0373960_0072323 3300035121 Unclassified 1069
504 Ga0373960_0208288 3300035121 Unclassified 694
505 Ga0373943_0318452 3300035170 Bacteria 886
506 Ga0373946_0041878 3300035171 Bacteria 1880
507 Ga0373961_0092809 3300035241 Unclassified 967
508 Ga0373931_0006970 3300035691 Bacteria 5317
509 Ga0373931_0936784 3300035691 Unclassified 584
510 Ga0373935_0027230 3300035692 Bacteria 3534
511 Ga0373927_0296065 3300035695 Unclassified 1065
512 Ga0373927_0966378 3300035695 Unclassified 562
513 Ga0373947_0008839 3300035725 Bacteria 5793
514 Ga0373937_0089288 3300036401 Bacteria 2854
515 Ga0373925_0058114 3300037068 Bacteria 2899
516 Ga0436360_0877177 3300039438 Bacteria 1621
517 Ga0436360_0877644 3300039438 Bacteria 1652
518 Ga0436362_0002027 3300039453 Bacteria 1295
519 Ga0439465_0332424 3300041413 Bacteria 572
520 Ga0439434_0241065 3300042435 Bacteria 617
521 Ga0451577_0170115 3300042876 Bacteria 1963
522 Ga0451577_1288509 3300042876 Bacteria 650
523 Ga0451577_1725766 3300042876 Unclassified 550
524 Ga0453683_0001749 3300044673 Bacteria 18015
525 Ga0466965_0071638 3300044683 Bacteria 1744
526 Ga0466965_0809268 3300044683 Bacteria 543
527 Ga0466963_0616679 3300044694 Bacteria 766
528 Ga0453684_0335194 3300044712 Bacteria 1709
529 Ga0453684_1485134 3300044712 Bacteria 700
530 Ga0466960_0669337 3300044901 Bacteria 621
531 Ga0466960_1012804 3300044901 Bacteria 511
532 Ga0451576_0733259 3300045051 Bacteria 1038
533 Ga0451576_1262493 3300045051 Bacteria 770
534 Ga0451576_1356746 3300045051 Unclassified 740
535 Ga0466967_0592370 3300045976 Bacteria 1094
536 Ga0495603_0474137 3300046455 Bacteria 717
537 Ga0495580_0000319 3300046472 Bacteria 39348
538 Ga0495594_0321687 3300046499 Bacteria 881
539 Ga0495586_0518800 3300046535 Bacteria 688
540 Ga0495656_0128634 3300046615 Bacteria 1203
541 Ga0495658_0182601 3300046683 Unclassified 1302
542 Ga0495636_0433434 3300047318 Unclassified 630
543 Ga0496100_0432184 3300048903 Unclassified 1007
544 Ga0496100_1636133 3300048903 Unclassified 509
545 Ga0496101_0398761 3300048904 Bacteria 1083
546 Ga0496101_1474142 3300048904 Bacteria 530
547 Ga0496102_0106319 3300048905 Bacteria 2612
548 Ga0496102_0700586 3300048905 Bacteria 936
549 Ga0496103_0623646 3300048906 Bacteria 686
550 Ga0496104_0271666 3300048907 Bacteria 1608
551 Ga0496104_0708353 3300048907 Bacteria 914
552 Ga0496106_0225540 3300048909 Unclassified 1495
553 Ga0496106_0413715 3300048909 Bacteria 1084
554 Ga0496106_0697146 3300048909 Bacteria 809
555 Ga0496106_1342095 3300048909 Unclassified 554
556 Ga0496108_0525516 3300048911 Unclassified 1033
557 Ga0496108_0590383 3300048911 Bacteria 968
558 Ga0496108_1366261 3300048911 Unclassified 594
559 Ga0496109_0461759 3300048912 Bacteria 1199
560 Ga0496109_1472466 3300048912 Unclassified 616
561 Ga0496110_0922564 3300048913 Bacteria 780
562 Ga0496112_0049540 3300048915 Unclassified 4118
563 Ga0496112_0051030 3300048915 Bacteria 4057
564 Ga0496112_0318135 3300048915 Bacteria 1501
565 Ga0496121_0001035 3300048924 Bacteria 49640
566 Ga0501291_028932 3300049514 Bacteria 925
567 Ga0501299_005995 3300049522 Bacteria 1892
568 Ga0501311_088092 3300049527 Bacteria 536
569 Ga0501031_0013574 3300049568 Bacteria 5307
570 Ga0501032_0024186 3300049569 Bacteria 4195
571 Ga0501033_0009833 3300049570 Bacteria 7339
572 Ga0501033_0240626 3300049570 Bacteria 1284
573 Ga0501036_0038284 3300049572 Bacteria 4058
574 Ga0501037_0021400 3300049573 Bacteria 4778
575 Ga0501037_0054232 3300049573 Bacteria 2932
576 Ga0501038_0001813 3300049574 Bacteria 19780
577 Ga0501038_0045039 3300049574 Bacteria 3830
578 Ga0501038_1033922 3300049574 Unclassified 602
579 Ga0501038_1064419 3300049574 Unclassified 592
580 Ga0501039_0019556 3300049575 Bacteria 5192
581 Ga0501039_0799232 3300049575 Bacteria 736
582 Ga0501040_0001107 3300049576 Bacteria 17068
583 Ga0501040_0035780 3300049576 Bacteria 3368
584 Ga0501040_0086621 3300049576 Bacteria 2175
585 Ga0501040_0555968 3300049576 Bacteria 828
586 Ga0501041_0000320 3300049577 Bacteria 23433
587 Ga0501041_0183091 3300049577 Bacteria 1311
588 Ga0501041_0456003 3300049577 Unclassified 812
589 Ga0501042_0000344 3300049578 Bacteria 23309
590 Ga0501042_0009875 3300049578 Bacteria 6375
591 Ga0501042_0780792 3300049578 Unclassified 695
592 Ga0501043_0031052 3300049579 Bacteria 4200
593 Ga0501043_0118310 3300049579 Bacteria 2078
594 Ga0501046_0011617 3300049580 Bacteria 7526
595 Ga0501046_0064845 3300049580 Bacteria 2850
596 Ga0501048_0010622 3300049582 Bacteria 6870
597 Ga0501048_0025633 3300049582 Bacteria 4297
598 Ga0501067_0300391 3300049583 Unclassified 894
599 Ga0501068_0014603 3300049584 Bacteria 4494
600 Ga0501068_0151187 3300049584 Bacteria 1459
601 Ga0501068_1072108 3300049584 Unclassified 532
602 Ga0501069_0040331 3300049585 Bacteria 2580
603 Ga0501070_0035091 3300049586 Bacteria 4191
604 Ga0501070_0238992 3300049586 Bacteria 1487
605 Ga0501071_0000317 3300049587 Bacteria 23301
606 Ga0501071_0016918 3300049587 Bacteria 5018
607 Ga0501071_0616952 3300049587 Bacteria 834
608 Ga0501071_1587343 3300049587 Bacteria 505
609 Ga0501072_0000574 3300049588 Bacteria 26476
610 Ga0501072_0093569 3300049588 Bacteria 2387
611 Ga0501072_0674699 3300049588 Bacteria 813
612 Ga0501072_0879871 3300049588 Unclassified 700
613 Ga0501072_1565193 3300049588 Unclassified 508
614 Ga0501073_0027625 3300049589 Bacteria 4057
615 Ga0501073_0332637 3300049589 Unclassified 1048
616 Ga0501074_0011344 3300049590 Bacteria 6476
617 Ga0501074_0025112 3300049590 Bacteria 4328
618 Ga0501075_0000513 3300049591 Bacteria 23373
619 Ga0501075_0003362 3300049591 Bacteria 10691
620 Ga0501075_0029414 3300049591 Bacteria 4063
621 Ga0501076_0000576 3300049592 Bacteria 23425
622 Ga0501076_0018169 3300049592 Bacteria 5355
623 Ga0501076_0057457 3300049592 Bacteria 3089
624 Ga0501076_0150536 3300049592 Bacteria 1893
625 Ga0501076_1325411 3300049592 Bacteria 592
626 Ga0501077_0000903 3300049593 Bacteria 17841
627 Ga0501077_0011889 3300049593 Bacteria 5445
628 Ga0501077_0049479 3300049593 Bacteria 2671
629 Ga0501077_0130191 3300049593 Unclassified 1595
630 Ga0501077_0516985 3300049593 Unclassified 766
631 Ga0501202_205994 3300049652 Unclassified 540
632 Ga0501227_014250 3300049665 Unclassified 1762
633 Ga0501233_045132 3300049668 Unclassified 1050
634 Ga0501235_139947 3300049669 Bacteria 619
635 Ga0501236_089943 3300049670 Unclassified 588
636 Ga0501247_024087 3300049677 Bacteria 803
637 Ga0501251_037960 3300049681 Bacteria 717
638 Ga0501225_0007472 3300049705 Bacteria 3165
639 Ga0501225_0123939 3300049705 Bacteria 769
640 Ga0501225_0335732 3300049705 Bacteria 519
641 Ga0501079_0001501 3300049741 Bacteria 16528
642 Ga0501079_0038808 3300049741 Bacteria 3672
643 Ga0501080_0006567 3300049742 Bacteria 10450
644 Ga0501080_0147844 3300049742 Bacteria 2172
645 Ga0501081_0000423 3300049743 Bacteria 23363
646 Ga0501081_0060086 3300049743 Bacteria 2632
647 Ga0501081_0283569 3300049743 Bacteria 1213
648 Ga0501081_0514814 3300049743 Bacteria 892
649 Ga0501081_0589722 3300049743 Bacteria 832
650 Ga0501081_0807135 3300049743 Unclassified 706
651 Ga0501081_1344711 3300049743 Unclassified 542
652 Ga0501083_0005809 3300049744 Bacteria 8741
653 Ga0501083_0101659 3300049744 Bacteria 1895
654 Ga0501265_065260 3300049762 Bacteria 603
655 Ga0501266_027167 3300049763 Bacteria 804
656 Ga0501268_015591 3300049765 Unclassified 1251
657 Ga0501035_0102964 3300049822 Bacteria 2504
658 Ga0501035_0110675 3300049822 Bacteria 2407
659 Ga0501035_1180393 3300049822 Bacteria 595
660 Ga0501044_0076398 3300049823 Bacteria 3399
661 Ga0501045_0002513 3300049824 Bacteria 12468
662 Ga0501045_0523138 3300049824 Unclassified 880
663 Ga0501045_0869778 3300049824 Bacteria 663
664 Ga0501045_1065524 3300049824 Unclassified 592
665 Ga0501212_007428 3300049851 Unclassified 1502
666 nmdc:mga05p37_105262_c1 3300050507 Bacteria 3471
667 nmdc:mga05p37_111264_c1 3300050507 Bacteria 3368
668 nmdc:mga05p37_1945581_c1 3300050507 Unclassified 559
669 nmdc:mga05p37_35482_c1 3300050507 Bacteria 3733
670 nmdc:mga05p37_54814_c1 3300050507 Bacteria 4904
671 nmdc:mga05p37_5586_c1 3300050507 Bacteria 14787
672 nmdc:mga05p37_731933_c1 3300050507 Bacteria 1093
673 nmdc:mga05p37_86276_c1 3300050507 Bacteria 3869
674 nmdc:mga09592_1427205_c1 3300050508 Bacteria 565
675 nmdc:mga09592_1640674_c1 3300050508 Unclassified 520
676 nmdc:mga09592_350042_c1 3300050508 Bacteria 1279
677 nmdc:mga09592_706272_c1 3300050508 Unclassified 858
678 nmdc:mga0qj67_116309_c1 3300050509 Bacteria 2161
679 nmdc:mga0qj67_246588_c1 3300050509 Bacteria 1449
680 nmdc:mga0qj67_321552_c1 3300050509 Bacteria 1252
681 nmdc:mga0qj67_76802_c1 3300050509 Unclassified 2672
682 nmdc:mga0qj67_782607_c1 3300050509 Bacteria 756
683 nmdc:mga0qj67_794403_c1 3300050509 Unclassified 749
684 nmdc:mga06r32_160600_c1 3300050510 Bacteria 2230
685 nmdc:mga06r32_2069307_c1 3300050510 Unclassified 502
686 nmdc:mga06r32_365009_c1 3300050510 Bacteria 1427
687 nmdc:mga06r32_69569_c1 3300050510 Bacteria 3402
688 nmdc:mga06r32_736538_c1 3300050510 Unclassified 950
689 nmdc:mga06r32_834553_c1 3300050510 Bacteria 881
690 nmdc:mga06r32_961547_c1 3300050510 Bacteria 808
691 nmdc:mga08y16_113752_c1 3300050511 Bacteria 2817
692 nmdc:mga08y16_1643812_c1 3300050511 Bacteria 599
693 nmdc:mga08y16_170704_c1 3300050511 Bacteria 2259
694 nmdc:mga08y16_20561_c1 3300050511 Bacteria 6968
695 nmdc:mga0n895_132125_c1 3300050512 Unclassified 2522
696 nmdc:mga0n895_1450631_c1 3300050512 Unclassified 654
697 nmdc:mga0n895_203789_c1 3300050512 Bacteria 2009
698 nmdc:mga0n895_24725_c1 3300050512 Bacteria 5664
699 nmdc:mga0n895_254711_c1 3300050512 Bacteria 1781
700 nmdc:mga0n895_2742_c1 3300050512 Bacteria 13908
701 nmdc:mga0n895_349243_c1 3300050512 Bacteria 1498
702 nmdc:mga0n895_611445_c1 3300050512 Bacteria 1091
703 nmdc:mga0n895_619097_c1 3300050512 Bacteria 1084
704 nmdc:mga0rr50_1174906_c1 3300050513 Bacteria 652
705 nmdc:mga0rr50_240977_c1 3300050513 Bacteria 1499
706 nmdc:mga0rr50_25473_c1 3300050513 Bacteria 4113
707 nmdc:mga0rr50_4059_c1 3300050513 Bacteria 8547
708 nmdc:mga0rr50_53845_c1 3300050513 Unclassified 2995
709 nmdc:mga0rr50_8734_c2 3300050513 Bacteria 5000
710 nmdc:mga0rr50_875596_c1 3300050513 Bacteria 766
711 nmdc:mga08x19_21129_c1 3300050514 Unclassified 4014
712 nmdc:mga08x19_23580_c1 3300050514 Bacteria 3818
713 nmdc:mga08x19_335909_c1 3300050514 Unclassified 1053
714 nmdc:mga08x19_392957_c1 3300050514 Bacteria 972
715 nmdc:mga08x19_407912_c1 3300050514 Bacteria 954
716 nmdc:mga08x19_89427_c1 3300050514 Bacteria 2031
717 nmdc:mga0a205_1197_c1 3300050515 Bacteria 21384
718 nmdc:mga0a205_1243527_c1 3300050515 Unclassified 592
719 nmdc:mga0a205_15616_c1 3300050515 Bacteria 7097
720 nmdc:mga0a205_189175_c1 3300050515 Bacteria 1951
721 nmdc:mga0a205_292750_c1 3300050515 Bacteria 1502
722 nmdc:mga0a205_324514_c1 3300050515 Bacteria 1410
723 nmdc:mga0a205_58716_c1 3300050515 Bacteria 3716
724 nmdc:mga0a205_591410_c1 3300050515 Bacteria 963
725 nmdc:mga0a205_65349_c1 3300050515 Bacteria 3514
726 nmdc:mga0a205_77643_c1 3300050515 Bacteria 3209
727 nmdc:mga0a205_80717_c1 3300050515 Bacteria 3142
728 Ga0500614_245695 3300053123 Bacteria 557
729 Ga0501084_0001468 3300054114 Bacteria 18724
730 Ga0501084_0105078 3300054114 Bacteria 2372
731 Ga0501084_0108629 3300054114 Bacteria 2330
732 Ga0501084_1108890 3300054114 Bacteria 664
733 Ga0501084_1800672 3300054114 Bacteria 511
734 Ga0590071_007223 3300059421 Bacteria 2630
735 Ga0590071_078757 3300059421 Bacteria 818
736 Ga0590074_109309 3300059423 Unclassified 544
737 Ga0501082_0006749 3300060353 Bacteria 9923
738 Ga0501082_0048010 3300060353 Bacteria 3679
739 Ga0501082_0091100 3300060353 Bacteria 2632
740 Ga0501082_0158625 3300060353 Bacteria 1966
741 Ga0501082_0238938 3300060353 Bacteria 1581
742 Ga0501082_0701675 3300060353 Bacteria 886
743 Ga0501082_1218414 3300060353 Bacteria 658
744 Ga0530510_0001077 3300061734 Bacteria 18097
745 Ga0530510_0014147 3300061734 Bacteria 5625
746 Ga0530510_0185010 3300061734 Bacteria 1545
747 Ga0530510_0273778 3300061734 Unclassified 1260
748 Ga0530510_0464169 3300061734 Bacteria 958
749 Ga0530510_1150035 3300061734 Unclassified 595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025899 Ga0207642_10051569 Ga0207642_100515692 87
2 3300006871 Ga0075434_100909133 Ga0075434_1009091332 90
3 3300004798 Ga0058859_10042614 Ga0058859_100426142 91
4 3300004801 Ga0058860_10067954 Ga0058860_100679542 91
5 3300004801 Ga0058860_11489369 Ga0058860_114893692 91
6 3300005335 Ga0070666_10200666 Ga0070666_102006661 91
7 3300005335 Ga0070666_10259902 Ga0070666_102599022 91
8 3300005337 Ga0070682_100743405 Ga0070682_1007434052 91
9 3300005337 Ga0070682_100977146 Ga0070682_1009771461 91
10 3300005340 Ga0070689_100135951 Ga0070689_1001359512 91
11 3300005343 Ga0070687_100102261 Ga0070687_1001022613 91
12 3300005345 Ga0070692_10606446 Ga0070692_106064461 91
13 3300005345 Ga0070692_11034244 Ga0070692_110342441 91
14 3300005353 Ga0070669_100368340 Ga0070669_1003683402 91
15 3300005365 Ga0070688_100050255 Ga0070688_1000502552 91
16 3300005366 Ga0070659_100275851 Ga0070659_1002758512 91
17 3300005436 Ga0070713_100950439 Ga0070713_1009504392 91
18 3300005438 Ga0070701_10051673 Ga0070701_100516732 91
19 3300005444 Ga0070694_100581013 Ga0070694_1005810132 91
20 3300005444 Ga0070694_100911016 Ga0070694_1009110162 91
21 3300005445 Ga0070708_100496844 Ga0070708_1004968442 91
22 3300005455 Ga0070663_101512430 Ga0070663_1015124301 91
23 3300005457 Ga0070662_100113587 Ga0070662_1001135872 91
24 3300005466 Ga0070685_10049255 Ga0070685_100492552 91
25 3300005467 Ga0070706_100266187 Ga0070706_1002661872 91
26 3300005467 Ga0070706_100268101 Ga0070706_1002681012 91
27 3300005467 Ga0070706_101317738 Ga0070706_1013177382 91
28 3300005468 Ga0070707_100141449 Ga0070707_1001414493 91
29 3300005468 Ga0070707_101509806 Ga0070707_1015098061 91
30 3300005518 Ga0070699_100872608 Ga0070699_1008726082 91
31 3300005536 Ga0070697_100324722 Ga0070697_1003247222 91
32 3300005544 Ga0070686_100013641 Ga0070686_1000136414 91
33 3300005544 Ga0070686_101582768 Ga0070686_1015827682 91
34 3300005546 Ga0070696_101008779 Ga0070696_1010087792 91
35 3300005546 Ga0070696_101161107 Ga0070696_1011611072 91
36 3300005548 Ga0070665_100899942 Ga0070665_1008999421 91
37 3300005549 Ga0070704_100023530 Ga0070704_1000235305 91
38 3300005577 Ga0068857_100127961 Ga0068857_1001279611 91
39 3300005578 Ga0068854_101892294 Ga0068854_1018922942 91
40 3300005615 Ga0070702_100035331 Ga0070702_1000353314 91
41 3300005617 Ga0068859_100009654 Ga0068859_10000965410 91
42 3300005618 Ga0068864_100155949 Ga0068864_1001559494 91
43 3300005618 Ga0068864_100605724 Ga0068864_1006057241 91
44 3300005618 Ga0068864_100941925 Ga0068864_1009419252 91
45 3300005719 Ga0068861_100101787 Ga0068861_1001017874 91
46 3300005719 Ga0068861_101821462 Ga0068861_1018214621 91
47 3300005719 Ga0068861_101906499 Ga0068861_1019064992 91
48 3300005842 Ga0068858_100038180 Ga0068858_1000381804 91
49 3300005844 Ga0068862_100274102 Ga0068862_1002741022 91
50 3300005844 Ga0068862_101040683 Ga0068862_1010406832 91
51 3300005985 Ga0081539_10000597 Ga0081539_1000059729 91
52 3300005985 Ga0081539_10092386 Ga0081539_100923861 91
53 3300006028 Ga0070717_10373601 Ga0070717_103736012 91
54 3300006058 Ga0075432_10141853 Ga0075432_101418532 91
55 3300006358 Ga0068871_102262809 Ga0068871_1022628092 91
56 3300006844 Ga0075428_100155465 Ga0075428_1001554654 91
57 3300006846 Ga0075430_100266972 Ga0075430_1002669722 91
58 3300006846 Ga0075430_100491428 Ga0075430_1004914281 91
59 3300006847 Ga0075431_100133852 Ga0075431_1001338522 91
60 3300006852 Ga0075433_10001943 Ga0075433_100019433 91
61 3300006852 Ga0075433_10068418 Ga0075433_100684184 91
62 3300006852 Ga0075433_11295867 Ga0075433_112958671 91
63 3300006871 Ga0075434_100003172 Ga0075434_1000031726 91
64 3300006871 Ga0075434_100023983 Ga0075434_1000239833 91
65 3300006871 Ga0075434_100059166 Ga0075434_1000591665 91
66 3300006871 Ga0075434_100359477 Ga0075434_1003594772 91
67 3300006871 Ga0075434_101313373 Ga0075434_1013133732 91
68 3300006880 Ga0075429_100774631 Ga0075429_1007746312 91
69 3300006881 Ga0068865_100400304 Ga0068865_1004003042 91
70 3300006914 Ga0075436_100066639 Ga0075436_1000666392 91
71 3300006931 Ga0097620_100009653 Ga0097620_10000965310 91
72 3300007076 Ga0075435_100089378 Ga0075435_1000893784 91
73 3300007076 Ga0075435_101336622 Ga0075435_1013366221 91
74 3300007076 Ga0075435_101511012 Ga0075435_1015110122 91
75 3300009092 Ga0105250_10564329 Ga0105250_105643292 91
76 3300009094 Ga0111539_10703303 Ga0111539_107033031 91
77 3300009098 Ga0105245_10179305 Ga0105245_101793051 91
78 3300009147 Ga0114129_10044906 Ga0114129_100449063 91
79 3300009147 Ga0114129_11448455 Ga0114129_114484552 91
80 3300009176 Ga0105242_10326011 Ga0105242_103260112 91
81 3300009545 Ga0105237_12183156 Ga0105237_121831562 91
82 3300009553 Ga0105249_10174231 Ga0105249_101742313 91
83 3300009553 Ga0105249_10213838 Ga0105249_102138381 91
84 3300010375 Ga0105239_12642740 Ga0105239_126427402 91
85 3300011119 Ga0105246_10105267 Ga0105246_101052673 91
86 3300013297 Ga0157378_10225070 Ga0157378_102250702 91
87 3300013306 Ga0163162_10042632 Ga0163162_100426325 91
88 3300013307 Ga0157372_11100783 Ga0157372_111007831 91
89 3300013308 Ga0157375_10052750 Ga0157375_100527502 91
90 3300013308 Ga0157375_10353274 Ga0157375_103532742 91
91 3300014326 Ga0157380_10418420 Ga0157380_104184202 91
92 3300014968 Ga0157379_10023228 Ga0157379_100232283 91
93 3300014969 Ga0157376_10968581 Ga0157376_109685812 91
94 3300017792 Ga0163161_10030861 Ga0163161_100308613 91
95 3300017792 Ga0163161_10905466 Ga0163161_109054662 91
96 3300025903 Ga0207680_10887648 Ga0207680_108876482 91
97 3300025903 Ga0207680_11234623 Ga0207680_112346231 91
98 3300025910 Ga0207684_10169248 Ga0207684_101692482 91
99 3300025910 Ga0207684_10492016 Ga0207684_104920162 91
100 3300025910 Ga0207684_11662582 Ga0207684_116625822 91
101 3300025914 Ga0207671_11518179 Ga0207671_115181792 91
102 3300025918 Ga0207662_10575740 Ga0207662_105757401 91
103 3300025922 Ga0207646_10302171 Ga0207646_103021712 91
104 3300025922 Ga0207646_11530895 Ga0207646_115308951 91
105 3300025928 Ga0207700_10710984 Ga0207700_107109842 91
106 3300025929 Ga0207664_11950612 Ga0207664_119506122 91
107 3300025932 Ga0207690_10237728 Ga0207690_102377282 91
108 3300025933 Ga0207706_10209758 Ga0207706_102097582 91
109 3300025935 Ga0207709_10323719 Ga0207709_103237193 91
110 3300025936 Ga0207670_10146756 Ga0207670_101467561 91
111 3300025944 Ga0207661_11959567 Ga0207661_119595672 91
112 3300026035 Ga0207703_10249996 Ga0207703_102499962 91
113 3300026067 Ga0207678_10239874 Ga0207678_102398742 91
114 3300026067 Ga0207678_10626048 Ga0207678_106260482 91
115 3300026075 Ga0207708_10052305 Ga0207708_100523054 91
116 3300026075 Ga0207708_11750909 Ga0207708_117509092 91
117 3300026095 Ga0207676_10773304 Ga0207676_107733042 91
118 3300026095 Ga0207676_11164414 Ga0207676_111644141 91
119 3300026116 Ga0207674_10068699 Ga0207674_100686991 91
120 3300026118 Ga0207675_100152977 Ga0207675_1001529772 91
121 3300026118 Ga0207675_102438671 Ga0207675_1024386711 91
122 3300028379 Ga0268266_10816402 Ga0268266_108164022 91
123 3300028380 Ga0268265_11444613 Ga0268265_114446132 91
124 3300031235 Ga0265330_10006523 Ga0265330_100065236 91
125 3300031238 Ga0265332_10000445 Ga0265332_1000044526 91
126 3300031239 Ga0265328_10004623 Ga0265328_100046234 91
127 3300031240 Ga0265320_10166742 Ga0265320_101667422 91
128 3300031242 Ga0265329_10020192 Ga0265329_100201922 91
129 3300031250 Ga0265331_10000076 Ga0265331_1000007664 91
130 3300031251 Ga0265327_10194101 Ga0265327_101941012 91
131 3300031344 Ga0265316_10000006 Ga0265316_10000006182 91
132 3300031548 Ga0307408_100115535 Ga0307408_1001155352 91
133 3300031548 Ga0307408_100148744 Ga0307408_1001487441 91
134 3300031548 Ga0307408_100612483 Ga0307408_1006124832 91
135 3300031548 Ga0307408_100836110 Ga0307408_1008361102 91
136 3300031711 Ga0265314_10000056 Ga0265314_1000005628 91
137 3300031712 Ga0265342_10020657 Ga0265342_100206574 91
138 3300031731 Ga0307405_10361429 Ga0307405_103614292 91
139 3300031824 Ga0307413_10017383 Ga0307413_100173832 91
140 3300031824 Ga0307413_10332317 Ga0307413_103323172 91
141 3300031852 Ga0307410_10028316 Ga0307410_100283164 91
142 3300031852 Ga0307410_10180000 Ga0307410_101800002 91
143 3300031852 Ga0307410_10199381 Ga0307410_101993813 91
144 3300031852 Ga0307410_10218337 Ga0307410_102183372 91
145 3300031852 Ga0307410_11600752 Ga0307410_116007522 91
146 3300031901 Ga0307406_10053549 Ga0307406_100535493 91
147 3300031901 Ga0307406_10080743 Ga0307406_100807432 91
148 3300031901 Ga0307406_10932272 Ga0307406_109322721 91
149 3300031901 Ga0307406_11580362 Ga0307406_115803621 91
150 3300031903 Ga0307407_10181062 Ga0307407_101810622 91
151 3300031903 Ga0307407_10756595 Ga0307407_107565952 91
152 3300031903 Ga0307407_11671827 Ga0307407_116718272 91
153 3300031911 Ga0307412_10192147 Ga0307412_101921473 91
154 3300031911 Ga0307412_11238252 Ga0307412_112382522 91
155 3300031995 Ga0307409_100094868 Ga0307409_1000948683 91
156 3300031995 Ga0307409_100170434 Ga0307409_1001704343 91
157 3300031995 Ga0307409_100201133 Ga0307409_1002011331 91
158 3300031995 Ga0307409_101124717 Ga0307409_1011247172 91
159 3300031995 Ga0307409_101358948 Ga0307409_1013589482 91
160 3300031995 Ga0307409_101472470 Ga0307409_1014724702 91
161 3300032002 Ga0307416_100011010 Ga0307416_1000110104 91
162 3300032002 Ga0307416_100125019 Ga0307416_1001250192 91
163 3300032002 Ga0307416_100144042 Ga0307416_1001440422 91
164 3300032002 Ga0307416_100268741 Ga0307416_1002687411 91
165 3300032002 Ga0307416_100391102 Ga0307416_1003911022 91
166 3300032002 Ga0307416_100543350 Ga0307416_1005433501 91
167 3300032002 Ga0307416_103790921 Ga0307416_1037909212 91
168 3300032004 Ga0307414_10156300 Ga0307414_101563002 91
169 3300032004 Ga0307414_10503101 Ga0307414_105031012 91
170 3300032004 Ga0307414_10889152 Ga0307414_108891522 91
171 3300032004 Ga0307414_11468748 Ga0307414_114687482 91
172 3300032004 Ga0307414_12133792 Ga0307414_121337921 91
173 3300032005 Ga0307411_10033546 Ga0307411_100335463 91
174 3300032005 Ga0307411_10226066 Ga0307411_102260662 91
175 3300032005 Ga0307411_10243631 Ga0307411_102436312 91
176 3300032005 Ga0307411_10407390 Ga0307411_104073902 91
177 3300032005 Ga0307411_11205581 Ga0307411_112055812 91
178 3300032126 Ga0307415_100026491 Ga0307415_1000264912 91
179 3300032126 Ga0307415_100042278 Ga0307415_1000422782 91
180 3300032126 Ga0307415_100179284 Ga0307415_1001792841 91
181 3300032126 Ga0307415_101142399 Ga0307415_1011423992 91
182 3300032126 Ga0307415_101585566 Ga0307415_1015855662 91
183 3300032126 Ga0307415_102513617 Ga0307415_1025136172 91
184 3300035091 Ga0373951_0023590 Ga0373951_0023590_270_545 91
185 3300035115 Ga0373941_0062561 Ga0373941_0062561_291_566 91
186 3300035695 Ga0373927_0296065 Ga0373927_0296065_481_756 91
187 3300041413 Ga0439465_0332424 Ga0439465_0332424_138_419 91
188 3300042876 Ga0451577_1725766 Ga0451577_1725766_116_391 91
189 3300044683 Ga0466965_0071638 Ga0466965_0071638_66_347 91
190 3300044683 Ga0466965_0809268 Ga0466965_0809268_52_330 91
191 3300044694 Ga0466963_0616679 Ga0466963_0616679_24_305 91
192 3300044901 Ga0466960_0669337 Ga0466960_0669337_246_527 91
193 3300044901 Ga0466960_1012804 Ga0466960_1012804_58_339 91
194 3300045976 Ga0466967_0592370 Ga0466967_0592370_71_352 91
195 3300046472 Ga0495580_0000319 Ga0495580_0000319_25522_25797 91
196 3300046683 Ga0495658_0182601 Ga0495658_0182601_232_507 91
197 3300048904 Ga0496101_0398761 Ga0496101_0398761_638_919 91
198 3300048905 Ga0496102_0106319 Ga0496102_0106319_787_1062 91
199 3300048905 Ga0496102_0700586 Ga0496102_0700586_450_731 91
200 3300048906 Ga0496103_0623646 Ga0496103_0623646_386_667 91
201 3300048907 Ga0496104_0708353 Ga0496104_0708353_537_812 91
202 3300048909 Ga0496106_0697146 Ga0496106_0697146_211_486 91
203 3300048911 Ga0496108_0590383 Ga0496108_0590383_188_463 91
204 3300048913 Ga0496110_0922564 Ga0496110_0922564_91_372 91
205 3300048924 Ga0496121_0001035 Ga0496121_0001035_27336_27614 91
206 3300049527 Ga0501311_088092 Ga0501311_088092_120_395 91
207 3300049705 Ga0501225_0335732 Ga0501225_0335732_90_365 91
208 3300049743 Ga0501081_0589722 Ga0501081_0589722_513_788 91
209 3300049762 Ga0501265_065260 Ga0501265_065260_94_369 91
210 3300049822 Ga0501035_1180393 Ga0501035_1180393_140_421 91
211 3300050507 nmdc:mga05p37_1945581_c1 nmdc:mga05p37_1945581_c1_73_348 91
212 3300050508 nmdc:mga09592_1640674_c1 nmdc:mga09592_1640674_c1_166_441 91
213 3300050509 nmdc:mga0qj67_246588_c1 nmdc:mga0qj67_246588_c1_397_672 91
214 3300050509 nmdc:mga0qj67_782607_c1 nmdc:mga0qj67_782607_c1_144_419 91
215 3300050510 nmdc:mga06r32_365009_c1 nmdc:mga06r32_365009_c1_838_1113 91
216 3300050511 nmdc:mga08y16_113752_c1 nmdc:mga08y16_113752_c1_1882_2157 91
217 3300050512 nmdc:mga0n895_24725_c1 nmdc:mga0n895_24725_c1_374_649 91
218 3300050512 nmdc:mga0n895_611445_c1 nmdc:mga0n895_611445_c1_305_580 91
219 3300050513 nmdc:mga0rr50_1174906_c1 nmdc:mga0rr50_1174906_c1_116_391 91
220 3300050513 nmdc:mga0rr50_8734_c2 nmdc:mga0rr50_8734_c2_3237_3566 91
221 3300050514 nmdc:mga08x19_23580_c1 nmdc:mga08x19_23580_c1_1842_2171 91
222 3300050515 nmdc:mga0a205_1197_c1 nmdc:mga0a205_1197_c1_9767_10042 91
223 3300050515 nmdc:mga0a205_591410_c1 nmdc:mga0a205_591410_c1_213_488 91
224 3300050515 nmdc:mga0a205_80717_c1 nmdc:mga0a205_80717_c1_1019_1294 91
225 3300053123 Ga0500614_245695 Ga0500614_245695_152_430 91
226 3300060353 Ga0501082_1218414 Ga0501082_1218414_307_588 91
227 2209111006 2214753862 2213766834 92
228 3300000043 ARcpr5yngRDRAFT_c025608 ARcpr5yngRDRAFT_0256081 92
229 3300003373 JGI25407J50210_10154818 JGI25407J50210_101548182 92
230 3300003911 JGI25405J52794_10001086 JGI25405J52794_100010865 92
231 3300004803 Ga0058862_12422882 Ga0058862_124228822 92
232 3300005289 Ga0065704_10079869 Ga0065704_100798692 92
233 3300005289 Ga0065704_10431775 Ga0065704_104317752 92
234 3300005290 Ga0065712_10068895 Ga0065712_1006889510 92
235 3300005290 Ga0065712_10218390 Ga0065712_102183902 92
236 3300005293 Ga0065715_10003569 Ga0065715_100035696 92
237 3300005293 Ga0065715_10007065 Ga0065715_100070652 92
238 3300005295 Ga0065707_10001176 Ga0065707_100011761 92
239 3300005295 Ga0065707_10107261 Ga0065707_101072612 92
240 3300005295 Ga0065707_10139404 Ga0065707_101394042 92
241 3300005295 Ga0065707_10264351 Ga0065707_102643512 92
242 3300005295 Ga0065707_10340060 Ga0065707_103400602 92
243 3300005327 Ga0070658_10024687 Ga0070658_100246877 92
244 3300005328 Ga0070676_10006899 Ga0070676_100068994 92
245 3300005329 Ga0070683_101028336 Ga0070683_1010283362 92
246 3300005330 Ga0070690_100098550 Ga0070690_1000985502 92
247 3300005331 Ga0070670_101631036 Ga0070670_1016310361 92
248 3300005333 Ga0070677_10647053 Ga0070677_106470532 92
249 3300005334 Ga0068869_100065762 Ga0068869_1000657622 92
250 3300005335 Ga0070666_10159846 Ga0070666_101598462 92
251 3300005336 Ga0070680_100071012 Ga0070680_1000710126 92
252 3300005336 Ga0070680_100949868 Ga0070680_1009498682 92
253 3300005337 Ga0070682_100528189 Ga0070682_1005281892 92
254 3300005338 Ga0068868_100939490 Ga0068868_1009394902 92
255 3300005339 Ga0070660_100471801 Ga0070660_1004718012 92
256 3300005340 Ga0070689_101102391 Ga0070689_1011023912 92
257 3300005341 Ga0070691_10003549 Ga0070691_100035494 92
258 3300005343 Ga0070687_100162251 Ga0070687_1001622512 92
259 3300005344 Ga0070661_100003230 Ga0070661_1000032302 92
260 3300005344 Ga0070661_101534050 Ga0070661_1015340502 92
261 3300005345 Ga0070692_10934193 Ga0070692_109341932 92
262 3300005347 Ga0070668_100084803 Ga0070668_1000848034 92
263 3300005347 Ga0070668_100176391 Ga0070668_1001763912 92
264 3300005353 Ga0070669_100832543 Ga0070669_1008325432 92
265 3300005353 Ga0070669_101285220 Ga0070669_1012852201 92
266 3300005354 Ga0070675_101063953 Ga0070675_1010639532 92
267 3300005354 Ga0070675_101540764 Ga0070675_1015407641 92
268 3300005356 Ga0070674_100983338 Ga0070674_1009833382 92
269 3300005364 Ga0070673_100578113 Ga0070673_1005781132 92
270 3300005365 Ga0070688_101275695 Ga0070688_1012756951 92
271 3300005367 Ga0070667_100061802 Ga0070667_1000618025 92
272 3300005406 Ga0070703_10113611 Ga0070703_101136112 92
273 3300005434 Ga0070709_10358089 Ga0070709_103580892 92
274 3300005436 Ga0070713_100666896 Ga0070713_1006668961 92
275 3300005439 Ga0070711_101508951 Ga0070711_1015089511 92
276 3300005440 Ga0070705_100125548 Ga0070705_1001255482 92
277 3300005440 Ga0070705_100975446 Ga0070705_1009754461 92
278 3300005444 Ga0070694_100007677 Ga0070694_1000076774 92
279 3300005445 Ga0070708_100045418 Ga0070708_1000454183 92
280 3300005445 Ga0070708_101576292 Ga0070708_1015762922 92
281 3300005455 Ga0070663_100966176 Ga0070663_1009661761 92
282 3300005456 Ga0070678_100860693 Ga0070678_1008606932 92
283 3300005457 Ga0070662_100136288 Ga0070662_1001362882 92
284 3300005457 Ga0070662_100217850 Ga0070662_1002178502 92
285 3300005457 Ga0070662_101637156 Ga0070662_1016371561 92
286 3300005458 Ga0070681_10001307 Ga0070681_1000130723 92
287 3300005467 Ga0070706_100060250 Ga0070706_1000602506 92
288 3300005468 Ga0070707_100251340 Ga0070707_1002513402 92
289 3300005468 Ga0070707_100401878 Ga0070707_1004018782 92
290 3300005468 Ga0070707_101874645 Ga0070707_1018746452 92
291 3300005471 Ga0070698_100071111 Ga0070698_1000711116 92
292 3300005471 Ga0070698_100346817 Ga0070698_1003468171 92
293 3300005471 Ga0070698_101762902 Ga0070698_1017629021 92
294 3300005471 Ga0070698_101960263 Ga0070698_1019602631 92
295 3300005530 Ga0070679_100007207 Ga0070679_1000072072 92
296 3300005535 Ga0070684_100160227 Ga0070684_1001602271 92
297 3300005536 Ga0070697_100157425 Ga0070697_1001574254 92
298 3300005536 Ga0070697_100279298 Ga0070697_1002792982 92
299 3300005536 Ga0070697_100562388 Ga0070697_1005623882 92
300 3300005543 Ga0070672_100042151 Ga0070672_1000421512 92
301 3300005544 Ga0070686_100016472 Ga0070686_1000164727 92
302 3300005545 Ga0070695_100048397 Ga0070695_1000483972 92
303 3300005545 Ga0070695_100156746 Ga0070695_1001567462 92
304 3300005546 Ga0070696_100008790 Ga0070696_1000087903 92
305 3300005546 Ga0070696_100049596 Ga0070696_1000495962 92
306 3300005546 Ga0070696_101765074 Ga0070696_1017650742 92
307 3300005547 Ga0070693_100042793 Ga0070693_1000427934 92
308 3300005549 Ga0070704_100559202 Ga0070704_1005592022 92
309 3300005549 Ga0070704_100713696 Ga0070704_1007136962 92
310 3300005549 Ga0070704_102023605 Ga0070704_1020236051 92
311 3300005564 Ga0070664_100006377 Ga0070664_1000063775 92
312 3300005564 Ga0070664_100163699 Ga0070664_1001636992 92
313 3300005577 Ga0068857_100037201 Ga0068857_1000372013 92
314 3300005578 Ga0068854_100447931 Ga0068854_1004479312 92
315 3300005614 Ga0068856_100019729 Ga0068856_1000197293 92
316 3300005617 Ga0068859_100553075 Ga0068859_1005530752 92
317 3300005617 Ga0068859_101686294 Ga0068859_1016862942 92
318 3300005617 Ga0068859_102973101 Ga0068859_1029731012 92
319 3300005618 Ga0068864_100216130 Ga0068864_1002161302 92
320 3300005718 Ga0068866_10054935 Ga0068866_100549352 92
321 3300005719 Ga0068861_100670450 Ga0068861_1006704502 92
322 3300005840 Ga0068870_10477936 Ga0068870_104779361 92
323 3300005840 Ga0068870_10711867 Ga0068870_107118672 92
324 3300005841 Ga0068863_100343623 Ga0068863_1003436233 92
325 3300005842 Ga0068858_101146667 Ga0068858_1011466672 92
326 3300005937 Ga0081455_10000223 Ga0081455_1000022358 92
327 3300005981 Ga0081538_10004812 Ga0081538_100048124 92
328 3300005981 Ga0081538_10046498 Ga0081538_100464982 92
329 3300005981 Ga0081538_10107300 Ga0081538_101073002 92
330 3300005983 Ga0081540_1176263 Ga0081540_11762632 92
331 3300006028 Ga0070717_11425243 Ga0070717_114252431 92
332 3300006058 Ga0075432_10077026 Ga0075432_100770261 92
333 3300006163 Ga0070715_10557010 Ga0070715_105570102 92
334 3300006173 Ga0070716_100106218 Ga0070716_1001062182 92
335 3300006173 Ga0070716_100114765 Ga0070716_1001147652 92
336 3300006173 Ga0070716_100115355 Ga0070716_1001153552 92
337 3300006173 Ga0070716_100807279 Ga0070716_1008072792 92
338 3300006175 Ga0070712_100433833 Ga0070712_1004338332 92
339 3300006194 Ga0075427_10006155 Ga0075427_100061553 92
340 3300006237 Ga0097621_100248783 Ga0097621_1002487833 92
341 3300006358 Ga0068871_100030902 Ga0068871_1000309024 92
342 3300006844 Ga0075428_100035445 Ga0075428_1000354454 92
343 3300006844 Ga0075428_100058926 Ga0075428_1000589265 92
344 3300006844 Ga0075428_100127230 Ga0075428_1001272302 92
345 3300006844 Ga0075428_100498440 Ga0075428_1004984402 92
346 3300006844 Ga0075428_100824216 Ga0075428_1008242162 92
347 3300006844 Ga0075428_101564951 Ga0075428_1015649512 92
348 3300006846 Ga0075430_100056524 Ga0075430_1000565243 92
349 3300006846 Ga0075430_100058839 Ga0075430_1000588395 92
350 3300006846 Ga0075430_100111961 Ga0075430_1001119612 92
351 3300006846 Ga0075430_100332148 Ga0075430_1003321482 92
352 3300006846 Ga0075430_100516308 Ga0075430_1005163082 92
353 3300006847 Ga0075431_100021111 Ga0075431_1000211114 92
354 3300006847 Ga0075431_100046181 Ga0075431_1000461814 92
355 3300006847 Ga0075431_100102716 Ga0075431_1001027164 92
356 3300006847 Ga0075431_100118579 Ga0075431_1001185793 92
357 3300006847 Ga0075431_101072477 Ga0075431_1010724772 92
358 3300006847 Ga0075431_101272885 Ga0075431_1012728851 92
359 3300006852 Ga0075433_10005393 Ga0075433_100053935 92
360 3300006852 Ga0075433_10066778 Ga0075433_100667784 92
361 3300006852 Ga0075433_10339588 Ga0075433_103395882 92
362 3300006852 Ga0075433_10344405 Ga0075433_103444052 92
363 3300006852 Ga0075433_10650776 Ga0075433_106507762 92
364 3300006852 Ga0075433_10986088 Ga0075433_109860882 92
365 3300006871 Ga0075434_100005178 Ga0075434_1000051786 92
366 3300006871 Ga0075434_100110008 Ga0075434_1001100082 92
367 3300006871 Ga0075434_100312167 Ga0075434_1003121672 92
368 3300006871 Ga0075434_100360861 Ga0075434_1003608612 92
369 3300006871 Ga0075434_100415459 Ga0075434_1004154592 92
370 3300006871 Ga0075434_100741250 Ga0075434_1007412502 92
371 3300006871 Ga0075434_101122572 Ga0075434_1011225722 92
372 3300006880 Ga0075429_100036332 Ga0075429_1000363322 92
373 3300006880 Ga0075429_100303923 Ga0075429_1003039232 92
374 3300006880 Ga0075429_100772052 Ga0075429_1007720521 92
375 3300006881 Ga0068865_100561325 Ga0068865_1005613252 92
376 3300006881 Ga0068865_101093992 Ga0068865_1010939922 92
377 3300006914 Ga0075436_100041107 Ga0075436_1000411072 92
378 3300006914 Ga0075436_100149506 Ga0075436_1001495062 92
379 3300006914 Ga0075436_100453473 Ga0075436_1004534732 92
380 3300006914 Ga0075436_100547589 Ga0075436_1005475892 92
381 3300006914 Ga0075436_100644735 Ga0075436_1006447352 92
382 3300006931 Ga0097620_100553081 Ga0097620_1005530812 92
383 3300006931 Ga0097620_101686114 Ga0097620_1016861142 92
384 3300006931 Ga0097620_102971720 Ga0097620_1029717202 92
385 3300007076 Ga0075435_100010907 Ga0075435_1000109077 92
386 3300007076 Ga0075435_100034480 Ga0075435_1000344802 92
387 3300007076 Ga0075435_100091020 Ga0075435_1000910205 92
388 3300007076 Ga0075435_101070694 Ga0075435_1010706941 92
389 3300009093 Ga0105240_10344208 Ga0105240_103442082 92
390 3300009093 Ga0105240_11763762 Ga0105240_117637622 92
391 3300009094 Ga0111539_10018416 Ga0111539_100184164 92
392 3300009094 Ga0111539_10130618 Ga0111539_101306183 92
393 3300009094 Ga0111539_10419206 Ga0111539_104192062 92
394 3300009098 Ga0105245_10241543 Ga0105245_102415433 92
395 3300009147 Ga0114129_10007068 Ga0114129_100070683 92
396 3300009147 Ga0114129_10009779 Ga0114129_100097793 92
397 3300009147 Ga0114129_10067938 Ga0114129_100679384 92
398 3300009147 Ga0114129_10141733 Ga0114129_101417335 92
399 3300009147 Ga0114129_10155601 Ga0114129_101556012 92
400 3300009147 Ga0114129_10253892 Ga0114129_102538922 92
401 3300009147 Ga0114129_10261868 Ga0114129_102618683 92
402 3300009148 Ga0105243_10362271 Ga0105243_103622712 92
403 3300009174 Ga0105241_10023686 Ga0105241_100236862 92
404 3300009176 Ga0105242_10023246 Ga0105242_100232469 92
405 3300009176 Ga0105242_10082027 Ga0105242_100820272 92
406 3300009545 Ga0105237_10268052 Ga0105237_102680522 92
407 3300009553 Ga0105249_10668698 Ga0105249_106686982 92
408 3300009553 Ga0105249_11229734 Ga0105249_112297342 92
409 3300011119 Ga0105246_10007585 Ga0105246_100075852 92
410 3300012497 Ga0157319_1012023 Ga0157319_10120232 92
411 3300012500 Ga0157314_1008434 Ga0157314_10084342 92
412 3300012506 Ga0157324_1009637 Ga0157324_10096372 92
413 3300012510 Ga0157316_1022501 Ga0157316_10225011 92
414 3300013100 Ga0157373_10131015 Ga0157373_101310153 92
415 3300013102 Ga0157371_10011208 Ga0157371_100112087 92
416 3300013296 Ga0157374_11512624 Ga0157374_115126241 92
417 3300013297 Ga0157378_10048977 Ga0157378_100489777 92
418 3300013297 Ga0157378_12483680 Ga0157378_124836801 92
419 3300013306 Ga0163162_10013962 Ga0163162_100139622 92
420 3300013306 Ga0163162_10174841 Ga0163162_101748412 92
421 3300013307 Ga0157372_10090284 Ga0157372_100902846 92
422 3300014325 Ga0163163_10178538 Ga0163163_101785382 92
423 3300014326 Ga0157380_10326792 Ga0157380_103267922 92
424 3300014326 Ga0157380_11378432 Ga0157380_113784321 92
425 3300014968 Ga0157379_10062159 Ga0157379_100621592 92
426 3300014969 Ga0157376_10185167 Ga0157376_101851673 92
427 3300015261 Ga0182006_1108679 Ga0182006_11086792 92
428 3300015262 Ga0182007_10074613 Ga0182007_100746132 92
429 3300017792 Ga0163161_10750676 Ga0163161_107506762 92
430 3300020069 Ga0197907_10944092 Ga0197907_109440922 92
431 3300020076 Ga0206355_1129667 Ga0206355_11296671 92
432 3300020080 Ga0206350_11056752 Ga0206350_110567522 92
433 3300020080 Ga0206350_11297399 Ga0206350_112973992 92
434 3300022467 Ga0224712_10271339 Ga0224712_102713392 92
435 3300022467 Ga0224712_10286009 Ga0224712_102860091 92
436 3300025271 Ga0207666_1021083 Ga0207666_10210832 92
437 3300025315 Ga0207697_10047695 Ga0207697_100476954 92
438 3300025901 Ga0207688_10047865 Ga0207688_100478652 92
439 3300025904 Ga0207647_10309254 Ga0207647_103092542 92
440 3300025907 Ga0207645_10000465 Ga0207645_1000046528 92
441 3300025908 Ga0207643_10211056 Ga0207643_102110562 92
442 3300025909 Ga0207705_10107232 Ga0207705_101072322 92
443 3300025911 Ga0207654_10300342 Ga0207654_103003422 92
444 3300025912 Ga0207707_10030527 Ga0207707_100305276 92
445 3300025913 Ga0207695_10491490 Ga0207695_104914901 92
446 3300025915 Ga0207693_10174017 Ga0207693_101740172 92
447 3300025917 Ga0207660_10497105 Ga0207660_104971052 92
448 3300025917 Ga0207660_10506524 Ga0207660_105065242 92
449 3300025918 Ga0207662_10183460 Ga0207662_101834602 92
450 3300025919 Ga0207657_10012781 Ga0207657_100127818 92
451 3300025920 Ga0207649_10681461 Ga0207649_106814612 92
452 3300025921 Ga0207652_10173731 Ga0207652_101737312 92
453 3300025922 Ga0207646_10036121 Ga0207646_100361212 92
454 3300025922 Ga0207646_10378907 Ga0207646_103789072 92
455 3300025923 Ga0207681_10620692 Ga0207681_106206922 92
456 3300025923 Ga0207681_10645160 Ga0207681_106451602 92
457 3300025925 Ga0207650_10317075 Ga0207650_103170752 92
458 3300025926 Ga0207659_10021423 Ga0207659_100214237 92
459 3300025927 Ga0207687_11746698 Ga0207687_117466982 92
460 3300025931 Ga0207644_10169451 Ga0207644_101694512 92
461 3300025932 Ga0207690_10422089 Ga0207690_104220892 92
462 3300025932 Ga0207690_11145291 Ga0207690_111452912 92
463 3300025933 Ga0207706_10007890 Ga0207706_100078907 92
464 3300025934 Ga0207686_10132402 Ga0207686_101324022 92
465 3300025936 Ga0207670_10015115 Ga0207670_100151152 92
466 3300025936 Ga0207670_10182196 Ga0207670_101821962 92
467 3300025937 Ga0207669_10028665 Ga0207669_100286652 92
468 3300025938 Ga0207704_10778113 Ga0207704_107781132 92
469 3300025939 Ga0207665_10196172 Ga0207665_101961722 92
470 3300025939 Ga0207665_10233379 Ga0207665_102333792 92
471 3300025939 Ga0207665_10248950 Ga0207665_102489502 92
472 3300025940 Ga0207691_10005743 Ga0207691_100057435 92
473 3300025942 Ga0207689_10028906 Ga0207689_100289062 92
474 3300025944 Ga0207661_11349896 Ga0207661_113498962 92
475 3300025945 Ga0207679_10303920 Ga0207679_103039202 92
476 3300025960 Ga0207651_10258509 Ga0207651_102585092 92
477 3300025961 Ga0207712_11291703 Ga0207712_112917031 92
478 3300025972 Ga0207668_10116801 Ga0207668_101168012 92
479 3300025981 Ga0207640_10243392 Ga0207640_102433922 92
480 3300025986 Ga0207658_10102992 Ga0207658_101029924 92
481 3300026023 Ga0207677_10852842 Ga0207677_108528422 92
482 3300026035 Ga0207703_10149979 Ga0207703_101499792 92
483 3300026041 Ga0207639_11211674 Ga0207639_112116742 92
484 3300026067 Ga0207678_10187347 Ga0207678_101873472 92
485 3300026078 Ga0207702_11570938 Ga0207702_115709382 92
486 3300026088 Ga0207641_10266556 Ga0207641_102665562 92
487 3300026089 Ga0207648_10015387 Ga0207648_100153875 92
488 3300026116 Ga0207674_10062280 Ga0207674_100622802 92
489 3300026116 Ga0207674_10093403 Ga0207674_100934032 92
490 3300026118 Ga0207675_100365763 Ga0207675_1003657632 92
491 3300026121 Ga0207683_10001178 Ga0207683_1000117821 92
492 3300027360 Ga0209969_1071640 Ga0209969_10716402 92
493 3300027424 Ga0209984_1005624 Ga0209984_10056242 92
494 3300027526 Ga0209968_1013318 Ga0209968_10133181 92
495 3300027552 Ga0209982_1010436 Ga0209982_10104361 92
496 3300027614 Ga0209970_1006749 Ga0209970_10067491 92
497 3300027617 Ga0210002_1006859 Ga0210002_10068592 92
498 3300027682 Ga0209971_1023839 Ga0209971_10238392 92
499 3300027682 Ga0209971_1039155 Ga0209971_10391552 92
500 3300027717 Ga0209998_10011102 Ga0209998_100111023 92
501 3300027876 Ga0209974_10054370 Ga0209974_100543701 92
502 3300027876 Ga0209974_10193602 Ga0209974_101936022 92
503 3300027876 Ga0209974_10207156 Ga0209974_102071562 92
504 3300027907 Ga0207428_10011568 Ga0207428_100115683 92
505 3300027907 Ga0207428_10143986 Ga0207428_101439862 92
506 3300027907 Ga0207428_11238066 Ga0207428_112380662 92
507 3300028379 Ga0268266_10062867 Ga0268266_100628675 92
508 3300028380 Ga0268265_11027186 Ga0268265_110271862 92
509 3300028381 Ga0268264_10106498 Ga0268264_101064984 92
510 3300031548 Ga0307408_100134193 Ga0307408_1001341932 92
511 3300031548 Ga0307408_100137852 Ga0307408_1001378522 92
512 3300031548 Ga0307408_100463945 Ga0307408_1004639452 92
513 3300031548 Ga0307408_100666189 Ga0307408_1006661893 92
514 3300031731 Ga0307405_10037651 Ga0307405_100376512 92
515 3300031731 Ga0307405_10067889 Ga0307405_100678893 92
516 3300031731 Ga0307405_10177362 Ga0307405_101773622 92
517 3300031824 Ga0307413_10095602 Ga0307413_100956022 92
518 3300031824 Ga0307413_10117210 Ga0307413_101172103 92
519 3300031901 Ga0307406_10092885 Ga0307406_100928852 92
520 3300031903 Ga0307407_10234502 Ga0307407_102345022 92
521 3300031911 Ga0307412_10151209 Ga0307412_101512092 92
522 3300031911 Ga0307412_10159134 Ga0307412_101591342 92
523 3300031911 Ga0307412_10189641 Ga0307412_101896412 92
524 3300031911 Ga0307412_10800421 Ga0307412_108004212 92
525 3300031995 Ga0307409_100288170 Ga0307409_1002881702 92
526 3300031995 Ga0307409_100690940 Ga0307409_1006909402 92
527 3300031995 Ga0307409_101037167 Ga0307409_1010371672 92
528 3300032002 Ga0307416_100009283 Ga0307416_1000092835 92
529 3300032002 Ga0307416_100033248 Ga0307416_1000332481 92
530 3300032002 Ga0307416_100699935 Ga0307416_1006999351 92
531 3300032005 Ga0307411_10007627 Ga0307411_100076273 92
532 3300032005 Ga0307411_10049595 Ga0307411_100495952 92
533 3300032005 Ga0307411_10383243 Ga0307411_103832432 92
534 3300032126 Ga0307415_100058195 Ga0307415_1000581951 92
535 3300034957 Ga0373938_0080501 Ga0373938_0080501_249_527 92
536 3300035083 Ga0373926_0066467 Ga0373926_0066467_273_551 92
537 3300035084 Ga0373928_0108399 Ga0373928_0108399_220_498 92
538 3300035085 Ga0373929_0171620 Ga0373929_0171620_150_428 92
539 3300035091 Ga0373951_0033190 Ga0373951_0033190_167_445 92
540 3300035112 Ga0373932_0027302 Ga0373932_0027302_816_1094 92
541 3300035113 Ga0373936_0056982 Ga0373936_0056982_1070_1348 92
542 3300035114 Ga0373939_0043450 Ga0373939_0043450_283_561 92
543 3300035115 Ga0373941_0243667 Ga0373941_0243667_315_599 92
544 3300035121 Ga0373960_0072323 Ga0373960_0072323_284_568 92
545 3300035121 Ga0373960_0208288 Ga0373960_0208288_158_436 92
546 3300035170 Ga0373943_0318452 Ga0373943_0318452_255_533 92
547 3300035171 Ga0373946_0041878 Ga0373946_0041878_1569_1847 92
548 3300035241 Ga0373961_0092809 Ga0373961_0092809_28_306 92
549 3300035691 Ga0373931_0006970 Ga0373931_0006970_2425_2703 92
550 3300035691 Ga0373931_0936784 Ga0373931_0936784_195_473 92
551 3300035692 Ga0373935_0027230 Ga0373935_0027230_2917_3195 92
552 3300035695 Ga0373927_0966378 Ga0373927_0966378_208_486 92
553 3300035725 Ga0373947_0008839 Ga0373947_0008839_3474_3752 92
554 3300036401 Ga0373937_0089288 Ga0373937_0089288_1249_1527 92
555 3300037068 Ga0373925_0058114 Ga0373925_0058114_1213_1491 92
556 3300039438 Ga0436360_0877177 Ga0436360_0877177_723_1004 92
557 3300039438 Ga0436360_0877644 Ga0436360_0877644_800_1084 92
558 3300039453 Ga0436362_0002027 Ga0436362_0002027_74_355 92
559 3300042435 Ga0439434_0241065 Ga0439434_0241065_70_354 92
560 3300042876 Ga0451577_0170115 Ga0451577_0170115_630_914 92
561 3300042876 Ga0451577_1288509 Ga0451577_1288509_28_312 92
562 3300044673 Ga0453683_0001749 Ga0453683_0001749_2770_3048 92
563 3300044712 Ga0453684_0335194 Ga0453684_0335194_694_978 92
564 3300044712 Ga0453684_1485134 Ga0453684_1485134_27_305 92
565 3300045051 Ga0451576_0733259 Ga0451576_0733259_648_926 92
566 3300045051 Ga0451576_1262493 Ga0451576_1262493_166_450 92
567 3300045051 Ga0451576_1356746 Ga0451576_1356746_383_667 92
568 3300046455 Ga0495603_0474137 Ga0495603_0474137_98_376 92
569 3300046499 Ga0495594_0321687 Ga0495594_0321687_395_673 92
570 3300046535 Ga0495586_0518800 Ga0495586_0518800_245_523 92
571 3300046615 Ga0495656_0128634 Ga0495656_0128634_913_1191 92
572 3300047318 Ga0495636_0433434 Ga0495636_0433434_251_529 92
573 3300048903 Ga0496100_0432184 Ga0496100_0432184_171_455 92
574 3300048903 Ga0496100_1636133 Ga0496100_1636133_204_488 92
575 3300048904 Ga0496101_1474142 Ga0496101_1474142_168_452 92
576 3300048907 Ga0496104_0271666 Ga0496104_0271666_555_839 92
577 3300048909 Ga0496106_0225540 Ga0496106_0225540_645_929 92
578 3300048909 Ga0496106_0413715 Ga0496106_0413715_622_906 92
579 3300048909 Ga0496106_1342095 Ga0496106_1342095_95_373 92
580 3300048911 Ga0496108_0525516 Ga0496108_0525516_695_979 92
581 3300048911 Ga0496108_1366261 Ga0496108_1366261_162_446 92
582 3300048912 Ga0496109_0461759 Ga0496109_0461759_843_1127 92
583 3300048912 Ga0496109_1472466 Ga0496109_1472466_76_360 92
584 3300048915 Ga0496112_0049540 Ga0496112_0049540_1776_2060 92
585 3300048915 Ga0496112_0051030 Ga0496112_0051030_841_1125 92
586 3300048915 Ga0496112_0318135 Ga0496112_0318135_132_410 92
587 3300049514 Ga0501291_028932 Ga0501291_028932_408_686 92
588 3300049522 Ga0501299_005995 Ga0501299_005995_70_354 92
589 3300049568 Ga0501031_0013574 Ga0501031_0013574_1335_1613 92
590 3300049569 Ga0501032_0024186 Ga0501032_0024186_1042_1320 92
591 3300049570 Ga0501033_0009833 Ga0501033_0009833_4028_4306 92
592 3300049570 Ga0501033_0240626 Ga0501033_0240626_919_1197 92
593 3300049572 Ga0501036_0038284 Ga0501036_0038284_1659_1937 92
594 3300049573 Ga0501037_0021400 Ga0501037_0021400_1849_2127 92
595 3300049573 Ga0501037_0054232 Ga0501037_0054232_1152_1430 92
596 3300049574 Ga0501038_0001813 Ga0501038_0001813_979_1257 92
597 3300049574 Ga0501038_0045039 Ga0501038_0045039_1987_2265 92
598 3300049574 Ga0501038_1033922 Ga0501038_1033922_90_425 92
599 3300049574 Ga0501038_1064419 Ga0501038_1064419_133_435 92
600 3300049575 Ga0501039_0019556 Ga0501039_0019556_3748_4026 92
601 3300049575 Ga0501039_0799232 Ga0501039_0799232_280_558 92
602 3300049576 Ga0501040_0001107 Ga0501040_0001107_114_392 92
603 3300049576 Ga0501040_0035780 Ga0501040_0035780_1097_1375 92
604 3300049576 Ga0501040_0086621 Ga0501040_0086621_1702_1980 92
605 3300049576 Ga0501040_0555968 Ga0501040_0555968_181_459 92
606 3300049577 Ga0501041_0000320 Ga0501041_0000320_22016_22294 92
607 3300049577 Ga0501041_0183091 Ga0501041_0183091_116_394 92
608 3300049577 Ga0501041_0456003 Ga0501041_0456003_44_322 92
609 3300049578 Ga0501042_0000344 Ga0501042_0000344_21904_22182 92
610 3300049578 Ga0501042_0009875 Ga0501042_0009875_3863_4141 92
611 3300049578 Ga0501042_0780792 Ga0501042_0780792_113_391 92
612 3300049579 Ga0501043_0031052 Ga0501043_0031052_2136_2414 92
613 3300049579 Ga0501043_0118310 Ga0501043_0118310_634_912 92
614 3300049580 Ga0501046_0011617 Ga0501046_0011617_6779_7057 92
615 3300049580 Ga0501046_0064845 Ga0501046_0064845_487_765 92
616 3300049582 Ga0501048_0010622 Ga0501048_0010622_1167_1445 92
617 3300049582 Ga0501048_0025633 Ga0501048_0025633_2152_2430 92
618 3300049583 Ga0501067_0300391 Ga0501067_0300391_348_632 92
619 3300049584 Ga0501068_0014603 Ga0501068_0014603_2651_2929 92
620 3300049584 Ga0501068_0151187 Ga0501068_0151187_1124_1402 92
621 3300049584 Ga0501068_1072108 Ga0501068_1072108_142_420 92
622 3300049585 Ga0501069_0040331 Ga0501069_0040331_598_876 92
623 3300049586 Ga0501070_0035091 Ga0501070_0035091_3829_4107 92
624 3300049586 Ga0501070_0238992 Ga0501070_0238992_987_1265 92
625 3300049587 Ga0501071_0000317 Ga0501071_0000317_21884_22162 92
626 3300049587 Ga0501071_0016918 Ga0501071_0016918_1280_1558 92
627 3300049587 Ga0501071_0616952 Ga0501071_0616952_538_816 92
628 3300049587 Ga0501071_1587343 Ga0501071_1587343_207_485 92
629 3300049588 Ga0501072_0000574 Ga0501072_0000574_485_763 92
630 3300049588 Ga0501072_0093569 Ga0501072_0093569_116_394 92
631 3300049588 Ga0501072_0674699 Ga0501072_0674699_293_580 92
632 3300049588 Ga0501072_0879871 Ga0501072_0879871_87_365 92
633 3300049588 Ga0501072_1565193 Ga0501072_1565193_70_348 92
634 3300049589 Ga0501073_0027625 Ga0501073_0027625_1594_1872 92
635 3300049589 Ga0501073_0332637 Ga0501073_0332637_568_846 92
636 3300049590 Ga0501074_0011344 Ga0501074_0011344_5061_5339 92
637 3300049590 Ga0501074_0025112 Ga0501074_0025112_2264_2542 92
638 3300049591 Ga0501075_0000513 Ga0501075_0000513_21929_22207 92
639 3300049591 Ga0501075_0003362 Ga0501075_0003362_10344_10622 92
640 3300049591 Ga0501075_0029414 Ga0501075_0029414_3028_3306 92
641 3300049592 Ga0501076_0000576 Ga0501076_0000576_1144_1422 92
642 3300049592 Ga0501076_0018169 Ga0501076_0018169_2050_2328 92
643 3300049592 Ga0501076_0057457 Ga0501076_0057457_2731_3009 92
644 3300049592 Ga0501076_0150536 Ga0501076_0150536_40_318 92
645 3300049592 Ga0501076_1325411 Ga0501076_1325411_43_321 92
646 3300049593 Ga0501077_0000903 Ga0501077_0000903_16428_16706 92
647 3300049593 Ga0501077_0011889 Ga0501077_0011889_1365_1667 92
648 3300049593 Ga0501077_0049479 Ga0501077_0049479_1907_2185 92
649 3300049593 Ga0501077_0130191 Ga0501077_0130191_147_431 92
650 3300049593 Ga0501077_0516985 Ga0501077_0516985_22_303 92
651 3300049652 Ga0501202_205994 Ga0501202_205994_216_494 92
652 3300049665 Ga0501227_014250 Ga0501227_014250_181_465 92
653 3300049668 Ga0501233_045132 Ga0501233_045132_595_879 92
654 3300049669 Ga0501235_139947 Ga0501235_139947_172_456 92
655 3300049670 Ga0501236_089943 Ga0501236_089943_216_494 92
656 3300049677 Ga0501247_024087 Ga0501247_024087_234_518 92
657 3300049681 Ga0501251_037960 Ga0501251_037960_192_476 92
658 3300049705 Ga0501225_0007472 Ga0501225_0007472_2608_2892 92
659 3300049705 Ga0501225_0123939 Ga0501225_0123939_133_411 92
660 3300049741 Ga0501079_0001501 Ga0501079_0001501_1148_1426 92
661 3300049741 Ga0501079_0038808 Ga0501079_0038808_2758_3036 92
662 3300049742 Ga0501080_0006567 Ga0501080_0006567_9178_9456 92
663 3300049742 Ga0501080_0147844 Ga0501080_0147844_27_305 92
664 3300049743 Ga0501081_0000423 Ga0501081_0000423_1138_1416 92
665 3300049743 Ga0501081_0060086 Ga0501081_0060086_1868_2146 92
666 3300049743 Ga0501081_0283569 Ga0501081_0283569_575_853 92
667 3300049743 Ga0501081_0514814 Ga0501081_0514814_460_795 92
668 3300049743 Ga0501081_0807135 Ga0501081_0807135_351_629 92
669 3300049743 Ga0501081_1344711 Ga0501081_1344711_249_527 92
670 3300049744 Ga0501083_0005809 Ga0501083_0005809_4367_4645 92
671 3300049744 Ga0501083_0101659 Ga0501083_0101659_1156_1434 92
672 3300049763 Ga0501266_027167 Ga0501266_027167_133_417 92
673 3300049765 Ga0501268_015591 Ga0501268_015591_237_521 92
674 3300049822 Ga0501035_0102964 Ga0501035_0102964_487_765 92
675 3300049822 Ga0501035_0110675 Ga0501035_0110675_1852_2130 92
676 3300049823 Ga0501044_0076398 Ga0501044_0076398_1553_1831 92
677 3300049824 Ga0501045_0002513 Ga0501045_0002513_795_1073 92
678 3300049824 Ga0501045_0523138 Ga0501045_0523138_116_394 92
679 3300049824 Ga0501045_0869778 Ga0501045_0869778_47_331 92
680 3300049824 Ga0501045_1065524 Ga0501045_1065524_114_395 92
681 3300049851 Ga0501212_007428 Ga0501212_007428_515_799 92
682 3300050507 nmdc:mga05p37_105262_c1 nmdc:mga05p37_105262_c1_1161_1439 92
683 3300050507 nmdc:mga05p37_111264_c1 nmdc:mga05p37_111264_c1_189_467 92
684 3300050507 nmdc:mga05p37_35482_c1 nmdc:mga05p37_35482_c1_446_724 92
685 3300050507 nmdc:mga05p37_54814_c1 nmdc:mga05p37_54814_c1_1923_2201 92
686 3300050507 nmdc:mga05p37_5586_c1 nmdc:mga05p37_5586_c1_14087_14365 92
687 3300050507 nmdc:mga05p37_731933_c1 nmdc:mga05p37_731933_c1_131_409 92
688 3300050507 nmdc:mga05p37_86276_c1 nmdc:mga05p37_86276_c1_2823_3101 92
689 3300050508 nmdc:mga09592_1427205_c1 nmdc:mga09592_1427205_c1_213_491 92
690 3300050508 nmdc:mga09592_350042_c1 nmdc:mga09592_350042_c1_722_1000 92
691 3300050508 nmdc:mga09592_706272_c1 nmdc:mga09592_706272_c1_42_326 92
692 3300050509 nmdc:mga0qj67_116309_c1 nmdc:mga0qj67_116309_c1_402_680 92
693 3300050509 nmdc:mga0qj67_321552_c1 nmdc:mga0qj67_321552_c1_241_519 92
694 3300050509 nmdc:mga0qj67_76802_c1 nmdc:mga0qj67_76802_c1_1905_2183 92
695 3300050509 nmdc:mga0qj67_794403_c1 nmdc:mga0qj67_794403_c1_407_685 92
696 3300050510 nmdc:mga06r32_160600_c1 nmdc:mga06r32_160600_c1_1151_1429 92
697 3300050510 nmdc:mga06r32_2069307_c1 nmdc:mga06r32_2069307_c1_51_329 92
698 3300050510 nmdc:mga06r32_69569_c1 nmdc:mga06r32_69569_c1_900_1178 92
699 3300050510 nmdc:mga06r32_736538_c1 nmdc:mga06r32_736538_c1_626_904 92
700 3300050510 nmdc:mga06r32_834553_c1 nmdc:mga06r32_834553_c1_104_388 92
701 3300050510 nmdc:mga06r32_961547_c1 nmdc:mga06r32_961547_c1_104_382 92
702 3300050511 nmdc:mga08y16_1643812_c1 nmdc:mga08y16_1643812_c1_144_428 92
703 3300050511 nmdc:mga08y16_170704_c1 nmdc:mga08y16_170704_c1_36_320 92
704 3300050511 nmdc:mga08y16_20561_c1 nmdc:mga08y16_20561_c1_4472_4750 92
705 3300050512 nmdc:mga0n895_132125_c1 nmdc:mga0n895_132125_c1_651_929 92
706 3300050512 nmdc:mga0n895_1450631_c1 nmdc:mga0n895_1450631_c1_339_623 92
707 3300050512 nmdc:mga0n895_203789_c1 nmdc:mga0n895_203789_c1_13_297 92
708 3300050512 nmdc:mga0n895_254711_c1 nmdc:mga0n895_254711_c1_428_706 92
709 3300050512 nmdc:mga0n895_2742_c1 nmdc:mga0n895_2742_c1_5782_6060 92
710 3300050512 nmdc:mga0n895_349243_c1 nmdc:mga0n895_349243_c1_473_751 92
711 3300050512 nmdc:mga0n895_619097_c1 nmdc:mga0n895_619097_c1_368_646 92
712 3300050513 nmdc:mga0rr50_240977_c1 nmdc:mga0rr50_240977_c1_92_370 92
713 3300050513 nmdc:mga0rr50_25473_c1 nmdc:mga0rr50_25473_c1_1664_1942 92
714 3300050513 nmdc:mga0rr50_4059_c1 nmdc:mga0rr50_4059_c1_1130_1414 92
715 3300050513 nmdc:mga0rr50_53845_c1 nmdc:mga0rr50_53845_c1_844_1122 92
716 3300050513 nmdc:mga0rr50_875596_c1 nmdc:mga0rr50_875596_c1_54_332 92
717 3300050514 nmdc:mga08x19_21129_c1 nmdc:mga08x19_21129_c1_2786_3064 92
718 3300050514 nmdc:mga08x19_335909_c1 nmdc:mga08x19_335909_c1_181_459 92
719 3300050514 nmdc:mga08x19_392957_c1 nmdc:mga08x19_392957_c1_144_422 92
720 3300050514 nmdc:mga08x19_407912_c1 nmdc:mga08x19_407912_c1_367_651 92
721 3300050514 nmdc:mga08x19_89427_c1 nmdc:mga08x19_89427_c1_312_590 92
722 3300050515 nmdc:mga0a205_1243527_c1 nmdc:mga0a205_1243527_c1_84_362 92
723 3300050515 nmdc:mga0a205_15616_c1 nmdc:mga0a205_15616_c1_5670_5948 92
724 3300050515 nmdc:mga0a205_189175_c1 nmdc:mga0a205_189175_c1_1031_1309 92
725 3300050515 nmdc:mga0a205_292750_c1 nmdc:mga0a205_292750_c1_79_363 92
726 3300050515 nmdc:mga0a205_324514_c1 nmdc:mga0a205_324514_c1_661_939 92
727 3300050515 nmdc:mga0a205_58716_c1 nmdc:mga0a205_58716_c1_3283_3561 92
728 3300050515 nmdc:mga0a205_65349_c1 nmdc:mga0a205_65349_c1_1000_1278 92
729 3300050515 nmdc:mga0a205_77643_c1 nmdc:mga0a205_77643_c1_2652_2930 92
730 3300054114 Ga0501084_0001468 Ga0501084_0001468_18025_18303 92
731 3300054114 Ga0501084_0105078 Ga0501084_0105078_780_1058 92
732 3300054114 Ga0501084_0108629 Ga0501084_0108629_487_765 92
733 3300054114 Ga0501084_1108890 Ga0501084_1108890_211_489 92
734 3300054114 Ga0501084_1800672 Ga0501084_1800672_193_471 92
735 3300059421 Ga0590071_007223 Ga0590071_007223_669_947 92
736 3300059421 Ga0590071_078757 Ga0590071_078757_461_745 92
737 3300059423 Ga0590074_109309 Ga0590074_109309_75_353 92
738 3300060353 Ga0501082_0006749 Ga0501082_0006749_5405_5683 92
739 3300060353 Ga0501082_0048010 Ga0501082_0048010_3298_3576 92
740 3300060353 Ga0501082_0091100 Ga0501082_0091100_487_765 92
741 3300060353 Ga0501082_0158625 Ga0501082_0158625_1283_1585 92
742 3300060353 Ga0501082_0238938 Ga0501082_0238938_978_1256 92
743 3300060353 Ga0501082_0701675 Ga0501082_0701675_493_774 92
744 3300061734 Ga0530510_0001077 Ga0530510_0001077_1167_1445 92
745 3300061734 Ga0530510_0014147 Ga0530510_0014147_379_657 92
746 3300061734 Ga0530510_0185010 Ga0530510_0185010_190_471 92
747 3300061734 Ga0530510_0273778 Ga0530510_0273778_113_391 92
748 3300061734 Ga0530510_0464169 Ga0530510_0464169_162_440 92
749 3300061734 Ga0530510_1150035 Ga0530510_1150035_228_506 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

25

111

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.979 3 88
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9513 3 91
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9361 3 88
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9307 3 91
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8975 4 91
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9513 3 91 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9307 3 91 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8933 4 86 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.864 4 86 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8605 2 88 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A6B3IN31-F1-model_v4 MoaD/ThiS family protein 1.001 1 88
AF-A0A382J5P3-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9973 1 83
AF-A0A4V2XVV1-F1-model_v4 MoaD/ThiS family protein 0.9953 1 78
AF-A0A1Q7B304-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.994 3 87
AF-P74060-F1-model_v4 Putative sulfur carrier protein slr0821 0.9935 1 91 GO:0006777
GO:1990133

Feature Viewer

pLDDT pTM Quality
93.9 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map