F478992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 749 | 334 | 749 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_101534050|Ga0070661_1015340502 |
| Length | 112 |
| Sequence | MGEGLFSPQVDFICKLEEVCMSVRVRVPTPLRKYTQGADEVNAQGSNVKSLVDDLEKNYPGIRERICDETGKVRRFVNVYVNGDDIRFLQNLDTTLKEGDSISIVPAIAGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 112 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 113 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 114 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 233 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 247 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 276 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 302 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 307 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 332 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 1.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 2.94 |
| Rhizosphere | 96.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214753862 | 2209111006 | Bacteria | 872 |
| 2 | ARcpr5yngRDRAFT_c025608 | 3300000043 | Unclassified | 506 |
| 3 | JGI25407J50210_10154818 | 3300003373 | Bacteria | 564 |
| 4 | JGI25405J52794_10001086 | 3300003911 | Unclassified | 4350 |
| 5 | Ga0058859_10042614 | 3300004798 | Unclassified | 2815 |
| 6 | Ga0058860_10067954 | 3300004801 | Unclassified | 1429 |
| 7 | Ga0058860_11489369 | 3300004801 | Bacteria | 826 |
| 8 | Ga0058862_12422882 | 3300004803 | Bacteria | 1488 |
| 9 | Ga0065704_10079869 | 3300005289 | Bacteria | 4060 |
| 10 | Ga0065704_10431775 | 3300005289 | Bacteria | 722 |
| 11 | Ga0065712_10068895 | 3300005290 | Bacteria | 8628 |
| 12 | Ga0065712_10218390 | 3300005290 | Unclassified | 1037 |
| 13 | Ga0065715_10003569 | 3300005293 | Bacteria | 3954 |
| 14 | Ga0065715_10007065 | 3300005293 | Bacteria | 3964 |
| 15 | Ga0065707_10001176 | 3300005295 | Bacteria | 7922 |
| 16 | Ga0065707_10107261 | 3300005295 | Bacteria | 2562 |
| 17 | Ga0065707_10139404 | 3300005295 | Unclassified | 1792 |
| 18 | Ga0065707_10264351 | 3300005295 | Bacteria | 1053 |
| 19 | Ga0065707_10340060 | 3300005295 | Unclassified | 935 |
| 20 | Ga0070658_10024687 | 3300005327 | Unclassified | 4820 |
| 21 | Ga0070676_10006899 | 3300005328 | Bacteria | 6079 |
| 22 | Ga0070683_101028336 | 3300005329 | Unclassified | 791 |
| 23 | Ga0070690_100098550 | 3300005330 | Unclassified | 1935 |
| 24 | Ga0070670_101631036 | 3300005331 | Unclassified | 593 |
| 25 | Ga0070677_10647053 | 3300005333 | Unclassified | 590 |
| 26 | Ga0068869_100065762 | 3300005334 | Unclassified | 2670 |
| 27 | Ga0070666_10159846 | 3300005335 | Bacteria | 1574 |
| 28 | Ga0070666_10200666 | 3300005335 | Unclassified | 1403 |
| 29 | Ga0070666_10259902 | 3300005335 | Bacteria | 1231 |
| 30 | Ga0070680_100071012 | 3300005336 | Bacteria | 2860 |
| 31 | Ga0070680_100949868 | 3300005336 | Bacteria | 742 |
| 32 | Ga0070682_100528189 | 3300005337 | Unclassified | 919 |
| 33 | Ga0070682_100743405 | 3300005337 | Bacteria | 791 |
| 34 | Ga0070682_100977146 | 3300005337 | Bacteria | 701 |
| 35 | Ga0068868_100939490 | 3300005338 | Bacteria | 788 |
| 36 | Ga0070660_100471801 | 3300005339 | Bacteria | 1042 |
| 37 | Ga0070689_100135951 | 3300005340 | Bacteria | 1974 |
| 38 | Ga0070689_101102391 | 3300005340 | Unclassified | 710 |
| 39 | Ga0070691_10003549 | 3300005341 | Bacteria | 7034 |
| 40 | Ga0070687_100102261 | 3300005343 | Unclassified | 1606 |
| 41 | Ga0070687_100162251 | 3300005343 | Bacteria | 1322 |
| 42 | Ga0070661_100003230 | 3300005344 | Bacteria | 11233 |
| 43 | Ga0070661_101534050 | 3300005344 | Unclassified | 562 |
| 44 | Ga0070692_10606446 | 3300005345 | Unclassified | 725 |
| 45 | Ga0070692_10934193 | 3300005345 | Unclassified | 602 |
| 46 | Ga0070692_11034244 | 3300005345 | Bacteria | 576 |
| 47 | Ga0070668_100084803 | 3300005347 | Unclassified | 2489 |
| 48 | Ga0070668_100176391 | 3300005347 | Bacteria | 1743 |
| 49 | Ga0070669_100368340 | 3300005353 | Unclassified | 1170 |
| 50 | Ga0070669_100832543 | 3300005353 | Bacteria | 785 |
| 51 | Ga0070669_101285220 | 3300005353 | Unclassified | 633 |
| 52 | Ga0070675_101063953 | 3300005354 | Unclassified | 743 |
| 53 | Ga0070675_101540764 | 3300005354 | Bacteria | 613 |
| 54 | Ga0070674_100983338 | 3300005356 | Unclassified | 740 |
| 55 | Ga0070673_100578113 | 3300005364 | Unclassified | 1023 |
| 56 | Ga0070688_100050255 | 3300005365 | Unclassified | 2597 |
| 57 | Ga0070688_101275695 | 3300005365 | Unclassified | 592 |
| 58 | Ga0070659_100275851 | 3300005366 | Unclassified | 1398 |
| 59 | Ga0070667_100061802 | 3300005367 | Unclassified | 3171 |
| 60 | Ga0070703_10113611 | 3300005406 | Bacteria | 972 |
| 61 | Ga0070709_10358089 | 3300005434 | Unclassified | 1080 |
| 62 | Ga0070713_100666896 | 3300005436 | Bacteria | 991 |
| 63 | Ga0070713_100950439 | 3300005436 | Bacteria | 828 |
| 64 | Ga0070701_10051673 | 3300005438 | Bacteria | 2133 |
| 65 | Ga0070711_101508951 | 3300005439 | Unclassified | 586 |
| 66 | Ga0070705_100125548 | 3300005440 | Unclassified | 1665 |
| 67 | Ga0070705_100975446 | 3300005440 | Archaea | 686 |
| 68 | Ga0070694_100007677 | 3300005444 | Bacteria | 6583 |
| 69 | Ga0070694_100581013 | 3300005444 | Bacteria | 900 |
| 70 | Ga0070694_100911016 | 3300005444 | Bacteria | 726 |
| 71 | Ga0070708_100045418 | 3300005445 | Bacteria | 3869 |
| 72 | Ga0070708_100496844 | 3300005445 | Unclassified | 1151 |
| 73 | Ga0070708_101576292 | 3300005445 | Unclassified | 611 |
| 74 | Ga0070663_100966176 | 3300005455 | Bacteria | 739 |
| 75 | Ga0070663_101512430 | 3300005455 | Bacteria | 597 |
| 76 | Ga0070678_100860693 | 3300005456 | Unclassified | 826 |
| 77 | Ga0070662_100113587 | 3300005457 | Unclassified | 2067 |
| 78 | Ga0070662_100136288 | 3300005457 | Unclassified | 1898 |
| 79 | Ga0070662_100217850 | 3300005457 | Bacteria | 1522 |
| 80 | Ga0070662_101637156 | 3300005457 | Unclassified | 556 |
| 81 | Ga0070681_10001307 | 3300005458 | Bacteria | 21746 |
| 82 | Ga0070685_10049255 | 3300005466 | Bacteria | 2429 |
| 83 | Ga0070706_100060250 | 3300005467 | Bacteria | 3503 |
| 84 | Ga0070706_100266187 | 3300005467 | Bacteria | 1600 |
| 85 | Ga0070706_100268101 | 3300005467 | Bacteria | 1593 |
| 86 | Ga0070706_101317738 | 3300005467 | Bacteria | 662 |
| 87 | Ga0070707_100141449 | 3300005468 | Bacteria | 2342 |
| 88 | Ga0070707_100251340 | 3300005468 | Bacteria | 1721 |
| 89 | Ga0070707_100401878 | 3300005468 | Bacteria | 1330 |
| 90 | Ga0070707_101509806 | 3300005468 | Bacteria | 639 |
| 91 | Ga0070707_101874645 | 3300005468 | Unclassified | 567 |
| 92 | Ga0070698_100071111 | 3300005471 | Bacteria | 3490 |
| 93 | Ga0070698_100346817 | 3300005471 | Bacteria | 1416 |
| 94 | Ga0070698_101762902 | 3300005471 | Unclassified | 572 |
| 95 | Ga0070698_101960263 | 3300005471 | Unclassified | 539 |
| 96 | Ga0070699_100872608 | 3300005518 | Bacteria | 824 |
| 97 | Ga0070679_100007207 | 3300005530 | Bacteria | 10385 |
| 98 | Ga0070684_100160227 | 3300005535 | Bacteria | 2041 |
| 99 | Ga0070697_100157425 | 3300005536 | Bacteria | 1918 |
| 100 | Ga0070697_100279298 | 3300005536 | Bacteria | 1433 |
| 101 | Ga0070697_100324722 | 3300005536 | Bacteria | 1326 |
| 102 | Ga0070697_100562388 | 3300005536 | Unclassified | 1000 |
| 103 | Ga0070672_100042151 | 3300005543 | Unclassified | 3513 |
| 104 | Ga0070686_100013641 | 3300005544 | Bacteria | 4660 |
| 105 | Ga0070686_100016472 | 3300005544 | Unclassified | 4301 |
| 106 | Ga0070686_101582768 | 3300005544 | Bacteria | 554 |
| 107 | Ga0070695_100048397 | 3300005545 | Unclassified | 2719 |
| 108 | Ga0070695_100156746 | 3300005545 | Unclassified | 1594 |
| 109 | Ga0070696_100008790 | 3300005546 | Bacteria | 6759 |
| 110 | Ga0070696_100049596 | 3300005546 | Bacteria | 2916 |
| 111 | Ga0070696_101008779 | 3300005546 | Bacteria | 696 |
| 112 | Ga0070696_101161107 | 3300005546 | Unclassified | 651 |
| 113 | Ga0070696_101765074 | 3300005546 | Unclassified | 534 |
| 114 | Ga0070693_100042793 | 3300005547 | Bacteria | 2554 |
| 115 | Ga0070665_100899942 | 3300005548 | Bacteria | 898 |
| 116 | Ga0070704_100023530 | 3300005549 | Bacteria | 4027 |
| 117 | Ga0070704_100559202 | 3300005549 | Bacteria | 1000 |
| 118 | Ga0070704_100713696 | 3300005549 | Unclassified | 890 |
| 119 | Ga0070704_102023605 | 3300005549 | Unclassified | 535 |
| 120 | Ga0070664_100006377 | 3300005564 | Bacteria | 9518 |
| 121 | Ga0070664_100163699 | 3300005564 | Bacteria | 1969 |
| 122 | Ga0068857_100037201 | 3300005577 | Bacteria | 4311 |
| 123 | Ga0068857_100127961 | 3300005577 | Bacteria | 2289 |
| 124 | Ga0068854_100447931 | 3300005578 | Unclassified | 1078 |
| 125 | Ga0068854_101892294 | 3300005578 | Bacteria | 548 |
| 126 | Ga0068856_100019729 | 3300005614 | Bacteria | 6543 |
| 127 | Ga0070702_100035331 | 3300005615 | Unclassified | 2761 |
| 128 | Ga0068859_100009654 | 3300005617 | Bacteria | 9743 |
| 129 | Ga0068859_100553075 | 3300005617 | Bacteria | 1245 |
| 130 | Ga0068859_101686294 | 3300005617 | Unclassified | 700 |
| 131 | Ga0068859_102973101 | 3300005617 | Unclassified | 518 |
| 132 | Ga0068864_100155949 | 3300005618 | Bacteria | 2072 |
| 133 | Ga0068864_100216130 | 3300005618 | Bacteria | 1767 |
| 134 | Ga0068864_100605724 | 3300005618 | Bacteria | 1063 |
| 135 | Ga0068864_100941925 | 3300005618 | Bacteria | 854 |
| 136 | Ga0068866_10054935 | 3300005718 | Unclassified | 2043 |
| 137 | Ga0068861_100101787 | 3300005719 | Unclassified | 2286 |
| 138 | Ga0068861_100670450 | 3300005719 | Unclassified | 960 |
| 139 | Ga0068861_101821462 | 3300005719 | Bacteria | 604 |
| 140 | Ga0068861_101906499 | 3300005719 | Bacteria | 591 |
| 141 | Ga0068870_10477936 | 3300005840 | Bacteria | 826 |
| 142 | Ga0068870_10711867 | 3300005840 | Unclassified | 694 |
| 143 | Ga0068863_100343623 | 3300005841 | Bacteria | 1452 |
| 144 | Ga0068858_100038180 | 3300005842 | Bacteria | 4454 |
| 145 | Ga0068858_101146667 | 3300005842 | Unclassified | 764 |
| 146 | Ga0068862_100274102 | 3300005844 | Bacteria | 1544 |
| 147 | Ga0068862_101040683 | 3300005844 | Bacteria | 811 |
| 148 | Ga0081455_10000223 | 3300005937 | Bacteria | 73038 |
| 149 | Ga0081538_10004812 | 3300005981 | Bacteria | 12305 |
| 150 | Ga0081538_10046498 | 3300005981 | Bacteria | 2675 |
| 151 | Ga0081538_10107300 | 3300005981 | Bacteria | 1383 |
| 152 | Ga0081540_1176263 | 3300005983 | Unclassified | 807 |
| 153 | Ga0081539_10000597 | 3300005985 | Bacteria | 73805 |
| 154 | Ga0081539_10092386 | 3300005985 | Bacteria | 1561 |
| 155 | Ga0070717_10373601 | 3300006028 | Bacteria | 1278 |
| 156 | Ga0070717_11425243 | 3300006028 | Bacteria | 629 |
| 157 | Ga0075432_10077026 | 3300006058 | Bacteria | 1205 |
| 158 | Ga0075432_10141853 | 3300006058 | Bacteria | 917 |
| 159 | Ga0070715_10557010 | 3300006163 | Unclassified | 665 |
| 160 | Ga0070716_100106218 | 3300006173 | Bacteria | 1731 |
| 161 | Ga0070716_100114765 | 3300006173 | Bacteria | 1675 |
| 162 | Ga0070716_100115355 | 3300006173 | Bacteria | 1672 |
| 163 | Ga0070716_100807279 | 3300006173 | Unclassified | 727 |
| 164 | Ga0070712_100433833 | 3300006175 | Bacteria | 1091 |
| 165 | Ga0075427_10006155 | 3300006194 | Bacteria | 1731 |
| 166 | Ga0097621_100248783 | 3300006237 | Bacteria | 1556 |
| 167 | Ga0068871_100030902 | 3300006358 | Unclassified | 4221 |
| 168 | Ga0068871_102262809 | 3300006358 | Unclassified | 518 |
| 169 | Ga0075428_100035445 | 3300006844 | Bacteria | 5501 |
| 170 | Ga0075428_100058926 | 3300006844 | Bacteria | 4205 |
| 171 | Ga0075428_100127230 | 3300006844 | Bacteria | 2772 |
| 172 | Ga0075428_100155465 | 3300006844 | Bacteria | 2485 |
| 173 | Ga0075428_100498440 | 3300006844 | Unclassified | 1303 |
| 174 | Ga0075428_100824216 | 3300006844 | Bacteria | 986 |
| 175 | Ga0075428_101564951 | 3300006844 | Unclassified | 690 |
| 176 | Ga0075430_100056524 | 3300006846 | Unclassified | 3300 |
| 177 | Ga0075430_100058839 | 3300006846 | Unclassified | 3230 |
| 178 | Ga0075430_100111961 | 3300006846 | Bacteria | 2275 |
| 179 | Ga0075430_100266972 | 3300006846 | Bacteria | 1417 |
| 180 | Ga0075430_100332148 | 3300006846 | Unclassified | 1256 |
| 181 | Ga0075430_100491428 | 3300006846 | Unclassified | 1013 |
| 182 | Ga0075430_100516308 | 3300006846 | Bacteria | 986 |
| 183 | Ga0075431_100021111 | 3300006847 | Bacteria | 6655 |
| 184 | Ga0075431_100046181 | 3300006847 | Unclassified | 4490 |
| 185 | Ga0075431_100102716 | 3300006847 | Bacteria | 2950 |
| 186 | Ga0075431_100118579 | 3300006847 | Bacteria | 2731 |
| 187 | Ga0075431_100133852 | 3300006847 | Bacteria | 2555 |
| 188 | Ga0075431_101072477 | 3300006847 | Bacteria | 771 |
| 189 | Ga0075431_101272885 | 3300006847 | Unclassified | 697 |
| 190 | Ga0075433_10001943 | 3300006852 | Bacteria | 15545 |
| 191 | Ga0075433_10005393 | 3300006852 | Bacteria | 10049 |
| 192 | Ga0075433_10066778 | 3300006852 | Bacteria | 3156 |
| 193 | Ga0075433_10068418 | 3300006852 | Bacteria | 3118 |
| 194 | Ga0075433_10339588 | 3300006852 | Bacteria | 1328 |
| 195 | Ga0075433_10344405 | 3300006852 | Unclassified | 1317 |
| 196 | Ga0075433_10650776 | 3300006852 | Bacteria | 924 |
| 197 | Ga0075433_10986088 | 3300006852 | Bacteria | 734 |
| 198 | Ga0075433_11295867 | 3300006852 | Bacteria | 631 |
| 199 | Ga0075434_100003172 | 3300006871 | Bacteria | 14660 |
| 200 | Ga0075434_100005178 | 3300006871 | Bacteria | 11839 |
| 201 | Ga0075434_100023983 | 3300006871 | Bacteria | 5956 |
| 202 | Ga0075434_100059166 | 3300006871 | Bacteria | 3809 |
| 203 | Ga0075434_100110008 | 3300006871 | Bacteria | 2766 |
| 204 | Ga0075434_100312167 | 3300006871 | Bacteria | 1593 |
| 205 | Ga0075434_100359477 | 3300006871 | Bacteria | 1477 |
| 206 | Ga0075434_100360861 | 3300006871 | Bacteria | 1474 |
| 207 | Ga0075434_100415459 | 3300006871 | Bacteria | 1366 |
| 208 | Ga0075434_100741250 | 3300006871 | Unclassified | 999 |
| 209 | Ga0075434_100909133 | 3300006871 | Bacteria | 895 |
| 210 | Ga0075434_101122572 | 3300006871 | Unclassified | 799 |
| 211 | Ga0075434_101313373 | 3300006871 | Bacteria | 734 |
| 212 | Ga0075429_100036332 | 3300006880 | Unclassified | 4284 |
| 213 | Ga0075429_100303923 | 3300006880 | Bacteria | 1397 |
| 214 | Ga0075429_100772052 | 3300006880 | Unclassified | 842 |
| 215 | Ga0075429_100774631 | 3300006880 | Bacteria | 840 |
| 216 | Ga0068865_100400304 | 3300006881 | Bacteria | 1124 |
| 217 | Ga0068865_100561325 | 3300006881 | Bacteria | 960 |
| 218 | Ga0068865_101093992 | 3300006881 | Unclassified | 702 |
| 219 | Ga0075436_100041107 | 3300006914 | Bacteria | 3190 |
| 220 | Ga0075436_100066639 | 3300006914 | Bacteria | 2489 |
| 221 | Ga0075436_100149506 | 3300006914 | Bacteria | 1643 |
| 222 | Ga0075436_100453473 | 3300006914 | Bacteria | 934 |
| 223 | Ga0075436_100547589 | 3300006914 | Unclassified | 849 |
| 224 | Ga0075436_100644735 | 3300006914 | Unclassified | 782 |
| 225 | Ga0097620_100009653 | 3300006931 | Bacteria | 9743 |
| 226 | Ga0097620_100553081 | 3300006931 | Bacteria | 1245 |
| 227 | Ga0097620_101686114 | 3300006931 | Unclassified | 700 |
| 228 | Ga0097620_102971720 | 3300006931 | Unclassified | 518 |
| 229 | Ga0075435_100010907 | 3300007076 | Bacteria | 6658 |
| 230 | Ga0075435_100034480 | 3300007076 | Unclassified | 4011 |
| 231 | Ga0075435_100089378 | 3300007076 | Bacteria | 2540 |
| 232 | Ga0075435_100091020 | 3300007076 | Bacteria | 2517 |
| 233 | Ga0075435_101070694 | 3300007076 | Unclassified | 705 |
| 234 | Ga0075435_101336622 | 3300007076 | Unclassified | 628 |
| 235 | Ga0075435_101511012 | 3300007076 | Bacteria | 589 |
| 236 | Ga0105250_10564329 | 3300009092 | Unclassified | 524 |
| 237 | Ga0105240_10344208 | 3300009093 | Bacteria | 1693 |
| 238 | Ga0105240_11763762 | 3300009093 | Unclassified | 645 |
| 239 | Ga0111539_10018416 | 3300009094 | Bacteria | 8651 |
| 240 | Ga0111539_10130618 | 3300009094 | Unclassified | 2941 |
| 241 | Ga0111539_10419206 | 3300009094 | Bacteria | 1559 |
| 242 | Ga0111539_10703303 | 3300009094 | Unclassified | 1176 |
| 243 | Ga0105245_10179305 | 3300009098 | Bacteria | 2023 |
| 244 | Ga0105245_10241543 | 3300009098 | Bacteria | 1751 |
| 245 | Ga0114129_10007068 | 3300009147 | Bacteria | 15976 |
| 246 | Ga0114129_10009779 | 3300009147 | Bacteria | 13677 |
| 247 | Ga0114129_10044906 | 3300009147 | Bacteria | 6214 |
| 248 | Ga0114129_10067938 | 3300009147 | Bacteria | 4970 |
| 249 | Ga0114129_10141733 | 3300009147 | Bacteria | 3294 |
| 250 | Ga0114129_10155601 | 3300009147 | Bacteria | 3126 |
| 251 | Ga0114129_10253892 | 3300009147 | Bacteria | 2359 |
| 252 | Ga0114129_10261868 | 3300009147 | Bacteria | 2317 |
| 253 | Ga0114129_11448455 | 3300009147 | Bacteria | 846 |
| 254 | Ga0105243_10362271 | 3300009148 | Bacteria | 1335 |
| 255 | Ga0105241_10023686 | 3300009174 | Unclassified | 4555 |
| 256 | Ga0105242_10023246 | 3300009176 | Unclassified | 4887 |
| 257 | Ga0105242_10082027 | 3300009176 | Bacteria | 2698 |
| 258 | Ga0105242_10326011 | 3300009176 | Bacteria | 1410 |
| 259 | Ga0105237_10268052 | 3300009545 | Bacteria | 1711 |
| 260 | Ga0105237_12183156 | 3300009545 | Unclassified | 563 |
| 261 | Ga0105249_10174231 | 3300009553 | Bacteria | 2088 |
| 262 | Ga0105249_10213838 | 3300009553 | Bacteria | 1893 |
| 263 | Ga0105249_10668698 | 3300009553 | Archaea | 1097 |
| 264 | Ga0105249_11229734 | 3300009553 | Unclassified | 820 |
| 265 | Ga0105239_12642740 | 3300010375 | Bacteria | 586 |
| 266 | Ga0105246_10007585 | 3300011119 | Bacteria | 6655 |
| 267 | Ga0105246_10105267 | 3300011119 | Bacteria | 2062 |
| 268 | Ga0157319_1012023 | 3300012497 | Unclassified | 724 |
| 269 | Ga0157314_1008434 | 3300012500 | Bacteria | 851 |
| 270 | Ga0157324_1009637 | 3300012506 | Bacteria | 802 |
| 271 | Ga0157316_1022501 | 3300012510 | Bacteria | 701 |
| 272 | Ga0157373_10131015 | 3300013100 | Unclassified | 1764 |
| 273 | Ga0157371_10011208 | 3300013102 | Bacteria | 6928 |
| 274 | Ga0157374_11512624 | 3300013296 | Unclassified | 695 |
| 275 | Ga0157378_10048977 | 3300013297 | Unclassified | 3758 |
| 276 | Ga0157378_10225070 | 3300013297 | Unclassified | 1785 |
| 277 | Ga0157378_12483680 | 3300013297 | Unclassified | 570 |
| 278 | Ga0163162_10013962 | 3300013306 | Bacteria | 7850 |
| 279 | Ga0163162_10042632 | 3300013306 | Unclassified | 4543 |
| 280 | Ga0163162_10174841 | 3300013306 | Bacteria | 2272 |
| 281 | Ga0157372_10090284 | 3300013307 | Bacteria | 3483 |
| 282 | Ga0157372_11100783 | 3300013307 | Bacteria | 919 |
| 283 | Ga0157375_10052750 | 3300013308 | Unclassified | 3999 |
| 284 | Ga0157375_10353274 | 3300013308 | Bacteria | 1636 |
| 285 | Ga0163163_10178538 | 3300014325 | Bacteria | 2170 |
| 286 | Ga0157380_10326792 | 3300014326 | Bacteria | 1424 |
| 287 | Ga0157380_10418420 | 3300014326 | Bacteria | 1277 |
| 288 | Ga0157380_11378432 | 3300014326 | Unclassified | 755 |
| 289 | Ga0157379_10023228 | 3300014968 | Bacteria | 5501 |
| 290 | Ga0157379_10062159 | 3300014968 | Unclassified | 3340 |
| 291 | Ga0157376_10185167 | 3300014969 | Bacteria | 1906 |
| 292 | Ga0157376_10968581 | 3300014969 | Bacteria | 872 |
| 293 | Ga0182006_1108679 | 3300015261 | Unclassified | 976 |
| 294 | Ga0182007_10074613 | 3300015262 | Bacteria | 1111 |
| 295 | Ga0163161_10030861 | 3300017792 | Bacteria | 3816 |
| 296 | Ga0163161_10750676 | 3300017792 | Unclassified | 816 |
| 297 | Ga0163161_10905466 | 3300017792 | Bacteria | 748 |
| 298 | Ga0197907_10944092 | 3300020069 | Bacteria | 769 |
| 299 | Ga0206355_1129667 | 3300020076 | Bacteria | 563 |
| 300 | Ga0206350_11056752 | 3300020080 | Unclassified | 1370 |
| 301 | Ga0206350_11297399 | 3300020080 | Unclassified | 822 |
| 302 | Ga0224712_10271339 | 3300022467 | Unclassified | 788 |
| 303 | Ga0224712_10286009 | 3300022467 | Bacteria | 768 |
| 304 | Ga0207666_1021083 | 3300025271 | Bacteria | 959 |
| 305 | Ga0207697_10047695 | 3300025315 | Bacteria | 1766 |
| 306 | Ga0207642_10051569 | 3300025899 | Unclassified | 1862 |
| 307 | Ga0207688_10047865 | 3300025901 | Unclassified | 2388 |
| 308 | Ga0207680_10887648 | 3300025903 | Unclassified | 639 |
| 309 | Ga0207680_11234623 | 3300025903 | Bacteria | 532 |
| 310 | Ga0207647_10309254 | 3300025904 | Unclassified | 899 |
| 311 | Ga0207645_10000465 | 3300025907 | Bacteria | 33565 |
| 312 | Ga0207643_10211056 | 3300025908 | Bacteria | 1185 |
| 313 | Ga0207705_10107232 | 3300025909 | Unclassified | 2061 |
| 314 | Ga0207684_10169248 | 3300025910 | Bacteria | 1883 |
| 315 | Ga0207684_10492016 | 3300025910 | Bacteria | 1052 |
| 316 | Ga0207684_11662582 | 3300025910 | Bacteria | 515 |
| 317 | Ga0207654_10300342 | 3300025911 | Unclassified | 1092 |
| 318 | Ga0207707_10030527 | 3300025912 | Unclassified | 4715 |
| 319 | Ga0207695_10491490 | 3300025913 | Bacteria | 1109 |
| 320 | Ga0207671_11518179 | 3300025914 | Unclassified | 517 |
| 321 | Ga0207693_10174017 | 3300025915 | Bacteria | 1694 |
| 322 | Ga0207660_10497105 | 3300025917 | Bacteria | 989 |
| 323 | Ga0207660_10506524 | 3300025917 | Bacteria | 980 |
| 324 | Ga0207662_10183460 | 3300025918 | Bacteria | 1347 |
| 325 | Ga0207662_10575740 | 3300025918 | Bacteria | 782 |
| 326 | Ga0207657_10012781 | 3300025919 | Bacteria | 8264 |
| 327 | Ga0207649_10681461 | 3300025920 | Bacteria | 796 |
| 328 | Ga0207652_10173731 | 3300025921 | Unclassified | 1934 |
| 329 | Ga0207646_10036121 | 3300025922 | Bacteria | 4461 |
| 330 | Ga0207646_10302171 | 3300025922 | Bacteria | 1446 |
| 331 | Ga0207646_10378907 | 3300025922 | Bacteria | 1278 |
| 332 | Ga0207646_11530895 | 3300025922 | Bacteria | 577 |
| 333 | Ga0207681_10620692 | 3300025923 | Unclassified | 895 |
| 334 | Ga0207681_10645160 | 3300025923 | Bacteria | 877 |
| 335 | Ga0207650_10317075 | 3300025925 | Bacteria | 1276 |
| 336 | Ga0207659_10021423 | 3300025926 | Unclassified | 4290 |
| 337 | Ga0207687_11746698 | 3300025927 | Unclassified | 533 |
| 338 | Ga0207700_10710984 | 3300025928 | Bacteria | 897 |
| 339 | Ga0207664_11950612 | 3300025929 | Bacteria | 510 |
| 340 | Ga0207644_10169451 | 3300025931 | Bacteria | 1703 |
| 341 | Ga0207690_10237728 | 3300025932 | Unclassified | 1402 |
| 342 | Ga0207690_10422089 | 3300025932 | Bacteria | 1067 |
| 343 | Ga0207690_11145291 | 3300025932 | Unclassified | 649 |
| 344 | Ga0207706_10007890 | 3300025933 | Bacteria | 9824 |
| 345 | Ga0207706_10209758 | 3300025933 | Unclassified | 1708 |
| 346 | Ga0207686_10132402 | 3300025934 | Bacteria | 1712 |
| 347 | Ga0207709_10323719 | 3300025935 | Bacteria | 1155 |
| 348 | Ga0207670_10015115 | 3300025936 | Unclassified | 4603 |
| 349 | Ga0207670_10146756 | 3300025936 | Unclassified | 1745 |
| 350 | Ga0207670_10182196 | 3300025936 | Bacteria | 1583 |
| 351 | Ga0207669_10028665 | 3300025937 | Unclassified | 3066 |
| 352 | Ga0207704_10778113 | 3300025938 | Bacteria | 798 |
| 353 | Ga0207665_10196172 | 3300025939 | Bacteria | 1469 |
| 354 | Ga0207665_10233379 | 3300025939 | Bacteria | 1353 |
| 355 | Ga0207665_10248950 | 3300025939 | Bacteria | 1312 |
| 356 | Ga0207691_10005743 | 3300025940 | Bacteria | 12003 |
| 357 | Ga0207689_10028906 | 3300025942 | Unclassified | 4634 |
| 358 | Ga0207661_11349896 | 3300025944 | Bacteria | 655 |
| 359 | Ga0207661_11959567 | 3300025944 | Bacteria | 532 |
| 360 | Ga0207679_10303920 | 3300025945 | Bacteria | 1376 |
| 361 | Ga0207651_10258509 | 3300025960 | Bacteria | 1428 |
| 362 | Ga0207712_11291703 | 3300025961 | Unclassified | 652 |
| 363 | Ga0207668_10116801 | 3300025972 | Unclassified | 2013 |
| 364 | Ga0207640_10243392 | 3300025981 | Bacteria | 1391 |
| 365 | Ga0207658_10102992 | 3300025986 | Unclassified | 2240 |
| 366 | Ga0207677_10852842 | 3300026023 | Unclassified | 819 |
| 367 | Ga0207703_10149979 | 3300026035 | Bacteria | 2032 |
| 368 | Ga0207703_10249996 | 3300026035 | Bacteria | 1597 |
| 369 | Ga0207639_11211674 | 3300026041 | Unclassified | 708 |
| 370 | Ga0207678_10187347 | 3300026067 | Bacteria | 1768 |
| 371 | Ga0207678_10239874 | 3300026067 | Bacteria | 1553 |
| 372 | Ga0207678_10626048 | 3300026067 | Bacteria | 944 |
| 373 | Ga0207708_10052305 | 3300026075 | Unclassified | 3111 |
| 374 | Ga0207708_11750909 | 3300026075 | Bacteria | 545 |
| 375 | Ga0207702_11570938 | 3300026078 | Unclassified | 651 |
| 376 | Ga0207641_10266556 | 3300026088 | Unclassified | 1606 |
| 377 | Ga0207648_10015387 | 3300026089 | Bacteria | 7039 |
| 378 | Ga0207676_10773304 | 3300026095 | Unclassified | 935 |
| 379 | Ga0207676_11164414 | 3300026095 | Bacteria | 763 |
| 380 | Ga0207674_10062280 | 3300026116 | Bacteria | 3768 |
| 381 | Ga0207674_10068699 | 3300026116 | Bacteria | 3565 |
| 382 | Ga0207674_10093403 | 3300026116 | Bacteria | 2997 |
| 383 | Ga0207675_100152977 | 3300026118 | Unclassified | 2197 |
| 384 | Ga0207675_100365763 | 3300026118 | Bacteria | 1416 |
| 385 | Ga0207675_102438671 | 3300026118 | Bacteria | 535 |
| 386 | Ga0207683_10001178 | 3300026121 | Bacteria | 23644 |
| 387 | Ga0209969_1071640 | 3300027360 | Unclassified | 551 |
| 388 | Ga0209984_1005624 | 3300027424 | Bacteria | 1512 |
| 389 | Ga0209968_1013318 | 3300027526 | Bacteria | 1289 |
| 390 | Ga0209982_1010436 | 3300027552 | Bacteria | 1376 |
| 391 | Ga0209970_1006749 | 3300027614 | Bacteria | 1885 |
| 392 | Ga0210002_1006859 | 3300027617 | Bacteria | 1722 |
| 393 | Ga0209971_1023839 | 3300027682 | Bacteria | 1460 |
| 394 | Ga0209971_1039155 | 3300027682 | Bacteria | 1141 |
| 395 | Ga0209998_10011102 | 3300027717 | Bacteria | 1864 |
| 396 | Ga0209974_10054370 | 3300027876 | Bacteria | 1349 |
| 397 | Ga0209974_10193602 | 3300027876 | Bacteria | 749 |
| 398 | Ga0209974_10207156 | 3300027876 | Unclassified | 726 |
| 399 | Ga0207428_10011568 | 3300027907 | Bacteria | 7793 |
| 400 | Ga0207428_10143986 | 3300027907 | Bacteria | 1817 |
| 401 | Ga0207428_11238066 | 3300027907 | Bacteria | 518 |
| 402 | Ga0268266_10062867 | 3300028379 | Bacteria | 3205 |
| 403 | Ga0268266_10816402 | 3300028379 | Bacteria | 901 |
| 404 | Ga0268265_11027186 | 3300028380 | Unclassified | 815 |
| 405 | Ga0268265_11444613 | 3300028380 | Unclassified | 690 |
| 406 | Ga0268264_10106498 | 3300028381 | Bacteria | 2448 |
| 407 | Ga0265330_10006523 | 3300031235 | Bacteria | 5769 |
| 408 | Ga0265332_10000445 | 3300031238 | Bacteria | 29097 |
| 409 | Ga0265328_10004623 | 3300031239 | Bacteria | 5959 |
| 410 | Ga0265320_10166742 | 3300031240 | Unclassified | 990 |
| 411 | Ga0265329_10020192 | 3300031242 | Unclassified | 2252 |
| 412 | Ga0265331_10000076 | 3300031250 | Bacteria | 145884 |
| 413 | Ga0265327_10194101 | 3300031251 | Unclassified | 923 |
| 414 | Ga0265316_10000006 | 3300031344 | Bacteria | 289686 |
| 415 | Ga0307408_100115535 | 3300031548 | Bacteria | 2070 |
| 416 | Ga0307408_100134193 | 3300031548 | Unclassified | 1935 |
| 417 | Ga0307408_100137852 | 3300031548 | Bacteria | 1911 |
| 418 | Ga0307408_100148744 | 3300031548 | Bacteria | 1847 |
| 419 | Ga0307408_100463945 | 3300031548 | Bacteria | 1101 |
| 420 | Ga0307408_100612483 | 3300031548 | Bacteria | 969 |
| 421 | Ga0307408_100666189 | 3300031548 | Bacteria | 932 |
| 422 | Ga0307408_100836110 | 3300031548 | Bacteria | 838 |
| 423 | Ga0265314_10000056 | 3300031711 | Bacteria | 171647 |
| 424 | Ga0265342_10020657 | 3300031712 | Unclassified | 4218 |
| 425 | Ga0307405_10037651 | 3300031731 | Bacteria | 2909 |
| 426 | Ga0307405_10067889 | 3300031731 | Bacteria | 2280 |
| 427 | Ga0307405_10177362 | 3300031731 | Unclassified | 1526 |
| 428 | Ga0307405_10361429 | 3300031731 | Bacteria | 1123 |
| 429 | Ga0307413_10017383 | 3300031824 | Bacteria | 3743 |
| 430 | Ga0307413_10095602 | 3300031824 | Unclassified | 1948 |
| 431 | Ga0307413_10117210 | 3300031824 | Bacteria | 1796 |
| 432 | Ga0307413_10332317 | 3300031824 | Bacteria | 1165 |
| 433 | Ga0307410_10028316 | 3300031852 | Bacteria | 3552 |
| 434 | Ga0307410_10180000 | 3300031852 | Bacteria | 1600 |
| 435 | Ga0307410_10199381 | 3300031852 | Bacteria | 1527 |
| 436 | Ga0307410_10218337 | 3300031852 | Bacteria | 1465 |
| 437 | Ga0307410_11600752 | 3300031852 | Bacteria | 576 |
| 438 | Ga0307406_10053549 | 3300031901 | Bacteria | 2571 |
| 439 | Ga0307406_10080743 | 3300031901 | Bacteria | 2160 |
| 440 | Ga0307406_10092885 | 3300031901 | Bacteria | 2036 |
| 441 | Ga0307406_10932272 | 3300031901 | Bacteria | 741 |
| 442 | Ga0307406_11580362 | 3300031901 | Bacteria | 579 |
| 443 | Ga0307407_10181062 | 3300031903 | Bacteria | 1397 |
| 444 | Ga0307407_10234502 | 3300031903 | Unclassified | 1248 |
| 445 | Ga0307407_10756595 | 3300031903 | Bacteria | 736 |
| 446 | Ga0307407_11671827 | 3300031903 | Bacteria | 506 |
| 447 | Ga0307412_10151209 | 3300031911 | Bacteria | 1713 |
| 448 | Ga0307412_10159134 | 3300031911 | Unclassified | 1676 |
| 449 | Ga0307412_10189641 | 3300031911 | Unclassified | 1553 |
| 450 | Ga0307412_10192147 | 3300031911 | Bacteria | 1544 |
| 451 | Ga0307412_10800421 | 3300031911 | Bacteria | 818 |
| 452 | Ga0307412_11238252 | 3300031911 | Bacteria | 670 |
| 453 | Ga0307409_100094868 | 3300031995 | Bacteria | 2456 |
| 454 | Ga0307409_100170434 | 3300031995 | Bacteria | 1915 |
| 455 | Ga0307409_100201133 | 3300031995 | Bacteria | 1782 |
| 456 | Ga0307409_100288170 | 3300031995 | Unclassified | 1521 |
| 457 | Ga0307409_100690940 | 3300031995 | Bacteria | 1019 |
| 458 | Ga0307409_101037167 | 3300031995 | Unclassified | 839 |
| 459 | Ga0307409_101124717 | 3300031995 | Bacteria | 807 |
| 460 | Ga0307409_101358948 | 3300031995 | Bacteria | 736 |
| 461 | Ga0307409_101472470 | 3300031995 | Bacteria | 708 |
| 462 | Ga0307416_100009283 | 3300032002 | Bacteria | 6428 |
| 463 | Ga0307416_100011010 | 3300032002 | Bacteria | 6007 |
| 464 | Ga0307416_100033248 | 3300032002 | Bacteria | 3907 |
| 465 | Ga0307416_100125019 | 3300032002 | Bacteria | 2302 |
| 466 | Ga0307416_100144042 | 3300032002 | Bacteria | 2172 |
| 467 | Ga0307416_100268741 | 3300032002 | Bacteria | 1672 |
| 468 | Ga0307416_100391102 | 3300032002 | Bacteria | 1424 |
| 469 | Ga0307416_100543350 | 3300032002 | Bacteria | 1234 |
| 470 | Ga0307416_100699935 | 3300032002 | Unclassified | 1102 |
| 471 | Ga0307416_103790921 | 3300032002 | Bacteria | 506 |
| 472 | Ga0307414_10156300 | 3300032004 | Bacteria | 1806 |
| 473 | Ga0307414_10503101 | 3300032004 | Bacteria | 1072 |
| 474 | Ga0307414_10889152 | 3300032004 | Bacteria | 816 |
| 475 | Ga0307414_11468748 | 3300032004 | Bacteria | 634 |
| 476 | Ga0307414_12133792 | 3300032004 | Bacteria | 523 |
| 477 | Ga0307411_10007627 | 3300032005 | Bacteria | 5535 |
| 478 | Ga0307411_10033546 | 3300032005 | Bacteria | 3185 |
| 479 | Ga0307411_10049595 | 3300032005 | Bacteria | 2729 |
| 480 | Ga0307411_10226066 | 3300032005 | Bacteria | 1455 |
| 481 | Ga0307411_10243631 | 3300032005 | Bacteria | 1409 |
| 482 | Ga0307411_10383243 | 3300032005 | Bacteria | 1157 |
| 483 | Ga0307411_10407390 | 3300032005 | Bacteria | 1126 |
| 484 | Ga0307411_11205581 | 3300032005 | Bacteria | 686 |
| 485 | Ga0307415_100026491 | 3300032126 | Bacteria | 3658 |
| 486 | Ga0307415_100042278 | 3300032126 | Bacteria | 3032 |
| 487 | Ga0307415_100058195 | 3300032126 | Bacteria | 2660 |
| 488 | Ga0307415_100179284 | 3300032126 | Bacteria | 1660 |
| 489 | Ga0307415_101142399 | 3300032126 | Bacteria | 731 |
| 490 | Ga0307415_101585566 | 3300032126 | Bacteria | 628 |
| 491 | Ga0307415_102513617 | 3300032126 | Bacteria | 507 |
| 492 | Ga0373938_0080501 | 3300034957 | Bacteria | 792 |
| 493 | Ga0373926_0066467 | 3300035083 | Bacteria | 1320 |
| 494 | Ga0373928_0108399 | 3300035084 | Unclassified | 732 |
| 495 | Ga0373929_0171620 | 3300035085 | Unclassified | 593 |
| 496 | Ga0373951_0023590 | 3300035091 | Bacteria | 1422 |
| 497 | Ga0373951_0033190 | 3300035091 | Bacteria | 1223 |
| 498 | Ga0373932_0027302 | 3300035112 | Bacteria | 1561 |
| 499 | Ga0373936_0056982 | 3300035113 | Bacteria | 1589 |
| 500 | Ga0373939_0043450 | 3300035114 | Bacteria | 1364 |
| 501 | Ga0373941_0062561 | 3300035115 | Bacteria | 1215 |
| 502 | Ga0373941_0243667 | 3300035115 | Unclassified | 699 |
| 503 | Ga0373960_0072323 | 3300035121 | Unclassified | 1069 |
| 504 | Ga0373960_0208288 | 3300035121 | Unclassified | 694 |
| 505 | Ga0373943_0318452 | 3300035170 | Bacteria | 886 |
| 506 | Ga0373946_0041878 | 3300035171 | Bacteria | 1880 |
| 507 | Ga0373961_0092809 | 3300035241 | Unclassified | 967 |
| 508 | Ga0373931_0006970 | 3300035691 | Bacteria | 5317 |
| 509 | Ga0373931_0936784 | 3300035691 | Unclassified | 584 |
| 510 | Ga0373935_0027230 | 3300035692 | Bacteria | 3534 |
| 511 | Ga0373927_0296065 | 3300035695 | Unclassified | 1065 |
| 512 | Ga0373927_0966378 | 3300035695 | Unclassified | 562 |
| 513 | Ga0373947_0008839 | 3300035725 | Bacteria | 5793 |
| 514 | Ga0373937_0089288 | 3300036401 | Bacteria | 2854 |
| 515 | Ga0373925_0058114 | 3300037068 | Bacteria | 2899 |
| 516 | Ga0436360_0877177 | 3300039438 | Bacteria | 1621 |
| 517 | Ga0436360_0877644 | 3300039438 | Bacteria | 1652 |
| 518 | Ga0436362_0002027 | 3300039453 | Bacteria | 1295 |
| 519 | Ga0439465_0332424 | 3300041413 | Bacteria | 572 |
| 520 | Ga0439434_0241065 | 3300042435 | Bacteria | 617 |
| 521 | Ga0451577_0170115 | 3300042876 | Bacteria | 1963 |
| 522 | Ga0451577_1288509 | 3300042876 | Bacteria | 650 |
| 523 | Ga0451577_1725766 | 3300042876 | Unclassified | 550 |
| 524 | Ga0453683_0001749 | 3300044673 | Bacteria | 18015 |
| 525 | Ga0466965_0071638 | 3300044683 | Bacteria | 1744 |
| 526 | Ga0466965_0809268 | 3300044683 | Bacteria | 543 |
| 527 | Ga0466963_0616679 | 3300044694 | Bacteria | 766 |
| 528 | Ga0453684_0335194 | 3300044712 | Bacteria | 1709 |
| 529 | Ga0453684_1485134 | 3300044712 | Bacteria | 700 |
| 530 | Ga0466960_0669337 | 3300044901 | Bacteria | 621 |
| 531 | Ga0466960_1012804 | 3300044901 | Bacteria | 511 |
| 532 | Ga0451576_0733259 | 3300045051 | Bacteria | 1038 |
| 533 | Ga0451576_1262493 | 3300045051 | Bacteria | 770 |
| 534 | Ga0451576_1356746 | 3300045051 | Unclassified | 740 |
| 535 | Ga0466967_0592370 | 3300045976 | Bacteria | 1094 |
| 536 | Ga0495603_0474137 | 3300046455 | Bacteria | 717 |
| 537 | Ga0495580_0000319 | 3300046472 | Bacteria | 39348 |
| 538 | Ga0495594_0321687 | 3300046499 | Bacteria | 881 |
| 539 | Ga0495586_0518800 | 3300046535 | Bacteria | 688 |
| 540 | Ga0495656_0128634 | 3300046615 | Bacteria | 1203 |
| 541 | Ga0495658_0182601 | 3300046683 | Unclassified | 1302 |
| 542 | Ga0495636_0433434 | 3300047318 | Unclassified | 630 |
| 543 | Ga0496100_0432184 | 3300048903 | Unclassified | 1007 |
| 544 | Ga0496100_1636133 | 3300048903 | Unclassified | 509 |
| 545 | Ga0496101_0398761 | 3300048904 | Bacteria | 1083 |
| 546 | Ga0496101_1474142 | 3300048904 | Bacteria | 530 |
| 547 | Ga0496102_0106319 | 3300048905 | Bacteria | 2612 |
| 548 | Ga0496102_0700586 | 3300048905 | Bacteria | 936 |
| 549 | Ga0496103_0623646 | 3300048906 | Bacteria | 686 |
| 550 | Ga0496104_0271666 | 3300048907 | Bacteria | 1608 |
| 551 | Ga0496104_0708353 | 3300048907 | Bacteria | 914 |
| 552 | Ga0496106_0225540 | 3300048909 | Unclassified | 1495 |
| 553 | Ga0496106_0413715 | 3300048909 | Bacteria | 1084 |
| 554 | Ga0496106_0697146 | 3300048909 | Bacteria | 809 |
| 555 | Ga0496106_1342095 | 3300048909 | Unclassified | 554 |
| 556 | Ga0496108_0525516 | 3300048911 | Unclassified | 1033 |
| 557 | Ga0496108_0590383 | 3300048911 | Bacteria | 968 |
| 558 | Ga0496108_1366261 | 3300048911 | Unclassified | 594 |
| 559 | Ga0496109_0461759 | 3300048912 | Bacteria | 1199 |
| 560 | Ga0496109_1472466 | 3300048912 | Unclassified | 616 |
| 561 | Ga0496110_0922564 | 3300048913 | Bacteria | 780 |
| 562 | Ga0496112_0049540 | 3300048915 | Unclassified | 4118 |
| 563 | Ga0496112_0051030 | 3300048915 | Bacteria | 4057 |
| 564 | Ga0496112_0318135 | 3300048915 | Bacteria | 1501 |
| 565 | Ga0496121_0001035 | 3300048924 | Bacteria | 49640 |
| 566 | Ga0501291_028932 | 3300049514 | Bacteria | 925 |
| 567 | Ga0501299_005995 | 3300049522 | Bacteria | 1892 |
| 568 | Ga0501311_088092 | 3300049527 | Bacteria | 536 |
| 569 | Ga0501031_0013574 | 3300049568 | Bacteria | 5307 |
| 570 | Ga0501032_0024186 | 3300049569 | Bacteria | 4195 |
| 571 | Ga0501033_0009833 | 3300049570 | Bacteria | 7339 |
| 572 | Ga0501033_0240626 | 3300049570 | Bacteria | 1284 |
| 573 | Ga0501036_0038284 | 3300049572 | Bacteria | 4058 |
| 574 | Ga0501037_0021400 | 3300049573 | Bacteria | 4778 |
| 575 | Ga0501037_0054232 | 3300049573 | Bacteria | 2932 |
| 576 | Ga0501038_0001813 | 3300049574 | Bacteria | 19780 |
| 577 | Ga0501038_0045039 | 3300049574 | Bacteria | 3830 |
| 578 | Ga0501038_1033922 | 3300049574 | Unclassified | 602 |
| 579 | Ga0501038_1064419 | 3300049574 | Unclassified | 592 |
| 580 | Ga0501039_0019556 | 3300049575 | Bacteria | 5192 |
| 581 | Ga0501039_0799232 | 3300049575 | Bacteria | 736 |
| 582 | Ga0501040_0001107 | 3300049576 | Bacteria | 17068 |
| 583 | Ga0501040_0035780 | 3300049576 | Bacteria | 3368 |
| 584 | Ga0501040_0086621 | 3300049576 | Bacteria | 2175 |
| 585 | Ga0501040_0555968 | 3300049576 | Bacteria | 828 |
| 586 | Ga0501041_0000320 | 3300049577 | Bacteria | 23433 |
| 587 | Ga0501041_0183091 | 3300049577 | Bacteria | 1311 |
| 588 | Ga0501041_0456003 | 3300049577 | Unclassified | 812 |
| 589 | Ga0501042_0000344 | 3300049578 | Bacteria | 23309 |
| 590 | Ga0501042_0009875 | 3300049578 | Bacteria | 6375 |
| 591 | Ga0501042_0780792 | 3300049578 | Unclassified | 695 |
| 592 | Ga0501043_0031052 | 3300049579 | Bacteria | 4200 |
| 593 | Ga0501043_0118310 | 3300049579 | Bacteria | 2078 |
| 594 | Ga0501046_0011617 | 3300049580 | Bacteria | 7526 |
| 595 | Ga0501046_0064845 | 3300049580 | Bacteria | 2850 |
| 596 | Ga0501048_0010622 | 3300049582 | Bacteria | 6870 |
| 597 | Ga0501048_0025633 | 3300049582 | Bacteria | 4297 |
| 598 | Ga0501067_0300391 | 3300049583 | Unclassified | 894 |
| 599 | Ga0501068_0014603 | 3300049584 | Bacteria | 4494 |
| 600 | Ga0501068_0151187 | 3300049584 | Bacteria | 1459 |
| 601 | Ga0501068_1072108 | 3300049584 | Unclassified | 532 |
| 602 | Ga0501069_0040331 | 3300049585 | Bacteria | 2580 |
| 603 | Ga0501070_0035091 | 3300049586 | Bacteria | 4191 |
| 604 | Ga0501070_0238992 | 3300049586 | Bacteria | 1487 |
| 605 | Ga0501071_0000317 | 3300049587 | Bacteria | 23301 |
| 606 | Ga0501071_0016918 | 3300049587 | Bacteria | 5018 |
| 607 | Ga0501071_0616952 | 3300049587 | Bacteria | 834 |
| 608 | Ga0501071_1587343 | 3300049587 | Bacteria | 505 |
| 609 | Ga0501072_0000574 | 3300049588 | Bacteria | 26476 |
| 610 | Ga0501072_0093569 | 3300049588 | Bacteria | 2387 |
| 611 | Ga0501072_0674699 | 3300049588 | Bacteria | 813 |
| 612 | Ga0501072_0879871 | 3300049588 | Unclassified | 700 |
| 613 | Ga0501072_1565193 | 3300049588 | Unclassified | 508 |
| 614 | Ga0501073_0027625 | 3300049589 | Bacteria | 4057 |
| 615 | Ga0501073_0332637 | 3300049589 | Unclassified | 1048 |
| 616 | Ga0501074_0011344 | 3300049590 | Bacteria | 6476 |
| 617 | Ga0501074_0025112 | 3300049590 | Bacteria | 4328 |
| 618 | Ga0501075_0000513 | 3300049591 | Bacteria | 23373 |
| 619 | Ga0501075_0003362 | 3300049591 | Bacteria | 10691 |
| 620 | Ga0501075_0029414 | 3300049591 | Bacteria | 4063 |
| 621 | Ga0501076_0000576 | 3300049592 | Bacteria | 23425 |
| 622 | Ga0501076_0018169 | 3300049592 | Bacteria | 5355 |
| 623 | Ga0501076_0057457 | 3300049592 | Bacteria | 3089 |
| 624 | Ga0501076_0150536 | 3300049592 | Bacteria | 1893 |
| 625 | Ga0501076_1325411 | 3300049592 | Bacteria | 592 |
| 626 | Ga0501077_0000903 | 3300049593 | Bacteria | 17841 |
| 627 | Ga0501077_0011889 | 3300049593 | Bacteria | 5445 |
| 628 | Ga0501077_0049479 | 3300049593 | Bacteria | 2671 |
| 629 | Ga0501077_0130191 | 3300049593 | Unclassified | 1595 |
| 630 | Ga0501077_0516985 | 3300049593 | Unclassified | 766 |
| 631 | Ga0501202_205994 | 3300049652 | Unclassified | 540 |
| 632 | Ga0501227_014250 | 3300049665 | Unclassified | 1762 |
| 633 | Ga0501233_045132 | 3300049668 | Unclassified | 1050 |
| 634 | Ga0501235_139947 | 3300049669 | Bacteria | 619 |
| 635 | Ga0501236_089943 | 3300049670 | Unclassified | 588 |
| 636 | Ga0501247_024087 | 3300049677 | Bacteria | 803 |
| 637 | Ga0501251_037960 | 3300049681 | Bacteria | 717 |
| 638 | Ga0501225_0007472 | 3300049705 | Bacteria | 3165 |
| 639 | Ga0501225_0123939 | 3300049705 | Bacteria | 769 |
| 640 | Ga0501225_0335732 | 3300049705 | Bacteria | 519 |
| 641 | Ga0501079_0001501 | 3300049741 | Bacteria | 16528 |
| 642 | Ga0501079_0038808 | 3300049741 | Bacteria | 3672 |
| 643 | Ga0501080_0006567 | 3300049742 | Bacteria | 10450 |
| 644 | Ga0501080_0147844 | 3300049742 | Bacteria | 2172 |
| 645 | Ga0501081_0000423 | 3300049743 | Bacteria | 23363 |
| 646 | Ga0501081_0060086 | 3300049743 | Bacteria | 2632 |
| 647 | Ga0501081_0283569 | 3300049743 | Bacteria | 1213 |
| 648 | Ga0501081_0514814 | 3300049743 | Bacteria | 892 |
| 649 | Ga0501081_0589722 | 3300049743 | Bacteria | 832 |
| 650 | Ga0501081_0807135 | 3300049743 | Unclassified | 706 |
| 651 | Ga0501081_1344711 | 3300049743 | Unclassified | 542 |
| 652 | Ga0501083_0005809 | 3300049744 | Bacteria | 8741 |
| 653 | Ga0501083_0101659 | 3300049744 | Bacteria | 1895 |
| 654 | Ga0501265_065260 | 3300049762 | Bacteria | 603 |
| 655 | Ga0501266_027167 | 3300049763 | Bacteria | 804 |
| 656 | Ga0501268_015591 | 3300049765 | Unclassified | 1251 |
| 657 | Ga0501035_0102964 | 3300049822 | Bacteria | 2504 |
| 658 | Ga0501035_0110675 | 3300049822 | Bacteria | 2407 |
| 659 | Ga0501035_1180393 | 3300049822 | Bacteria | 595 |
| 660 | Ga0501044_0076398 | 3300049823 | Bacteria | 3399 |
| 661 | Ga0501045_0002513 | 3300049824 | Bacteria | 12468 |
| 662 | Ga0501045_0523138 | 3300049824 | Unclassified | 880 |
| 663 | Ga0501045_0869778 | 3300049824 | Bacteria | 663 |
| 664 | Ga0501045_1065524 | 3300049824 | Unclassified | 592 |
| 665 | Ga0501212_007428 | 3300049851 | Unclassified | 1502 |
| 666 | nmdc:mga05p37_105262_c1 | 3300050507 | Bacteria | 3471 |
| 667 | nmdc:mga05p37_111264_c1 | 3300050507 | Bacteria | 3368 |
| 668 | nmdc:mga05p37_1945581_c1 | 3300050507 | Unclassified | 559 |
| 669 | nmdc:mga05p37_35482_c1 | 3300050507 | Bacteria | 3733 |
| 670 | nmdc:mga05p37_54814_c1 | 3300050507 | Bacteria | 4904 |
| 671 | nmdc:mga05p37_5586_c1 | 3300050507 | Bacteria | 14787 |
| 672 | nmdc:mga05p37_731933_c1 | 3300050507 | Bacteria | 1093 |
| 673 | nmdc:mga05p37_86276_c1 | 3300050507 | Bacteria | 3869 |
| 674 | nmdc:mga09592_1427205_c1 | 3300050508 | Bacteria | 565 |
| 675 | nmdc:mga09592_1640674_c1 | 3300050508 | Unclassified | 520 |
| 676 | nmdc:mga09592_350042_c1 | 3300050508 | Bacteria | 1279 |
| 677 | nmdc:mga09592_706272_c1 | 3300050508 | Unclassified | 858 |
| 678 | nmdc:mga0qj67_116309_c1 | 3300050509 | Bacteria | 2161 |
| 679 | nmdc:mga0qj67_246588_c1 | 3300050509 | Bacteria | 1449 |
| 680 | nmdc:mga0qj67_321552_c1 | 3300050509 | Bacteria | 1252 |
| 681 | nmdc:mga0qj67_76802_c1 | 3300050509 | Unclassified | 2672 |
| 682 | nmdc:mga0qj67_782607_c1 | 3300050509 | Bacteria | 756 |
| 683 | nmdc:mga0qj67_794403_c1 | 3300050509 | Unclassified | 749 |
| 684 | nmdc:mga06r32_160600_c1 | 3300050510 | Bacteria | 2230 |
| 685 | nmdc:mga06r32_2069307_c1 | 3300050510 | Unclassified | 502 |
| 686 | nmdc:mga06r32_365009_c1 | 3300050510 | Bacteria | 1427 |
| 687 | nmdc:mga06r32_69569_c1 | 3300050510 | Bacteria | 3402 |
| 688 | nmdc:mga06r32_736538_c1 | 3300050510 | Unclassified | 950 |
| 689 | nmdc:mga06r32_834553_c1 | 3300050510 | Bacteria | 881 |
| 690 | nmdc:mga06r32_961547_c1 | 3300050510 | Bacteria | 808 |
| 691 | nmdc:mga08y16_113752_c1 | 3300050511 | Bacteria | 2817 |
| 692 | nmdc:mga08y16_1643812_c1 | 3300050511 | Bacteria | 599 |
| 693 | nmdc:mga08y16_170704_c1 | 3300050511 | Bacteria | 2259 |
| 694 | nmdc:mga08y16_20561_c1 | 3300050511 | Bacteria | 6968 |
| 695 | nmdc:mga0n895_132125_c1 | 3300050512 | Unclassified | 2522 |
| 696 | nmdc:mga0n895_1450631_c1 | 3300050512 | Unclassified | 654 |
| 697 | nmdc:mga0n895_203789_c1 | 3300050512 | Bacteria | 2009 |
| 698 | nmdc:mga0n895_24725_c1 | 3300050512 | Bacteria | 5664 |
| 699 | nmdc:mga0n895_254711_c1 | 3300050512 | Bacteria | 1781 |
| 700 | nmdc:mga0n895_2742_c1 | 3300050512 | Bacteria | 13908 |
| 701 | nmdc:mga0n895_349243_c1 | 3300050512 | Bacteria | 1498 |
| 702 | nmdc:mga0n895_611445_c1 | 3300050512 | Bacteria | 1091 |
| 703 | nmdc:mga0n895_619097_c1 | 3300050512 | Bacteria | 1084 |
| 704 | nmdc:mga0rr50_1174906_c1 | 3300050513 | Bacteria | 652 |
| 705 | nmdc:mga0rr50_240977_c1 | 3300050513 | Bacteria | 1499 |
| 706 | nmdc:mga0rr50_25473_c1 | 3300050513 | Bacteria | 4113 |
| 707 | nmdc:mga0rr50_4059_c1 | 3300050513 | Bacteria | 8547 |
| 708 | nmdc:mga0rr50_53845_c1 | 3300050513 | Unclassified | 2995 |
| 709 | nmdc:mga0rr50_8734_c2 | 3300050513 | Bacteria | 5000 |
| 710 | nmdc:mga0rr50_875596_c1 | 3300050513 | Bacteria | 766 |
| 711 | nmdc:mga08x19_21129_c1 | 3300050514 | Unclassified | 4014 |
| 712 | nmdc:mga08x19_23580_c1 | 3300050514 | Bacteria | 3818 |
| 713 | nmdc:mga08x19_335909_c1 | 3300050514 | Unclassified | 1053 |
| 714 | nmdc:mga08x19_392957_c1 | 3300050514 | Bacteria | 972 |
| 715 | nmdc:mga08x19_407912_c1 | 3300050514 | Bacteria | 954 |
| 716 | nmdc:mga08x19_89427_c1 | 3300050514 | Bacteria | 2031 |
| 717 | nmdc:mga0a205_1197_c1 | 3300050515 | Bacteria | 21384 |
| 718 | nmdc:mga0a205_1243527_c1 | 3300050515 | Unclassified | 592 |
| 719 | nmdc:mga0a205_15616_c1 | 3300050515 | Bacteria | 7097 |
| 720 | nmdc:mga0a205_189175_c1 | 3300050515 | Bacteria | 1951 |
| 721 | nmdc:mga0a205_292750_c1 | 3300050515 | Bacteria | 1502 |
| 722 | nmdc:mga0a205_324514_c1 | 3300050515 | Bacteria | 1410 |
| 723 | nmdc:mga0a205_58716_c1 | 3300050515 | Bacteria | 3716 |
| 724 | nmdc:mga0a205_591410_c1 | 3300050515 | Bacteria | 963 |
| 725 | nmdc:mga0a205_65349_c1 | 3300050515 | Bacteria | 3514 |
| 726 | nmdc:mga0a205_77643_c1 | 3300050515 | Bacteria | 3209 |
| 727 | nmdc:mga0a205_80717_c1 | 3300050515 | Bacteria | 3142 |
| 728 | Ga0500614_245695 | 3300053123 | Bacteria | 557 |
| 729 | Ga0501084_0001468 | 3300054114 | Bacteria | 18724 |
| 730 | Ga0501084_0105078 | 3300054114 | Bacteria | 2372 |
| 731 | Ga0501084_0108629 | 3300054114 | Bacteria | 2330 |
| 732 | Ga0501084_1108890 | 3300054114 | Bacteria | 664 |
| 733 | Ga0501084_1800672 | 3300054114 | Bacteria | 511 |
| 734 | Ga0590071_007223 | 3300059421 | Bacteria | 2630 |
| 735 | Ga0590071_078757 | 3300059421 | Bacteria | 818 |
| 736 | Ga0590074_109309 | 3300059423 | Unclassified | 544 |
| 737 | Ga0501082_0006749 | 3300060353 | Bacteria | 9923 |
| 738 | Ga0501082_0048010 | 3300060353 | Bacteria | 3679 |
| 739 | Ga0501082_0091100 | 3300060353 | Bacteria | 2632 |
| 740 | Ga0501082_0158625 | 3300060353 | Bacteria | 1966 |
| 741 | Ga0501082_0238938 | 3300060353 | Bacteria | 1581 |
| 742 | Ga0501082_0701675 | 3300060353 | Bacteria | 886 |
| 743 | Ga0501082_1218414 | 3300060353 | Bacteria | 658 |
| 744 | Ga0530510_0001077 | 3300061734 | Bacteria | 18097 |
| 745 | Ga0530510_0014147 | 3300061734 | Bacteria | 5625 |
| 746 | Ga0530510_0185010 | 3300061734 | Bacteria | 1545 |
| 747 | Ga0530510_0273778 | 3300061734 | Unclassified | 1260 |
| 748 | Ga0530510_0464169 | 3300061734 | Bacteria | 958 |
| 749 | Ga0530510_1150035 | 3300061734 | Unclassified | 595 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025899 | Ga0207642_10051569 | Ga0207642_100515692 | 87 |
| 2 | 3300006871 | Ga0075434_100909133 | Ga0075434_1009091332 | 90 |
| 3 | 3300004798 | Ga0058859_10042614 | Ga0058859_100426142 | 91 |
| 4 | 3300004801 | Ga0058860_10067954 | Ga0058860_100679542 | 91 |
| 5 | 3300004801 | Ga0058860_11489369 | Ga0058860_114893692 | 91 |
| 6 | 3300005335 | Ga0070666_10200666 | Ga0070666_102006661 | 91 |
| 7 | 3300005335 | Ga0070666_10259902 | Ga0070666_102599022 | 91 |
| 8 | 3300005337 | Ga0070682_100743405 | Ga0070682_1007434052 | 91 |
| 9 | 3300005337 | Ga0070682_100977146 | Ga0070682_1009771461 | 91 |
| 10 | 3300005340 | Ga0070689_100135951 | Ga0070689_1001359512 | 91 |
| 11 | 3300005343 | Ga0070687_100102261 | Ga0070687_1001022613 | 91 |
| 12 | 3300005345 | Ga0070692_10606446 | Ga0070692_106064461 | 91 |
| 13 | 3300005345 | Ga0070692_11034244 | Ga0070692_110342441 | 91 |
| 14 | 3300005353 | Ga0070669_100368340 | Ga0070669_1003683402 | 91 |
| 15 | 3300005365 | Ga0070688_100050255 | Ga0070688_1000502552 | 91 |
| 16 | 3300005366 | Ga0070659_100275851 | Ga0070659_1002758512 | 91 |
| 17 | 3300005436 | Ga0070713_100950439 | Ga0070713_1009504392 | 91 |
| 18 | 3300005438 | Ga0070701_10051673 | Ga0070701_100516732 | 91 |
| 19 | 3300005444 | Ga0070694_100581013 | Ga0070694_1005810132 | 91 |
| 20 | 3300005444 | Ga0070694_100911016 | Ga0070694_1009110162 | 91 |
| 21 | 3300005445 | Ga0070708_100496844 | Ga0070708_1004968442 | 91 |
| 22 | 3300005455 | Ga0070663_101512430 | Ga0070663_1015124301 | 91 |
| 23 | 3300005457 | Ga0070662_100113587 | Ga0070662_1001135872 | 91 |
| 24 | 3300005466 | Ga0070685_10049255 | Ga0070685_100492552 | 91 |
| 25 | 3300005467 | Ga0070706_100266187 | Ga0070706_1002661872 | 91 |
| 26 | 3300005467 | Ga0070706_100268101 | Ga0070706_1002681012 | 91 |
| 27 | 3300005467 | Ga0070706_101317738 | Ga0070706_1013177382 | 91 |
| 28 | 3300005468 | Ga0070707_100141449 | Ga0070707_1001414493 | 91 |
| 29 | 3300005468 | Ga0070707_101509806 | Ga0070707_1015098061 | 91 |
| 30 | 3300005518 | Ga0070699_100872608 | Ga0070699_1008726082 | 91 |
| 31 | 3300005536 | Ga0070697_100324722 | Ga0070697_1003247222 | 91 |
| 32 | 3300005544 | Ga0070686_100013641 | Ga0070686_1000136414 | 91 |
| 33 | 3300005544 | Ga0070686_101582768 | Ga0070686_1015827682 | 91 |
| 34 | 3300005546 | Ga0070696_101008779 | Ga0070696_1010087792 | 91 |
| 35 | 3300005546 | Ga0070696_101161107 | Ga0070696_1011611072 | 91 |
| 36 | 3300005548 | Ga0070665_100899942 | Ga0070665_1008999421 | 91 |
| 37 | 3300005549 | Ga0070704_100023530 | Ga0070704_1000235305 | 91 |
| 38 | 3300005577 | Ga0068857_100127961 | Ga0068857_1001279611 | 91 |
| 39 | 3300005578 | Ga0068854_101892294 | Ga0068854_1018922942 | 91 |
| 40 | 3300005615 | Ga0070702_100035331 | Ga0070702_1000353314 | 91 |
| 41 | 3300005617 | Ga0068859_100009654 | Ga0068859_10000965410 | 91 |
| 42 | 3300005618 | Ga0068864_100155949 | Ga0068864_1001559494 | 91 |
| 43 | 3300005618 | Ga0068864_100605724 | Ga0068864_1006057241 | 91 |
| 44 | 3300005618 | Ga0068864_100941925 | Ga0068864_1009419252 | 91 |
| 45 | 3300005719 | Ga0068861_100101787 | Ga0068861_1001017874 | 91 |
| 46 | 3300005719 | Ga0068861_101821462 | Ga0068861_1018214621 | 91 |
| 47 | 3300005719 | Ga0068861_101906499 | Ga0068861_1019064992 | 91 |
| 48 | 3300005842 | Ga0068858_100038180 | Ga0068858_1000381804 | 91 |
| 49 | 3300005844 | Ga0068862_100274102 | Ga0068862_1002741022 | 91 |
| 50 | 3300005844 | Ga0068862_101040683 | Ga0068862_1010406832 | 91 |
| 51 | 3300005985 | Ga0081539_10000597 | Ga0081539_1000059729 | 91 |
| 52 | 3300005985 | Ga0081539_10092386 | Ga0081539_100923861 | 91 |
| 53 | 3300006028 | Ga0070717_10373601 | Ga0070717_103736012 | 91 |
| 54 | 3300006058 | Ga0075432_10141853 | Ga0075432_101418532 | 91 |
| 55 | 3300006358 | Ga0068871_102262809 | Ga0068871_1022628092 | 91 |
| 56 | 3300006844 | Ga0075428_100155465 | Ga0075428_1001554654 | 91 |
| 57 | 3300006846 | Ga0075430_100266972 | Ga0075430_1002669722 | 91 |
| 58 | 3300006846 | Ga0075430_100491428 | Ga0075430_1004914281 | 91 |
| 59 | 3300006847 | Ga0075431_100133852 | Ga0075431_1001338522 | 91 |
| 60 | 3300006852 | Ga0075433_10001943 | Ga0075433_100019433 | 91 |
| 61 | 3300006852 | Ga0075433_10068418 | Ga0075433_100684184 | 91 |
| 62 | 3300006852 | Ga0075433_11295867 | Ga0075433_112958671 | 91 |
| 63 | 3300006871 | Ga0075434_100003172 | Ga0075434_1000031726 | 91 |
| 64 | 3300006871 | Ga0075434_100023983 | Ga0075434_1000239833 | 91 |
| 65 | 3300006871 | Ga0075434_100059166 | Ga0075434_1000591665 | 91 |
| 66 | 3300006871 | Ga0075434_100359477 | Ga0075434_1003594772 | 91 |
| 67 | 3300006871 | Ga0075434_101313373 | Ga0075434_1013133732 | 91 |
| 68 | 3300006880 | Ga0075429_100774631 | Ga0075429_1007746312 | 91 |
| 69 | 3300006881 | Ga0068865_100400304 | Ga0068865_1004003042 | 91 |
| 70 | 3300006914 | Ga0075436_100066639 | Ga0075436_1000666392 | 91 |
| 71 | 3300006931 | Ga0097620_100009653 | Ga0097620_10000965310 | 91 |
| 72 | 3300007076 | Ga0075435_100089378 | Ga0075435_1000893784 | 91 |
| 73 | 3300007076 | Ga0075435_101336622 | Ga0075435_1013366221 | 91 |
| 74 | 3300007076 | Ga0075435_101511012 | Ga0075435_1015110122 | 91 |
| 75 | 3300009092 | Ga0105250_10564329 | Ga0105250_105643292 | 91 |
| 76 | 3300009094 | Ga0111539_10703303 | Ga0111539_107033031 | 91 |
| 77 | 3300009098 | Ga0105245_10179305 | Ga0105245_101793051 | 91 |
| 78 | 3300009147 | Ga0114129_10044906 | Ga0114129_100449063 | 91 |
| 79 | 3300009147 | Ga0114129_11448455 | Ga0114129_114484552 | 91 |
| 80 | 3300009176 | Ga0105242_10326011 | Ga0105242_103260112 | 91 |
| 81 | 3300009545 | Ga0105237_12183156 | Ga0105237_121831562 | 91 |
| 82 | 3300009553 | Ga0105249_10174231 | Ga0105249_101742313 | 91 |
| 83 | 3300009553 | Ga0105249_10213838 | Ga0105249_102138381 | 91 |
| 84 | 3300010375 | Ga0105239_12642740 | Ga0105239_126427402 | 91 |
| 85 | 3300011119 | Ga0105246_10105267 | Ga0105246_101052673 | 91 |
| 86 | 3300013297 | Ga0157378_10225070 | Ga0157378_102250702 | 91 |
| 87 | 3300013306 | Ga0163162_10042632 | Ga0163162_100426325 | 91 |
| 88 | 3300013307 | Ga0157372_11100783 | Ga0157372_111007831 | 91 |
| 89 | 3300013308 | Ga0157375_10052750 | Ga0157375_100527502 | 91 |
| 90 | 3300013308 | Ga0157375_10353274 | Ga0157375_103532742 | 91 |
| 91 | 3300014326 | Ga0157380_10418420 | Ga0157380_104184202 | 91 |
| 92 | 3300014968 | Ga0157379_10023228 | Ga0157379_100232283 | 91 |
| 93 | 3300014969 | Ga0157376_10968581 | Ga0157376_109685812 | 91 |
| 94 | 3300017792 | Ga0163161_10030861 | Ga0163161_100308613 | 91 |
| 95 | 3300017792 | Ga0163161_10905466 | Ga0163161_109054662 | 91 |
| 96 | 3300025903 | Ga0207680_10887648 | Ga0207680_108876482 | 91 |
| 97 | 3300025903 | Ga0207680_11234623 | Ga0207680_112346231 | 91 |
| 98 | 3300025910 | Ga0207684_10169248 | Ga0207684_101692482 | 91 |
| 99 | 3300025910 | Ga0207684_10492016 | Ga0207684_104920162 | 91 |
| 100 | 3300025910 | Ga0207684_11662582 | Ga0207684_116625822 | 91 |
| 101 | 3300025914 | Ga0207671_11518179 | Ga0207671_115181792 | 91 |
| 102 | 3300025918 | Ga0207662_10575740 | Ga0207662_105757401 | 91 |
| 103 | 3300025922 | Ga0207646_10302171 | Ga0207646_103021712 | 91 |
| 104 | 3300025922 | Ga0207646_11530895 | Ga0207646_115308951 | 91 |
| 105 | 3300025928 | Ga0207700_10710984 | Ga0207700_107109842 | 91 |
| 106 | 3300025929 | Ga0207664_11950612 | Ga0207664_119506122 | 91 |
| 107 | 3300025932 | Ga0207690_10237728 | Ga0207690_102377282 | 91 |
| 108 | 3300025933 | Ga0207706_10209758 | Ga0207706_102097582 | 91 |
| 109 | 3300025935 | Ga0207709_10323719 | Ga0207709_103237193 | 91 |
| 110 | 3300025936 | Ga0207670_10146756 | Ga0207670_101467561 | 91 |
| 111 | 3300025944 | Ga0207661_11959567 | Ga0207661_119595672 | 91 |
| 112 | 3300026035 | Ga0207703_10249996 | Ga0207703_102499962 | 91 |
| 113 | 3300026067 | Ga0207678_10239874 | Ga0207678_102398742 | 91 |
| 114 | 3300026067 | Ga0207678_10626048 | Ga0207678_106260482 | 91 |
| 115 | 3300026075 | Ga0207708_10052305 | Ga0207708_100523054 | 91 |
| 116 | 3300026075 | Ga0207708_11750909 | Ga0207708_117509092 | 91 |
| 117 | 3300026095 | Ga0207676_10773304 | Ga0207676_107733042 | 91 |
| 118 | 3300026095 | Ga0207676_11164414 | Ga0207676_111644141 | 91 |
| 119 | 3300026116 | Ga0207674_10068699 | Ga0207674_100686991 | 91 |
| 120 | 3300026118 | Ga0207675_100152977 | Ga0207675_1001529772 | 91 |
| 121 | 3300026118 | Ga0207675_102438671 | Ga0207675_1024386711 | 91 |
| 122 | 3300028379 | Ga0268266_10816402 | Ga0268266_108164022 | 91 |
| 123 | 3300028380 | Ga0268265_11444613 | Ga0268265_114446132 | 91 |
| 124 | 3300031235 | Ga0265330_10006523 | Ga0265330_100065236 | 91 |
| 125 | 3300031238 | Ga0265332_10000445 | Ga0265332_1000044526 | 91 |
| 126 | 3300031239 | Ga0265328_10004623 | Ga0265328_100046234 | 91 |
| 127 | 3300031240 | Ga0265320_10166742 | Ga0265320_101667422 | 91 |
| 128 | 3300031242 | Ga0265329_10020192 | Ga0265329_100201922 | 91 |
| 129 | 3300031250 | Ga0265331_10000076 | Ga0265331_1000007664 | 91 |
| 130 | 3300031251 | Ga0265327_10194101 | Ga0265327_101941012 | 91 |
| 131 | 3300031344 | Ga0265316_10000006 | Ga0265316_10000006182 | 91 |
| 132 | 3300031548 | Ga0307408_100115535 | Ga0307408_1001155352 | 91 |
| 133 | 3300031548 | Ga0307408_100148744 | Ga0307408_1001487441 | 91 |
| 134 | 3300031548 | Ga0307408_100612483 | Ga0307408_1006124832 | 91 |
| 135 | 3300031548 | Ga0307408_100836110 | Ga0307408_1008361102 | 91 |
| 136 | 3300031711 | Ga0265314_10000056 | Ga0265314_1000005628 | 91 |
| 137 | 3300031712 | Ga0265342_10020657 | Ga0265342_100206574 | 91 |
| 138 | 3300031731 | Ga0307405_10361429 | Ga0307405_103614292 | 91 |
| 139 | 3300031824 | Ga0307413_10017383 | Ga0307413_100173832 | 91 |
| 140 | 3300031824 | Ga0307413_10332317 | Ga0307413_103323172 | 91 |
| 141 | 3300031852 | Ga0307410_10028316 | Ga0307410_100283164 | 91 |
| 142 | 3300031852 | Ga0307410_10180000 | Ga0307410_101800002 | 91 |
| 143 | 3300031852 | Ga0307410_10199381 | Ga0307410_101993813 | 91 |
| 144 | 3300031852 | Ga0307410_10218337 | Ga0307410_102183372 | 91 |
| 145 | 3300031852 | Ga0307410_11600752 | Ga0307410_116007522 | 91 |
| 146 | 3300031901 | Ga0307406_10053549 | Ga0307406_100535493 | 91 |
| 147 | 3300031901 | Ga0307406_10080743 | Ga0307406_100807432 | 91 |
| 148 | 3300031901 | Ga0307406_10932272 | Ga0307406_109322721 | 91 |
| 149 | 3300031901 | Ga0307406_11580362 | Ga0307406_115803621 | 91 |
| 150 | 3300031903 | Ga0307407_10181062 | Ga0307407_101810622 | 91 |
| 151 | 3300031903 | Ga0307407_10756595 | Ga0307407_107565952 | 91 |
| 152 | 3300031903 | Ga0307407_11671827 | Ga0307407_116718272 | 91 |
| 153 | 3300031911 | Ga0307412_10192147 | Ga0307412_101921473 | 91 |
| 154 | 3300031911 | Ga0307412_11238252 | Ga0307412_112382522 | 91 |
| 155 | 3300031995 | Ga0307409_100094868 | Ga0307409_1000948683 | 91 |
| 156 | 3300031995 | Ga0307409_100170434 | Ga0307409_1001704343 | 91 |
| 157 | 3300031995 | Ga0307409_100201133 | Ga0307409_1002011331 | 91 |
| 158 | 3300031995 | Ga0307409_101124717 | Ga0307409_1011247172 | 91 |
| 159 | 3300031995 | Ga0307409_101358948 | Ga0307409_1013589482 | 91 |
| 160 | 3300031995 | Ga0307409_101472470 | Ga0307409_1014724702 | 91 |
| 161 | 3300032002 | Ga0307416_100011010 | Ga0307416_1000110104 | 91 |
| 162 | 3300032002 | Ga0307416_100125019 | Ga0307416_1001250192 | 91 |
| 163 | 3300032002 | Ga0307416_100144042 | Ga0307416_1001440422 | 91 |
| 164 | 3300032002 | Ga0307416_100268741 | Ga0307416_1002687411 | 91 |
| 165 | 3300032002 | Ga0307416_100391102 | Ga0307416_1003911022 | 91 |
| 166 | 3300032002 | Ga0307416_100543350 | Ga0307416_1005433501 | 91 |
| 167 | 3300032002 | Ga0307416_103790921 | Ga0307416_1037909212 | 91 |
| 168 | 3300032004 | Ga0307414_10156300 | Ga0307414_101563002 | 91 |
| 169 | 3300032004 | Ga0307414_10503101 | Ga0307414_105031012 | 91 |
| 170 | 3300032004 | Ga0307414_10889152 | Ga0307414_108891522 | 91 |
| 171 | 3300032004 | Ga0307414_11468748 | Ga0307414_114687482 | 91 |
| 172 | 3300032004 | Ga0307414_12133792 | Ga0307414_121337921 | 91 |
| 173 | 3300032005 | Ga0307411_10033546 | Ga0307411_100335463 | 91 |
| 174 | 3300032005 | Ga0307411_10226066 | Ga0307411_102260662 | 91 |
| 175 | 3300032005 | Ga0307411_10243631 | Ga0307411_102436312 | 91 |
| 176 | 3300032005 | Ga0307411_10407390 | Ga0307411_104073902 | 91 |
| 177 | 3300032005 | Ga0307411_11205581 | Ga0307411_112055812 | 91 |
| 178 | 3300032126 | Ga0307415_100026491 | Ga0307415_1000264912 | 91 |
| 179 | 3300032126 | Ga0307415_100042278 | Ga0307415_1000422782 | 91 |
| 180 | 3300032126 | Ga0307415_100179284 | Ga0307415_1001792841 | 91 |
| 181 | 3300032126 | Ga0307415_101142399 | Ga0307415_1011423992 | 91 |
| 182 | 3300032126 | Ga0307415_101585566 | Ga0307415_1015855662 | 91 |
| 183 | 3300032126 | Ga0307415_102513617 | Ga0307415_1025136172 | 91 |
| 184 | 3300035091 | Ga0373951_0023590 | Ga0373951_0023590_270_545 | 91 |
| 185 | 3300035115 | Ga0373941_0062561 | Ga0373941_0062561_291_566 | 91 |
| 186 | 3300035695 | Ga0373927_0296065 | Ga0373927_0296065_481_756 | 91 |
| 187 | 3300041413 | Ga0439465_0332424 | Ga0439465_0332424_138_419 | 91 |
| 188 | 3300042876 | Ga0451577_1725766 | Ga0451577_1725766_116_391 | 91 |
| 189 | 3300044683 | Ga0466965_0071638 | Ga0466965_0071638_66_347 | 91 |
| 190 | 3300044683 | Ga0466965_0809268 | Ga0466965_0809268_52_330 | 91 |
| 191 | 3300044694 | Ga0466963_0616679 | Ga0466963_0616679_24_305 | 91 |
| 192 | 3300044901 | Ga0466960_0669337 | Ga0466960_0669337_246_527 | 91 |
| 193 | 3300044901 | Ga0466960_1012804 | Ga0466960_1012804_58_339 | 91 |
| 194 | 3300045976 | Ga0466967_0592370 | Ga0466967_0592370_71_352 | 91 |
| 195 | 3300046472 | Ga0495580_0000319 | Ga0495580_0000319_25522_25797 | 91 |
| 196 | 3300046683 | Ga0495658_0182601 | Ga0495658_0182601_232_507 | 91 |
| 197 | 3300048904 | Ga0496101_0398761 | Ga0496101_0398761_638_919 | 91 |
| 198 | 3300048905 | Ga0496102_0106319 | Ga0496102_0106319_787_1062 | 91 |
| 199 | 3300048905 | Ga0496102_0700586 | Ga0496102_0700586_450_731 | 91 |
| 200 | 3300048906 | Ga0496103_0623646 | Ga0496103_0623646_386_667 | 91 |
| 201 | 3300048907 | Ga0496104_0708353 | Ga0496104_0708353_537_812 | 91 |
| 202 | 3300048909 | Ga0496106_0697146 | Ga0496106_0697146_211_486 | 91 |
| 203 | 3300048911 | Ga0496108_0590383 | Ga0496108_0590383_188_463 | 91 |
| 204 | 3300048913 | Ga0496110_0922564 | Ga0496110_0922564_91_372 | 91 |
| 205 | 3300048924 | Ga0496121_0001035 | Ga0496121_0001035_27336_27614 | 91 |
| 206 | 3300049527 | Ga0501311_088092 | Ga0501311_088092_120_395 | 91 |
| 207 | 3300049705 | Ga0501225_0335732 | Ga0501225_0335732_90_365 | 91 |
| 208 | 3300049743 | Ga0501081_0589722 | Ga0501081_0589722_513_788 | 91 |
| 209 | 3300049762 | Ga0501265_065260 | Ga0501265_065260_94_369 | 91 |
| 210 | 3300049822 | Ga0501035_1180393 | Ga0501035_1180393_140_421 | 91 |
| 211 | 3300050507 | nmdc:mga05p37_1945581_c1 | nmdc:mga05p37_1945581_c1_73_348 | 91 |
| 212 | 3300050508 | nmdc:mga09592_1640674_c1 | nmdc:mga09592_1640674_c1_166_441 | 91 |
| 213 | 3300050509 | nmdc:mga0qj67_246588_c1 | nmdc:mga0qj67_246588_c1_397_672 | 91 |
| 214 | 3300050509 | nmdc:mga0qj67_782607_c1 | nmdc:mga0qj67_782607_c1_144_419 | 91 |
| 215 | 3300050510 | nmdc:mga06r32_365009_c1 | nmdc:mga06r32_365009_c1_838_1113 | 91 |
| 216 | 3300050511 | nmdc:mga08y16_113752_c1 | nmdc:mga08y16_113752_c1_1882_2157 | 91 |
| 217 | 3300050512 | nmdc:mga0n895_24725_c1 | nmdc:mga0n895_24725_c1_374_649 | 91 |
| 218 | 3300050512 | nmdc:mga0n895_611445_c1 | nmdc:mga0n895_611445_c1_305_580 | 91 |
| 219 | 3300050513 | nmdc:mga0rr50_1174906_c1 | nmdc:mga0rr50_1174906_c1_116_391 | 91 |
| 220 | 3300050513 | nmdc:mga0rr50_8734_c2 | nmdc:mga0rr50_8734_c2_3237_3566 | 91 |
| 221 | 3300050514 | nmdc:mga08x19_23580_c1 | nmdc:mga08x19_23580_c1_1842_2171 | 91 |
| 222 | 3300050515 | nmdc:mga0a205_1197_c1 | nmdc:mga0a205_1197_c1_9767_10042 | 91 |
| 223 | 3300050515 | nmdc:mga0a205_591410_c1 | nmdc:mga0a205_591410_c1_213_488 | 91 |
| 224 | 3300050515 | nmdc:mga0a205_80717_c1 | nmdc:mga0a205_80717_c1_1019_1294 | 91 |
| 225 | 3300053123 | Ga0500614_245695 | Ga0500614_245695_152_430 | 91 |
| 226 | 3300060353 | Ga0501082_1218414 | Ga0501082_1218414_307_588 | 91 |
| 227 | 2209111006 | 2214753862 | 2213766834 | 92 |
| 228 | 3300000043 | ARcpr5yngRDRAFT_c025608 | ARcpr5yngRDRAFT_0256081 | 92 |
| 229 | 3300003373 | JGI25407J50210_10154818 | JGI25407J50210_101548182 | 92 |
| 230 | 3300003911 | JGI25405J52794_10001086 | JGI25405J52794_100010865 | 92 |
| 231 | 3300004803 | Ga0058862_12422882 | Ga0058862_124228822 | 92 |
| 232 | 3300005289 | Ga0065704_10079869 | Ga0065704_100798692 | 92 |
| 233 | 3300005289 | Ga0065704_10431775 | Ga0065704_104317752 | 92 |
| 234 | 3300005290 | Ga0065712_10068895 | Ga0065712_1006889510 | 92 |
| 235 | 3300005290 | Ga0065712_10218390 | Ga0065712_102183902 | 92 |
| 236 | 3300005293 | Ga0065715_10003569 | Ga0065715_100035696 | 92 |
| 237 | 3300005293 | Ga0065715_10007065 | Ga0065715_100070652 | 92 |
| 238 | 3300005295 | Ga0065707_10001176 | Ga0065707_100011761 | 92 |
| 239 | 3300005295 | Ga0065707_10107261 | Ga0065707_101072612 | 92 |
| 240 | 3300005295 | Ga0065707_10139404 | Ga0065707_101394042 | 92 |
| 241 | 3300005295 | Ga0065707_10264351 | Ga0065707_102643512 | 92 |
| 242 | 3300005295 | Ga0065707_10340060 | Ga0065707_103400602 | 92 |
| 243 | 3300005327 | Ga0070658_10024687 | Ga0070658_100246877 | 92 |
| 244 | 3300005328 | Ga0070676_10006899 | Ga0070676_100068994 | 92 |
| 245 | 3300005329 | Ga0070683_101028336 | Ga0070683_1010283362 | 92 |
| 246 | 3300005330 | Ga0070690_100098550 | Ga0070690_1000985502 | 92 |
| 247 | 3300005331 | Ga0070670_101631036 | Ga0070670_1016310361 | 92 |
| 248 | 3300005333 | Ga0070677_10647053 | Ga0070677_106470532 | 92 |
| 249 | 3300005334 | Ga0068869_100065762 | Ga0068869_1000657622 | 92 |
| 250 | 3300005335 | Ga0070666_10159846 | Ga0070666_101598462 | 92 |
| 251 | 3300005336 | Ga0070680_100071012 | Ga0070680_1000710126 | 92 |
| 252 | 3300005336 | Ga0070680_100949868 | Ga0070680_1009498682 | 92 |
| 253 | 3300005337 | Ga0070682_100528189 | Ga0070682_1005281892 | 92 |
| 254 | 3300005338 | Ga0068868_100939490 | Ga0068868_1009394902 | 92 |
| 255 | 3300005339 | Ga0070660_100471801 | Ga0070660_1004718012 | 92 |
| 256 | 3300005340 | Ga0070689_101102391 | Ga0070689_1011023912 | 92 |
| 257 | 3300005341 | Ga0070691_10003549 | Ga0070691_100035494 | 92 |
| 258 | 3300005343 | Ga0070687_100162251 | Ga0070687_1001622512 | 92 |
| 259 | 3300005344 | Ga0070661_100003230 | Ga0070661_1000032302 | 92 |
| 260 | 3300005344 | Ga0070661_101534050 | Ga0070661_1015340502 | 92 |
| 261 | 3300005345 | Ga0070692_10934193 | Ga0070692_109341932 | 92 |
| 262 | 3300005347 | Ga0070668_100084803 | Ga0070668_1000848034 | 92 |
| 263 | 3300005347 | Ga0070668_100176391 | Ga0070668_1001763912 | 92 |
| 264 | 3300005353 | Ga0070669_100832543 | Ga0070669_1008325432 | 92 |
| 265 | 3300005353 | Ga0070669_101285220 | Ga0070669_1012852201 | 92 |
| 266 | 3300005354 | Ga0070675_101063953 | Ga0070675_1010639532 | 92 |
| 267 | 3300005354 | Ga0070675_101540764 | Ga0070675_1015407641 | 92 |
| 268 | 3300005356 | Ga0070674_100983338 | Ga0070674_1009833382 | 92 |
| 269 | 3300005364 | Ga0070673_100578113 | Ga0070673_1005781132 | 92 |
| 270 | 3300005365 | Ga0070688_101275695 | Ga0070688_1012756951 | 92 |
| 271 | 3300005367 | Ga0070667_100061802 | Ga0070667_1000618025 | 92 |
| 272 | 3300005406 | Ga0070703_10113611 | Ga0070703_101136112 | 92 |
| 273 | 3300005434 | Ga0070709_10358089 | Ga0070709_103580892 | 92 |
| 274 | 3300005436 | Ga0070713_100666896 | Ga0070713_1006668961 | 92 |
| 275 | 3300005439 | Ga0070711_101508951 | Ga0070711_1015089511 | 92 |
| 276 | 3300005440 | Ga0070705_100125548 | Ga0070705_1001255482 | 92 |
| 277 | 3300005440 | Ga0070705_100975446 | Ga0070705_1009754461 | 92 |
| 278 | 3300005444 | Ga0070694_100007677 | Ga0070694_1000076774 | 92 |
| 279 | 3300005445 | Ga0070708_100045418 | Ga0070708_1000454183 | 92 |
| 280 | 3300005445 | Ga0070708_101576292 | Ga0070708_1015762922 | 92 |
| 281 | 3300005455 | Ga0070663_100966176 | Ga0070663_1009661761 | 92 |
| 282 | 3300005456 | Ga0070678_100860693 | Ga0070678_1008606932 | 92 |
| 283 | 3300005457 | Ga0070662_100136288 | Ga0070662_1001362882 | 92 |
| 284 | 3300005457 | Ga0070662_100217850 | Ga0070662_1002178502 | 92 |
| 285 | 3300005457 | Ga0070662_101637156 | Ga0070662_1016371561 | 92 |
| 286 | 3300005458 | Ga0070681_10001307 | Ga0070681_1000130723 | 92 |
| 287 | 3300005467 | Ga0070706_100060250 | Ga0070706_1000602506 | 92 |
| 288 | 3300005468 | Ga0070707_100251340 | Ga0070707_1002513402 | 92 |
| 289 | 3300005468 | Ga0070707_100401878 | Ga0070707_1004018782 | 92 |
| 290 | 3300005468 | Ga0070707_101874645 | Ga0070707_1018746452 | 92 |
| 291 | 3300005471 | Ga0070698_100071111 | Ga0070698_1000711116 | 92 |
| 292 | 3300005471 | Ga0070698_100346817 | Ga0070698_1003468171 | 92 |
| 293 | 3300005471 | Ga0070698_101762902 | Ga0070698_1017629021 | 92 |
| 294 | 3300005471 | Ga0070698_101960263 | Ga0070698_1019602631 | 92 |
| 295 | 3300005530 | Ga0070679_100007207 | Ga0070679_1000072072 | 92 |
| 296 | 3300005535 | Ga0070684_100160227 | Ga0070684_1001602271 | 92 |
| 297 | 3300005536 | Ga0070697_100157425 | Ga0070697_1001574254 | 92 |
| 298 | 3300005536 | Ga0070697_100279298 | Ga0070697_1002792982 | 92 |
| 299 | 3300005536 | Ga0070697_100562388 | Ga0070697_1005623882 | 92 |
| 300 | 3300005543 | Ga0070672_100042151 | Ga0070672_1000421512 | 92 |
| 301 | 3300005544 | Ga0070686_100016472 | Ga0070686_1000164727 | 92 |
| 302 | 3300005545 | Ga0070695_100048397 | Ga0070695_1000483972 | 92 |
| 303 | 3300005545 | Ga0070695_100156746 | Ga0070695_1001567462 | 92 |
| 304 | 3300005546 | Ga0070696_100008790 | Ga0070696_1000087903 | 92 |
| 305 | 3300005546 | Ga0070696_100049596 | Ga0070696_1000495962 | 92 |
| 306 | 3300005546 | Ga0070696_101765074 | Ga0070696_1017650742 | 92 |
| 307 | 3300005547 | Ga0070693_100042793 | Ga0070693_1000427934 | 92 |
| 308 | 3300005549 | Ga0070704_100559202 | Ga0070704_1005592022 | 92 |
| 309 | 3300005549 | Ga0070704_100713696 | Ga0070704_1007136962 | 92 |
| 310 | 3300005549 | Ga0070704_102023605 | Ga0070704_1020236051 | 92 |
| 311 | 3300005564 | Ga0070664_100006377 | Ga0070664_1000063775 | 92 |
| 312 | 3300005564 | Ga0070664_100163699 | Ga0070664_1001636992 | 92 |
| 313 | 3300005577 | Ga0068857_100037201 | Ga0068857_1000372013 | 92 |
| 314 | 3300005578 | Ga0068854_100447931 | Ga0068854_1004479312 | 92 |
| 315 | 3300005614 | Ga0068856_100019729 | Ga0068856_1000197293 | 92 |
| 316 | 3300005617 | Ga0068859_100553075 | Ga0068859_1005530752 | 92 |
| 317 | 3300005617 | Ga0068859_101686294 | Ga0068859_1016862942 | 92 |
| 318 | 3300005617 | Ga0068859_102973101 | Ga0068859_1029731012 | 92 |
| 319 | 3300005618 | Ga0068864_100216130 | Ga0068864_1002161302 | 92 |
| 320 | 3300005718 | Ga0068866_10054935 | Ga0068866_100549352 | 92 |
| 321 | 3300005719 | Ga0068861_100670450 | Ga0068861_1006704502 | 92 |
| 322 | 3300005840 | Ga0068870_10477936 | Ga0068870_104779361 | 92 |
| 323 | 3300005840 | Ga0068870_10711867 | Ga0068870_107118672 | 92 |
| 324 | 3300005841 | Ga0068863_100343623 | Ga0068863_1003436233 | 92 |
| 325 | 3300005842 | Ga0068858_101146667 | Ga0068858_1011466672 | 92 |
| 326 | 3300005937 | Ga0081455_10000223 | Ga0081455_1000022358 | 92 |
| 327 | 3300005981 | Ga0081538_10004812 | Ga0081538_100048124 | 92 |
| 328 | 3300005981 | Ga0081538_10046498 | Ga0081538_100464982 | 92 |
| 329 | 3300005981 | Ga0081538_10107300 | Ga0081538_101073002 | 92 |
| 330 | 3300005983 | Ga0081540_1176263 | Ga0081540_11762632 | 92 |
| 331 | 3300006028 | Ga0070717_11425243 | Ga0070717_114252431 | 92 |
| 332 | 3300006058 | Ga0075432_10077026 | Ga0075432_100770261 | 92 |
| 333 | 3300006163 | Ga0070715_10557010 | Ga0070715_105570102 | 92 |
| 334 | 3300006173 | Ga0070716_100106218 | Ga0070716_1001062182 | 92 |
| 335 | 3300006173 | Ga0070716_100114765 | Ga0070716_1001147652 | 92 |
| 336 | 3300006173 | Ga0070716_100115355 | Ga0070716_1001153552 | 92 |
| 337 | 3300006173 | Ga0070716_100807279 | Ga0070716_1008072792 | 92 |
| 338 | 3300006175 | Ga0070712_100433833 | Ga0070712_1004338332 | 92 |
| 339 | 3300006194 | Ga0075427_10006155 | Ga0075427_100061553 | 92 |
| 340 | 3300006237 | Ga0097621_100248783 | Ga0097621_1002487833 | 92 |
| 341 | 3300006358 | Ga0068871_100030902 | Ga0068871_1000309024 | 92 |
| 342 | 3300006844 | Ga0075428_100035445 | Ga0075428_1000354454 | 92 |
| 343 | 3300006844 | Ga0075428_100058926 | Ga0075428_1000589265 | 92 |
| 344 | 3300006844 | Ga0075428_100127230 | Ga0075428_1001272302 | 92 |
| 345 | 3300006844 | Ga0075428_100498440 | Ga0075428_1004984402 | 92 |
| 346 | 3300006844 | Ga0075428_100824216 | Ga0075428_1008242162 | 92 |
| 347 | 3300006844 | Ga0075428_101564951 | Ga0075428_1015649512 | 92 |
| 348 | 3300006846 | Ga0075430_100056524 | Ga0075430_1000565243 | 92 |
| 349 | 3300006846 | Ga0075430_100058839 | Ga0075430_1000588395 | 92 |
| 350 | 3300006846 | Ga0075430_100111961 | Ga0075430_1001119612 | 92 |
| 351 | 3300006846 | Ga0075430_100332148 | Ga0075430_1003321482 | 92 |
| 352 | 3300006846 | Ga0075430_100516308 | Ga0075430_1005163082 | 92 |
| 353 | 3300006847 | Ga0075431_100021111 | Ga0075431_1000211114 | 92 |
| 354 | 3300006847 | Ga0075431_100046181 | Ga0075431_1000461814 | 92 |
| 355 | 3300006847 | Ga0075431_100102716 | Ga0075431_1001027164 | 92 |
| 356 | 3300006847 | Ga0075431_100118579 | Ga0075431_1001185793 | 92 |
| 357 | 3300006847 | Ga0075431_101072477 | Ga0075431_1010724772 | 92 |
| 358 | 3300006847 | Ga0075431_101272885 | Ga0075431_1012728851 | 92 |
| 359 | 3300006852 | Ga0075433_10005393 | Ga0075433_100053935 | 92 |
| 360 | 3300006852 | Ga0075433_10066778 | Ga0075433_100667784 | 92 |
| 361 | 3300006852 | Ga0075433_10339588 | Ga0075433_103395882 | 92 |
| 362 | 3300006852 | Ga0075433_10344405 | Ga0075433_103444052 | 92 |
| 363 | 3300006852 | Ga0075433_10650776 | Ga0075433_106507762 | 92 |
| 364 | 3300006852 | Ga0075433_10986088 | Ga0075433_109860882 | 92 |
| 365 | 3300006871 | Ga0075434_100005178 | Ga0075434_1000051786 | 92 |
| 366 | 3300006871 | Ga0075434_100110008 | Ga0075434_1001100082 | 92 |
| 367 | 3300006871 | Ga0075434_100312167 | Ga0075434_1003121672 | 92 |
| 368 | 3300006871 | Ga0075434_100360861 | Ga0075434_1003608612 | 92 |
| 369 | 3300006871 | Ga0075434_100415459 | Ga0075434_1004154592 | 92 |
| 370 | 3300006871 | Ga0075434_100741250 | Ga0075434_1007412502 | 92 |
| 371 | 3300006871 | Ga0075434_101122572 | Ga0075434_1011225722 | 92 |
| 372 | 3300006880 | Ga0075429_100036332 | Ga0075429_1000363322 | 92 |
| 373 | 3300006880 | Ga0075429_100303923 | Ga0075429_1003039232 | 92 |
| 374 | 3300006880 | Ga0075429_100772052 | Ga0075429_1007720521 | 92 |
| 375 | 3300006881 | Ga0068865_100561325 | Ga0068865_1005613252 | 92 |
| 376 | 3300006881 | Ga0068865_101093992 | Ga0068865_1010939922 | 92 |
| 377 | 3300006914 | Ga0075436_100041107 | Ga0075436_1000411072 | 92 |
| 378 | 3300006914 | Ga0075436_100149506 | Ga0075436_1001495062 | 92 |
| 379 | 3300006914 | Ga0075436_100453473 | Ga0075436_1004534732 | 92 |
| 380 | 3300006914 | Ga0075436_100547589 | Ga0075436_1005475892 | 92 |
| 381 | 3300006914 | Ga0075436_100644735 | Ga0075436_1006447352 | 92 |
| 382 | 3300006931 | Ga0097620_100553081 | Ga0097620_1005530812 | 92 |
| 383 | 3300006931 | Ga0097620_101686114 | Ga0097620_1016861142 | 92 |
| 384 | 3300006931 | Ga0097620_102971720 | Ga0097620_1029717202 | 92 |
| 385 | 3300007076 | Ga0075435_100010907 | Ga0075435_1000109077 | 92 |
| 386 | 3300007076 | Ga0075435_100034480 | Ga0075435_1000344802 | 92 |
| 387 | 3300007076 | Ga0075435_100091020 | Ga0075435_1000910205 | 92 |
| 388 | 3300007076 | Ga0075435_101070694 | Ga0075435_1010706941 | 92 |
| 389 | 3300009093 | Ga0105240_10344208 | Ga0105240_103442082 | 92 |
| 390 | 3300009093 | Ga0105240_11763762 | Ga0105240_117637622 | 92 |
| 391 | 3300009094 | Ga0111539_10018416 | Ga0111539_100184164 | 92 |
| 392 | 3300009094 | Ga0111539_10130618 | Ga0111539_101306183 | 92 |
| 393 | 3300009094 | Ga0111539_10419206 | Ga0111539_104192062 | 92 |
| 394 | 3300009098 | Ga0105245_10241543 | Ga0105245_102415433 | 92 |
| 395 | 3300009147 | Ga0114129_10007068 | Ga0114129_100070683 | 92 |
| 396 | 3300009147 | Ga0114129_10009779 | Ga0114129_100097793 | 92 |
| 397 | 3300009147 | Ga0114129_10067938 | Ga0114129_100679384 | 92 |
| 398 | 3300009147 | Ga0114129_10141733 | Ga0114129_101417335 | 92 |
| 399 | 3300009147 | Ga0114129_10155601 | Ga0114129_101556012 | 92 |
| 400 | 3300009147 | Ga0114129_10253892 | Ga0114129_102538922 | 92 |
| 401 | 3300009147 | Ga0114129_10261868 | Ga0114129_102618683 | 92 |
| 402 | 3300009148 | Ga0105243_10362271 | Ga0105243_103622712 | 92 |
| 403 | 3300009174 | Ga0105241_10023686 | Ga0105241_100236862 | 92 |
| 404 | 3300009176 | Ga0105242_10023246 | Ga0105242_100232469 | 92 |
| 405 | 3300009176 | Ga0105242_10082027 | Ga0105242_100820272 | 92 |
| 406 | 3300009545 | Ga0105237_10268052 | Ga0105237_102680522 | 92 |
| 407 | 3300009553 | Ga0105249_10668698 | Ga0105249_106686982 | 92 |
| 408 | 3300009553 | Ga0105249_11229734 | Ga0105249_112297342 | 92 |
| 409 | 3300011119 | Ga0105246_10007585 | Ga0105246_100075852 | 92 |
| 410 | 3300012497 | Ga0157319_1012023 | Ga0157319_10120232 | 92 |
| 411 | 3300012500 | Ga0157314_1008434 | Ga0157314_10084342 | 92 |
| 412 | 3300012506 | Ga0157324_1009637 | Ga0157324_10096372 | 92 |
| 413 | 3300012510 | Ga0157316_1022501 | Ga0157316_10225011 | 92 |
| 414 | 3300013100 | Ga0157373_10131015 | Ga0157373_101310153 | 92 |
| 415 | 3300013102 | Ga0157371_10011208 | Ga0157371_100112087 | 92 |
| 416 | 3300013296 | Ga0157374_11512624 | Ga0157374_115126241 | 92 |
| 417 | 3300013297 | Ga0157378_10048977 | Ga0157378_100489777 | 92 |
| 418 | 3300013297 | Ga0157378_12483680 | Ga0157378_124836801 | 92 |
| 419 | 3300013306 | Ga0163162_10013962 | Ga0163162_100139622 | 92 |
| 420 | 3300013306 | Ga0163162_10174841 | Ga0163162_101748412 | 92 |
| 421 | 3300013307 | Ga0157372_10090284 | Ga0157372_100902846 | 92 |
| 422 | 3300014325 | Ga0163163_10178538 | Ga0163163_101785382 | 92 |
| 423 | 3300014326 | Ga0157380_10326792 | Ga0157380_103267922 | 92 |
| 424 | 3300014326 | Ga0157380_11378432 | Ga0157380_113784321 | 92 |
| 425 | 3300014968 | Ga0157379_10062159 | Ga0157379_100621592 | 92 |
| 426 | 3300014969 | Ga0157376_10185167 | Ga0157376_101851673 | 92 |
| 427 | 3300015261 | Ga0182006_1108679 | Ga0182006_11086792 | 92 |
| 428 | 3300015262 | Ga0182007_10074613 | Ga0182007_100746132 | 92 |
| 429 | 3300017792 | Ga0163161_10750676 | Ga0163161_107506762 | 92 |
| 430 | 3300020069 | Ga0197907_10944092 | Ga0197907_109440922 | 92 |
| 431 | 3300020076 | Ga0206355_1129667 | Ga0206355_11296671 | 92 |
| 432 | 3300020080 | Ga0206350_11056752 | Ga0206350_110567522 | 92 |
| 433 | 3300020080 | Ga0206350_11297399 | Ga0206350_112973992 | 92 |
| 434 | 3300022467 | Ga0224712_10271339 | Ga0224712_102713392 | 92 |
| 435 | 3300022467 | Ga0224712_10286009 | Ga0224712_102860091 | 92 |
| 436 | 3300025271 | Ga0207666_1021083 | Ga0207666_10210832 | 92 |
| 437 | 3300025315 | Ga0207697_10047695 | Ga0207697_100476954 | 92 |
| 438 | 3300025901 | Ga0207688_10047865 | Ga0207688_100478652 | 92 |
| 439 | 3300025904 | Ga0207647_10309254 | Ga0207647_103092542 | 92 |
| 440 | 3300025907 | Ga0207645_10000465 | Ga0207645_1000046528 | 92 |
| 441 | 3300025908 | Ga0207643_10211056 | Ga0207643_102110562 | 92 |
| 442 | 3300025909 | Ga0207705_10107232 | Ga0207705_101072322 | 92 |
| 443 | 3300025911 | Ga0207654_10300342 | Ga0207654_103003422 | 92 |
| 444 | 3300025912 | Ga0207707_10030527 | Ga0207707_100305276 | 92 |
| 445 | 3300025913 | Ga0207695_10491490 | Ga0207695_104914901 | 92 |
| 446 | 3300025915 | Ga0207693_10174017 | Ga0207693_101740172 | 92 |
| 447 | 3300025917 | Ga0207660_10497105 | Ga0207660_104971052 | 92 |
| 448 | 3300025917 | Ga0207660_10506524 | Ga0207660_105065242 | 92 |
| 449 | 3300025918 | Ga0207662_10183460 | Ga0207662_101834602 | 92 |
| 450 | 3300025919 | Ga0207657_10012781 | Ga0207657_100127818 | 92 |
| 451 | 3300025920 | Ga0207649_10681461 | Ga0207649_106814612 | 92 |
| 452 | 3300025921 | Ga0207652_10173731 | Ga0207652_101737312 | 92 |
| 453 | 3300025922 | Ga0207646_10036121 | Ga0207646_100361212 | 92 |
| 454 | 3300025922 | Ga0207646_10378907 | Ga0207646_103789072 | 92 |
| 455 | 3300025923 | Ga0207681_10620692 | Ga0207681_106206922 | 92 |
| 456 | 3300025923 | Ga0207681_10645160 | Ga0207681_106451602 | 92 |
| 457 | 3300025925 | Ga0207650_10317075 | Ga0207650_103170752 | 92 |
| 458 | 3300025926 | Ga0207659_10021423 | Ga0207659_100214237 | 92 |
| 459 | 3300025927 | Ga0207687_11746698 | Ga0207687_117466982 | 92 |
| 460 | 3300025931 | Ga0207644_10169451 | Ga0207644_101694512 | 92 |
| 461 | 3300025932 | Ga0207690_10422089 | Ga0207690_104220892 | 92 |
| 462 | 3300025932 | Ga0207690_11145291 | Ga0207690_111452912 | 92 |
| 463 | 3300025933 | Ga0207706_10007890 | Ga0207706_100078907 | 92 |
| 464 | 3300025934 | Ga0207686_10132402 | Ga0207686_101324022 | 92 |
| 465 | 3300025936 | Ga0207670_10015115 | Ga0207670_100151152 | 92 |
| 466 | 3300025936 | Ga0207670_10182196 | Ga0207670_101821962 | 92 |
| 467 | 3300025937 | Ga0207669_10028665 | Ga0207669_100286652 | 92 |
| 468 | 3300025938 | Ga0207704_10778113 | Ga0207704_107781132 | 92 |
| 469 | 3300025939 | Ga0207665_10196172 | Ga0207665_101961722 | 92 |
| 470 | 3300025939 | Ga0207665_10233379 | Ga0207665_102333792 | 92 |
| 471 | 3300025939 | Ga0207665_10248950 | Ga0207665_102489502 | 92 |
| 472 | 3300025940 | Ga0207691_10005743 | Ga0207691_100057435 | 92 |
| 473 | 3300025942 | Ga0207689_10028906 | Ga0207689_100289062 | 92 |
| 474 | 3300025944 | Ga0207661_11349896 | Ga0207661_113498962 | 92 |
| 475 | 3300025945 | Ga0207679_10303920 | Ga0207679_103039202 | 92 |
| 476 | 3300025960 | Ga0207651_10258509 | Ga0207651_102585092 | 92 |
| 477 | 3300025961 | Ga0207712_11291703 | Ga0207712_112917031 | 92 |
| 478 | 3300025972 | Ga0207668_10116801 | Ga0207668_101168012 | 92 |
| 479 | 3300025981 | Ga0207640_10243392 | Ga0207640_102433922 | 92 |
| 480 | 3300025986 | Ga0207658_10102992 | Ga0207658_101029924 | 92 |
| 481 | 3300026023 | Ga0207677_10852842 | Ga0207677_108528422 | 92 |
| 482 | 3300026035 | Ga0207703_10149979 | Ga0207703_101499792 | 92 |
| 483 | 3300026041 | Ga0207639_11211674 | Ga0207639_112116742 | 92 |
| 484 | 3300026067 | Ga0207678_10187347 | Ga0207678_101873472 | 92 |
| 485 | 3300026078 | Ga0207702_11570938 | Ga0207702_115709382 | 92 |
| 486 | 3300026088 | Ga0207641_10266556 | Ga0207641_102665562 | 92 |
| 487 | 3300026089 | Ga0207648_10015387 | Ga0207648_100153875 | 92 |
| 488 | 3300026116 | Ga0207674_10062280 | Ga0207674_100622802 | 92 |
| 489 | 3300026116 | Ga0207674_10093403 | Ga0207674_100934032 | 92 |
| 490 | 3300026118 | Ga0207675_100365763 | Ga0207675_1003657632 | 92 |
| 491 | 3300026121 | Ga0207683_10001178 | Ga0207683_1000117821 | 92 |
| 492 | 3300027360 | Ga0209969_1071640 | Ga0209969_10716402 | 92 |
| 493 | 3300027424 | Ga0209984_1005624 | Ga0209984_10056242 | 92 |
| 494 | 3300027526 | Ga0209968_1013318 | Ga0209968_10133181 | 92 |
| 495 | 3300027552 | Ga0209982_1010436 | Ga0209982_10104361 | 92 |
| 496 | 3300027614 | Ga0209970_1006749 | Ga0209970_10067491 | 92 |
| 497 | 3300027617 | Ga0210002_1006859 | Ga0210002_10068592 | 92 |
| 498 | 3300027682 | Ga0209971_1023839 | Ga0209971_10238392 | 92 |
| 499 | 3300027682 | Ga0209971_1039155 | Ga0209971_10391552 | 92 |
| 500 | 3300027717 | Ga0209998_10011102 | Ga0209998_100111023 | 92 |
| 501 | 3300027876 | Ga0209974_10054370 | Ga0209974_100543701 | 92 |
| 502 | 3300027876 | Ga0209974_10193602 | Ga0209974_101936022 | 92 |
| 503 | 3300027876 | Ga0209974_10207156 | Ga0209974_102071562 | 92 |
| 504 | 3300027907 | Ga0207428_10011568 | Ga0207428_100115683 | 92 |
| 505 | 3300027907 | Ga0207428_10143986 | Ga0207428_101439862 | 92 |
| 506 | 3300027907 | Ga0207428_11238066 | Ga0207428_112380662 | 92 |
| 507 | 3300028379 | Ga0268266_10062867 | Ga0268266_100628675 | 92 |
| 508 | 3300028380 | Ga0268265_11027186 | Ga0268265_110271862 | 92 |
| 509 | 3300028381 | Ga0268264_10106498 | Ga0268264_101064984 | 92 |
| 510 | 3300031548 | Ga0307408_100134193 | Ga0307408_1001341932 | 92 |
| 511 | 3300031548 | Ga0307408_100137852 | Ga0307408_1001378522 | 92 |
| 512 | 3300031548 | Ga0307408_100463945 | Ga0307408_1004639452 | 92 |
| 513 | 3300031548 | Ga0307408_100666189 | Ga0307408_1006661893 | 92 |
| 514 | 3300031731 | Ga0307405_10037651 | Ga0307405_100376512 | 92 |
| 515 | 3300031731 | Ga0307405_10067889 | Ga0307405_100678893 | 92 |
| 516 | 3300031731 | Ga0307405_10177362 | Ga0307405_101773622 | 92 |
| 517 | 3300031824 | Ga0307413_10095602 | Ga0307413_100956022 | 92 |
| 518 | 3300031824 | Ga0307413_10117210 | Ga0307413_101172103 | 92 |
| 519 | 3300031901 | Ga0307406_10092885 | Ga0307406_100928852 | 92 |
| 520 | 3300031903 | Ga0307407_10234502 | Ga0307407_102345022 | 92 |
| 521 | 3300031911 | Ga0307412_10151209 | Ga0307412_101512092 | 92 |
| 522 | 3300031911 | Ga0307412_10159134 | Ga0307412_101591342 | 92 |
| 523 | 3300031911 | Ga0307412_10189641 | Ga0307412_101896412 | 92 |
| 524 | 3300031911 | Ga0307412_10800421 | Ga0307412_108004212 | 92 |
| 525 | 3300031995 | Ga0307409_100288170 | Ga0307409_1002881702 | 92 |
| 526 | 3300031995 | Ga0307409_100690940 | Ga0307409_1006909402 | 92 |
| 527 | 3300031995 | Ga0307409_101037167 | Ga0307409_1010371672 | 92 |
| 528 | 3300032002 | Ga0307416_100009283 | Ga0307416_1000092835 | 92 |
| 529 | 3300032002 | Ga0307416_100033248 | Ga0307416_1000332481 | 92 |
| 530 | 3300032002 | Ga0307416_100699935 | Ga0307416_1006999351 | 92 |
| 531 | 3300032005 | Ga0307411_10007627 | Ga0307411_100076273 | 92 |
| 532 | 3300032005 | Ga0307411_10049595 | Ga0307411_100495952 | 92 |
| 533 | 3300032005 | Ga0307411_10383243 | Ga0307411_103832432 | 92 |
| 534 | 3300032126 | Ga0307415_100058195 | Ga0307415_1000581951 | 92 |
| 535 | 3300034957 | Ga0373938_0080501 | Ga0373938_0080501_249_527 | 92 |
| 536 | 3300035083 | Ga0373926_0066467 | Ga0373926_0066467_273_551 | 92 |
| 537 | 3300035084 | Ga0373928_0108399 | Ga0373928_0108399_220_498 | 92 |
| 538 | 3300035085 | Ga0373929_0171620 | Ga0373929_0171620_150_428 | 92 |
| 539 | 3300035091 | Ga0373951_0033190 | Ga0373951_0033190_167_445 | 92 |
| 540 | 3300035112 | Ga0373932_0027302 | Ga0373932_0027302_816_1094 | 92 |
| 541 | 3300035113 | Ga0373936_0056982 | Ga0373936_0056982_1070_1348 | 92 |
| 542 | 3300035114 | Ga0373939_0043450 | Ga0373939_0043450_283_561 | 92 |
| 543 | 3300035115 | Ga0373941_0243667 | Ga0373941_0243667_315_599 | 92 |
| 544 | 3300035121 | Ga0373960_0072323 | Ga0373960_0072323_284_568 | 92 |
| 545 | 3300035121 | Ga0373960_0208288 | Ga0373960_0208288_158_436 | 92 |
| 546 | 3300035170 | Ga0373943_0318452 | Ga0373943_0318452_255_533 | 92 |
| 547 | 3300035171 | Ga0373946_0041878 | Ga0373946_0041878_1569_1847 | 92 |
| 548 | 3300035241 | Ga0373961_0092809 | Ga0373961_0092809_28_306 | 92 |
| 549 | 3300035691 | Ga0373931_0006970 | Ga0373931_0006970_2425_2703 | 92 |
| 550 | 3300035691 | Ga0373931_0936784 | Ga0373931_0936784_195_473 | 92 |
| 551 | 3300035692 | Ga0373935_0027230 | Ga0373935_0027230_2917_3195 | 92 |
| 552 | 3300035695 | Ga0373927_0966378 | Ga0373927_0966378_208_486 | 92 |
| 553 | 3300035725 | Ga0373947_0008839 | Ga0373947_0008839_3474_3752 | 92 |
| 554 | 3300036401 | Ga0373937_0089288 | Ga0373937_0089288_1249_1527 | 92 |
| 555 | 3300037068 | Ga0373925_0058114 | Ga0373925_0058114_1213_1491 | 92 |
| 556 | 3300039438 | Ga0436360_0877177 | Ga0436360_0877177_723_1004 | 92 |
| 557 | 3300039438 | Ga0436360_0877644 | Ga0436360_0877644_800_1084 | 92 |
| 558 | 3300039453 | Ga0436362_0002027 | Ga0436362_0002027_74_355 | 92 |
| 559 | 3300042435 | Ga0439434_0241065 | Ga0439434_0241065_70_354 | 92 |
| 560 | 3300042876 | Ga0451577_0170115 | Ga0451577_0170115_630_914 | 92 |
| 561 | 3300042876 | Ga0451577_1288509 | Ga0451577_1288509_28_312 | 92 |
| 562 | 3300044673 | Ga0453683_0001749 | Ga0453683_0001749_2770_3048 | 92 |
| 563 | 3300044712 | Ga0453684_0335194 | Ga0453684_0335194_694_978 | 92 |
| 564 | 3300044712 | Ga0453684_1485134 | Ga0453684_1485134_27_305 | 92 |
| 565 | 3300045051 | Ga0451576_0733259 | Ga0451576_0733259_648_926 | 92 |
| 566 | 3300045051 | Ga0451576_1262493 | Ga0451576_1262493_166_450 | 92 |
| 567 | 3300045051 | Ga0451576_1356746 | Ga0451576_1356746_383_667 | 92 |
| 568 | 3300046455 | Ga0495603_0474137 | Ga0495603_0474137_98_376 | 92 |
| 569 | 3300046499 | Ga0495594_0321687 | Ga0495594_0321687_395_673 | 92 |
| 570 | 3300046535 | Ga0495586_0518800 | Ga0495586_0518800_245_523 | 92 |
| 571 | 3300046615 | Ga0495656_0128634 | Ga0495656_0128634_913_1191 | 92 |
| 572 | 3300047318 | Ga0495636_0433434 | Ga0495636_0433434_251_529 | 92 |
| 573 | 3300048903 | Ga0496100_0432184 | Ga0496100_0432184_171_455 | 92 |
| 574 | 3300048903 | Ga0496100_1636133 | Ga0496100_1636133_204_488 | 92 |
| 575 | 3300048904 | Ga0496101_1474142 | Ga0496101_1474142_168_452 | 92 |
| 576 | 3300048907 | Ga0496104_0271666 | Ga0496104_0271666_555_839 | 92 |
| 577 | 3300048909 | Ga0496106_0225540 | Ga0496106_0225540_645_929 | 92 |
| 578 | 3300048909 | Ga0496106_0413715 | Ga0496106_0413715_622_906 | 92 |
| 579 | 3300048909 | Ga0496106_1342095 | Ga0496106_1342095_95_373 | 92 |
| 580 | 3300048911 | Ga0496108_0525516 | Ga0496108_0525516_695_979 | 92 |
| 581 | 3300048911 | Ga0496108_1366261 | Ga0496108_1366261_162_446 | 92 |
| 582 | 3300048912 | Ga0496109_0461759 | Ga0496109_0461759_843_1127 | 92 |
| 583 | 3300048912 | Ga0496109_1472466 | Ga0496109_1472466_76_360 | 92 |
| 584 | 3300048915 | Ga0496112_0049540 | Ga0496112_0049540_1776_2060 | 92 |
| 585 | 3300048915 | Ga0496112_0051030 | Ga0496112_0051030_841_1125 | 92 |
| 586 | 3300048915 | Ga0496112_0318135 | Ga0496112_0318135_132_410 | 92 |
| 587 | 3300049514 | Ga0501291_028932 | Ga0501291_028932_408_686 | 92 |
| 588 | 3300049522 | Ga0501299_005995 | Ga0501299_005995_70_354 | 92 |
| 589 | 3300049568 | Ga0501031_0013574 | Ga0501031_0013574_1335_1613 | 92 |
| 590 | 3300049569 | Ga0501032_0024186 | Ga0501032_0024186_1042_1320 | 92 |
| 591 | 3300049570 | Ga0501033_0009833 | Ga0501033_0009833_4028_4306 | 92 |
| 592 | 3300049570 | Ga0501033_0240626 | Ga0501033_0240626_919_1197 | 92 |
| 593 | 3300049572 | Ga0501036_0038284 | Ga0501036_0038284_1659_1937 | 92 |
| 594 | 3300049573 | Ga0501037_0021400 | Ga0501037_0021400_1849_2127 | 92 |
| 595 | 3300049573 | Ga0501037_0054232 | Ga0501037_0054232_1152_1430 | 92 |
| 596 | 3300049574 | Ga0501038_0001813 | Ga0501038_0001813_979_1257 | 92 |
| 597 | 3300049574 | Ga0501038_0045039 | Ga0501038_0045039_1987_2265 | 92 |
| 598 | 3300049574 | Ga0501038_1033922 | Ga0501038_1033922_90_425 | 92 |
| 599 | 3300049574 | Ga0501038_1064419 | Ga0501038_1064419_133_435 | 92 |
| 600 | 3300049575 | Ga0501039_0019556 | Ga0501039_0019556_3748_4026 | 92 |
| 601 | 3300049575 | Ga0501039_0799232 | Ga0501039_0799232_280_558 | 92 |
| 602 | 3300049576 | Ga0501040_0001107 | Ga0501040_0001107_114_392 | 92 |
| 603 | 3300049576 | Ga0501040_0035780 | Ga0501040_0035780_1097_1375 | 92 |
| 604 | 3300049576 | Ga0501040_0086621 | Ga0501040_0086621_1702_1980 | 92 |
| 605 | 3300049576 | Ga0501040_0555968 | Ga0501040_0555968_181_459 | 92 |
| 606 | 3300049577 | Ga0501041_0000320 | Ga0501041_0000320_22016_22294 | 92 |
| 607 | 3300049577 | Ga0501041_0183091 | Ga0501041_0183091_116_394 | 92 |
| 608 | 3300049577 | Ga0501041_0456003 | Ga0501041_0456003_44_322 | 92 |
| 609 | 3300049578 | Ga0501042_0000344 | Ga0501042_0000344_21904_22182 | 92 |
| 610 | 3300049578 | Ga0501042_0009875 | Ga0501042_0009875_3863_4141 | 92 |
| 611 | 3300049578 | Ga0501042_0780792 | Ga0501042_0780792_113_391 | 92 |
| 612 | 3300049579 | Ga0501043_0031052 | Ga0501043_0031052_2136_2414 | 92 |
| 613 | 3300049579 | Ga0501043_0118310 | Ga0501043_0118310_634_912 | 92 |
| 614 | 3300049580 | Ga0501046_0011617 | Ga0501046_0011617_6779_7057 | 92 |
| 615 | 3300049580 | Ga0501046_0064845 | Ga0501046_0064845_487_765 | 92 |
| 616 | 3300049582 | Ga0501048_0010622 | Ga0501048_0010622_1167_1445 | 92 |
| 617 | 3300049582 | Ga0501048_0025633 | Ga0501048_0025633_2152_2430 | 92 |
| 618 | 3300049583 | Ga0501067_0300391 | Ga0501067_0300391_348_632 | 92 |
| 619 | 3300049584 | Ga0501068_0014603 | Ga0501068_0014603_2651_2929 | 92 |
| 620 | 3300049584 | Ga0501068_0151187 | Ga0501068_0151187_1124_1402 | 92 |
| 621 | 3300049584 | Ga0501068_1072108 | Ga0501068_1072108_142_420 | 92 |
| 622 | 3300049585 | Ga0501069_0040331 | Ga0501069_0040331_598_876 | 92 |
| 623 | 3300049586 | Ga0501070_0035091 | Ga0501070_0035091_3829_4107 | 92 |
| 624 | 3300049586 | Ga0501070_0238992 | Ga0501070_0238992_987_1265 | 92 |
| 625 | 3300049587 | Ga0501071_0000317 | Ga0501071_0000317_21884_22162 | 92 |
| 626 | 3300049587 | Ga0501071_0016918 | Ga0501071_0016918_1280_1558 | 92 |
| 627 | 3300049587 | Ga0501071_0616952 | Ga0501071_0616952_538_816 | 92 |
| 628 | 3300049587 | Ga0501071_1587343 | Ga0501071_1587343_207_485 | 92 |
| 629 | 3300049588 | Ga0501072_0000574 | Ga0501072_0000574_485_763 | 92 |
| 630 | 3300049588 | Ga0501072_0093569 | Ga0501072_0093569_116_394 | 92 |
| 631 | 3300049588 | Ga0501072_0674699 | Ga0501072_0674699_293_580 | 92 |
| 632 | 3300049588 | Ga0501072_0879871 | Ga0501072_0879871_87_365 | 92 |
| 633 | 3300049588 | Ga0501072_1565193 | Ga0501072_1565193_70_348 | 92 |
| 634 | 3300049589 | Ga0501073_0027625 | Ga0501073_0027625_1594_1872 | 92 |
| 635 | 3300049589 | Ga0501073_0332637 | Ga0501073_0332637_568_846 | 92 |
| 636 | 3300049590 | Ga0501074_0011344 | Ga0501074_0011344_5061_5339 | 92 |
| 637 | 3300049590 | Ga0501074_0025112 | Ga0501074_0025112_2264_2542 | 92 |
| 638 | 3300049591 | Ga0501075_0000513 | Ga0501075_0000513_21929_22207 | 92 |
| 639 | 3300049591 | Ga0501075_0003362 | Ga0501075_0003362_10344_10622 | 92 |
| 640 | 3300049591 | Ga0501075_0029414 | Ga0501075_0029414_3028_3306 | 92 |
| 641 | 3300049592 | Ga0501076_0000576 | Ga0501076_0000576_1144_1422 | 92 |
| 642 | 3300049592 | Ga0501076_0018169 | Ga0501076_0018169_2050_2328 | 92 |
| 643 | 3300049592 | Ga0501076_0057457 | Ga0501076_0057457_2731_3009 | 92 |
| 644 | 3300049592 | Ga0501076_0150536 | Ga0501076_0150536_40_318 | 92 |
| 645 | 3300049592 | Ga0501076_1325411 | Ga0501076_1325411_43_321 | 92 |
| 646 | 3300049593 | Ga0501077_0000903 | Ga0501077_0000903_16428_16706 | 92 |
| 647 | 3300049593 | Ga0501077_0011889 | Ga0501077_0011889_1365_1667 | 92 |
| 648 | 3300049593 | Ga0501077_0049479 | Ga0501077_0049479_1907_2185 | 92 |
| 649 | 3300049593 | Ga0501077_0130191 | Ga0501077_0130191_147_431 | 92 |
| 650 | 3300049593 | Ga0501077_0516985 | Ga0501077_0516985_22_303 | 92 |
| 651 | 3300049652 | Ga0501202_205994 | Ga0501202_205994_216_494 | 92 |
| 652 | 3300049665 | Ga0501227_014250 | Ga0501227_014250_181_465 | 92 |
| 653 | 3300049668 | Ga0501233_045132 | Ga0501233_045132_595_879 | 92 |
| 654 | 3300049669 | Ga0501235_139947 | Ga0501235_139947_172_456 | 92 |
| 655 | 3300049670 | Ga0501236_089943 | Ga0501236_089943_216_494 | 92 |
| 656 | 3300049677 | Ga0501247_024087 | Ga0501247_024087_234_518 | 92 |
| 657 | 3300049681 | Ga0501251_037960 | Ga0501251_037960_192_476 | 92 |
| 658 | 3300049705 | Ga0501225_0007472 | Ga0501225_0007472_2608_2892 | 92 |
| 659 | 3300049705 | Ga0501225_0123939 | Ga0501225_0123939_133_411 | 92 |
| 660 | 3300049741 | Ga0501079_0001501 | Ga0501079_0001501_1148_1426 | 92 |
| 661 | 3300049741 | Ga0501079_0038808 | Ga0501079_0038808_2758_3036 | 92 |
| 662 | 3300049742 | Ga0501080_0006567 | Ga0501080_0006567_9178_9456 | 92 |
| 663 | 3300049742 | Ga0501080_0147844 | Ga0501080_0147844_27_305 | 92 |
| 664 | 3300049743 | Ga0501081_0000423 | Ga0501081_0000423_1138_1416 | 92 |
| 665 | 3300049743 | Ga0501081_0060086 | Ga0501081_0060086_1868_2146 | 92 |
| 666 | 3300049743 | Ga0501081_0283569 | Ga0501081_0283569_575_853 | 92 |
| 667 | 3300049743 | Ga0501081_0514814 | Ga0501081_0514814_460_795 | 92 |
| 668 | 3300049743 | Ga0501081_0807135 | Ga0501081_0807135_351_629 | 92 |
| 669 | 3300049743 | Ga0501081_1344711 | Ga0501081_1344711_249_527 | 92 |
| 670 | 3300049744 | Ga0501083_0005809 | Ga0501083_0005809_4367_4645 | 92 |
| 671 | 3300049744 | Ga0501083_0101659 | Ga0501083_0101659_1156_1434 | 92 |
| 672 | 3300049763 | Ga0501266_027167 | Ga0501266_027167_133_417 | 92 |
| 673 | 3300049765 | Ga0501268_015591 | Ga0501268_015591_237_521 | 92 |
| 674 | 3300049822 | Ga0501035_0102964 | Ga0501035_0102964_487_765 | 92 |
| 675 | 3300049822 | Ga0501035_0110675 | Ga0501035_0110675_1852_2130 | 92 |
| 676 | 3300049823 | Ga0501044_0076398 | Ga0501044_0076398_1553_1831 | 92 |
| 677 | 3300049824 | Ga0501045_0002513 | Ga0501045_0002513_795_1073 | 92 |
| 678 | 3300049824 | Ga0501045_0523138 | Ga0501045_0523138_116_394 | 92 |
| 679 | 3300049824 | Ga0501045_0869778 | Ga0501045_0869778_47_331 | 92 |
| 680 | 3300049824 | Ga0501045_1065524 | Ga0501045_1065524_114_395 | 92 |
| 681 | 3300049851 | Ga0501212_007428 | Ga0501212_007428_515_799 | 92 |
| 682 | 3300050507 | nmdc:mga05p37_105262_c1 | nmdc:mga05p37_105262_c1_1161_1439 | 92 |
| 683 | 3300050507 | nmdc:mga05p37_111264_c1 | nmdc:mga05p37_111264_c1_189_467 | 92 |
| 684 | 3300050507 | nmdc:mga05p37_35482_c1 | nmdc:mga05p37_35482_c1_446_724 | 92 |
| 685 | 3300050507 | nmdc:mga05p37_54814_c1 | nmdc:mga05p37_54814_c1_1923_2201 | 92 |
| 686 | 3300050507 | nmdc:mga05p37_5586_c1 | nmdc:mga05p37_5586_c1_14087_14365 | 92 |
| 687 | 3300050507 | nmdc:mga05p37_731933_c1 | nmdc:mga05p37_731933_c1_131_409 | 92 |
| 688 | 3300050507 | nmdc:mga05p37_86276_c1 | nmdc:mga05p37_86276_c1_2823_3101 | 92 |
| 689 | 3300050508 | nmdc:mga09592_1427205_c1 | nmdc:mga09592_1427205_c1_213_491 | 92 |
| 690 | 3300050508 | nmdc:mga09592_350042_c1 | nmdc:mga09592_350042_c1_722_1000 | 92 |
| 691 | 3300050508 | nmdc:mga09592_706272_c1 | nmdc:mga09592_706272_c1_42_326 | 92 |
| 692 | 3300050509 | nmdc:mga0qj67_116309_c1 | nmdc:mga0qj67_116309_c1_402_680 | 92 |
| 693 | 3300050509 | nmdc:mga0qj67_321552_c1 | nmdc:mga0qj67_321552_c1_241_519 | 92 |
| 694 | 3300050509 | nmdc:mga0qj67_76802_c1 | nmdc:mga0qj67_76802_c1_1905_2183 | 92 |
| 695 | 3300050509 | nmdc:mga0qj67_794403_c1 | nmdc:mga0qj67_794403_c1_407_685 | 92 |
| 696 | 3300050510 | nmdc:mga06r32_160600_c1 | nmdc:mga06r32_160600_c1_1151_1429 | 92 |
| 697 | 3300050510 | nmdc:mga06r32_2069307_c1 | nmdc:mga06r32_2069307_c1_51_329 | 92 |
| 698 | 3300050510 | nmdc:mga06r32_69569_c1 | nmdc:mga06r32_69569_c1_900_1178 | 92 |
| 699 | 3300050510 | nmdc:mga06r32_736538_c1 | nmdc:mga06r32_736538_c1_626_904 | 92 |
| 700 | 3300050510 | nmdc:mga06r32_834553_c1 | nmdc:mga06r32_834553_c1_104_388 | 92 |
| 701 | 3300050510 | nmdc:mga06r32_961547_c1 | nmdc:mga06r32_961547_c1_104_382 | 92 |
| 702 | 3300050511 | nmdc:mga08y16_1643812_c1 | nmdc:mga08y16_1643812_c1_144_428 | 92 |
| 703 | 3300050511 | nmdc:mga08y16_170704_c1 | nmdc:mga08y16_170704_c1_36_320 | 92 |
| 704 | 3300050511 | nmdc:mga08y16_20561_c1 | nmdc:mga08y16_20561_c1_4472_4750 | 92 |
| 705 | 3300050512 | nmdc:mga0n895_132125_c1 | nmdc:mga0n895_132125_c1_651_929 | 92 |
| 706 | 3300050512 | nmdc:mga0n895_1450631_c1 | nmdc:mga0n895_1450631_c1_339_623 | 92 |
| 707 | 3300050512 | nmdc:mga0n895_203789_c1 | nmdc:mga0n895_203789_c1_13_297 | 92 |
| 708 | 3300050512 | nmdc:mga0n895_254711_c1 | nmdc:mga0n895_254711_c1_428_706 | 92 |
| 709 | 3300050512 | nmdc:mga0n895_2742_c1 | nmdc:mga0n895_2742_c1_5782_6060 | 92 |
| 710 | 3300050512 | nmdc:mga0n895_349243_c1 | nmdc:mga0n895_349243_c1_473_751 | 92 |
| 711 | 3300050512 | nmdc:mga0n895_619097_c1 | nmdc:mga0n895_619097_c1_368_646 | 92 |
| 712 | 3300050513 | nmdc:mga0rr50_240977_c1 | nmdc:mga0rr50_240977_c1_92_370 | 92 |
| 713 | 3300050513 | nmdc:mga0rr50_25473_c1 | nmdc:mga0rr50_25473_c1_1664_1942 | 92 |
| 714 | 3300050513 | nmdc:mga0rr50_4059_c1 | nmdc:mga0rr50_4059_c1_1130_1414 | 92 |
| 715 | 3300050513 | nmdc:mga0rr50_53845_c1 | nmdc:mga0rr50_53845_c1_844_1122 | 92 |
| 716 | 3300050513 | nmdc:mga0rr50_875596_c1 | nmdc:mga0rr50_875596_c1_54_332 | 92 |
| 717 | 3300050514 | nmdc:mga08x19_21129_c1 | nmdc:mga08x19_21129_c1_2786_3064 | 92 |
| 718 | 3300050514 | nmdc:mga08x19_335909_c1 | nmdc:mga08x19_335909_c1_181_459 | 92 |
| 719 | 3300050514 | nmdc:mga08x19_392957_c1 | nmdc:mga08x19_392957_c1_144_422 | 92 |
| 720 | 3300050514 | nmdc:mga08x19_407912_c1 | nmdc:mga08x19_407912_c1_367_651 | 92 |
| 721 | 3300050514 | nmdc:mga08x19_89427_c1 | nmdc:mga08x19_89427_c1_312_590 | 92 |
| 722 | 3300050515 | nmdc:mga0a205_1243527_c1 | nmdc:mga0a205_1243527_c1_84_362 | 92 |
| 723 | 3300050515 | nmdc:mga0a205_15616_c1 | nmdc:mga0a205_15616_c1_5670_5948 | 92 |
| 724 | 3300050515 | nmdc:mga0a205_189175_c1 | nmdc:mga0a205_189175_c1_1031_1309 | 92 |
| 725 | 3300050515 | nmdc:mga0a205_292750_c1 | nmdc:mga0a205_292750_c1_79_363 | 92 |
| 726 | 3300050515 | nmdc:mga0a205_324514_c1 | nmdc:mga0a205_324514_c1_661_939 | 92 |
| 727 | 3300050515 | nmdc:mga0a205_58716_c1 | nmdc:mga0a205_58716_c1_3283_3561 | 92 |
| 728 | 3300050515 | nmdc:mga0a205_65349_c1 | nmdc:mga0a205_65349_c1_1000_1278 | 92 |
| 729 | 3300050515 | nmdc:mga0a205_77643_c1 | nmdc:mga0a205_77643_c1_2652_2930 | 92 |
| 730 | 3300054114 | Ga0501084_0001468 | Ga0501084_0001468_18025_18303 | 92 |
| 731 | 3300054114 | Ga0501084_0105078 | Ga0501084_0105078_780_1058 | 92 |
| 732 | 3300054114 | Ga0501084_0108629 | Ga0501084_0108629_487_765 | 92 |
| 733 | 3300054114 | Ga0501084_1108890 | Ga0501084_1108890_211_489 | 92 |
| 734 | 3300054114 | Ga0501084_1800672 | Ga0501084_1800672_193_471 | 92 |
| 735 | 3300059421 | Ga0590071_007223 | Ga0590071_007223_669_947 | 92 |
| 736 | 3300059421 | Ga0590071_078757 | Ga0590071_078757_461_745 | 92 |
| 737 | 3300059423 | Ga0590074_109309 | Ga0590074_109309_75_353 | 92 |
| 738 | 3300060353 | Ga0501082_0006749 | Ga0501082_0006749_5405_5683 | 92 |
| 739 | 3300060353 | Ga0501082_0048010 | Ga0501082_0048010_3298_3576 | 92 |
| 740 | 3300060353 | Ga0501082_0091100 | Ga0501082_0091100_487_765 | 92 |
| 741 | 3300060353 | Ga0501082_0158625 | Ga0501082_0158625_1283_1585 | 92 |
| 742 | 3300060353 | Ga0501082_0238938 | Ga0501082_0238938_978_1256 | 92 |
| 743 | 3300060353 | Ga0501082_0701675 | Ga0501082_0701675_493_774 | 92 |
| 744 | 3300061734 | Ga0530510_0001077 | Ga0530510_0001077_1167_1445 | 92 |
| 745 | 3300061734 | Ga0530510_0014147 | Ga0530510_0014147_379_657 | 92 |
| 746 | 3300061734 | Ga0530510_0185010 | Ga0530510_0185010_190_471 | 92 |
| 747 | 3300061734 | Ga0530510_0273778 | Ga0530510_0273778_113_391 | 92 |
| 748 | 3300061734 | Ga0530510_0464169 | Ga0530510_0464169_162_440 | 92 |
| 749 | 3300061734 | Ga0530510_1150035 | Ga0530510_1150035_228_506 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.979 | 3 | 88 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.9513 | 3 | 91 |
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.9361 | 3 | 88 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.9307 | 3 | 91 |
| 1v8c-assembly1.cif.gz_A | crystal structure of moad related protein from thermus thermophilus hb8 | 0.8975 | 4 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9513 | 3 | 91 | 3.10.20.30 |
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9307 | 3 | 91 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8933 | 4 | 86 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.864 | 4 | 86 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8605 | 2 | 88 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3IN31-F1-model_v4 | MoaD/ThiS family protein | 1.001 | 1 | 88 |
|
| AF-A0A382J5P3-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9973 | 1 | 83 |
|
| AF-A0A4V2XVV1-F1-model_v4 | MoaD/ThiS family protein | 0.9953 | 1 | 78 |
|
| AF-A0A1Q7B304-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.994 | 3 | 87 |
|
| AF-P74060-F1-model_v4 | Putative sulfur carrier protein slr0821 | 0.9935 | 1 | 91 |
GO:0006777
GO:1990133 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar