F479018

General Info

Members Datasets Scaffolds Average Seq Length
749 251 1498 131

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0080447|Ga0495638_0080447_441_908
Length 155
Sequence LAPRGAARILTRETPSPEDAMPLELKILAWGCVLALVHILAASHVRTRQFGIAWNTGPRDTDPAAPAPIVGRLLRAQANYFETFPIAAAALLIDGLFPLSSALTQLGAALWLGARIIYLPLYAAGVPVLRSLVWLVSLLGIALLLWPALWASLVA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
225 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
230 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
231 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
245 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.13
Rhizoplane 3.2
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0080447 3300046460 Bacteria 1980
2 JGI24740J21852_10020127 3300001979 Bacteria 2335
3 JGI24740J21852_10034420 3300001979 Bacteria 1596
4 JGI24739J22299_10000453 3300001989 Bacteria 14331
5 JGI24739J22299_10027197 3300001989 Unclassified 2001
6 JGI24737J22298_10000021 3300001990 Bacteria 45543
7 JGI24737J22298_10056449 3300001990 Bacteria 1186
8 JGI24735J21928_10017771 3300002067 Bacteria 2198
9 JGI24748J21848_1024486 3300002074 Bacteria 735
10 JGI24738J21930_10000062 3300002075 Bacteria 22279
11 JGI24749J21850_1007519 3300002076 Bacteria 1519
12 JGI24035J26624_1005815 3300002126 Bacteria 1184
13 Ga0065712_10031930 3300005290 Bacteria 1229
14 Ga0070658_10034989 3300005327 Bacteria 4044
15 Ga0070658_10169474 3300005327 Bacteria 1834
16 Ga0070658_10410767 3300005327 Bacteria 1163
17 Ga0070658_10857287 3300005327 Bacteria 789
18 Ga0070658_11090690 3300005327 Bacteria 694
19 Ga0070658_11141804 3300005327 Bacteria 677
20 Ga0070658_11327575 3300005327 Unclassified 624
21 Ga0070676_10003504 3300005328 Bacteria 8192
22 Ga0070676_10011228 3300005328 Bacteria 4871
23 Ga0070676_10169095 3300005328 Bacteria 1412
24 Ga0070676_10218065 3300005328 Bacteria 1259
25 Ga0070683_101497744 3300005329 Bacteria 649
26 Ga0070683_101765478 3300005329 Bacteria 595
27 Ga0070690_100018652 3300005330 Bacteria 4194
28 Ga0070670_100010365 3300005331 Bacteria 7955
29 Ga0070670_100075676 3300005331 Bacteria 2892
30 Ga0070670_100197748 3300005331 Bacteria 1746
31 Ga0070670_100211938 3300005331 Bacteria 1684
32 Ga0070670_100301085 3300005331 Bacteria 1403
33 Ga0070677_10004566 3300005333 Bacteria 4525
34 Ga0070677_10061063 3300005333 Bacteria 1555
35 Ga0070677_10560965 3300005333 Bacteria 627
36 Ga0068869_100034193 3300005334 Bacteria 3594
37 Ga0068869_100071883 3300005334 Bacteria 2562
38 Ga0068869_100339175 3300005334 Bacteria 1223
39 Ga0070666_10049262 3300005335 Bacteria 2830
40 Ga0070666_10052157 3300005335 Bacteria 2756
41 Ga0070666_10162447 3300005335 Bacteria 1561
42 Ga0070666_10657553 3300005335 Bacteria 767
43 Ga0070680_100294940 3300005336 Bacteria 1374
44 Ga0070680_101054807 3300005336 Bacteria 702
45 Ga0070682_100123267 3300005337 Bacteria 1743
46 Ga0070682_100214281 3300005337 Bacteria 1367
47 Ga0068868_100000637 3300005338 Bacteria 23618
48 Ga0068868_101126191 3300005338 Bacteria 723
49 Ga0070660_100001821 3300005339 Bacteria 14639
50 Ga0070660_100002082 3300005339 Bacteria 13818
51 Ga0070660_100023740 3300005339 Bacteria 4544
52 Ga0070660_100152967 3300005339 Unclassified 1856
53 Ga0070660_100219149 3300005339 Bacteria 1546
54 Ga0070660_100387183 3300005339 Bacteria 1154
55 Ga0070660_100419199 3300005339 Bacteria 1108
56 Ga0070660_100429773 3300005339 Bacteria 1094
57 Ga0070660_100478065 3300005339 Bacteria 1035
58 Ga0070660_100542317 3300005339 Bacteria 970
59 Ga0070660_100973574 3300005339 Bacteria 716
60 Ga0070689_100009615 3300005340 Bacteria 6863
61 Ga0070689_100013741 3300005340 Bacteria 5865
62 Ga0070689_101226884 3300005340 Bacteria 674
63 Ga0070687_100216472 3300005343 Bacteria 1170
64 Ga0070661_100007377 3300005344 Bacteria 7580
65 Ga0070661_100031513 3300005344 Bacteria 3836
66 Ga0070661_100074768 3300005344 Bacteria 2495
67 Ga0070661_100109407 3300005344 Bacteria 2062
68 Ga0070661_100314557 3300005344 Bacteria 1222
69 Ga0070661_100342559 3300005344 Bacteria 1171
70 Ga0070661_100445614 3300005344 Bacteria 1029
71 Ga0070661_100514389 3300005344 Bacteria 959
72 Ga0070661_100795031 3300005344 Bacteria 776
73 Ga0070661_101052675 3300005344 Bacteria 676
74 Ga0070661_101105657 3300005344 Bacteria 660
75 Ga0070661_101334919 3300005344 Bacteria 602
76 Ga0070668_100005175 3300005347 Bacteria 9673
77 Ga0070668_100032860 3300005347 Bacteria 3949
78 Ga0070668_100359173 3300005347 Bacteria 1235
79 Ga0070668_101547510 3300005347 Bacteria 607
80 Ga0070669_100000009 3300005353 Bacteria 224683
81 Ga0070669_100000862 3300005353 Bacteria 22037
82 Ga0070669_100096778 3300005353 Bacteria 2221
83 Ga0070669_100118774 3300005353 Bacteria 2014
84 Ga0070669_100171760 3300005353 Bacteria 1690
85 Ga0070669_100199231 3300005353 Bacteria 1574
86 Ga0070675_100007443 3300005354 Bacteria 8456
87 Ga0070675_100047334 3300005354 Bacteria 3524
88 Ga0070675_100302676 3300005354 Bacteria 1409
89 Ga0070675_100858179 3300005354 Bacteria 831
90 Ga0070671_100001012 3300005355 Bacteria 20660
91 Ga0070671_100002229 3300005355 Bacteria 14965
92 Ga0070671_100076910 3300005355 Bacteria 2789
93 Ga0070671_100503647 3300005355 Bacteria 1042
94 Ga0070671_100732538 3300005355 Bacteria 859
95 Ga0070671_100772397 3300005355 Bacteria 836
96 Ga0070671_101167974 3300005355 Bacteria 677
97 Ga0070674_100001982 3300005356 Bacteria 11206
98 Ga0070674_100051087 3300005356 Bacteria 2848
99 Ga0070674_100139092 3300005356 Bacteria 1820
100 Ga0070674_100196996 3300005356 Bacteria 1553
101 Ga0070674_100330914 3300005356 Unclassified 1224
102 Ga0070673_100000209 3300005364 Bacteria 29078
103 Ga0070673_100057133 3300005364 Bacteria 3082
104 Ga0070673_100096310 3300005364 Bacteria 2428
105 Ga0070673_100161093 3300005364 Bacteria 1908
106 Ga0070673_100933179 3300005364 Bacteria 806
107 Ga0070673_100967289 3300005364 Bacteria 791
108 Ga0070659_100006023 3300005366 Bacteria 8743
109 Ga0070659_100007835 3300005366 Bacteria 7774
110 Ga0070659_100028371 3300005366 Bacteria 4322
111 Ga0070659_100323638 3300005366 Bacteria 1289
112 Ga0070659_100427468 3300005366 Bacteria 1121
113 Ga0070659_101220277 3300005366 Bacteria 665
114 Ga0070667_100004734 3300005367 Bacteria 11402
115 Ga0070667_100005313 3300005367 Bacteria 10759
116 Ga0070667_100090330 3300005367 Bacteria 2632
117 Ga0070667_100116585 3300005367 Bacteria 2319
118 Ga0070667_100264669 3300005367 Bacteria 1540
119 Ga0070667_100322181 3300005367 Bacteria 1395
120 Ga0070705_100765159 3300005440 Bacteria 765
121 Ga0070663_100013706 3300005455 Bacteria 5180
122 Ga0070663_100050307 3300005455 Bacteria 2963
123 Ga0070663_100094108 3300005455 Bacteria 2224
124 Ga0070663_100217564 3300005455 Bacteria 1498
125 Ga0070663_100237306 3300005455 Bacteria 1438
126 Ga0070663_100303531 3300005455 Bacteria 1279
127 Ga0070663_101003971 3300005455 Bacteria 726
128 Ga0070663_101017456 3300005455 Unclassified 721
129 Ga0070663_101026257 3300005455 Bacteria 718
130 Ga0070663_101370813 3300005455 Bacteria 625
131 Ga0070663_101525893 3300005455 Bacteria 594
132 Ga0070678_100089929 3300005456 Bacteria 2351
133 Ga0070678_100123475 3300005456 Bacteria 2046
134 Ga0070678_100197779 3300005456 Bacteria 1657
135 Ga0070662_100001955 3300005457 Bacteria 12662
136 Ga0070662_100044295 3300005457 Bacteria 3187
137 Ga0070662_100083028 3300005457 Bacteria 2390
138 Ga0070662_100255675 3300005457 Bacteria 1410
139 Ga0070662_100293262 3300005457 Bacteria 1319
140 Ga0070662_100346368 3300005457 Bacteria 1216
141 Ga0070662_100638120 3300005457 Bacteria 898
142 Ga0070662_100833426 3300005457 Bacteria 785
143 Ga0070662_101187810 3300005457 Bacteria 656
144 Ga0070681_10051638 3300005458 Bacteria 4101
145 Ga0070681_10246249 3300005458 Bacteria 1700
146 Ga0070681_11901214 3300005458 Unclassified 523
147 Ga0068867_100000633 3300005459 Bacteria 23213
148 Ga0068867_100011413 3300005459 Bacteria 6269
149 Ga0068867_100329452 3300005459 Bacteria 1268
150 Ga0068867_100401748 3300005459 Bacteria 1156
151 Ga0068867_101063450 3300005459 Bacteria 737
152 Ga0070685_10000225 3300005466 Bacteria 37151
153 Ga0070679_100000750 3300005530 Bacteria 28064
154 Ga0070679_100091968 3300005530 Bacteria 3021
155 Ga0070679_101202036 3300005530 Unclassified 703
156 Ga0070679_101246968 3300005530 Bacteria 689
157 Ga0070679_101472415 3300005530 Bacteria 627
158 Ga0070679_101551282 3300005530 Bacteria 610
159 Ga0068853_100002063 3300005539 Bacteria 14889
160 Ga0068853_100060675 3300005539 Bacteria 3269
161 Ga0068853_100342356 3300005539 Bacteria 1390
162 Ga0068853_100444925 3300005539 Unclassified 1218
163 Ga0068853_100621954 3300005539 Bacteria 1026
164 Ga0068853_100885472 3300005539 Bacteria 857
165 Ga0068853_101259303 3300005539 Bacteria 714
166 Ga0068853_101934244 3300005539 Bacteria 572
167 Ga0070672_100000770 3300005543 Bacteria 19069
168 Ga0070672_100012771 3300005543 Bacteria 5912
169 Ga0070672_100332309 3300005543 Bacteria 1293
170 Ga0070672_100743794 3300005543 Bacteria 860
171 Ga0070695_101420361 3300005545 Unclassified 576
172 Ga0070696_100054831 3300005546 Bacteria 2779
173 Ga0070693_100039946 3300005547 Unclassified 2631
174 Ga0070693_100369905 3300005547 Bacteria 986
175 Ga0070665_100000004 3300005548 Bacteria 785500
176 Ga0070665_100000590 3300005548 Bacteria 50563
177 Ga0070665_101003374 3300005548 Bacteria 847
178 Ga0070665_101415786 3300005548 Bacteria 704
179 Ga0068855_100039372 3300005563 Bacteria 5611
180 Ga0068855_100659183 3300005563 Unclassified 1123
181 Ga0068855_101588504 3300005563 Bacteria 669
182 Ga0070664_100002427 3300005564 Bacteria 14988
183 Ga0070664_100009081 3300005564 Bacteria 8067
184 Ga0070664_100010866 3300005564 Bacteria 7383
185 Ga0070664_100046060 3300005564 Bacteria 3683
186 Ga0070664_100183983 3300005564 Bacteria 1858
187 Ga0070664_100518830 3300005564 Bacteria 1100
188 Ga0068857_100004161 3300005577 Bacteria 12189
189 Ga0068857_100105577 3300005577 Bacteria 2529
190 Ga0068857_100150925 3300005577 Unclassified 2105
191 Ga0068857_100857248 3300005577 Bacteria 869
192 Ga0068857_101202536 3300005577 Bacteria 734
193 Ga0068857_101902702 3300005577 Bacteria 583
194 Ga0068854_100000614 3300005578 Bacteria 21116
195 Ga0068854_100068281 3300005578 Bacteria 2592
196 Ga0068854_100103296 3300005578 Bacteria 2139
197 Ga0068854_100337004 3300005578 Bacteria 1231
198 Ga0068854_100523947 3300005578 Bacteria 1001
199 Ga0068854_100724192 3300005578 Bacteria 861
200 Ga0068854_101022875 3300005578 Bacteria 733
201 Ga0068856_100057609 3300005614 Bacteria 3836
202 Ga0068856_100182730 3300005614 Bacteria 2111
203 Ga0068856_100801697 3300005614 Bacteria 961
204 Ga0068856_100850295 3300005614 Bacteria 931
205 Ga0068856_101015343 3300005614 Bacteria 848
206 Ga0070702_100102565 3300005615 Bacteria 1758
207 Ga0068852_100000804 3300005616 Bacteria 20664
208 Ga0068852_100039331 3300005616 Bacteria 3982
209 Ga0068852_100086339 3300005616 Bacteria 2797
210 Ga0068852_100086868 3300005616 Unclassified 2789
211 Ga0068852_100439777 3300005616 Bacteria 1289
212 Ga0068852_100463930 3300005616 Bacteria 1256
213 Ga0068852_100655564 3300005616 Bacteria 1057
214 Ga0068852_101059328 3300005616 Bacteria 830
215 Ga0068852_101280805 3300005616 Bacteria 755
216 Ga0068859_100000104 3300005617 Bacteria 78653
217 Ga0068859_100000478 3300005617 Bacteria 39430
218 Ga0068859_100022547 3300005617 Bacteria 6315
219 Ga0068859_100119080 3300005617 Unclassified 2706
220 Ga0068859_100362012 3300005617 Bacteria 1546
221 Ga0068859_100409780 3300005617 Bacteria 1451
222 Ga0068864_100000118 3300005618 Bacteria 77800
223 Ga0068864_100000174 3300005618 Bacteria 59338
224 Ga0068864_100017446 3300005618 Bacteria 5985
225 Ga0068864_100136248 3300005618 Bacteria 2211
226 Ga0068864_100756044 3300005618 Bacteria 953
227 Ga0068864_101332917 3300005618 Bacteria 718
228 Ga0068866_10754807 3300005718 Bacteria 672
229 Ga0068866_10957279 3300005718 Bacteria 606
230 Ga0068861_100001151 3300005719 Bacteria 16469
231 Ga0068861_100010621 3300005719 Bacteria 6394
232 Ga0068861_100481942 3300005719 Bacteria 1118
233 Ga0068861_102360272 3300005719 Unclassified 534
234 Ga0068851_10157421 3300005834 Unclassified 1246
235 Ga0068851_10299332 3300005834 Bacteria 924
236 Ga0068851_10300744 3300005834 Bacteria 922
237 Ga0068851_10375744 3300005834 Bacteria 832
238 Ga0068870_10184423 3300005840 Bacteria 1255
239 Ga0068863_100000152 3300005841 Bacteria 72823
240 Ga0068863_100004878 3300005841 Bacteria 13216
241 Ga0068863_100076008 3300005841 Bacteria 3177
242 Ga0068863_100208726 3300005841 Bacteria 1880
243 Ga0068863_100285525 3300005841 Bacteria 1599
244 Ga0068863_101763628 3300005841 Bacteria 629
245 Ga0068858_100028224 3300005842 Bacteria 5214
246 Ga0068858_100068281 3300005842 Bacteria 3294
247 Ga0068858_100283369 3300005842 Bacteria 1578
248 Ga0068860_100003157 3300005843 Bacteria 17012
249 Ga0068860_100005690 3300005843 Bacteria 12583
250 Ga0068860_100007725 3300005843 Bacteria 10751
251 Ga0068860_100341159 3300005843 Bacteria 1473
252 Ga0068860_100658460 3300005843 Bacteria 1055
253 Ga0068862_100000421 3300005844 Bacteria 45988
254 Ga0068862_100005596 3300005844 Bacteria 10498
255 Ga0068862_100026268 3300005844 Bacteria 4894
256 Ga0068862_100054895 3300005844 Bacteria 3412
257 Ga0068862_100149447 3300005844 Bacteria 2078
258 Ga0068862_100727452 3300005844 Bacteria 963
259 Ga0081539_10040175 3300005985 Bacteria 2749
260 Ga0097621_100013235 3300006237 Bacteria 6141
261 Ga0097621_100088606 3300006237 Bacteria 2586
262 Ga0068871_100135529 3300006358 Bacteria 2091
263 Ga0068871_100180491 3300006358 Bacteria 1814
264 Ga0068871_100468183 3300006358 Bacteria 1132
265 Ga0068865_100000240 3300006881 Bacteria 30384
266 Ga0097620_100000104 3300006931 Bacteria 78653
267 Ga0097620_100000478 3300006931 Bacteria 39430
268 Ga0097620_100022548 3300006931 Bacteria 6315
269 Ga0097620_100119090 3300006931 Unclassified 2706
270 Ga0097620_100361978 3300006931 Bacteria 1546
271 Ga0097620_100409763 3300006931 Bacteria 1451
272 Ga0105251_10405572 3300009011 Bacteria 627
273 Ga0105250_10017923 3300009092 Bacteria 2873
274 Ga0105240_10073297 3300009093 Bacteria 4228
275 Ga0105240_10745376 3300009093 Bacteria 1065
276 Ga0105245_10000300 3300009098 Bacteria 47446
277 Ga0105247_10006055 3300009101 Bacteria 7524
278 Ga0105247_10170804 3300009101 Bacteria 1445
279 Ga0114129_11975131 3300009147 Bacteria 706
280 Ga0105241_10022584 3300009174 Bacteria 4661
281 Ga0105242_11884389 3300009176 Bacteria 638
282 Ga0105248_10000295 3300009177 Bacteria 59247
283 Ga0105248_10002741 3300009177 Bacteria 19562
284 Ga0105248_10006633 3300009177 Bacteria 12692
285 Ga0105248_10014716 3300009177 Bacteria 8612
286 Ga0105248_10017802 3300009177 Bacteria 7840
287 Ga0105248_10390186 3300009177 Bacteria 1568
288 Ga0105248_10559403 3300009177 Bacteria 1290
289 Ga0105248_11151389 3300009177 Bacteria 877
290 Ga0105237_10950039 3300009545 Bacteria 866
291 Ga0105238_10049432 3300009551 Bacteria 4235
292 Ga0105238_10507330 3300009551 Bacteria 1208
293 Ga0105238_10981814 3300009551 Bacteria 865
294 Ga0105249_11261345 3300009553 Bacteria 810
295 Ga0105249_13262366 3300009553 Bacteria 522
296 Ga0105239_10044676 3300010375 Bacteria 4856
297 Ga0105239_11858988 3300010375 Bacteria 698
298 Ga0105246_10021355 3300011119 Bacteria 4166
299 Ga0105246_10647241 3300011119 Bacteria 920
300 Ga0157373_10006164 3300013100 Bacteria 8961
301 Ga0157373_10085912 3300013100 Bacteria 2217
302 Ga0157373_10278215 3300013100 Unclassified 1186
303 Ga0157373_10463670 3300013100 Bacteria 913
304 Ga0157371_10000677 3300013102 Bacteria 40414
305 Ga0157371_10424834 3300013102 Bacteria 975
306 Ga0157371_10441020 3300013102 Bacteria 956
307 Ga0157371_10754115 3300013102 Bacteria 731
308 Ga0157370_10115511 3300013104 Unclassified 2507
309 Ga0157370_10244964 3300013104 Bacteria 1658
310 Ga0157370_10748181 3300013104 Bacteria 891
311 Ga0157370_10855001 3300013104 Bacteria 826
312 Ga0157369_10391583 3300013105 Bacteria 1442
313 Ga0157374_11086772 3300013296 Bacteria 820
314 Ga0157378_10002011 3300013297 Bacteria 18196
315 Ga0157378_11188894 3300013297 Bacteria 802
316 Ga0163162_10045123 3300013306 Bacteria 4415
317 Ga0163162_10202482 3300013306 Bacteria 2114
318 Ga0157372_10045485 3300013307 Bacteria 4870
319 Ga0157372_10088817 3300013307 Bacteria 3510
320 Ga0157372_10754899 3300013307 Unclassified 1131
321 Ga0157372_11547760 3300013307 Bacteria 764
322 Ga0157375_10124625 3300013308 Bacteria 2690
323 Ga0157375_10499140 3300013308 Bacteria 1381
324 Ga0157375_11854929 3300013308 Bacteria 715
325 Ga0163163_10000882 3300014325 Bacteria 25516
326 Ga0163163_10400460 3300014325 Bacteria 1431
327 Ga0157380_10853842 3300014326 Bacteria 932
328 Ga0157377_10033043 3300014745 Bacteria 2821
329 Ga0157379_10009073 3300014968 Bacteria 8666
330 Ga0157379_10054102 3300014968 Bacteria 3587
331 Ga0163161_11058312 3300017792 Bacteria 695
332 Ga0213876_10010656 3300021384 Bacteria 4925
333 Ga0207673_1001669 3300025290 Bacteria 2454
334 Ga0207697_10000026 3300025315 Bacteria 52498
335 Ga0207697_10186033 3300025315 Bacteria 911
336 Ga0207697_10373337 3300025315 Bacteria 633
337 Ga0207656_10072117 3300025321 Bacteria 1537
338 Ga0207656_10494086 3300025321 Bacteria 621
339 Ga0207696_1048263 3300025711 Bacteria 1224
340 Ga0207713_1166571 3300025735 Unclassified 698
341 Ga0207713_1196393 3300025735 Bacteria 621
342 Ga0207682_10009951 3300025893 Bacteria 3735
343 Ga0207682_10100070 3300025893 Bacteria 1266
344 Ga0207642_10147168 3300025899 Bacteria 1249
345 Ga0207710_10018640 3300025900 Bacteria 2954
346 Ga0207710_10079543 3300025900 Bacteria 1518
347 Ga0207688_10000055 3300025901 Bacteria 41067
348 Ga0207688_10011889 3300025901 Bacteria 4736
349 Ga0207680_10036791 3300025903 Bacteria 2821
350 Ga0207680_10680949 3300025903 Bacteria 737
351 Ga0207647_10006361 3300025904 Bacteria 8588
352 Ga0207647_10222636 3300025904 Bacteria 1087
353 Ga0207645_10001667 3300025907 Bacteria 18069
354 Ga0207645_10006444 3300025907 Bacteria 8421
355 Ga0207645_10086464 3300025907 Bacteria 2014
356 Ga0207645_10115763 3300025907 Bacteria 1738
357 Ga0207643_10166873 3300025908 Bacteria 1327
358 Ga0207705_10021828 3300025909 Bacteria 4567
359 Ga0207705_10105183 3300025909 Bacteria 2080
360 Ga0207705_10382308 3300025909 Bacteria 1087
361 Ga0207705_10388709 3300025909 Bacteria 1078
362 Ga0207705_10645806 3300025909 Bacteria 823
363 Ga0207705_10684759 3300025909 Bacteria 797
364 Ga0207705_10737343 3300025909 Bacteria 765
365 Ga0207705_11138284 3300025909 Bacteria 600
366 Ga0207654_10477819 3300025911 Bacteria 877
367 Ga0207707_10016712 3300025912 Bacteria 6395
368 Ga0207707_10713216 3300025912 Bacteria 841
369 Ga0207695_10009319 3300025913 Bacteria 12153
370 Ga0207695_10942521 3300025913 Unclassified 743
371 Ga0207660_10007761 3300025917 Bacteria 6947
372 Ga0207660_10883860 3300025917 Bacteria 729
373 Ga0207660_11260820 3300025917 Bacteria 601
374 Ga0207662_10242073 3300025918 Bacteria 1181
375 Ga0207657_10001574 3300025919 Bacteria 24502
376 Ga0207657_10003629 3300025919 Bacteria 16433
377 Ga0207657_10077813 3300025919 Bacteria 2795
378 Ga0207657_10078938 3300025919 Bacteria 2770
379 Ga0207657_10088943 3300025919 Bacteria 2581
380 Ga0207657_10284189 3300025919 Bacteria 1313
381 Ga0207657_10393461 3300025919 Bacteria 1090
382 Ga0207657_10496323 3300025919 Bacteria 956
383 Ga0207657_10685154 3300025919 Bacteria 797
384 Ga0207657_10852268 3300025919 Unclassified 703
385 Ga0207657_10867747 3300025919 Bacteria 696
386 Ga0207649_10031780 3300025920 Bacteria 3141
387 Ga0207649_10063331 3300025920 Bacteria 2334
388 Ga0207649_10116587 3300025920 Unclassified 1794
389 Ga0207649_10117121 3300025920 Bacteria 1790
390 Ga0207649_10200440 3300025920 Bacteria 1409
391 Ga0207649_10533279 3300025920 Bacteria 896
392 Ga0207649_10672194 3300025920 Bacteria 802
393 Ga0207649_10986334 3300025920 Bacteria 663
394 Ga0207652_10000001 3300025921 Bacteria 1006643
395 Ga0207681_10000020 3300025923 Bacteria 240498
396 Ga0207681_10001514 3300025923 Bacteria 14993
397 Ga0207681_10005327 3300025923 Bacteria 7903
398 Ga0207681_10121455 3300025923 Bacteria 1916
399 Ga0207681_10419369 3300025923 Bacteria 1084
400 Ga0207694_10225304 3300025924 Bacteria 1530
401 Ga0207694_10761855 3300025924 Unclassified 817
402 Ga0207650_10044004 3300025925 Bacteria 3280
403 Ga0207650_10066692 3300025925 Bacteria 2699
404 Ga0207650_10143822 3300025925 Bacteria 1877
405 Ga0207650_11297963 3300025925 Unclassified 620
406 Ga0207659_10028105 3300025926 Bacteria 3818
407 Ga0207659_10287965 3300025926 Bacteria 1345
408 Ga0207687_10003666 3300025927 Bacteria 10346
409 Ga0207644_10000052 3300025931 Bacteria 91473
410 Ga0207644_10059162 3300025931 Bacteria 2771
411 Ga0207644_10063446 3300025931 Bacteria 2682
412 Ga0207644_10114557 3300025931 Bacteria 2043
413 Ga0207644_10185747 3300025931 Bacteria 1632
414 Ga0207644_10481092 3300025931 Bacteria 1023
415 Ga0207690_10007026 3300025932 Bacteria 6676
416 Ga0207690_10066792 3300025932 Bacteria 2464
417 Ga0207690_10070989 3300025932 Unclassified 2401
418 Ga0207690_11290549 3300025932 Bacteria 610
419 Ga0207706_10000278 3300025933 Bacteria 55758
420 Ga0207706_10014921 3300025933 Bacteria 7036
421 Ga0207706_10015386 3300025933 Bacteria 6911
422 Ga0207706_10045118 3300025933 Bacteria 3906
423 Ga0207706_10135438 3300025933 Bacteria 2167
424 Ga0207706_10524191 3300025933 Bacteria 1021
425 Ga0207706_10608876 3300025933 Bacteria 938
426 Ga0207706_10628496 3300025933 Bacteria 921
427 Ga0207706_10832642 3300025933 Unclassified 782
428 Ga0207706_10999102 3300025933 Bacteria 703
429 Ga0207709_10220259 3300025935 Bacteria 1368
430 Ga0207670_10049248 3300025936 Bacteria 2817
431 Ga0207670_10096032 3300025936 Bacteria 2107
432 Ga0207669_10013438 3300025937 Bacteria 4066
433 Ga0207669_10028194 3300025937 Bacteria 3086
434 Ga0207669_10037936 3300025937 Bacteria 2770
435 Ga0207669_10178597 3300025937 Bacteria 1519
436 Ga0207704_10005707 3300025938 Bacteria 5753
437 Ga0207691_10000045 3300025940 Bacteria 99798
438 Ga0207691_10023749 3300025940 Bacteria 5771
439 Ga0207691_10029849 3300025940 Bacteria 5099
440 Ga0207691_10141127 3300025940 Bacteria 2123
441 Ga0207711_10000153 3300025941 Bacteria 73814
442 Ga0207711_10003154 3300025941 Bacteria 14370
443 Ga0207711_10004637 3300025941 Bacteria 11679
444 Ga0207711_10007319 3300025941 Bacteria 9240
445 Ga0207711_10047780 3300025941 Bacteria 3661
446 Ga0207689_10000182 3300025942 Bacteria 54476
447 Ga0207689_10065887 3300025942 Bacteria 2979
448 Ga0207689_10647788 3300025942 Bacteria 890
449 Ga0207661_10467236 3300025944 Bacteria 1151
450 Ga0207679_10007082 3300025945 Bacteria 7108
451 Ga0207679_10008820 3300025945 Bacteria 6428
452 Ga0207679_10067699 3300025945 Bacteria 2680
453 Ga0207679_11762215 3300025945 Unclassified 566
454 Ga0207667_10000603 3300025949 Bacteria 46518
455 Ga0207667_10007486 3300025949 Bacteria 13111
456 Ga0207667_10010624 3300025949 Bacteria 10748
457 Ga0207667_10446882 3300025949 Unclassified 1314
458 Ga0207667_11242090 3300025949 Bacteria 723
459 Ga0207651_10004393 3300025960 Bacteria 7096
460 Ga0207651_10014814 3300025960 Bacteria 4513
461 Ga0207651_10024827 3300025960 Bacteria 3715
462 Ga0207651_10451071 3300025960 Bacteria 1103
463 Ga0207651_11023146 3300025960 Bacteria 739
464 Ga0207651_11151170 3300025960 Bacteria 696
465 Ga0207712_10269352 3300025961 Bacteria 1385
466 Ga0207712_11890913 3300025961 Bacteria 534
467 Ga0207668_10000050 3300025972 Bacteria 98767
468 Ga0207668_10006477 3300025972 Bacteria 6924
469 Ga0207668_10230583 3300025972 Bacteria 1493
470 Ga0207640_10000849 3300025981 Bacteria 17357
471 Ga0207640_10048450 3300025981 Bacteria 2747
472 Ga0207640_10124633 3300025981 Bacteria 1852
473 Ga0207640_10280024 3300025981 Bacteria 1309
474 Ga0207640_10597310 3300025981 Bacteria 934
475 Ga0207640_11996386 3300025981 Bacteria 525
476 Ga0207658_10000453 3300025986 Bacteria 38410
477 Ga0207658_10002786 3300025986 Bacteria 12583
478 Ga0207658_10013766 3300025986 Bacteria 5534
479 Ga0207658_10018210 3300025986 Bacteria 4846
480 Ga0207658_10112529 3300025986 Bacteria 2154
481 Ga0207658_10255372 3300025986 Bacteria 1491
482 Ga0207658_10393221 3300025986 Bacteria 1217
483 Ga0207658_10436661 3300025986 Bacteria 1157
484 Ga0207658_11361972 3300025986 Bacteria 649
485 Ga0207677_10003889 3300026023 Bacteria 7950
486 Ga0207677_10505333 3300026023 Bacteria 1046
487 Ga0207677_11066296 3300026023 Bacteria 735
488 Ga0207703_10202580 3300026035 Bacteria 1764
489 Ga0207703_10518864 3300026035 Bacteria 1120
490 Ga0207703_10536251 3300026035 Bacteria 1102
491 Ga0207639_10028229 3300026041 Bacteria 4095
492 Ga0207639_10092070 3300026041 Bacteria 2429
493 Ga0207639_10205450 3300026041 Bacteria 1692
494 Ga0207639_10245146 3300026041 Bacteria 1560
495 Ga0207639_10249195 3300026041 Unclassified 1548
496 Ga0207639_10363808 3300026041 Bacteria 1295
497 Ga0207639_10961805 3300026041 Unclassified 799
498 Ga0207639_11759584 3300026041 Unclassified 580
499 Ga0207678_10027360 3300026067 Bacteria 4974
500 Ga0207678_10055329 3300026067 Bacteria 3418
501 Ga0207678_10156283 3300026067 Bacteria 1947
502 Ga0207678_10278998 3300026067 Bacteria 1434
503 Ga0207678_10320777 3300026067 Bacteria 1333
504 Ga0207678_10332886 3300026067 Bacteria 1307
505 Ga0207678_10401866 3300026067 Bacteria 1186
506 Ga0207678_10759924 3300026067 Bacteria 855
507 Ga0207678_11804206 3300026067 Bacteria 535
508 Ga0207702_10072998 3300026078 Unclassified 2958
509 Ga0207702_10894069 3300026078 Bacteria 880
510 Ga0207702_11033197 3300026078 Bacteria 815
511 Ga0207641_10000205 3300026088 Bacteria 78692
512 Ga0207641_10004210 3300026088 Bacteria 12546
513 Ga0207641_10020495 3300026088 Bacteria 5430
514 Ga0207641_10039788 3300026088 Bacteria 3933
515 Ga0207641_10318857 3300026088 Bacteria 1473
516 Ga0207648_10000222 3300026089 Bacteria 61156
517 Ga0207648_10000477 3300026089 Bacteria 44735
518 Ga0207648_10406247 3300026089 Bacteria 1235
519 Ga0207648_10699294 3300026089 Bacteria 939
520 Ga0207676_10000702 3300026095 Bacteria 26358
521 Ga0207676_10000878 3300026095 Bacteria 23329
522 Ga0207676_10004741 3300026095 Bacteria 9642
523 Ga0207676_10030670 3300026095 Bacteria 4038
524 Ga0207676_10041510 3300026095 Bacteria 3532
525 Ga0207676_10719904 3300026095 Bacteria 968
526 Ga0207674_10006997 3300026116 Bacteria 13192
527 Ga0207674_10007144 3300026116 Bacteria 13044
528 Ga0207674_10045072 3300026116 Bacteria 4539
529 Ga0207675_100017759 3300026118 Bacteria 6636
530 Ga0207675_100634490 3300026118 Bacteria 1073
531 Ga0207675_101092001 3300026118 Bacteria 818
532 Ga0207675_101435600 3300026118 Bacteria 711
533 Ga0207683_10518164 3300026121 Bacteria 1102
534 Ga0207683_10649869 3300026121 Bacteria 977
535 Ga0207698_10019294 3300026142 Bacteria 4665
536 Ga0207698_10078028 3300026142 Bacteria 2657
537 Ga0207698_10093920 3300026142 Bacteria 2464
538 Ga0207698_10141609 3300026142 Unclassified 2073
539 Ga0207698_10416833 3300026142 Bacteria 1288
540 Ga0207698_10575268 3300026142 Bacteria 1107
541 Ga0268266_10000009 3300028379 Bacteria 1097737
542 Ga0268266_10001084 3300028379 Bacteria 34117
543 Ga0268266_10898387 3300028379 Unclassified 856
544 Ga0268266_11175193 3300028379 Bacteria 742
545 Ga0268265_10000149 3300028380 Bacteria 86376
546 Ga0268265_10002738 3300028380 Bacteria 13007
547 Ga0268265_10012277 3300028380 Bacteria 5806
548 Ga0268265_10021229 3300028380 Bacteria 4545
549 Ga0268265_10094838 3300028380 Bacteria 2394
550 Ga0268265_10573781 3300028380 Bacteria 1074
551 Ga0268264_10004932 3300028381 Bacteria 11301
552 Ga0268264_10012724 3300028381 Bacteria 6924
553 Ga0268264_10054777 3300028381 Bacteria 3331
554 Ga0268264_10136528 3300028381 Bacteria 2181
555 Ga0268264_10345616 3300028381 Bacteria 1414
556 Ga0268264_10408759 3300028381 Bacteria 1306
557 Ga0307513_10136335 3300031456 Bacteria 2390
558 Ga0307408_100007319 3300031548 Bacteria 7302
559 Ga0307408_100090381 3300031548 Bacteria 2310
560 Ga0307408_100122842 3300031548 Bacteria 2014
561 Ga0307408_101116847 3300031548 Bacteria 732
562 Ga0307405_10540024 3300031731 Unclassified 941
563 Ga0307413_10011502 3300031824 Bacteria 4358
564 Ga0307413_10021142 3300031824 Bacteria 3476
565 Ga0307413_10054220 3300031824 Bacteria 2431
566 Ga0307413_10624651 3300031824 Bacteria 885
567 Ga0307413_11728035 3300031824 Bacteria 558
568 Ga0307410_10000294 3300031852 Bacteria 19366
569 Ga0307410_10031350 3300031852 Bacteria 3410
570 Ga0307410_10127667 3300031852 Bacteria 1864
571 Ga0307410_10336432 3300031852 Bacteria 1202
572 Ga0307410_10539211 3300031852 Bacteria 965
573 Ga0307410_10736831 3300031852 Bacteria 833
574 Ga0307410_11713883 3300031852 Unclassified 557
575 Ga0307406_10026936 3300031901 Bacteria 3458
576 Ga0307406_11346552 3300031901 Unclassified 624
577 Ga0307407_10153128 3300031903 Bacteria 1500
578 Ga0307407_11052616 3300031903 Bacteria 631
579 Ga0307412_10104276 3300031911 Bacteria 2012
580 Ga0307409_100004079 3300031995 Bacteria 8121
581 Ga0307409_100023780 3300031995 Bacteria 4255
582 Ga0307409_100034240 3300031995 Bacteria 3706
583 Ga0307409_100124178 3300031995 Bacteria 2192
584 Ga0307409_100185104 3300031995 Bacteria 1848
585 Ga0307409_102592124 3300031995 Bacteria 535
586 Ga0307416_100008181 3300032002 Bacteria 6723
587 Ga0307416_100015063 3300032002 Bacteria 5325
588 Ga0307416_100776354 3300032002 Bacteria 1052
589 Ga0307414_10001887 3300032004 Bacteria 10822
590 Ga0307414_10002479 3300032004 Bacteria 9673
591 Ga0307414_10037950 3300032004 Bacteria 3230
592 Ga0307414_10126072 3300032004 Bacteria 1978
593 Ga0307414_11231579 3300032004 Bacteria 693
594 Ga0307411_10003224 3300032005 Bacteria 7512
595 Ga0307411_10010236 3300032005 Bacteria 4986
596 Ga0307411_10031850 3300032005 Bacteria 3250
597 Ga0307411_10519482 3300032005 Bacteria 1010
598 Ga0307411_10618040 3300032005 Bacteria 934
599 Ga0307411_11808158 3300032005 Bacteria 567
600 Ga0307415_100001215 3300032126 Bacteria 12074
601 Ga0307415_100064778 3300032126 Bacteria 2544
602 Ga0307415_100862530 3300032126 Unclassified 832
603 Ga0373931_0435445 3300035691 Bacteria 836
604 Ga0395899_0047184 3300037312 Bacteria 3208
605 Ga0395899_0074345 3300037312 Bacteria 2483
606 Ga0395899_0098646 3300037312 Bacteria 2111
607 Ga0395899_0128456 3300037312 Bacteria 1811
608 Ga0395899_0166143 3300037312 Bacteria 1556
609 Ga0395900_0052135 3300037418 Bacteria 4212
610 Ga0395900_0079130 3300037418 Bacteria 3377
611 Ga0395900_0099438 3300037418 Bacteria 2988
612 Ga0395900_0245655 3300037418 Bacteria 1793
613 Ga0395900_0314478 3300037418 Bacteria 1548
614 Ga0395900_0417574 3300037418 Bacteria 1303
615 Ga0395900_0572578 3300037418 Bacteria 1072
616 Ga0395900_0602294 3300037418 Bacteria 1039
617 Ga0395900_0622435 3300037418 Bacteria 1018
618 Ga0395900_0654002 3300037418 Unclassified 987
619 Ga0395900_1444797 3300037418 Bacteria 600
620 Ga0395898_0124483 3300037466 Bacteria 2470
621 Ga0395898_0236923 3300037466 Bacteria 1740
622 Ga0395898_0247117 3300037466 Bacteria 1701
623 Ga0395898_1384655 3300037466 Unclassified 631
624 Ga0395905_0007984 3300037471 Bacteria 10459
625 Ga0395905_0012758 3300037471 Bacteria 8083
626 Ga0395905_0041636 3300037471 Bacteria 4310
627 Ga0395905_0042251 3300037471 Bacteria 4278
628 Ga0395905_0085792 3300037471 Bacteria 2950
629 Ga0395905_0091148 3300037471 Bacteria 2858
630 Ga0395905_0100758 3300037471 Bacteria 2712
631 Ga0395905_0158392 3300037471 Bacteria 2129
632 Ga0395905_0199182 3300037471 Bacteria 1878
633 Ga0395905_0315488 3300037471 Bacteria 1452
634 Ga0395905_0345006 3300037471 Bacteria 1380
635 Ga0395905_0617162 3300037471 Bacteria 986
636 Ga0395905_0894553 3300037471 Bacteria 791
637 Ga0395905_1684179 3300037471 Bacteria 539
638 Ga0395901_0045185 3300038443 Bacteria 4569
639 Ga0395901_0052588 3300038443 Bacteria 4233
640 Ga0395901_0055707 3300038443 Bacteria 4112
641 Ga0395901_0110501 3300038443 Bacteria 2886
642 Ga0395901_0317203 3300038443 Bacteria 1613
643 Ga0395901_1742331 3300038443 Unclassified 573
644 Ga0395901_2009600 3300038443 Bacteria 524
645 Ga0436365_0616364 3300039437 Bacteria 2274
646 Ga0466969_0010103 3300044656 Bacteria 5008
647 Ga0466972_0122315 3300044658 Unclassified 1227
648 Ga0466963_0023577 3300044694 Bacteria 3910
649 Ga0466963_0518154 3300044694 Unclassified 842
650 Ga0466963_0964393 3300044694 Unclassified 601
651 Ga0466970_0276733 3300044765 Bacteria 943
652 Ga0466957_0713726 3300044842 Bacteria 708
653 Ga0466959_0284970 3300045049 Bacteria 1133
654 Ga0451576_2664736 3300045051 Unclassified 509
655 Ga0466958_0044797 3300045836 Bacteria 2667
656 Ga0466967_0121344 3300045976 Bacteria 2415
657 Ga0466967_0360583 3300045976 Bacteria 1408
658 Ga0466967_1294656 3300045976 Bacteria 726
659 Ga0466967_2050601 3300045976 Bacteria 568
660 Ga0495617_083767 3300046452 Bacteria 1044
661 Ga0495629_0255686 3300046459 Bacteria 1205
662 Ga0495638_0060556 3300046460 Bacteria 2341
663 Ga0495605_0247781 3300046474 Bacteria 763
664 Ga0495622_0016233 3300046557 Bacteria 3467
665 Ga0495668_0038263 3300046616 Bacteria 2681
666 Ga0495668_0042044 3300046616 Bacteria 2544
667 Ga0495668_0151708 3300046616 Unclassified 1269
668 Ga0495611_0141707 3300046648 Bacteria 1122
669 Ga0495625_0013331 3300046660 Bacteria 6609
670 Ga0495625_0116964 3300046660 Bacteria 1818
671 Ga0495625_0241179 3300046660 Bacteria 1177
672 Ga0495625_0445590 3300046660 Bacteria 801
673 Ga0495588_0257948 3300046674 Bacteria 919
674 Ga0495669_0059532 3300046684 Bacteria 1725
675 Ga0495669_0358940 3300046684 Bacteria 704
676 Ga0495677_0096589 3300047445 Bacteria 1116
677 Ga0496100_0115291 3300048903 Bacteria 1873
678 Ga0496101_0265240 3300048904 Bacteria 1340
679 Ga0496101_0299489 3300048904 Bacteria 1259
680 Ga0496101_0601246 3300048904 Bacteria 869
681 Ga0496102_0883830 3300048905 Bacteria 815
682 Ga0496103_0702866 3300048906 Bacteria 641
683 Ga0496106_0325797 3300048909 Bacteria 1233
684 Ga0496107_0074078 3300048910 Bacteria 2477
685 Ga0496107_0133434 3300048910 Bacteria 1834
686 Ga0496107_0219518 3300048910 Bacteria 1414
687 Ga0496107_0319613 3300048910 Bacteria 1155
688 Ga0496107_0671866 3300048910 Unclassified 763
689 Ga0496108_0147581 3300048911 Bacteria 2028
690 Ga0496109_0384718 3300048912 Bacteria 1325
691 Ga0496109_1042603 3300048912 Bacteria 755
692 Ga0496111_0347342 3300048914 Unclassified 1098
693 Ga0496112_0021492 3300048915 Bacteria 6138
694 Ga0496112_0231321 3300048915 Bacteria 1803
695 Ga0496112_0695931 3300048915 Unclassified 944
696 Ga0496113_0031718 3300048916 Bacteria 3837
697 Ga0496114_0012689 3300048917 Bacteria 6749
698 Ga0496114_0761960 3300048917 Bacteria 845
699 Ga0496115_0009567 3300048918 Bacteria 7201
700 Ga0496115_0304248 3300048918 Bacteria 1306
701 Ga0496124_0891598 3300048927 Bacteria 541
702 Ga0501034_0625661 3300049571 Bacteria 980
703 Ga0501037_0048103 3300049573 Archaea 3126
704 Ga0501038_0016555 3300049574 Bacteria 6684
705 Ga0501039_0609705 3300049575 Bacteria 855
706 Ga0501043_0031737 3300049579 Bacteria 4153
707 Ga0501046_0163598 3300049580 Bacteria 1672
708 Ga0501047_0030675 3300049581 Bacteria 5182
709 Ga0501067_0047296 3300049583 Bacteria 2386
710 Ga0501068_0251906 3300049584 Bacteria 1125
711 Ga0501073_0013519 3300049589 Bacteria 5935
712 Ga0501073_0393653 3300049589 Bacteria 957
713 Ga0501074_0106547 3300049590 Bacteria 2006
714 Ga0501075_1232063 3300049591 Bacteria 567
715 Ga0501242_051722 3300049674 Bacteria 605
716 Ga0501253_165979 3300049683 Bacteria 566
717 Ga0501079_0274399 3300049741 Bacteria 1318
718 Ga0501079_1139578 3300049741 Bacteria 614
719 Ga0501080_0025952 3300049742 Bacteria 5443
720 Ga0501080_0043551 3300049742 Bacteria 4180
721 Ga0501083_0018333 3300049744 Bacteria 4878
722 Ga0501241_007349 3300049758 Bacteria 2018
723 Ga0501262_081513 3300049759 Unclassified 541
724 Ga0501268_176367 3300049765 Unclassified 507
725 Ga0501035_0541344 3300049822 Bacteria 955
726 Ga0501044_0044001 3300049823 Bacteria 4636
727 Ga0501204_040309 3300049850 Bacteria 682
728 nmdc:mga09592_295816_c1 3300050508 Bacteria 1403
729 Ga0500643_000311 3300053087 Bacteria 39950
730 Ga0500643_004317 3300053087 Bacteria 6483
731 Ga0500643_029458 3300053087 Bacteria 1688
732 Ga0500643_043433 3300053087 Bacteria 1310
733 Ga0500644_0053585 3300053088 Bacteria 1393
734 Ga0500556_0000144 3300053104 Bacteria 59354
735 Ga0500608_186366 3300053122 Bacteria 873
736 Ga0500618_012926 3300053125 Bacteria 2173
737 Ga0500642_0000001 3300053130 Bacteria 1468402
738 Ga0500658_0000147 3300053134 Bacteria 33394
739 Ga0500559_0003490 3300053136 Bacteria 7715
740 Ga0500559_0069243 3300053136 Bacteria 1586
741 Ga0500620_005699 3300053155 Bacteria 2910
742 Ga0500624_000027 3300053157 Bacteria 108821
743 Ga0500645_000414 3300053730 Bacteria 29750
744 Ga0501084_0581921 3300054114 Bacteria 946
745 Ga0500661_003397 3300055283 Bacteria 2984
746 Ga0501082_0130738 3300060353 Bacteria 2178
747 Ga0466962_0083666 3300061719 Bacteria 1527
748 Ga0466962_0508108 3300061719 Bacteria 610
749 8055620604 8055617313 Bacteria 7548464
750 Ga0495638_0080447
751 JGI24740J21852_10020127
752 JGI24740J21852_10034420
753 JGI24739J22299_10000453
754 JGI24739J22299_10027197
755 JGI24737J22298_10000021
756 JGI24737J22298_10056449
757 JGI24735J21928_10017771
758 JGI24748J21848_1024486
759 JGI24738J21930_10000062
760 JGI24749J21850_1007519
761 JGI24035J26624_1005815
762 Ga0065712_10031930
763 Ga0070658_10034989
764 Ga0070658_10169474
765 Ga0070658_10410767
766 Ga0070658_10857287
767 Ga0070658_11090690
768 Ga0070658_11141804
769 Ga0070658_11327575
770 Ga0070676_10003504
771 Ga0070676_10011228
772 Ga0070676_10169095
773 Ga0070676_10218065
774 Ga0070683_101497744
775 Ga0070683_101765478
776 Ga0070690_100018652
777 Ga0070670_100010365
778 Ga0070670_100075676
779 Ga0070670_100197748
780 Ga0070670_100211938
781 Ga0070670_100301085
782 Ga0070677_10004566
783 Ga0070677_10061063
784 Ga0070677_10560965
785 Ga0068869_100034193
786 Ga0068869_100071883
787 Ga0068869_100339175
788 Ga0070666_10049262
789 Ga0070666_10052157
790 Ga0070666_10162447
791 Ga0070666_10657553
792 Ga0070680_100294940
793 Ga0070680_101054807
794 Ga0070682_100123267
795 Ga0070682_100214281
796 Ga0068868_100000637
797 Ga0068868_101126191
798 Ga0070660_100001821
799 Ga0070660_100002082
800 Ga0070660_100023740
801 Ga0070660_100152967
802 Ga0070660_100219149
803 Ga0070660_100387183
804 Ga0070660_100419199
805 Ga0070660_100429773
806 Ga0070660_100478065
807 Ga0070660_100542317
808 Ga0070660_100973574
809 Ga0070689_100009615
810 Ga0070689_100013741
811 Ga0070689_101226884
812 Ga0070687_100216472
813 Ga0070661_100007377
814 Ga0070661_100031513
815 Ga0070661_100074768
816 Ga0070661_100109407
817 Ga0070661_100314557
818 Ga0070661_100342559
819 Ga0070661_100445614
820 Ga0070661_100514389
821 Ga0070661_100795031
822 Ga0070661_101052675
823 Ga0070661_101105657
824 Ga0070661_101334919
825 Ga0070668_100005175
826 Ga0070668_100032860
827 Ga0070668_100359173
828 Ga0070668_101547510
829 Ga0070669_100000009
830 Ga0070669_100000862
831 Ga0070669_100096778
832 Ga0070669_100118774
833 Ga0070669_100171760
834 Ga0070669_100199231
835 Ga0070675_100007443
836 Ga0070675_100047334
837 Ga0070675_100302676
838 Ga0070675_100858179
839 Ga0070671_100001012
840 Ga0070671_100002229
841 Ga0070671_100076910
842 Ga0070671_100503647
843 Ga0070671_100732538
844 Ga0070671_100772397
845 Ga0070671_101167974
846 Ga0070674_100001982
847 Ga0070674_100051087
848 Ga0070674_100139092
849 Ga0070674_100196996
850 Ga0070674_100330914
851 Ga0070673_100000209
852 Ga0070673_100057133
853 Ga0070673_100096310
854 Ga0070673_100161093
855 Ga0070673_100933179
856 Ga0070673_100967289
857 Ga0070659_100006023
858 Ga0070659_100007835
859 Ga0070659_100028371
860 Ga0070659_100323638
861 Ga0070659_100427468
862 Ga0070659_101220277
863 Ga0070667_100004734
864 Ga0070667_100005313
865 Ga0070667_100090330
866 Ga0070667_100116585
867 Ga0070667_100264669
868 Ga0070667_100322181
869 Ga0070705_100765159
870 Ga0070663_100013706
871 Ga0070663_100050307
872 Ga0070663_100094108
873 Ga0070663_100217564
874 Ga0070663_100237306
875 Ga0070663_100303531
876 Ga0070663_101003971
877 Ga0070663_101017456
878 Ga0070663_101026257
879 Ga0070663_101370813
880 Ga0070663_101525893
881 Ga0070678_100089929
882 Ga0070678_100123475
883 Ga0070678_100197779
884 Ga0070662_100001955
885 Ga0070662_100044295
886 Ga0070662_100083028
887 Ga0070662_100255675
888 Ga0070662_100293262
889 Ga0070662_100346368
890 Ga0070662_100638120
891 Ga0070662_100833426
892 Ga0070662_101187810
893 Ga0070681_10051638
894 Ga0070681_10246249
895 Ga0070681_11901214
896 Ga0068867_100000633
897 Ga0068867_100011413
898 Ga0068867_100329452
899 Ga0068867_100401748
900 Ga0068867_101063450
901 Ga0070685_10000225
902 Ga0070679_100000750
903 Ga0070679_100091968
904 Ga0070679_101202036
905 Ga0070679_101246968
906 Ga0070679_101472415
907 Ga0070679_101551282
908 Ga0068853_100002063
909 Ga0068853_100060675
910 Ga0068853_100342356
911 Ga0068853_100444925
912 Ga0068853_100621954
913 Ga0068853_100885472
914 Ga0068853_101259303
915 Ga0068853_101934244
916 Ga0070672_100000770
917 Ga0070672_100012771
918 Ga0070672_100332309
919 Ga0070672_100743794
920 Ga0070695_101420361
921 Ga0070696_100054831
922 Ga0070693_100039946
923 Ga0070693_100369905
924 Ga0070665_100000004
925 Ga0070665_100000590
926 Ga0070665_101003374
927 Ga0070665_101415786
928 Ga0068855_100039372
929 Ga0068855_100659183
930 Ga0068855_101588504
931 Ga0070664_100002427
932 Ga0070664_100009081
933 Ga0070664_100010866
934 Ga0070664_100046060
935 Ga0070664_100183983
936 Ga0070664_100518830
937 Ga0068857_100004161
938 Ga0068857_100105577
939 Ga0068857_100150925
940 Ga0068857_100857248
941 Ga0068857_101202536
942 Ga0068857_101902702
943 Ga0068854_100000614
944 Ga0068854_100068281
945 Ga0068854_100103296
946 Ga0068854_100337004
947 Ga0068854_100523947
948 Ga0068854_100724192
949 Ga0068854_101022875
950 Ga0068856_100057609
951 Ga0068856_100182730
952 Ga0068856_100801697
953 Ga0068856_100850295
954 Ga0068856_101015343
955 Ga0070702_100102565
956 Ga0068852_100000804
957 Ga0068852_100039331
958 Ga0068852_100086339
959 Ga0068852_100086868
960 Ga0068852_100439777
961 Ga0068852_100463930
962 Ga0068852_100655564
963 Ga0068852_101059328
964 Ga0068852_101280805
965 Ga0068859_100000104
966 Ga0068859_100000478
967 Ga0068859_100022547
968 Ga0068859_100119080
969 Ga0068859_100362012
970 Ga0068859_100409780
971 Ga0068864_100000118
972 Ga0068864_100000174
973 Ga0068864_100017446
974 Ga0068864_100136248
975 Ga0068864_100756044
976 Ga0068864_101332917
977 Ga0068866_10754807
978 Ga0068866_10957279
979 Ga0068861_100001151
980 Ga0068861_100010621
981 Ga0068861_100481942
982 Ga0068861_102360272
983 Ga0068851_10157421
984 Ga0068851_10299332
985 Ga0068851_10300744
986 Ga0068851_10375744
987 Ga0068870_10184423
988 Ga0068863_100000152
989 Ga0068863_100004878
990 Ga0068863_100076008
991 Ga0068863_100208726
992 Ga0068863_100285525
993 Ga0068863_101763628
994 Ga0068858_100028224
995 Ga0068858_100068281
996 Ga0068858_100283369
997 Ga0068860_100003157
998 Ga0068860_100005690
999 Ga0068860_100007725
1000 Ga0068860_100341159
1001 Ga0068860_100658460
1002 Ga0068862_100000421
1003 Ga0068862_100005596
1004 Ga0068862_100026268
1005 Ga0068862_100054895
1006 Ga0068862_100149447
1007 Ga0068862_100727452
1008 Ga0081539_10040175
1009 Ga0097621_100013235
1010 Ga0097621_100088606
1011 Ga0068871_100135529
1012 Ga0068871_100180491
1013 Ga0068871_100468183
1014 Ga0068865_100000240
1015 Ga0097620_100000104
1016 Ga0097620_100000478
1017 Ga0097620_100022548
1018 Ga0097620_100119090
1019 Ga0097620_100361978
1020 Ga0097620_100409763
1021 Ga0105251_10405572
1022 Ga0105250_10017923
1023 Ga0105240_10073297
1024 Ga0105240_10745376
1025 Ga0105245_10000300
1026 Ga0105247_10006055
1027 Ga0105247_10170804
1028 Ga0114129_11975131
1029 Ga0105241_10022584
1030 Ga0105242_11884389
1031 Ga0105248_10000295
1032 Ga0105248_10002741
1033 Ga0105248_10006633
1034 Ga0105248_10014716
1035 Ga0105248_10017802
1036 Ga0105248_10390186
1037 Ga0105248_10559403
1038 Ga0105248_11151389
1039 Ga0105237_10950039
1040 Ga0105238_10049432
1041 Ga0105238_10507330
1042 Ga0105238_10981814
1043 Ga0105249_11261345
1044 Ga0105249_13262366
1045 Ga0105239_10044676
1046 Ga0105239_11858988
1047 Ga0105246_10021355
1048 Ga0105246_10647241
1049 Ga0157373_10006164
1050 Ga0157373_10085912
1051 Ga0157373_10278215
1052 Ga0157373_10463670
1053 Ga0157371_10000677
1054 Ga0157371_10424834
1055 Ga0157371_10441020
1056 Ga0157371_10754115
1057 Ga0157370_10115511
1058 Ga0157370_10244964
1059 Ga0157370_10748181
1060 Ga0157370_10855001
1061 Ga0157369_10391583
1062 Ga0157374_11086772
1063 Ga0157378_10002011
1064 Ga0157378_11188894
1065 Ga0163162_10045123
1066 Ga0163162_10202482
1067 Ga0157372_10045485
1068 Ga0157372_10088817
1069 Ga0157372_10754899
1070 Ga0157372_11547760
1071 Ga0157375_10124625
1072 Ga0157375_10499140
1073 Ga0157375_11854929
1074 Ga0163163_10000882
1075 Ga0163163_10400460
1076 Ga0157380_10853842
1077 Ga0157377_10033043
1078 Ga0157379_10009073
1079 Ga0157379_10054102
1080 Ga0163161_11058312
1081 Ga0213876_10010656
1082 Ga0207673_1001669
1083 Ga0207697_10000026
1084 Ga0207697_10186033
1085 Ga0207697_10373337
1086 Ga0207656_10072117
1087 Ga0207656_10494086
1088 Ga0207696_1048263
1089 Ga0207713_1166571
1090 Ga0207713_1196393
1091 Ga0207682_10009951
1092 Ga0207682_10100070
1093 Ga0207642_10147168
1094 Ga0207710_10018640
1095 Ga0207710_10079543
1096 Ga0207688_10000055
1097 Ga0207688_10011889
1098 Ga0207680_10036791
1099 Ga0207680_10680949
1100 Ga0207647_10006361
1101 Ga0207647_10222636
1102 Ga0207645_10001667
1103 Ga0207645_10006444
1104 Ga0207645_10086464
1105 Ga0207645_10115763
1106 Ga0207643_10166873
1107 Ga0207705_10021828
1108 Ga0207705_10105183
1109 Ga0207705_10382308
1110 Ga0207705_10388709
1111 Ga0207705_10645806
1112 Ga0207705_10684759
1113 Ga0207705_10737343
1114 Ga0207705_11138284
1115 Ga0207654_10477819
1116 Ga0207707_10016712
1117 Ga0207707_10713216
1118 Ga0207695_10009319
1119 Ga0207695_10942521
1120 Ga0207660_10007761
1121 Ga0207660_10883860
1122 Ga0207660_11260820
1123 Ga0207662_10242073
1124 Ga0207657_10001574
1125 Ga0207657_10003629
1126 Ga0207657_10077813
1127 Ga0207657_10078938
1128 Ga0207657_10088943
1129 Ga0207657_10284189
1130 Ga0207657_10393461
1131 Ga0207657_10496323
1132 Ga0207657_10685154
1133 Ga0207657_10852268
1134 Ga0207657_10867747
1135 Ga0207649_10031780
1136 Ga0207649_10063331
1137 Ga0207649_10116587
1138 Ga0207649_10117121
1139 Ga0207649_10200440
1140 Ga0207649_10533279
1141 Ga0207649_10672194
1142 Ga0207649_10986334
1143 Ga0207652_10000001
1144 Ga0207681_10000020
1145 Ga0207681_10001514
1146 Ga0207681_10005327
1147 Ga0207681_10121455
1148 Ga0207681_10419369
1149 Ga0207694_10225304
1150 Ga0207694_10761855
1151 Ga0207650_10044004
1152 Ga0207650_10066692
1153 Ga0207650_10143822
1154 Ga0207650_11297963
1155 Ga0207659_10028105
1156 Ga0207659_10287965
1157 Ga0207687_10003666
1158 Ga0207644_10000052
1159 Ga0207644_10059162
1160 Ga0207644_10063446
1161 Ga0207644_10114557
1162 Ga0207644_10185747
1163 Ga0207644_10481092
1164 Ga0207690_10007026
1165 Ga0207690_10066792
1166 Ga0207690_10070989
1167 Ga0207690_11290549
1168 Ga0207706_10000278
1169 Ga0207706_10014921
1170 Ga0207706_10015386
1171 Ga0207706_10045118
1172 Ga0207706_10135438
1173 Ga0207706_10524191
1174 Ga0207706_10608876
1175 Ga0207706_10628496
1176 Ga0207706_10832642
1177 Ga0207706_10999102
1178 Ga0207709_10220259
1179 Ga0207670_10049248
1180 Ga0207670_10096032
1181 Ga0207669_10013438
1182 Ga0207669_10028194
1183 Ga0207669_10037936
1184 Ga0207669_10178597
1185 Ga0207704_10005707
1186 Ga0207691_10000045
1187 Ga0207691_10023749
1188 Ga0207691_10029849
1189 Ga0207691_10141127
1190 Ga0207711_10000153
1191 Ga0207711_10003154
1192 Ga0207711_10004637
1193 Ga0207711_10007319
1194 Ga0207711_10047780
1195 Ga0207689_10000182
1196 Ga0207689_10065887
1197 Ga0207689_10647788
1198 Ga0207661_10467236
1199 Ga0207679_10007082
1200 Ga0207679_10008820
1201 Ga0207679_10067699
1202 Ga0207679_11762215
1203 Ga0207667_10000603
1204 Ga0207667_10007486
1205 Ga0207667_10010624
1206 Ga0207667_10446882
1207 Ga0207667_11242090
1208 Ga0207651_10004393
1209 Ga0207651_10014814
1210 Ga0207651_10024827
1211 Ga0207651_10451071
1212 Ga0207651_11023146
1213 Ga0207651_11151170
1214 Ga0207712_10269352
1215 Ga0207712_11890913
1216 Ga0207668_10000050
1217 Ga0207668_10006477
1218 Ga0207668_10230583
1219 Ga0207640_10000849
1220 Ga0207640_10048450
1221 Ga0207640_10124633
1222 Ga0207640_10280024
1223 Ga0207640_10597310
1224 Ga0207640_11996386
1225 Ga0207658_10000453
1226 Ga0207658_10002786
1227 Ga0207658_10013766
1228 Ga0207658_10018210
1229 Ga0207658_10112529
1230 Ga0207658_10255372
1231 Ga0207658_10393221
1232 Ga0207658_10436661
1233 Ga0207658_11361972
1234 Ga0207677_10003889
1235 Ga0207677_10505333
1236 Ga0207677_11066296
1237 Ga0207703_10202580
1238 Ga0207703_10518864
1239 Ga0207703_10536251
1240 Ga0207639_10028229
1241 Ga0207639_10092070
1242 Ga0207639_10205450
1243 Ga0207639_10245146
1244 Ga0207639_10249195
1245 Ga0207639_10363808
1246 Ga0207639_10961805
1247 Ga0207639_11759584
1248 Ga0207678_10027360
1249 Ga0207678_10055329
1250 Ga0207678_10156283
1251 Ga0207678_10278998
1252 Ga0207678_10320777
1253 Ga0207678_10332886
1254 Ga0207678_10401866
1255 Ga0207678_10759924
1256 Ga0207678_11804206
1257 Ga0207702_10072998
1258 Ga0207702_10894069
1259 Ga0207702_11033197
1260 Ga0207641_10000205
1261 Ga0207641_10004210
1262 Ga0207641_10020495
1263 Ga0207641_10039788
1264 Ga0207641_10318857
1265 Ga0207648_10000222
1266 Ga0207648_10000477
1267 Ga0207648_10406247
1268 Ga0207648_10699294
1269 Ga0207676_10000702
1270 Ga0207676_10000878
1271 Ga0207676_10004741
1272 Ga0207676_10030670
1273 Ga0207676_10041510
1274 Ga0207676_10719904
1275 Ga0207674_10006997
1276 Ga0207674_10007144
1277 Ga0207674_10045072
1278 Ga0207675_100017759
1279 Ga0207675_100634490
1280 Ga0207675_101092001
1281 Ga0207675_101435600
1282 Ga0207683_10518164
1283 Ga0207683_10649869
1284 Ga0207698_10019294
1285 Ga0207698_10078028
1286 Ga0207698_10093920
1287 Ga0207698_10141609
1288 Ga0207698_10416833
1289 Ga0207698_10575268
1290 Ga0268266_10000009
1291 Ga0268266_10001084
1292 Ga0268266_10898387
1293 Ga0268266_11175193
1294 Ga0268265_10000149
1295 Ga0268265_10002738
1296 Ga0268265_10012277
1297 Ga0268265_10021229
1298 Ga0268265_10094838
1299 Ga0268265_10573781
1300 Ga0268264_10004932
1301 Ga0268264_10012724
1302 Ga0268264_10054777
1303 Ga0268264_10136528
1304 Ga0268264_10345616
1305 Ga0268264_10408759
1306 Ga0307513_10136335
1307 Ga0307408_100007319
1308 Ga0307408_100090381
1309 Ga0307408_100122842
1310 Ga0307408_101116847
1311 Ga0307405_10540024
1312 Ga0307413_10011502
1313 Ga0307413_10021142
1314 Ga0307413_10054220
1315 Ga0307413_10624651
1316 Ga0307413_11728035
1317 Ga0307410_10000294
1318 Ga0307410_10031350
1319 Ga0307410_10127667
1320 Ga0307410_10336432
1321 Ga0307410_10539211
1322 Ga0307410_10736831
1323 Ga0307410_11713883
1324 Ga0307406_10026936
1325 Ga0307406_11346552
1326 Ga0307407_10153128
1327 Ga0307407_11052616
1328 Ga0307412_10104276
1329 Ga0307409_100004079
1330 Ga0307409_100023780
1331 Ga0307409_100034240
1332 Ga0307409_100124178
1333 Ga0307409_100185104
1334 Ga0307409_102592124
1335 Ga0307416_100008181
1336 Ga0307416_100015063
1337 Ga0307416_100776354
1338 Ga0307414_10001887
1339 Ga0307414_10002479
1340 Ga0307414_10037950
1341 Ga0307414_10126072
1342 Ga0307414_11231579
1343 Ga0307411_10003224
1344 Ga0307411_10010236
1345 Ga0307411_10031850
1346 Ga0307411_10519482
1347 Ga0307411_10618040
1348 Ga0307411_11808158
1349 Ga0307415_100001215
1350 Ga0307415_100064778
1351 Ga0307415_100862530
1352 Ga0373931_0435445
1353 Ga0395899_0047184
1354 Ga0395899_0074345
1355 Ga0395899_0098646
1356 Ga0395899_0128456
1357 Ga0395899_0166143
1358 Ga0395900_0052135
1359 Ga0395900_0079130
1360 Ga0395900_0099438
1361 Ga0395900_0245655
1362 Ga0395900_0314478
1363 Ga0395900_0417574
1364 Ga0395900_0572578
1365 Ga0395900_0602294
1366 Ga0395900_0622435
1367 Ga0395900_0654002
1368 Ga0395900_1444797
1369 Ga0395898_0124483
1370 Ga0395898_0236923
1371 Ga0395898_0247117
1372 Ga0395898_1384655
1373 Ga0395905_0007984
1374 Ga0395905_0012758
1375 Ga0395905_0041636
1376 Ga0395905_0042251
1377 Ga0395905_0085792
1378 Ga0395905_0091148
1379 Ga0395905_0100758
1380 Ga0395905_0158392
1381 Ga0395905_0199182
1382 Ga0395905_0315488
1383 Ga0395905_0345006
1384 Ga0395905_0617162
1385 Ga0395905_0894553
1386 Ga0395905_1684179
1387 Ga0395901_0045185
1388 Ga0395901_0052588
1389 Ga0395901_0055707
1390 Ga0395901_0110501
1391 Ga0395901_0317203
1392 Ga0395901_1742331
1393 Ga0395901_2009600
1394 Ga0436365_0616364
1395 Ga0466969_0010103
1396 Ga0466972_0122315
1397 Ga0466963_0023577
1398 Ga0466963_0518154
1399 Ga0466963_0964393
1400 Ga0466970_0276733
1401 Ga0466957_0713726
1402 Ga0466959_0284970
1403 Ga0451576_2664736
1404 Ga0466958_0044797
1405 Ga0466967_0121344
1406 Ga0466967_0360583
1407 Ga0466967_1294656
1408 Ga0466967_2050601
1409 Ga0495617_083767
1410 Ga0495629_0255686
1411 Ga0495638_0060556
1412 Ga0495605_0247781
1413 Ga0495622_0016233
1414 Ga0495668_0038263
1415 Ga0495668_0042044
1416 Ga0495668_0151708
1417 Ga0495611_0141707
1418 Ga0495625_0013331
1419 Ga0495625_0116964
1420 Ga0495625_0241179
1421 Ga0495625_0445590
1422 Ga0495588_0257948
1423 Ga0495669_0059532
1424 Ga0495669_0358940
1425 Ga0495677_0096589
1426 Ga0496100_0115291
1427 Ga0496101_0265240
1428 Ga0496101_0299489
1429 Ga0496101_0601246
1430 Ga0496102_0883830
1431 Ga0496103_0702866
1432 Ga0496106_0325797
1433 Ga0496107_0074078
1434 Ga0496107_0133434
1435 Ga0496107_0219518
1436 Ga0496107_0319613
1437 Ga0496107_0671866
1438 Ga0496108_0147581
1439 Ga0496109_0384718
1440 Ga0496109_1042603
1441 Ga0496111_0347342
1442 Ga0496112_0021492
1443 Ga0496112_0231321
1444 Ga0496112_0695931
1445 Ga0496113_0031718
1446 Ga0496114_0012689
1447 Ga0496114_0761960
1448 Ga0496115_0009567
1449 Ga0496115_0304248
1450 Ga0496124_0891598
1451 Ga0501034_0625661
1452 Ga0501037_0048103
1453 Ga0501038_0016555
1454 Ga0501039_0609705
1455 Ga0501043_0031737
1456 Ga0501046_0163598
1457 Ga0501047_0030675
1458 Ga0501067_0047296
1459 Ga0501068_0251906
1460 Ga0501073_0013519
1461 Ga0501073_0393653
1462 Ga0501074_0106547
1463 Ga0501075_1232063
1464 Ga0501242_051722
1465 Ga0501253_165979
1466 Ga0501079_0274399
1467 Ga0501079_1139578
1468 Ga0501080_0025952
1469 Ga0501080_0043551
1470 Ga0501083_0018333
1471 Ga0501241_007349
1472 Ga0501262_081513
1473 Ga0501268_176367
1474 Ga0501035_0541344
1475 Ga0501044_0044001
1476 Ga0501204_040309
1477 nmdc:mga09592_295816_c1
1478 Ga0500643_000311
1479 Ga0500643_004317
1480 Ga0500643_029458
1481 Ga0500643_043433
1482 Ga0500644_0053585
1483 Ga0500556_0000144
1484 Ga0500608_186366
1485 Ga0500618_012926
1486 Ga0500642_0000001
1487 Ga0500658_0000147
1488 Ga0500559_0003490
1489 Ga0500559_0069243
1490 Ga0500620_005699
1491 Ga0500624_000027
1492 Ga0500645_000414
1493 Ga0501084_0581921
1494 Ga0500661_003397
1495 Ga0501082_0130738
1496 Ga0466962_0083666
1497 Ga0466962_0508108
1498 8055620604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

27

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.8427 3 131
4j7t-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.8298 3 130
6r7d-assembly3.cif.gz_H crystal structure of ltc4s in complex with az13690257 0.7999 3 130
3hkk-assembly1.cif.gz_A structure of human leukotriene c4 synthase in complex with glutathione sulfonate 0.7924 3 130
3leo-assembly1.cif.gz_A structure of human leukotriene c4 synthase mutant r31q in complex with glutathione 0.791 3 130
ID Description Score Start End Superfamily
af_A1A5Y1_7_139_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8427 3 130 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8263 3 128 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7922 3 128 1.20.120.550
3leoA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.791 3 130 1.20.120.550
4jrzA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7907 3 130 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A836P0J2-F1-model_v4 Membrane protein 0.9679 47 131 GO:0016020
AF-M5CKQ2-F1-model_v4 deleted 0.9548 1 127
AF-A0A149QFF4-F1-model_v4 Membrane protein 0.9546 1 128 GO:0016020
AF-A0A246HHW7-F1-model_v4 MAPEG family protein 0.9536 1 128 GO:0016020
AF-A0A7V7PLX7-F1-model_v4 MAPEG family protein 0.9517 1 127 GO:0016020

Map