F479028

General Info

Members Datasets Scaffolds Average Seq Length
750 418 1500 254

Family's Representative Sequence

Representative Sequence 3300003790|Ga0055528_1000377|Ga0055528_10003778
Length 304
Sequence VRRKPPFGLTAEDERASHRRVKPRMDEPRIRLIEPKEKCMNTAVAATPAAHHAVVSKDRWLAQRKALLAREKELTHLRDQIARERRALPWTRVEKDYVFDTPEGARALADLFEGRRQLLVQHFMLGPDWEQGCPSCSYMSDHLDGMKVHLENRDLSLLVVSRAPLDQIERFRRRMGWQFKWVSSHGSDFNYXXXVSFEPRQWAEGKGEVYYNYSVRPFPAQEAPGISVFYRDDAGEVFHTYSTYERGVEAMMGTYNLLDLTPKGRDEPNPVHAMDWVRHHDRYEPAAPAAKPAGGSGSCCHGPD

Samples

Sample ID Description Type Environment
1 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
208 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
209 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
217 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
239 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
242 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
243 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
250 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
251 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
252 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
253 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
254 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
255 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
256 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
333 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
337 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
356 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
357 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
358 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
361 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
362 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
363 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
366 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
369 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
372 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
373 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
374 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
378 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
379 2643221559 Lysobacter sp. Root559 Isolate Unclassified
380 2643221573 Lysobacter sp. Root604 Isolate Unclassified
381 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
382 2643221585 Pelomonas sp. Root662 Isolate Unclassified
383 2643221586 Lysobacter sp. Root667 Isolate Unclassified
384 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
385 2643221593 Lysobacter sp. Root690 Isolate Unclassified
386 2643221609 Acidovorax sp. Root217 Isolate Unclassified
387 2643221611 Acidovorax sp. Root219 Isolate Unclassified
388 2643221612 Lysobacter sp. Root76 Isolate Unclassified
389 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
390 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
391 2643221645 Massilia sp. Root351 Isolate Unclassified
392 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
393 2643221656 Pelomonas sp. Root405 Isolate Unclassified
394 2643221664 Massilia sp. Root418 Isolate Unclassified
395 2643221683 Variovorax sp. Root473 Isolate Unclassified
396 2643221727 Lysobacter sp. Root96 Isolate Unclassified
397 2643221728 Lysobacter sp. Root983 Isolate Unclassified
398 2738541277 Variovorax sp. GV051 Isolate Unclassified
399 2738541280 Massilia sp. GV090 Isolate Unclassified
400 2738541300 Massilia sp. GV016 Isolate Unclassified
401 2738541307 Variovorax sp. GV008 Isolate Unclassified
402 2738543012 Acidovorax sp. CF301 Isolate Unclassified
403 2738543018 Massilia sp. GV045 Isolate Unclassified
404 2738543019 Variovorax sp. GV040 Isolate Unclassified
405 2738543030 Massilia sp. GV097 Isolate Unclassified
406 2816332133 Acidovorax radicis 2721A Isolate Unclassified
407 2842677519 Variovorax sp. R-72495 Isolate Unclassified
408 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
409 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
410 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
411 2904456579 Variovorax sp. 2002 Isolate Unclassified
412 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
413 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
414 2929520902 Variovorax beijingensis 502 Isolate Unclassified
415 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
416 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
417 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
418 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.4
Metatranscriptomes 0.13
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.8
Nodule 0.4
Rhizoplane 3.33
Rhizosphere 67.2
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055528_1000377 3300003790 Bacteria 36291
2 SwRhRL2b_contig_2058914 2162886007 Bacteria 4642
3 JGI25156J39149_1000016 3300002705 Bacteria 178691
4 JGI25156J39149_1000061 3300002705 Bacteria 84583
5 JGI25157J39369_1000035 3300002741 Bacteria 136011
6 JGI25157J39369_1000180 3300002741 Bacteria 53594
7 JGI25151J46595_10001011 3300003187 Bacteria 21245
8 rootH1_10001573 3300003316 Bacteria 2984
9 rootL2_10049763 3300003322 Bacteria 2860
10 rootL2_10055265 3300003322 Bacteria 4735
11 rootH1_10154922 3300003323 Bacteria 1405
12 Ga0006562J51391_1111735 3300003578 Bacteria 2630
13 Ga0055539_1000124 3300003752 Bacteria 82223
14 Ga0055539_1008631 3300003752 Bacteria 1273
15 Ga0055533_1000024 3300003756 Bacteria 338067
16 Ga0055525_1001151 3300003759 Bacteria 6253
17 Ga0055535_1000183 3300003761 Bacteria 66520
18 Ga0055535_1000393 3300003761 Bacteria 41335
19 Ga0055535_1006549 3300003761 Bacteria 2339
20 Ga0055529_1000064 3300003763 Bacteria 178831
21 Ga0055529_1002064 3300003763 Bacteria 4342
22 Ga0055526_1032910 3300003771 Bacteria 1451
23 Ga0055537_1000010 3300003773 Bacteria 138059
24 Ga0055524_1002702 3300003775 Bacteria 8965
25 Ga0055524_1002878 3300003775 Bacteria 8615
26 Ga0055536_1002555 3300003781 Bacteria 10174
27 Ga0055536_1007581 3300003781 Bacteria 4824
28 Ga0055536_1011792 3300003781 Bacteria 3304
29 Ga0055534_1000015 3300003784 Bacteria 148531
30 Ga0055534_1003939 3300003784 Bacteria 4477
31 Ga0055534_1024889 3300003784 Bacteria 966
32 Ga0055528_1027352 3300003790 Bacteria 1608
33 Ga0055530_10005109 3300003791 Bacteria 6420
34 Ga0055540_1000015 3300003792 Bacteria 232986
35 Ga0055540_1000625 3300003792 Bacteria 25161
36 Ga0055540_1001156 3300003792 Bacteria 16424
37 Ga0055531_10009441 3300003794 Bacteria 4983
38 Ga0055531_10031543 3300003794 Bacteria 1752
39 Ga0065165_1003590 3300005262 Bacteria 10695
40 Ga0065714_10012400 3300005288 Bacteria 2045
41 Ga0065714_10098198 3300005288 Bacteria 1717
42 Ga0065714_10135375 3300005288 Bacteria 1214
43 Ga0065704_10071167 3300005289 Bacteria 12711
44 Ga0065704_10190037 3300005289 Bacteria 1194
45 Ga0070658_10006378 3300005327 Bacteria 9559
46 Ga0070658_10393348 3300005327 Bacteria 1190
47 Ga0070676_10042449 3300005328 Bacteria 2641
48 Ga0070676_10059644 3300005328 Bacteria 2264
49 Ga0070683_100007807 3300005329 Bacteria 9060
50 Ga0070690_100069279 3300005330 Bacteria 2289
51 Ga0070690_100279968 3300005330 Bacteria 1189
52 Ga0070670_100015017 3300005331 Bacteria 6645
53 Ga0070670_100052538 3300005331 Bacteria 3499
54 Ga0070677_10001118 3300005333 Bacteria 8610
55 Ga0070677_10097407 3300005333 Bacteria 1290
56 Ga0070677_10159219 3300005333 Bacteria 1058
57 Ga0070666_10246187 3300005335 Bacteria 1265
58 Ga0070682_100461931 3300005337 Bacteria 975
59 Ga0068868_100184829 3300005338 Bacteria 1731
60 Ga0068868_100342648 3300005338 Unclassified 1278
61 Ga0070660_100115501 3300005339 Bacteria 2139
62 Ga0070660_100374063 3300005339 Bacteria 1176
63 Ga0070661_100001406 3300005344 Bacteria 16794
64 Ga0070661_100039349 3300005344 Bacteria 3445
65 Ga0070661_100292933 3300005344 Bacteria 1265
66 Ga0070668_100211738 3300005347 Bacteria 1595
67 Ga0070669_100001153 3300005353 Bacteria 19303
68 Ga0070669_100219498 3300005353 Bacteria 1503
69 Ga0070669_100238623 3300005353 Bacteria 1443
70 Ga0070669_100306889 3300005353 Bacteria 1278
71 Ga0070675_100000219 3300005354 Bacteria 36584
72 Ga0070675_100073009 3300005354 Bacteria 2848
73 Ga0070675_100266688 3300005354 Bacteria 1502
74 Ga0070675_100321492 3300005354 Bacteria 1367
75 Ga0070671_100014483 3300005355 Bacteria 6373
76 Ga0070671_100073955 3300005355 Bacteria 2846
77 Ga0070674_100008397 3300005356 Bacteria 6150
78 Ga0070674_100030134 3300005356 Bacteria 3582
79 Ga0070674_100171135 3300005356 Bacteria 1656
80 Ga0070673_100016775 3300005364 Bacteria 5190
81 Ga0070673_100236884 3300005364 Bacteria 1585
82 Ga0070673_100524112 3300005364 Bacteria 1074
83 Ga0070667_100130790 3300005367 Bacteria 2190
84 Ga0070667_100423243 3300005367 Bacteria 1214
85 Ga0070714_100675924 3300005435 Bacteria 995
86 Ga0070713_100173092 3300005436 Unclassified 1935
87 Ga0070713_100230015 3300005436 Bacteria 1685
88 Ga0070713_100437197 3300005436 Bacteria 1227
89 Ga0070711_100490847 3300005439 Bacteria 1011
90 Ga0070663_100307632 3300005455 Bacteria 1271
91 Ga0070678_100082305 3300005456 Bacteria 2443
92 Ga0070678_100104732 3300005456 Bacteria 2201
93 Ga0070678_100321072 3300005456 Bacteria 1322
94 Ga0070662_100007583 3300005457 Bacteria 7041
95 Ga0070662_100303250 3300005457 Bacteria 1298
96 Ga0068867_100000257 3300005459 Bacteria 34998
97 Ga0068867_100000287 3300005459 Bacteria 33183
98 Ga0068867_100549100 3300005459 Bacteria 1000
99 Ga0068867_100587446 3300005459 Bacteria 969
100 Ga0070706_100046962 3300005467 Bacteria 3984
101 Ga0070706_100147422 3300005467 Bacteria 2197
102 Ga0070707_100311578 3300005468 Bacteria 1530
103 Ga0070698_100131748 3300005471 Bacteria 2455
104 Ga0070699_100123539 3300005518 Bacteria 2278
105 Ga0070697_100118575 3300005536 Bacteria 2212
106 Ga0068853_100059813 3300005539 Bacteria 3292
107 Ga0070672_100024889 3300005543 Bacteria 4432
108 Ga0070672_100116189 3300005543 Bacteria 2186
109 Ga0070672_100128982 3300005543 Bacteria 2077
110 Ga0070672_100164859 3300005543 Bacteria 1840
111 Ga0070686_100468523 3300005544 Bacteria 972
112 Ga0070665_100005593 3300005548 Bacteria 12922
113 Ga0070665_100027314 3300005548 Bacteria 5749
114 Ga0070665_100749225 3300005548 Bacteria 990
115 Ga0068855_100032438 3300005563 Bacteria 6237
116 Ga0068855_100040092 3300005563 Bacteria 5559
117 Ga0068855_100055019 3300005563 Bacteria 4675
118 Ga0068855_100202244 3300005563 Bacteria 2236
119 Ga0068855_100655682 3300005563 Bacteria 1127
120 Ga0070664_100005979 3300005564 Bacteria 9837
121 Ga0070664_100006836 3300005564 Bacteria 9200
122 Ga0068857_100155059 3300005577 Bacteria 2076
123 Ga0068857_100413942 3300005577 Bacteria 1256
124 Ga0068854_100018452 3300005578 Bacteria 4683
125 Ga0068856_100005465 3300005614 Bacteria 12519
126 Ga0068856_100135356 3300005614 Bacteria 2469
127 Ga0068852_100036176 3300005616 Bacteria 4128
128 Ga0068852_100077532 3300005616 Bacteria 2938
129 Ga0068859_100288940 3300005617 Bacteria 1732
130 Ga0068859_100637578 3300005617 Bacteria 1158
131 Ga0068864_100031303 3300005618 Bacteria 4514
132 Ga0068864_100083709 3300005618 Bacteria 2802
133 Ga0068864_100471248 3300005618 Bacteria 1204
134 Ga0068866_10001764 3300005718 Bacteria 9099
135 Ga0068861_100022190 3300005719 Bacteria 4570
136 Ga0068861_100821686 3300005719 Bacteria 874
137 Ga0068851_10215542 3300005834 Bacteria 1077
138 Ga0068851_10256556 3300005834 Bacteria 993
139 Ga0068870_10041850 3300005840 Bacteria 2383
140 Ga0068870_10119732 3300005840 Bacteria 1515
141 Ga0068870_10303013 3300005840 Bacteria 1009
142 Ga0068863_100093710 3300005841 Bacteria 2850
143 Ga0068863_100120711 3300005841 Bacteria 2499
144 Ga0068858_100033996 3300005842 Bacteria 4729
145 Ga0068860_100000444 3300005843 Bacteria 52273
146 Ga0068860_100181705 3300005843 Bacteria 2033
147 Ga0068862_100005619 3300005844 Bacteria 10481
148 Ga0068862_100007521 3300005844 Bacteria 9026
149 Ga0068862_100087278 3300005844 Bacteria 2714
150 Ga0081455_10000211 3300005937 Bacteria 74488
151 Ga0081455_10023053 3300005937 Bacteria 5802
152 Ga0081455_10033603 3300005937 Bacteria 4607
153 Ga0081455_10221551 3300005937 Bacteria 1401
154 Ga0081539_10012312 3300005985 Bacteria 6614
155 Ga0081539_10029495 3300005985 Bacteria 3425
156 Ga0070717_10072109 3300006028 Bacteria 2883
157 Ga0070717_10441651 3300006028 Unclassified 1172
158 Ga0075365_10048421 3300006038 Bacteria 2798
159 Ga0075365_10059553 3300006038 Bacteria 2545
160 Ga0075365_10131459 3300006038 Bacteria 1732
161 Ga0075368_10067240 3300006042 Bacteria 1442
162 Ga0075363_100072347 3300006048 Bacteria 1874
163 Ga0075364_10034721 3300006051 Bacteria 3256
164 Ga0075364_10057960 3300006051 Bacteria 2538
165 Ga0075364_10099648 3300006051 Bacteria 1934
166 Ga0075432_10017697 3300006058 Bacteria 2429
167 Ga0070712_100569735 3300006175 Bacteria 956
168 Ga0075362_10075928 3300006177 Bacteria 1542
169 Ga0075367_10071757 3300006178 Bacteria 2084
170 Ga0075369_10014386 3300006186 Bacteria 3160
171 Ga0075369_10142855 3300006186 Bacteria 1092
172 Ga0075366_10014177 3300006195 Bacteria 4550
173 Ga0075366_10022500 3300006195 Bacteria 3667
174 Ga0097621_100010684 3300006237 Bacteria 6727
175 Ga0097621_100022185 3300006237 Bacteria 4925
176 Ga0097621_100284698 3300006237 Bacteria 1456
177 Ga0097621_100439109 3300006237 Bacteria 1174
178 Ga0097621_100504782 3300006237 Bacteria 1096
179 Ga0075370_10029763 3300006353 Bacteria 3043
180 Ga0075370_10049998 3300006353 Bacteria 2371
181 Ga0068871_100017429 3300006358 Bacteria 5436
182 Ga0068871_100026498 3300006358 Bacteria 4524
183 Ga0075428_100084707 3300006844 Bacteria 3458
184 Ga0075431_100005078 3300006847 Bacteria 12949
185 Ga0075429_100002970 3300006880 Bacteria 14385
186 Ga0075429_100006854 3300006880 Bacteria 9886
187 Ga0075429_100396202 3300006880 Bacteria 1209
188 Ga0068865_100072113 3300006881 Bacteria 2452
189 Ga0068865_100177807 3300006881 Bacteria 1637
190 Ga0068865_100537199 3300006881 Bacteria 980
191 Ga0097620_100104708 3300006931 Bacteria 2889
192 Ga0097620_100288967 3300006931 Bacteria 1732
193 Ga0097620_100637647 3300006931 Bacteria 1158
194 Ga0099826_10062906 3300006948 Bacteria 2402
195 Ga0075435_100110885 3300007076 Bacteria 2282
196 Ga0105240_10003444 3300009093 Bacteria 24555
197 Ga0105240_10039722 3300009093 Bacteria 6024
198 Ga0105240_10048411 3300009093 Bacteria 5373
199 Ga0105240_10331375 3300009093 Bacteria 1732
200 Ga0111539_10015684 3300009094 Bacteria 9418
201 Ga0105245_10504539 3300009098 Bacteria 1226
202 Ga0114129_10007699 3300009147 Bacteria 15329
203 Ga0114129_10171771 3300009147 Bacteria 2955
204 Ga0105243_10001557 3300009148 Bacteria 20059
205 Ga0105243_10001974 3300009148 Bacteria 17474
206 Ga0105243_10036123 3300009148 Bacteria 3833
207 Ga0105241_10092724 3300009174 Bacteria 2385
208 Ga0105242_10004095 3300009176 Bacteria 11335
209 Ga0105242_10006406 3300009176 Bacteria 9065
210 Ga0105242_10631983 3300009176 Bacteria 1039
211 Ga0105248_10001750 3300009177 Bacteria 24170
212 Ga0105248_10209272 3300009177 Bacteria 2197
213 Ga0105238_10009551 3300009551 Bacteria 9705
214 Ga0105238_10059850 3300009551 Bacteria 3815
215 Ga0105249_10554275 3300009553 Bacteria 1200
216 Ga0105249_10652291 3300009553 Bacteria 1110
217 Ga0105239_10047798 3300010375 Bacteria 4690
218 Ga0105239_10113071 3300010375 Bacteria 3011
219 Ga0105246_10048831 3300011119 Bacteria 2895
220 Ga0105246_10278320 3300011119 Bacteria 1341
221 Ga0157373_10036351 3300013100 Bacteria 3535
222 Ga0157373_10268384 3300013100 Bacteria 1208
223 Ga0157370_10001585 3300013104 Bacteria 28149
224 Ga0157370_10121753 3300013104 Bacteria 2436
225 Ga0157370_10469454 3300013104 Bacteria 1156
226 Ga0157369_10070182 3300013105 Bacteria 3764
227 Ga0157378_10047413 3300013297 Bacteria 3821
228 Ga0163162_10005859 3300013306 Bacteria 11891
229 Ga0163162_10075011 3300013306 Bacteria 3442
230 Ga0163162_10181586 3300013306 Bacteria 2230
231 Ga0163162_10244309 3300013306 Bacteria 1926
232 Ga0157372_10008371 3300013307 Bacteria 10996
233 Ga0157372_10099893 3300013307 Bacteria 3311
234 Ga0157372_10477128 3300013307 Bacteria 1454
235 Ga0157375_10042937 3300013308 Bacteria 4381
236 Ga0157375_10144787 3300013308 Bacteria 2506
237 Ga0157375_10303401 3300013308 Bacteria 1760
238 Ga0157375_10724851 3300013308 Bacteria 1147
239 Ga0157380_10195170 3300014326 Bacteria 1791
240 Ga0157380_10294006 3300014326 Bacteria 1493
241 Ga0182008_10000711 3300014497 Bacteria 23842
242 Ga0182008_10021087 3300014497 Bacteria 3350
243 Ga0182008_10100425 3300014497 Bacteria 1430
244 Ga0157379_10243909 3300014968 Bacteria 1630
245 Ga0157376_10000023 3300014969 Bacteria 223978
246 Ga0182006_1000964 3300015261 Bacteria 19073
247 Ga0182006_1092354 3300015261 Bacteria 1087
248 Ga0182007_10003164 3300015262 Bacteria 7886
249 Ga0182007_10045136 3300015262 Bacteria 1461
250 Ga0163161_10000127 3300017792 Bacteria 71051
251 Ga0163161_10065478 3300017792 Bacteria 2652
252 Ga0213872_10030461 3300021361 Bacteria 2473
253 Ga0209674_100007 3300025226 Bacteria 1077082
254 Ga0209672_103582 3300025228 Bacteria 3150
255 Ga0209563_100060 3300025230 Bacteria 284876
256 Ga0209258_100124 3300025242 Bacteria 178883
257 Ga0209258_100415 3300025242 Bacteria 51014
258 Ga0207425_1008473 3300025245 Bacteria 2627
259 Ga0207425_1034144 3300025245 Bacteria 999
260 Ga0209646_1000056 3300025246 Bacteria 269860
261 Ga0209026_1000009 3300025250 Bacteria 531812
262 Ga0209677_100108 3300025253 Bacteria 89018
263 Ga0209677_100198 3300025253 Bacteria 48090
264 Ga0209759_1000035 3300025256 Bacteria 264254
265 Ga0209759_1001942 3300025256 Bacteria 10052
266 Ga0209129_1003835 3300025258 Bacteria 6275
267 Ga0209565_1000025 3300025263 Bacteria 377969
268 Ga0209565_1010809 3300025263 Bacteria 2251
269 Ga0209565_1013694 3300025263 Bacteria 1891
270 Ga0209455_1000114 3300025272 Bacteria 178883
271 Ga0209455_1000337 3300025272 Bacteria 44758
272 Ga0209673_1000077 3300025273 Bacteria 229470
273 Ga0209673_1001615 3300025273 Bacteria 19674
274 Ga0209673_1006170 3300025273 Bacteria 5864
275 Ga0209130_1016584 3300025284 Bacteria 1778
276 Ga0209675_1000017 3300025291 Bacteria 378002
277 Ga0209675_1001897 3300025291 Bacteria 11275
278 Ga0209675_1027953 3300025291 Bacteria 1378
279 Ga0209676_1000034 3300025292 Bacteria 460125
280 Ga0209676_1000785 3300025292 Bacteria 42175
281 Ga0209676_1003468 3300025292 Bacteria 9682
282 Ga0209676_1020288 3300025292 Bacteria 2262
283 Ga0209025_1000005 3300025294 Bacteria 1272149
284 Ga0209025_1001450 3300025294 Bacteria 31111
285 Ga0209025_1002222 3300025294 Bacteria 21391
286 Ga0209025_1035923 3300025294 Bacteria 2229
287 Ga0209564_1004349 3300025295 Bacteria 8723
288 Ga0209564_1039105 3300025295 Bacteria 1309
289 Ga0209758_1024888 3300025297 Bacteria 2649
290 Ga0209050_1000170 3300025298 Bacteria 151162
291 Ga0209050_1000528 3300025298 Bacteria 63464
292 Ga0209050_1000529 3300025298 Bacteria 63410
293 Ga0209256_1000120 3300025299 Bacteria 167691
294 Ga0209256_1000980 3300025299 Bacteria 34284
295 Ga0209051_1000020 3300025303 Bacteria 508628
296 Ga0209051_1000271 3300025303 Bacteria 86541
297 Ga0209051_1000398 3300025303 Bacteria 60408
298 Ga0209051_1016226 3300025303 Bacteria 3384
299 Ga0209051_1020044 3300025303 Bacteria 2897
300 Ga0209257_1000189 3300025304 Bacteria 153917
301 Ga0209257_1000727 3300025304 Bacteria 50163
302 Ga0209257_1004132 3300025304 Bacteria 11573
303 Ga0209257_1007879 3300025304 Bacteria 6270
304 Ga0209257_1009161 3300025304 Bacteria 5388
305 Ga0207697_10155989 3300025315 Bacteria 994
306 Ga0207655_1003754 3300025728 Bacteria 11132
307 Ga0207655_1047804 3300025728 Bacteria 1762
308 Ga0207682_10000318 3300025893 Bacteria 21940
309 Ga0207642_10003806 3300025899 Bacteria 4809
310 Ga0207680_10115550 3300025903 Bacteria 1748
311 Ga0207645_10053165 3300025907 Bacteria 2588
312 Ga0207643_10223059 3300025908 Bacteria 1154
313 Ga0207643_10290194 3300025908 Bacteria 1016
314 Ga0207705_10232650 3300025909 Bacteria 1402
315 Ga0207684_10091817 3300025910 Bacteria 2588
316 Ga0207684_10099326 3300025910 Bacteria 2486
317 Ga0207684_10221853 3300025910 Bacteria 1631
318 Ga0207695_10001146 3300025913 Bacteria 45967
319 Ga0207695_10125579 3300025913 Bacteria 2528
320 Ga0207662_10036678 3300025918 Bacteria 2867
321 Ga0207657_10174036 3300025919 Bacteria 1743
322 Ga0207649_10023829 3300025920 Bacteria 3549
323 Ga0207646_10151450 3300025922 Bacteria 2092
324 Ga0207646_10624795 3300025922 Bacteria 966
325 Ga0207681_10001999 3300025923 Bacteria 13101
326 Ga0207681_10334874 3300025923 Bacteria 1207
327 Ga0207694_10014155 3300025924 Bacteria 6014
328 Ga0207694_10070372 3300025924 Bacteria 2733
329 Ga0207694_10181914 3300025924 Bacteria 1705
330 Ga0207650_10000435 3300025925 Bacteria 36300
331 Ga0207650_10027784 3300025925 Bacteria 4052
332 Ga0207650_10490009 3300025925 Bacteria 1026
333 Ga0207659_10000301 3300025926 Bacteria 29933
334 Ga0207659_10327028 3300025926 Bacteria 1266
335 Ga0207700_10097431 3300025928 Bacteria 2337
336 Ga0207700_10135300 3300025928 Bacteria 2018
337 Ga0207664_10461960 3300025929 Bacteria 1134
338 Ga0207664_10691548 3300025929 Bacteria 917
339 Ga0207644_10031872 3300025931 Bacteria 3676
340 Ga0207644_10037348 3300025931 Bacteria 3416
341 Ga0207690_10095180 3300025932 Bacteria 2115
342 Ga0207709_10000295 3300025935 Bacteria 55888
343 Ga0207709_10006321 3300025935 Bacteria 6649
344 Ga0207709_10031111 3300025935 Bacteria 3113
345 Ga0207709_10054605 3300025935 Bacteria 2464
346 Ga0207669_10000291 3300025937 Bacteria 22986
347 Ga0207669_10030757 3300025937 Bacteria 2988
348 Ga0207669_10072473 3300025937 Bacteria 2169
349 Ga0207704_10004798 3300025938 Bacteria 6207
350 Ga0207704_10428917 3300025938 Bacteria 1050
351 Ga0207691_10000148 3300025940 Bacteria 64859
352 Ga0207691_10010991 3300025940 Bacteria 8686
353 Ga0207691_10020929 3300025940 Bacteria 6182
354 Ga0207691_10077217 3300025940 Bacteria 3001
355 Ga0207691_10113200 3300025940 Bacteria 2411
356 Ga0207711_10218808 3300025941 Bacteria 1741
357 Ga0207689_10220933 3300025942 Bacteria 1565
358 Ga0207661_10007104 3300025944 Bacteria 7956
359 Ga0207661_10349605 3300025944 Bacteria 1334
360 Ga0207679_10000088 3300025945 Bacteria 79836
361 Ga0207679_10000265 3300025945 Bacteria 39990
362 Ga0207667_10024754 3300025949 Bacteria 6583
363 Ga0207667_10059920 3300025949 Bacteria 3985
364 Ga0207667_10119750 3300025949 Bacteria 2713
365 Ga0207667_10523706 3300025949 Bacteria 1201
366 Ga0207651_10007310 3300025960 Bacteria 5872
367 Ga0207651_10093246 3300025960 Bacteria 2210
368 Ga0207712_10342035 3300025961 Bacteria 1241
369 Ga0207668_10138875 3300025972 Bacteria 1866
370 Ga0207658_10104335 3300025986 Bacteria 2227
371 Ga0207658_10211584 3300025986 Bacteria 1625
372 Ga0207658_10447202 3300025986 Bacteria 1143
373 Ga0207677_10396024 3300026023 Unclassified 1170
374 Ga0207703_10010771 3300026035 Bacteria 7134
375 Ga0207703_10052243 3300026035 Bacteria 3317
376 Ga0207639_10016455 3300026041 Bacteria 5233
377 Ga0207639_10353577 3300026041 Bacteria 1313
378 Ga0207708_10000659 3300026075 Bacteria 26455
379 Ga0207708_10071198 3300026075 Bacteria 2663
380 Ga0207702_10007291 3300026078 Bacteria 9454
381 Ga0207702_10016789 3300026078 Bacteria 6059
382 Ga0207641_10078072 3300026088 Bacteria 2867
383 Ga0207641_10108254 3300026088 Bacteria 2460
384 Ga0207641_10644410 3300026088 Bacteria 1040
385 Ga0207648_10000283 3300026089 Bacteria 55253
386 Ga0207648_10000741 3300026089 Bacteria 36624
387 Ga0207648_10001569 3300026089 Bacteria 25081
388 Ga0207648_10144894 3300026089 Bacteria 2095
389 Ga0207648_10169073 3300026089 Bacteria 1932
390 Ga0207648_10185179 3300026089 Bacteria 1844
391 Ga0207648_10237217 3300026089 Bacteria 1623
392 Ga0207676_10005361 3300026095 Bacteria 9081
393 Ga0207676_10703245 3300026095 Bacteria 979
394 Ga0207674_10004183 3300026116 Bacteria 17430
395 Ga0207674_10067265 3300026116 Bacteria 3607
396 Ga0207674_10356524 3300026116 Bacteria 1414
397 Ga0207675_100000946 3300026118 Bacteria 29002
398 Ga0207675_100119096 3300026118 Bacteria 2497
399 Ga0207675_100848070 3300026118 Bacteria 928
400 Ga0207675_101037710 3300026118 Bacteria 839
401 Ga0207683_10027159 3300026121 Bacteria 4946
402 Ga0207683_10076230 3300026121 Bacteria 2969
403 Ga0207698_10004401 3300026142 Bacteria 8580
404 Ga0209282_1000229 3300027666 Bacteria 29075
405 Ga0209813_10070936 3300027866 Bacteria 1132
406 Ga0207428_10010548 3300027907 Bacteria 8247
407 Ga0268266_10000276 3300028379 Bacteria 84981
408 Ga0268265_10017636 3300028380 Bacteria 4933
409 Ga0268265_10051884 3300028380 Bacteria 3098
410 Ga0268265_10583115 3300028380 Bacteria 1066
411 Ga0268264_10008357 3300028381 Bacteria 8604
412 Ga0268264_10641211 3300028381 Bacteria 1050
413 Ga0265336_10000022 3300028666 Bacteria 192716
414 Ga0307517_10100690 3300028786 Bacteria 2280
415 Ga0307515_10000212 3300028794 Bacteria 143024
416 Ga0307515_10001343 3300028794 Bacteria 55676
417 Ga0307515_10002672 3300028794 Bacteria 38207
418 Ga0307515_10003631 3300028794 Bacteria 32412
419 Ga0307515_10006216 3300028794 Bacteria 23987
420 Ga0307515_10110109 3300028794 Bacteria 3227
421 Ga0307511_10138468 3300030521 Bacteria 1440
422 Ga0316177_1121344 3300030731 Bacteria 5730
423 Ga0314311_1150282 3300030733 Bacteria 3746
424 Ga0314311_1170870 3300030733 Bacteria 1327
425 Ga0316179_1019061 3300030734 Bacteria 2452
426 Ga0316183_1128149 3300030742 Bacteria 1966
427 Ga0316181_1134026 3300030744 Bacteria 7152
428 Ga0316182_1365804 3300030745 Bacteria 1342
429 Ga0265327_10000841 3300031251 Bacteria 45822
430 Ga0265327_10008749 3300031251 Bacteria 7480
431 Ga0265327_10117302 3300031251 Bacteria 1265
432 Ga0307509_10023870 3300031507 Bacteria 6855
433 Ga0307509_10109053 3300031507 Bacteria 2780
434 Ga0307408_100029462 3300031548 Bacteria 3804
435 Ga0307408_100044597 3300031548 Bacteria 3161
436 Ga0307408_100086803 3300031548 Bacteria 2352
437 Ga0307408_100087023 3300031548 Bacteria 2349
438 Ga0307408_100119983 3300031548 Bacteria 2035
439 Ga0307408_100252878 3300031548 Bacteria 1454
440 Ga0307508_10000549 3300031616 Bacteria 44475
441 Ga0307508_10060284 3300031616 Bacteria 3355
442 Ga0307508_10200014 3300031616 Bacteria 1599
443 Ga0307514_10003783 3300031649 Bacteria 14253
444 Ga0307514_10230827 3300031649 Bacteria 1122
445 Ga0316575_10164074 3300031665 Bacteria 919
446 Ga0307516_10000926 3300031730 Bacteria 40364
447 Ga0307516_10001203 3300031730 Bacteria 36097
448 Ga0307516_10005479 3300031730 Bacteria 15154
449 Ga0307516_10009294 3300031730 Bacteria 10985
450 Ga0307405_10023689 3300031731 Bacteria 3493
451 Ga0307405_10033160 3300031731 Bacteria 3060
452 Ga0307405_10059202 3300031731 Bacteria 2413
453 Ga0307405_10254474 3300031731 Bacteria 1308
454 Ga0307413_10202749 3300031824 Bacteria 1434
455 Ga0307406_10000356 3300031901 Bacteria 26772
456 Ga0307406_10000418 3300031901 Bacteria 24737
457 Ga0307406_10036690 3300031901 Bacteria 3022
458 Ga0307406_10288612 3300031901 Bacteria 1255
459 Ga0307412_10005923 3300031911 Bacteria 6890
460 Ga0307412_10022514 3300031911 Bacteria 3864
461 Ga0307412_10060115 3300031911 Bacteria 2549
462 Ga0307412_10143127 3300031911 Bacteria 1754
463 Ga0307412_10413423 3300031911 Bacteria 1102
464 Ga0307409_100000680 3300031995 Bacteria 15083
465 Ga0307416_100001182 3300032002 Bacteria 14007
466 Ga0307416_100618044 3300032002 Bacteria 1165
467 Ga0307416_101141087 3300032002 Bacteria 884
468 Ga0307414_10069798 3300032004 Bacteria 2527
469 Ga0307411_10151779 3300032005 Bacteria 1722
470 Ga0307411_10293811 3300032005 Bacteria 1300
471 Ga0307415_100003784 3300032126 Bacteria 7753
472 Ga0316583_10015793 3300032133 Bacteria 2719
473 Ga0373937_0821452 3300036401 Bacteria 878
474 Ga0373925_0070054 3300037068 Bacteria 2650
475 Ga0395899_0047170 3300037312 Bacteria 3208
476 Ga0395899_0250249 3300037312 Bacteria 1216
477 Ga0395900_0066916 3300037418 Bacteria 3692
478 Ga0395898_0024937 3300037466 Bacteria 6029
479 Ga0395905_0001288 3300037471 Bacteria 30819
480 Ga0395905_0086403 3300037471 Bacteria 2939
481 Ga0395905_0114921 3300037471 Bacteria 2529
482 Ga0395905_0269989 3300037471 Bacteria 1587
483 Ga0395905_0405666 3300037471 Bacteria 1258
484 Ga0395901_0010155 3300038443 Bacteria 9540
485 Ga0395901_0013644 3300038443 Bacteria 8261
486 Ga0395901_0070453 3300038443 Bacteria 3643
487 Ga0395901_0248551 3300038443 Bacteria 1853
488 Ga0436360_0378379 3300039438 Bacteria 3603
489 Ga0436361_0201117 3300039447 Bacteria 5845
490 Ga0436361_0759821 3300039447 Bacteria 1501
491 Ga0436361_1117914 3300039447 Bacteria 4441
492 Ga0436361_1173055 3300039447 Bacteria 3143
493 Ga0439447_000529 3300041407 Bacteria 14138
494 Ga0439461_0021134 3300041410 Bacteria 1295
495 Ga0439465_0000084 3300041413 Bacteria 20771
496 Ga0439465_0040571 3300041413 Bacteria 1505
497 Ga0451793_1414310 3300041452 Bacteria 1389
498 Ga0451833_1255216 3300041491 Bacteria 954
499 Ga0451845_0393817 3300041501 Bacteria 931
500 Ga0451853_0547373 3300041512 Bacteria 1576
501 Ga0451853_1218881 3300041512 Bacteria 859
502 Ga0439445_0056153 3300042004 Bacteria 1070
503 Ga0439448_0074588 3300042005 Bacteria 1133
504 Ga0439432_074696 3300042006 Bacteria 1031
505 Ga0439449_0000268 3300042007 Bacteria 18787
506 Ga0439449_0008418 3300042007 Bacteria 3920
507 Ga0439452_062604 3300042010 Bacteria 831
508 Ga0450917_000970 3300042120 Bacteria 2113
509 Ga0450888_000401 3300042126 Bacteria 4104
510 Ga0450898_010536 3300042134 Bacteria 1499
511 Ga0450903_016201 3300042138 Bacteria 1170
512 Ga0450889_001420 3300042144 Bacteria 2468
513 Ga0450906_023736 3300042145 Bacteria 1091
514 Ga0450910_013718 3300042147 Bacteria 1181
515 Ga0439446_0002028 3300042156 Bacteria 4794
516 Ga0450908_006003 3300042184 Bacteria 2318
517 Ga0439434_0026513 3300042435 Bacteria 1750
518 Ga0439434_0075677 3300042435 Bacteria 1064
519 Ga0450918_000414 3300042531 Bacteria 9267
520 Ga0450918_006895 3300042531 Bacteria 2018
521 Ga0466972_0001578 3300044658 Bacteria 11124
522 Ga0466965_0086719 3300044683 Bacteria 1588
523 Ga0466971_0234295 3300044719 Bacteria 872
524 Ga0466970_0075878 3300044765 Bacteria 1811
525 Ga0466957_0074081 3300044842 Bacteria 2111
526 Ga0451576_0147436 3300045051 Bacteria 2454
527 Ga0495627_006828 3300046453 Bacteria 4439
528 Ga0495627_027845 3300046453 Bacteria 1809
529 Ga0495650_0067401 3300046471 Bacteria 1414
530 Ga0495639_0002546 3300046475 Bacteria 7952
531 Ga0495584_0003469 3300046491 Bacteria 8673
532 Ga0495585_0053252 3300046492 Bacteria 2240
533 Ga0495583_0000793 3300046506 Bacteria 39114
534 Ga0495606_0005138 3300046507 Bacteria 12695
535 Ga0495606_0007042 3300046507 Bacteria 10192
536 Ga0495606_0155394 3300046507 Bacteria 1339
537 Ga0495620_0137700 3300046515 Bacteria 955
538 Ga0495630_0000030 3300046517 Bacteria 139077
539 Ga0495637_0000370 3300046520 Bacteria 33899
540 Ga0495637_0001189 3300046520 Bacteria 15841
541 Ga0495663_0044485 3300046525 Bacteria 1359
542 Ga0495654_0062108 3300046530 Bacteria 1792
543 Ga0495654_0077578 3300046530 Bacteria 1563
544 Ga0495586_0022024 3300046535 Bacteria 3401
545 Ga0495621_0036563 3300046539 Bacteria 1705
546 Ga0495621_0037761 3300046539 Bacteria 1681
547 Ga0495597_0003400 3300046542 Bacteria 9320
548 Ga0495645_0343906 3300046543 Bacteria 963
549 Ga0495656_0001230 3300046615 Bacteria 8327
550 Ga0495656_0013520 3300046615 Bacteria 3039
551 Ga0495668_0000681 3300046616 Bacteria 40916
552 Ga0495625_0000638 3300046660 Bacteria 50402
553 Ga0495625_0018461 3300046660 Bacteria 5445
554 Ga0495625_0024281 3300046660 Bacteria 4615
555 Ga0495625_0114367 3300046660 Bacteria 1842
556 Ga0495625_0193880 3300046660 Bacteria 1344
557 Ga0495659_0000557 3300046664 Bacteria 13692
558 Ga0495588_0043306 3300046674 Bacteria 2303
559 Ga0495670_0027741 3300046691 Bacteria 2807
560 Ga0495671_0000086 3300046692 Bacteria 87499
561 Ga0495649_0004901 3300046694 Bacteria 8635
562 Ga0495589_0008420 3300046794 Bacteria 5391
563 Ga0495636_0011051 3300047318 Bacteria 3573
564 Ga0495672_0000458 3300047320 Bacteria 48213
565 Ga0495673_0088134 3300047469 Bacteria 1272
566 Ga0495686_0006678 3300047472 Bacteria 8780
567 Ga0496101_0006811 3300048904 Bacteria 7371
568 Ga0496103_0028850 3300048906 Bacteria 3370
569 Ga0496104_0025417 3300048907 Bacteria 5459
570 Ga0496104_0027094 3300048907 Bacteria 5300
571 Ga0496105_0002846 3300048908 Bacteria 12657
572 Ga0496106_0058106 3300048909 Bacteria 2927
573 Ga0496106_0321985 3300048909 Bacteria 1241
574 Ga0496107_0029116 3300048910 Bacteria 3927
575 Ga0496108_0056426 3300048911 Bacteria 3300
576 Ga0496108_0068954 3300048911 Bacteria 2984
577 Ga0496108_0224766 3300048911 Bacteria 1631
578 Ga0496109_0061608 3300048912 Bacteria 3430
579 Ga0496109_0121333 3300048912 Bacteria 2435
580 Ga0496109_0245079 3300048912 Bacteria 1687
581 Ga0496110_0052425 3300048913 Bacteria 3584
582 Ga0496110_0123111 3300048913 Bacteria 2338
583 Ga0496111_0116415 3300048914 Bacteria 1971
584 Ga0496111_0278171 3300048914 Bacteria 1241
585 Ga0496114_0006538 3300048917 Bacteria 9186
586 Ga0496114_0043794 3300048917 Bacteria 3711
587 Ga0496114_0097975 3300048917 Bacteria 2499
588 Ga0496114_0128320 3300048917 Bacteria 2188
589 Ga0496114_0158950 3300048917 Bacteria 1964
590 Ga0496114_0518415 3300048917 Bacteria 1054
591 Ga0496117_0004897 3300048920 Bacteria 14423
592 Ga0496121_0006346 3300048924 Bacteria 14735
593 Ga0496121_0008905 3300048924 Bacteria 11654
594 Ga0496121_0049489 3300048924 Bacteria 3563
595 Ga0496122_0034206 3300048925 Bacteria 4163
596 Ga0496122_0199841 3300048925 Bacteria 1170
597 Ga0496123_0004412 3300048926 Bacteria 14811
598 Ga0496124_0001194 3300048927 Bacteria 40486
599 Ga0496125_0121450 3300048928 Bacteria 1863
600 Ga0496126_0044652 3300048929 Bacteria 4079
601 Ga0495678_000302 3300049459 Bacteria 53782
602 Ga0501033_0053494 3300049570 Bacteria 2990
603 Ga0501034_0000222 3300049571 Bacteria 108857
604 Ga0501034_0000898 3300049571 Bacteria 43341
605 Ga0501036_0189614 3300049572 Bacteria 1730
606 Ga0501036_0433907 3300049572 Bacteria 1095
607 Ga0501038_0141493 3300049574 Bacteria 1968
608 Ga0501039_0010790 3300049575 Bacteria 6958
609 Ga0501039_0015187 3300049575 Bacteria 5893
610 Ga0501040_0028612 3300049576 Bacteria 3758
611 Ga0501041_0002404 3300049577 Bacteria 10600
612 Ga0501041_0006696 3300049577 Bacteria 6752
613 Ga0501041_0357588 3300049577 Bacteria 923
614 Ga0501042_0366992 3300049578 Bacteria 1042
615 Ga0501043_0000101 3300049579 Bacteria 78983
616 Ga0501043_0012695 3300049579 Bacteria 6588
617 Ga0501043_0139603 3300049579 Bacteria 1898
618 Ga0501043_0169394 3300049579 Bacteria 1704
619 Ga0501043_0254805 3300049579 Bacteria 1351
620 Ga0501046_0000135 3300049580 Bacteria 79084
621 Ga0501046_0246501 3300049580 Bacteria 1316
622 Ga0501047_0000173 3300049581 Bacteria 79071
623 Ga0501048_0000452 3300049582 Bacteria 28741
624 Ga0501048_0189279 3300049582 Bacteria 1458
625 Ga0501071_0011488 3300049587 Bacteria 5969
626 Ga0501071_0014912 3300049587 Bacteria 5325
627 Ga0501072_0037193 3300049588 Bacteria 3817
628 Ga0501072_0200199 3300049588 Bacteria 1592
629 Ga0501075_0058953 3300049591 Bacteria 2891
630 Ga0501075_0344075 3300049591 Bacteria 1136
631 Ga0501076_0006136 3300049592 Bacteria 8698
632 Ga0501076_0011408 3300049592 Bacteria 6617
633 Ga0501077_0029861 3300049593 Bacteria 3467
634 Ga0501223_021719 3300049663 Bacteria 1255
635 Ga0501225_0035994 3300049705 Bacteria 1364
636 Ga0501079_0425576 3300049741 Bacteria 1042
637 Ga0501081_0015619 3300049743 Bacteria 5012
638 Ga0501081_0312261 3300049743 Bacteria 1154
639 Ga0501262_000176 3300049759 Bacteria 8070
640 Ga0501269_000229 3300049766 Bacteria 16443
641 Ga0501035_0020829 3300049822 Bacteria 6025
642 Ga0501035_0155201 3300049822 Bacteria 1984
643 Ga0501045_0002898 3300049824 Bacteria 11719
644 Ga0501045_0007526 3300049824 Bacteria 7568
645 Ga0501045_0062480 3300049824 Bacteria 2733
646 nmdc:mga03683_100965_c1 3300050489 Bacteria 1268
647 nmdc:mga03683_126965_c1 3300050489 Bacteria 1138
648 nmdc:mga03683_31153_c1 3300050489 Bacteria 2138
649 nmdc:mga03683_43024_c1 3300050489 Bacteria 1861
650 nmdc:mga03683_54099_c1 3300050489 Bacteria 1682
651 nmdc:mga03683_6403_c1 3300050489 Bacteria 4028
652 nmdc:mga03683_6512_c1 3300050489 Bacteria 4002
653 nmdc:mga03683_7996_c1 3300050489 Bacteria 3698
654 nmdc:mga03683_8539_c1 3300050489 Bacteria 3605
655 nmdc:mga03n38_7168_c1 3300050490 Bacteria 3927
656 nmdc:mga00v17_180286_c1 3300050491 Bacteria 1363
657 nmdc:mga00v17_36229_c1 3300050491 Bacteria 2940
658 nmdc:mga0yw44_13764_c1 3300050492 Bacteria 4272
659 nmdc:mga0yw44_147998_c1 3300050492 Bacteria 1530
660 nmdc:mga0yw44_28476_c1 3300050492 Bacteria 3213
661 nmdc:mga0yw44_478019_c1 3300050492 Bacteria 845
662 nmdc:mga0k408_22684_c1 3300050493 Bacteria 3536
663 nmdc:mga0k408_34040_c1 3300050493 Bacteria 2915
664 nmdc:mga0k408_89021_c1 3300050493 Bacteria 1813
665 nmdc:mga06z11_297568_c1 3300050494 Bacteria 959
666 nmdc:mga06z11_5710_c1 3300050494 Bacteria 5012
667 nmdc:mga04h51_48324_c1 3300050495 Bacteria 1417
668 nmdc:mga07m45_42522_c1 3300050496 Bacteria 2547
669 nmdc:mga07m45_527_c1 3300050496 Bacteria 16233
670 nmdc:mga05p37_6901_c1 3300050507 Bacteria 13387
671 nmdc:mga09592_159191_c1 3300050508 Bacteria 1950
672 nmdc:mga09592_4077_c1 3300050508 Bacteria 11795
673 nmdc:mga09592_5902_c1 3300050508 Bacteria 9989
674 nmdc:mga09592_859_c1 3300050508 Bacteria 23706
675 nmdc:mga0qj67_4193_c1 3300050509 Bacteria 10443
676 nmdc:mga06r32_220734_c1 3300050510 Bacteria 1884
677 nmdc:mga06r32_35242_c1 3300050510 Bacteria 4722
678 nmdc:mga08y16_14823_c1 3300050511 Bacteria 8197
679 nmdc:mga08y16_431644_c1 3300050511 Bacteria 1345
680 nmdc:mga0rr50_95526_c1 3300050513 Bacteria 2323
681 nmdc:mga0sz30_2905_c1 3300050516 Bacteria 6140
682 Ga0500610_0001037 3300053079 Bacteria 9100
683 Ga0500610_0021069 3300053079 Bacteria 3192
684 Ga0500635_0000025 3300053080 Bacteria 105726
685 Ga0500578_0001187 3300053086 Bacteria 27526
686 Ga0500644_0001451 3300053088 Bacteria 6255
687 Ga0500641_0008683 3300053096 Bacteria 3633
688 Ga0500641_0119735 3300053096 Bacteria 1134
689 Ga0500562_001416 3300053108 Bacteria 5893
690 Ga0500593_001175 3300053117 Bacteria 9454
691 Ga0500593_146308 3300053117 Bacteria 923
692 Ga0500597_197105 3300053120 Bacteria 847
693 Ga0500607_000368 3300053121 Bacteria 43100
694 Ga0500608_009545 3300053122 Bacteria 4127
695 Ga0500628_002085 3300053129 Bacteria 3354
696 Ga0500561_0025890 3300053137 Bacteria 1432
697 Ga0500568_0008442 3300053139 Bacteria 4960
698 Ga0500604_0005928 3300053151 Bacteria 3228
699 Ga0500619_000183 3300053154 Bacteria 14804
700 Ga0500622_0125911 3300053156 Bacteria 1237
701 Ga0500627_0017867 3300053158 Bacteria 2795
702 Ga0500636_0153269 3300053177 Bacteria 1263
703 Ga0500587_002124 3300053739 Bacteria 2830
704 Ga0501084_0023612 3300054114 Bacteria 5129
705 Ga0501084_0056926 3300054114 Bacteria 3271
706 Ga0501082_0005977 3300060353 Bacteria 10555
707 Ga0501082_0014790 3300060353 Bacteria 6719
708 Ga0466962_0012160 3300061719 Bacteria 4138
709 Ga0530510_0022112 3300061734 Bacteria 4528
710 2587754043 2585428062 Bacteria 6842168
711 2643816855 2643221559 Bacteria 4424915
712 2643880333 2643221573 Bacteria 4784121
713 2643915481 2643221581 Bacteria 3893603
714 2643934351 2643221585 Bacteria 5812563
715 2643939275 2643221586 Bacteria 4446529
716 2643970832 2643221592 Bacteria 6608788
717 2643976020 2643221593 Bacteria 6296053
718 2644061923 2643221609 Bacteria 6756331
719 2644071569 2643221611 Bacteria 6820941
720 2644077951 2643221612 Bacteria 4361984
721 2644138895 2643221625 Bacteria 6512927
722 2644159153 2643221628 Bacteria 5745828
723 2644255374 2643221645 Bacteria 7207331
724 2644273874 2643221648 Bacteria 6521465
725 2644315838 2643221656 Bacteria 5809961
726 2644359898 2643221664 Bacteria 7272945
727 2644468701 2643221683 Bacteria 5749203
728 2644696252 2643221727 Bacteria 4415595
729 2644698992 2643221728 Bacteria 4797149
730 2738720987 2738541277 Bacteria 7458140
731 2738742656 2738541280 Bacteria 6630198
732 2738846566 2738541300 Bacteria 6675882
733 2738880979 2738541307 Bacteria 8606193
734 2739245075 2738543012 Bacteria 7115078
735 2739277208 2738543018 Bacteria 6718814
736 2739280186 2738543019 Bacteria 7459457
737 2739346232 2738543030 Bacteria 6719714
738 2816474568 2816332133 Bacteria 7249298
739 2842680949 2842677519 Bacteria 5615038
740 2894025053 2894023352 Bacteria 5167372
741 2894417004 2894414249 Bacteria 4405451
742 2904453405 2904449895 Bacteria 6927402
743 2904459376 2904456579 Bacteria 6819253
744 2919466757 2919462493 Bacteria 5817112
745 2923518992 2923516293 Bacteria 3716336
746 2929523138 2929520902 Bacteria 6765052
747 2945910479 2945909444 Bacteria 7065066
748 2945948485 2945945610 Bacteria 5951079
749 2945972174 2945972063 Bacteria 6086495
750 2945987465 2945984333 Bacteria 7358892
751 Ga0055528_1000377
752 SwRhRL2b_contig_2058914
753 JGI25156J39149_1000016
754 JGI25156J39149_1000061
755 JGI25157J39369_1000035
756 JGI25157J39369_1000180
757 JGI25151J46595_10001011
758 rootH1_10001573
759 rootL2_10049763
760 rootL2_10055265
761 rootH1_10154922
762 Ga0006562J51391_1111735
763 Ga0055539_1000124
764 Ga0055539_1008631
765 Ga0055533_1000024
766 Ga0055525_1001151
767 Ga0055535_1000183
768 Ga0055535_1000393
769 Ga0055535_1006549
770 Ga0055529_1000064
771 Ga0055529_1002064
772 Ga0055526_1032910
773 Ga0055537_1000010
774 Ga0055524_1002702
775 Ga0055524_1002878
776 Ga0055536_1002555
777 Ga0055536_1007581
778 Ga0055536_1011792
779 Ga0055534_1000015
780 Ga0055534_1003939
781 Ga0055534_1024889
782 Ga0055528_1027352
783 Ga0055530_10005109
784 Ga0055540_1000015
785 Ga0055540_1000625
786 Ga0055540_1001156
787 Ga0055531_10009441
788 Ga0055531_10031543
789 Ga0065165_1003590
790 Ga0065714_10012400
791 Ga0065714_10098198
792 Ga0065714_10135375
793 Ga0065704_10071167
794 Ga0065704_10190037
795 Ga0070658_10006378
796 Ga0070658_10393348
797 Ga0070676_10042449
798 Ga0070676_10059644
799 Ga0070683_100007807
800 Ga0070690_100069279
801 Ga0070690_100279968
802 Ga0070670_100015017
803 Ga0070670_100052538
804 Ga0070677_10001118
805 Ga0070677_10097407
806 Ga0070677_10159219
807 Ga0070666_10246187
808 Ga0070682_100461931
809 Ga0068868_100184829
810 Ga0068868_100342648
811 Ga0070660_100115501
812 Ga0070660_100374063
813 Ga0070661_100001406
814 Ga0070661_100039349
815 Ga0070661_100292933
816 Ga0070668_100211738
817 Ga0070669_100001153
818 Ga0070669_100219498
819 Ga0070669_100238623
820 Ga0070669_100306889
821 Ga0070675_100000219
822 Ga0070675_100073009
823 Ga0070675_100266688
824 Ga0070675_100321492
825 Ga0070671_100014483
826 Ga0070671_100073955
827 Ga0070674_100008397
828 Ga0070674_100030134
829 Ga0070674_100171135
830 Ga0070673_100016775
831 Ga0070673_100236884
832 Ga0070673_100524112
833 Ga0070667_100130790
834 Ga0070667_100423243
835 Ga0070714_100675924
836 Ga0070713_100173092
837 Ga0070713_100230015
838 Ga0070713_100437197
839 Ga0070711_100490847
840 Ga0070663_100307632
841 Ga0070678_100082305
842 Ga0070678_100104732
843 Ga0070678_100321072
844 Ga0070662_100007583
845 Ga0070662_100303250
846 Ga0068867_100000257
847 Ga0068867_100000287
848 Ga0068867_100549100
849 Ga0068867_100587446
850 Ga0070706_100046962
851 Ga0070706_100147422
852 Ga0070707_100311578
853 Ga0070698_100131748
854 Ga0070699_100123539
855 Ga0070697_100118575
856 Ga0068853_100059813
857 Ga0070672_100024889
858 Ga0070672_100116189
859 Ga0070672_100128982
860 Ga0070672_100164859
861 Ga0070686_100468523
862 Ga0070665_100005593
863 Ga0070665_100027314
864 Ga0070665_100749225
865 Ga0068855_100032438
866 Ga0068855_100040092
867 Ga0068855_100055019
868 Ga0068855_100202244
869 Ga0068855_100655682
870 Ga0070664_100005979
871 Ga0070664_100006836
872 Ga0068857_100155059
873 Ga0068857_100413942
874 Ga0068854_100018452
875 Ga0068856_100005465
876 Ga0068856_100135356
877 Ga0068852_100036176
878 Ga0068852_100077532
879 Ga0068859_100288940
880 Ga0068859_100637578
881 Ga0068864_100031303
882 Ga0068864_100083709
883 Ga0068864_100471248
884 Ga0068866_10001764
885 Ga0068861_100022190
886 Ga0068861_100821686
887 Ga0068851_10215542
888 Ga0068851_10256556
889 Ga0068870_10041850
890 Ga0068870_10119732
891 Ga0068870_10303013
892 Ga0068863_100093710
893 Ga0068863_100120711
894 Ga0068858_100033996
895 Ga0068860_100000444
896 Ga0068860_100181705
897 Ga0068862_100005619
898 Ga0068862_100007521
899 Ga0068862_100087278
900 Ga0081455_10000211
901 Ga0081455_10023053
902 Ga0081455_10033603
903 Ga0081455_10221551
904 Ga0081539_10012312
905 Ga0081539_10029495
906 Ga0070717_10072109
907 Ga0070717_10441651
908 Ga0075365_10048421
909 Ga0075365_10059553
910 Ga0075365_10131459
911 Ga0075368_10067240
912 Ga0075363_100072347
913 Ga0075364_10034721
914 Ga0075364_10057960
915 Ga0075364_10099648
916 Ga0075432_10017697
917 Ga0070712_100569735
918 Ga0075362_10075928
919 Ga0075367_10071757
920 Ga0075369_10014386
921 Ga0075369_10142855
922 Ga0075366_10014177
923 Ga0075366_10022500
924 Ga0097621_100010684
925 Ga0097621_100022185
926 Ga0097621_100284698
927 Ga0097621_100439109
928 Ga0097621_100504782
929 Ga0075370_10029763
930 Ga0075370_10049998
931 Ga0068871_100017429
932 Ga0068871_100026498
933 Ga0075428_100084707
934 Ga0075431_100005078
935 Ga0075429_100002970
936 Ga0075429_100006854
937 Ga0075429_100396202
938 Ga0068865_100072113
939 Ga0068865_100177807
940 Ga0068865_100537199
941 Ga0097620_100104708
942 Ga0097620_100288967
943 Ga0097620_100637647
944 Ga0099826_10062906
945 Ga0075435_100110885
946 Ga0105240_10003444
947 Ga0105240_10039722
948 Ga0105240_10048411
949 Ga0105240_10331375
950 Ga0111539_10015684
951 Ga0105245_10504539
952 Ga0114129_10007699
953 Ga0114129_10171771
954 Ga0105243_10001557
955 Ga0105243_10001974
956 Ga0105243_10036123
957 Ga0105241_10092724
958 Ga0105242_10004095
959 Ga0105242_10006406
960 Ga0105242_10631983
961 Ga0105248_10001750
962 Ga0105248_10209272
963 Ga0105238_10009551
964 Ga0105238_10059850
965 Ga0105249_10554275
966 Ga0105249_10652291
967 Ga0105239_10047798
968 Ga0105239_10113071
969 Ga0105246_10048831
970 Ga0105246_10278320
971 Ga0157373_10036351
972 Ga0157373_10268384
973 Ga0157370_10001585
974 Ga0157370_10121753
975 Ga0157370_10469454
976 Ga0157369_10070182
977 Ga0157378_10047413
978 Ga0163162_10005859
979 Ga0163162_10075011
980 Ga0163162_10181586
981 Ga0163162_10244309
982 Ga0157372_10008371
983 Ga0157372_10099893
984 Ga0157372_10477128
985 Ga0157375_10042937
986 Ga0157375_10144787
987 Ga0157375_10303401
988 Ga0157375_10724851
989 Ga0157380_10195170
990 Ga0157380_10294006
991 Ga0182008_10000711
992 Ga0182008_10021087
993 Ga0182008_10100425
994 Ga0157379_10243909
995 Ga0157376_10000023
996 Ga0182006_1000964
997 Ga0182006_1092354
998 Ga0182007_10003164
999 Ga0182007_10045136
1000 Ga0163161_10000127
1001 Ga0163161_10065478
1002 Ga0213872_10030461
1003 Ga0209674_100007
1004 Ga0209672_103582
1005 Ga0209563_100060
1006 Ga0209258_100124
1007 Ga0209258_100415
1008 Ga0207425_1008473
1009 Ga0207425_1034144
1010 Ga0209646_1000056
1011 Ga0209026_1000009
1012 Ga0209677_100108
1013 Ga0209677_100198
1014 Ga0209759_1000035
1015 Ga0209759_1001942
1016 Ga0209129_1003835
1017 Ga0209565_1000025
1018 Ga0209565_1010809
1019 Ga0209565_1013694
1020 Ga0209455_1000114
1021 Ga0209455_1000337
1022 Ga0209673_1000077
1023 Ga0209673_1001615
1024 Ga0209673_1006170
1025 Ga0209130_1016584
1026 Ga0209675_1000017
1027 Ga0209675_1001897
1028 Ga0209675_1027953
1029 Ga0209676_1000034
1030 Ga0209676_1000785
1031 Ga0209676_1003468
1032 Ga0209676_1020288
1033 Ga0209025_1000005
1034 Ga0209025_1001450
1035 Ga0209025_1002222
1036 Ga0209025_1035923
1037 Ga0209564_1004349
1038 Ga0209564_1039105
1039 Ga0209758_1024888
1040 Ga0209050_1000170
1041 Ga0209050_1000528
1042 Ga0209050_1000529
1043 Ga0209256_1000120
1044 Ga0209256_1000980
1045 Ga0209051_1000020
1046 Ga0209051_1000271
1047 Ga0209051_1000398
1048 Ga0209051_1016226
1049 Ga0209051_1020044
1050 Ga0209257_1000189
1051 Ga0209257_1000727
1052 Ga0209257_1004132
1053 Ga0209257_1007879
1054 Ga0209257_1009161
1055 Ga0207697_10155989
1056 Ga0207655_1003754
1057 Ga0207655_1047804
1058 Ga0207682_10000318
1059 Ga0207642_10003806
1060 Ga0207680_10115550
1061 Ga0207645_10053165
1062 Ga0207643_10223059
1063 Ga0207643_10290194
1064 Ga0207705_10232650
1065 Ga0207684_10091817
1066 Ga0207684_10099326
1067 Ga0207684_10221853
1068 Ga0207695_10001146
1069 Ga0207695_10125579
1070 Ga0207662_10036678
1071 Ga0207657_10174036
1072 Ga0207649_10023829
1073 Ga0207646_10151450
1074 Ga0207646_10624795
1075 Ga0207681_10001999
1076 Ga0207681_10334874
1077 Ga0207694_10014155
1078 Ga0207694_10070372
1079 Ga0207694_10181914
1080 Ga0207650_10000435
1081 Ga0207650_10027784
1082 Ga0207650_10490009
1083 Ga0207659_10000301
1084 Ga0207659_10327028
1085 Ga0207700_10097431
1086 Ga0207700_10135300
1087 Ga0207664_10461960
1088 Ga0207664_10691548
1089 Ga0207644_10031872
1090 Ga0207644_10037348
1091 Ga0207690_10095180
1092 Ga0207709_10000295
1093 Ga0207709_10006321
1094 Ga0207709_10031111
1095 Ga0207709_10054605
1096 Ga0207669_10000291
1097 Ga0207669_10030757
1098 Ga0207669_10072473
1099 Ga0207704_10004798
1100 Ga0207704_10428917
1101 Ga0207691_10000148
1102 Ga0207691_10010991
1103 Ga0207691_10020929
1104 Ga0207691_10077217
1105 Ga0207691_10113200
1106 Ga0207711_10218808
1107 Ga0207689_10220933
1108 Ga0207661_10007104
1109 Ga0207661_10349605
1110 Ga0207679_10000088
1111 Ga0207679_10000265
1112 Ga0207667_10024754
1113 Ga0207667_10059920
1114 Ga0207667_10119750
1115 Ga0207667_10523706
1116 Ga0207651_10007310
1117 Ga0207651_10093246
1118 Ga0207712_10342035
1119 Ga0207668_10138875
1120 Ga0207658_10104335
1121 Ga0207658_10211584
1122 Ga0207658_10447202
1123 Ga0207677_10396024
1124 Ga0207703_10010771
1125 Ga0207703_10052243
1126 Ga0207639_10016455
1127 Ga0207639_10353577
1128 Ga0207708_10000659
1129 Ga0207708_10071198
1130 Ga0207702_10007291
1131 Ga0207702_10016789
1132 Ga0207641_10078072
1133 Ga0207641_10108254
1134 Ga0207641_10644410
1135 Ga0207648_10000283
1136 Ga0207648_10000741
1137 Ga0207648_10001569
1138 Ga0207648_10144894
1139 Ga0207648_10169073
1140 Ga0207648_10185179
1141 Ga0207648_10237217
1142 Ga0207676_10005361
1143 Ga0207676_10703245
1144 Ga0207674_10004183
1145 Ga0207674_10067265
1146 Ga0207674_10356524
1147 Ga0207675_100000946
1148 Ga0207675_100119096
1149 Ga0207675_100848070
1150 Ga0207675_101037710
1151 Ga0207683_10027159
1152 Ga0207683_10076230
1153 Ga0207698_10004401
1154 Ga0209282_1000229
1155 Ga0209813_10070936
1156 Ga0207428_10010548
1157 Ga0268266_10000276
1158 Ga0268265_10017636
1159 Ga0268265_10051884
1160 Ga0268265_10583115
1161 Ga0268264_10008357
1162 Ga0268264_10641211
1163 Ga0265336_10000022
1164 Ga0307517_10100690
1165 Ga0307515_10000212
1166 Ga0307515_10001343
1167 Ga0307515_10002672
1168 Ga0307515_10003631
1169 Ga0307515_10006216
1170 Ga0307515_10110109
1171 Ga0307511_10138468
1172 Ga0316177_1121344
1173 Ga0314311_1150282
1174 Ga0314311_1170870
1175 Ga0316179_1019061
1176 Ga0316183_1128149
1177 Ga0316181_1134026
1178 Ga0316182_1365804
1179 Ga0265327_10000841
1180 Ga0265327_10008749
1181 Ga0265327_10117302
1182 Ga0307509_10023870
1183 Ga0307509_10109053
1184 Ga0307408_100029462
1185 Ga0307408_100044597
1186 Ga0307408_100086803
1187 Ga0307408_100087023
1188 Ga0307408_100119983
1189 Ga0307408_100252878
1190 Ga0307508_10000549
1191 Ga0307508_10060284
1192 Ga0307508_10200014
1193 Ga0307514_10003783
1194 Ga0307514_10230827
1195 Ga0316575_10164074
1196 Ga0307516_10000926
1197 Ga0307516_10001203
1198 Ga0307516_10005479
1199 Ga0307516_10009294
1200 Ga0307405_10023689
1201 Ga0307405_10033160
1202 Ga0307405_10059202
1203 Ga0307405_10254474
1204 Ga0307413_10202749
1205 Ga0307406_10000356
1206 Ga0307406_10000418
1207 Ga0307406_10036690
1208 Ga0307406_10288612
1209 Ga0307412_10005923
1210 Ga0307412_10022514
1211 Ga0307412_10060115
1212 Ga0307412_10143127
1213 Ga0307412_10413423
1214 Ga0307409_100000680
1215 Ga0307416_100001182
1216 Ga0307416_100618044
1217 Ga0307416_101141087
1218 Ga0307414_10069798
1219 Ga0307411_10151779
1220 Ga0307411_10293811
1221 Ga0307415_100003784
1222 Ga0316583_10015793
1223 Ga0373937_0821452
1224 Ga0373925_0070054
1225 Ga0395899_0047170
1226 Ga0395899_0250249
1227 Ga0395900_0066916
1228 Ga0395898_0024937
1229 Ga0395905_0001288
1230 Ga0395905_0086403
1231 Ga0395905_0114921
1232 Ga0395905_0269989
1233 Ga0395905_0405666
1234 Ga0395901_0010155
1235 Ga0395901_0013644
1236 Ga0395901_0070453
1237 Ga0395901_0248551
1238 Ga0436360_0378379
1239 Ga0436361_0201117
1240 Ga0436361_0759821
1241 Ga0436361_1117914
1242 Ga0436361_1173055
1243 Ga0439447_000529
1244 Ga0439461_0021134
1245 Ga0439465_0000084
1246 Ga0439465_0040571
1247 Ga0451793_1414310
1248 Ga0451833_1255216
1249 Ga0451845_0393817
1250 Ga0451853_0547373
1251 Ga0451853_1218881
1252 Ga0439445_0056153
1253 Ga0439448_0074588
1254 Ga0439432_074696
1255 Ga0439449_0000268
1256 Ga0439449_0008418
1257 Ga0439452_062604
1258 Ga0450917_000970
1259 Ga0450888_000401
1260 Ga0450898_010536
1261 Ga0450903_016201
1262 Ga0450889_001420
1263 Ga0450906_023736
1264 Ga0450910_013718
1265 Ga0439446_0002028
1266 Ga0450908_006003
1267 Ga0439434_0026513
1268 Ga0439434_0075677
1269 Ga0450918_000414
1270 Ga0450918_006895
1271 Ga0466972_0001578
1272 Ga0466965_0086719
1273 Ga0466971_0234295
1274 Ga0466970_0075878
1275 Ga0466957_0074081
1276 Ga0451576_0147436
1277 Ga0495627_006828
1278 Ga0495627_027845
1279 Ga0495650_0067401
1280 Ga0495639_0002546
1281 Ga0495584_0003469
1282 Ga0495585_0053252
1283 Ga0495583_0000793
1284 Ga0495606_0005138
1285 Ga0495606_0007042
1286 Ga0495606_0155394
1287 Ga0495620_0137700
1288 Ga0495630_0000030
1289 Ga0495637_0000370
1290 Ga0495637_0001189
1291 Ga0495663_0044485
1292 Ga0495654_0062108
1293 Ga0495654_0077578
1294 Ga0495586_0022024
1295 Ga0495621_0036563
1296 Ga0495621_0037761
1297 Ga0495597_0003400
1298 Ga0495645_0343906
1299 Ga0495656_0001230
1300 Ga0495656_0013520
1301 Ga0495668_0000681
1302 Ga0495625_0000638
1303 Ga0495625_0018461
1304 Ga0495625_0024281
1305 Ga0495625_0114367
1306 Ga0495625_0193880
1307 Ga0495659_0000557
1308 Ga0495588_0043306
1309 Ga0495670_0027741
1310 Ga0495671_0000086
1311 Ga0495649_0004901
1312 Ga0495589_0008420
1313 Ga0495636_0011051
1314 Ga0495672_0000458
1315 Ga0495673_0088134
1316 Ga0495686_0006678
1317 Ga0496101_0006811
1318 Ga0496103_0028850
1319 Ga0496104_0025417
1320 Ga0496104_0027094
1321 Ga0496105_0002846
1322 Ga0496106_0058106
1323 Ga0496106_0321985
1324 Ga0496107_0029116
1325 Ga0496108_0056426
1326 Ga0496108_0068954
1327 Ga0496108_0224766
1328 Ga0496109_0061608
1329 Ga0496109_0121333
1330 Ga0496109_0245079
1331 Ga0496110_0052425
1332 Ga0496110_0123111
1333 Ga0496111_0116415
1334 Ga0496111_0278171
1335 Ga0496114_0006538
1336 Ga0496114_0043794
1337 Ga0496114_0097975
1338 Ga0496114_0128320
1339 Ga0496114_0158950
1340 Ga0496114_0518415
1341 Ga0496117_0004897
1342 Ga0496121_0006346
1343 Ga0496121_0008905
1344 Ga0496121_0049489
1345 Ga0496122_0034206
1346 Ga0496122_0199841
1347 Ga0496123_0004412
1348 Ga0496124_0001194
1349 Ga0496125_0121450
1350 Ga0496126_0044652
1351 Ga0495678_000302
1352 Ga0501033_0053494
1353 Ga0501034_0000222
1354 Ga0501034_0000898
1355 Ga0501036_0189614
1356 Ga0501036_0433907
1357 Ga0501038_0141493
1358 Ga0501039_0010790
1359 Ga0501039_0015187
1360 Ga0501040_0028612
1361 Ga0501041_0002404
1362 Ga0501041_0006696
1363 Ga0501041_0357588
1364 Ga0501042_0366992
1365 Ga0501043_0000101
1366 Ga0501043_0012695
1367 Ga0501043_0139603
1368 Ga0501043_0169394
1369 Ga0501043_0254805
1370 Ga0501046_0000135
1371 Ga0501046_0246501
1372 Ga0501047_0000173
1373 Ga0501048_0000452
1374 Ga0501048_0189279
1375 Ga0501071_0011488
1376 Ga0501071_0014912
1377 Ga0501072_0037193
1378 Ga0501072_0200199
1379 Ga0501075_0058953
1380 Ga0501075_0344075
1381 Ga0501076_0006136
1382 Ga0501076_0011408
1383 Ga0501077_0029861
1384 Ga0501223_021719
1385 Ga0501225_0035994
1386 Ga0501079_0425576
1387 Ga0501081_0015619
1388 Ga0501081_0312261
1389 Ga0501262_000176
1390 Ga0501269_000229
1391 Ga0501035_0020829
1392 Ga0501035_0155201
1393 Ga0501045_0002898
1394 Ga0501045_0007526
1395 Ga0501045_0062480
1396 nmdc:mga03683_100965_c1
1397 nmdc:mga03683_126965_c1
1398 nmdc:mga03683_31153_c1
1399 nmdc:mga03683_43024_c1
1400 nmdc:mga03683_54099_c1
1401 nmdc:mga03683_6403_c1
1402 nmdc:mga03683_6512_c1
1403 nmdc:mga03683_7996_c1
1404 nmdc:mga03683_8539_c1
1405 nmdc:mga03n38_7168_c1
1406 nmdc:mga00v17_180286_c1
1407 nmdc:mga00v17_36229_c1
1408 nmdc:mga0yw44_13764_c1
1409 nmdc:mga0yw44_147998_c1
1410 nmdc:mga0yw44_28476_c1
1411 nmdc:mga0yw44_478019_c1
1412 nmdc:mga0k408_22684_c1
1413 nmdc:mga0k408_34040_c1
1414 nmdc:mga0k408_89021_c1
1415 nmdc:mga06z11_297568_c1
1416 nmdc:mga06z11_5710_c1
1417 nmdc:mga04h51_48324_c1
1418 nmdc:mga07m45_42522_c1
1419 nmdc:mga07m45_527_c1
1420 nmdc:mga05p37_6901_c1
1421 nmdc:mga09592_159191_c1
1422 nmdc:mga09592_4077_c1
1423 nmdc:mga09592_5902_c1
1424 nmdc:mga09592_859_c1
1425 nmdc:mga0qj67_4193_c1
1426 nmdc:mga06r32_220734_c1
1427 nmdc:mga06r32_35242_c1
1428 nmdc:mga08y16_14823_c1
1429 nmdc:mga08y16_431644_c1
1430 nmdc:mga0rr50_95526_c1
1431 nmdc:mga0sz30_2905_c1
1432 Ga0500610_0001037
1433 Ga0500610_0021069
1434 Ga0500635_0000025
1435 Ga0500578_0001187
1436 Ga0500644_0001451
1437 Ga0500641_0008683
1438 Ga0500641_0119735
1439 Ga0500562_001416
1440 Ga0500593_001175
1441 Ga0500593_146308
1442 Ga0500597_197105
1443 Ga0500607_000368
1444 Ga0500608_009545
1445 Ga0500628_002085
1446 Ga0500561_0025890
1447 Ga0500568_0008442
1448 Ga0500604_0005928
1449 Ga0500619_000183
1450 Ga0500622_0125911
1451 Ga0500627_0017867
1452 Ga0500636_0153269
1453 Ga0500587_002124
1454 Ga0501084_0023612
1455 Ga0501084_0056926
1456 Ga0501082_0005977
1457 Ga0501082_0014790
1458 Ga0466962_0012160
1459 Ga0530510_0022112
1460 2587754043
1461 2643816855
1462 2643880333
1463 2643915481
1464 2643934351
1465 2643939275
1466 2643970832
1467 2643976020
1468 2644061923
1469 2644071569
1470 2644077951
1471 2644138895
1472 2644159153
1473 2644255374
1474 2644273874
1475 2644315838
1476 2644359898
1477 2644468701
1478 2644696252
1479 2644698992
1480 2738720987
1481 2738742656
1482 2738846566
1483 2738880979
1484 2739245075
1485 2739277208
1486 2739280186
1487 2739346232
1488 2816474568
1489 2842680949
1490 2894025053
1491 2894417004
1492 2904453405
1493 2904459376
1494 2919466757
1495 2923518992
1496 2929523138
1497 2945910479
1498 2945948485
1499 2945972174
1500 2945987465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

49

283

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bpf-assembly1.cif.gz_B crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8151 193 215
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.764 61 222
2yjh-assembly1.cif.gz_A-2 thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s 0.7538 68 216
3d3l-assembly1.cif.gz_A the 2.6 a crystal structure of the lipoxygenase domain of human arachidonate 12-lipoxygenase, 12s-type 0.7438 189 215
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.7339 61 218
ID Description Score Start End Superfamily
5d8dD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8168 193 216 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7872 193 216 3.30.470.20
af_P21264_187_380_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7702 189 215 3.30.470.20
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7682 69 156 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7639 61 222 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V6KS03-F1-model_v4 DUF899 domain-containing protein 0.986 40 254
AF-A0A2V6G796-F1-model_v4 DUF899 domain-containing protein 0.9859 23 254
AF-A0A538SV51-F1-model_v4 DUF899 domain-containing protein 0.9845 63 254
AF-A0A2S6R5Q2-F1-model_v4 Thioredoxin domain-containing protein 0.9824 23 203
AF-A0A2R8B491-F1-model_v4 Thioredoxin domain-containing protein 0.9822 25 255

Map