F479161

General Info

Members Datasets Scaffolds Average Seq Length
752 386 703 332

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1000906|Ga0209676_100090629
Length 376
Sequence MDKLQAPNPEYGQVVCVLWDLPVPRGGDRGVIIAGMRVLGIESSCDETGVAVYDTDLAGSAALRAHAVYSQIALHAEYGGVVPELASRDHVRKLLPLVRQTLAEAGLGVGDIDGVAYTAGPGLVGALLVGAGVARSLAWALEVPAVGVHHMEGHLLAPLMEDDPPEAPFVALLVSGGHTQLVAVDAIGQYRLLGETLDDAAGEAFDKTAKMMGLPYPGGPQLARLAEQGTPGVYRFARPMTDRPGLDFSFSGLKTQVLMAWRDSDQSEQTRADIARGFEDAVVETLSIKCERALEAAGTNVIVVAGGVGANKRLRARLQQMAERLGGRACFPRPALCTDNGAMIAFAGALRLQAGQHNPPKVDVTPRWDMATLPAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
5 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
6 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
9 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
17 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
18 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
19 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
20 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
21 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
22 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
23 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
24 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
25 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
26 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
27 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
28 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
29 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
30 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
31 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
32 2919513703 Luteimonas sp. 3794 Isolate Unclassified
33 2919675420 Luteimonas terrae 4099 Isolate Unclassified
34 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
35 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
36 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
37 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
38 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
39 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
40 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
41 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
42 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
43 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
44 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
45 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
46 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
47 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
48 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
49 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
52 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
100 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
101 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
102 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
112 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
156 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
157 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
163 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
223 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
224 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
228 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
229 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
230 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
261 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
262 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
263 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
270 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
273 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
386 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.22
Metatranscriptomes 0.27
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 9.57
Nodule 0.13
Rhizoplane 4.52
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_24145 2162886007 Bacteria 4392
2 JGI24739J22299_10004160 3300001989 Bacteria 5537
3 JGI25152J39213_1000039 3300002773 Bacteria 89573
4 JGI25150J39212_1000422 3300002774 Bacteria 19529
5 JGI25151J46595_10000008 3300003187 Bacteria 334180
6 JGI25151J46595_10000154 3300003187 Bacteria 89582
7 JGI25151J46595_10047611 3300003187 Bacteria 1490
8 JGI25153J46596_10000120 3300003215 Bacteria 89582
9 rootH2_10050576 3300003320 Bacteria 5405
10 JGI25160J50197_1006305 3300003354 Bacteria 4817
11 JGI25407J50210_10045132 3300003373 Bacteria 1124
12 Ga0055526_1000015 3300003771 Bacteria 226543
13 Ga0055526_1011436 3300003771 Bacteria 3996
14 Ga0055526_1011939 3300003771 Bacteria 3849
15 Ga0055537_1000132 3300003773 Bacteria 56953
16 Ga0055537_1000177 3300003773 Bacteria 47558
17 Ga0055524_1000132 3300003775 Bacteria 87907
18 Ga0055536_1000626 3300003781 Bacteria 24000
19 Ga0055536_1002286 3300003781 Bacteria 10882
20 Ga0055536_1007175 3300003781 Bacteria 5037
21 Ga0055534_1000055 3300003784 Bacteria 88009
22 Ga0055534_1000706 3300003784 Bacteria 16374
23 Ga0055534_1000870 3300003784 Bacteria 13802
24 Ga0055528_1000008 3300003790 Bacteria 226543
25 Ga0055528_1000045 3300003790 Bacteria 101917
26 Ga0055530_10002878 3300003791 Bacteria 10485
27 Ga0055531_10005845 3300003794 Bacteria 7108
28 Ga0055531_10011945 3300003794 Bacteria 4131
29 Ga0055531_10014427 3300003794 Bacteria 3556
30 Ga0058692_1000026 3300003856 Bacteria 203096
31 Ga0065704_10072580 3300005289 Bacteria 8305
32 Ga0070658_10069423 3300005327 Bacteria 2883
33 Ga0070658_10145276 3300005327 Bacteria 1983
34 Ga0070683_100060010 3300005329 Bacteria 3534
35 Ga0070683_100092653 3300005329 Bacteria 2838
36 Ga0070690_100036047 3300005330 Bacteria 3106
37 Ga0070670_100231701 3300005331 Bacteria 1607
38 Ga0070666_10257039 3300005335 Bacteria 1238
39 Ga0070680_100003170 3300005336 Bacteria 12221
40 Ga0070682_100011512 3300005337 Bacteria 5056
41 Ga0070660_100010096 3300005339 Bacteria 6662
42 Ga0070660_100170424 3300005339 Bacteria 1758
43 Ga0070668_100016107 3300005347 Bacteria 5594
44 Ga0070668_100019159 3300005347 Bacteria 5146
45 Ga0070668_100031994 3300005347 Bacteria 4003
46 Ga0070669_100049635 3300005353 Bacteria 3064
47 Ga0070674_100174385 3300005356 Bacteria 1642
48 Ga0070674_100254978 3300005356 Bacteria 1379
49 Ga0070673_100110039 3300005364 Bacteria 2283
50 Ga0070659_100001553 3300005366 Bacteria 16555
51 Ga0070659_100068955 3300005366 Bacteria 2807
52 Ga0070703_10000599 3300005406 Bacteria 12921
53 Ga0070709_10021134 3300005434 Bacteria 3788
54 Ga0070714_100062593 3300005435 Bacteria 3198
55 Ga0070713_100030412 3300005436 Bacteria 4288
56 Ga0070711_100248503 3300005439 Bacteria 1394
57 Ga0070705_100030815 3300005440 Bacteria 2964
58 Ga0070708_100002202 3300005445 Bacteria 15054
59 Ga0070708_100022520 3300005445 Bacteria 5345
60 Ga0070678_100038110 3300005456 Bacteria 3381
61 Ga0070681_10223970 3300005458 Bacteria 1796
62 Ga0068867_100193782 3300005459 Bacteria 1623
63 Ga0070706_100000503 3300005467 Bacteria 45861
64 Ga0070706_100208148 3300005467 Bacteria 1826
65 Ga0070707_100144123 3300005468 Bacteria 2318
66 Ga0070698_100022834 3300005471 Bacteria 6541
67 Ga0070698_100053404 3300005471 Bacteria 4106
68 Ga0070699_100132740 3300005518 Bacteria 2196
69 Ga0070679_100014388 3300005530 Bacteria 7599
70 Ga0070679_100098566 3300005530 Bacteria 2910
71 Ga0070684_100165652 3300005535 Bacteria 2006
72 Ga0070697_100000833 3300005536 Bacteria 23139
73 Ga0070672_100006123 3300005543 Bacteria 8051
74 Ga0070696_100045575 3300005546 Bacteria 3038
75 Ga0070693_100069355 3300005547 Bacteria 2072
76 Ga0070665_100394780 3300005548 Bacteria 1391
77 Ga0070704_100008393 3300005549 Bacteria 6193
78 Ga0068855_100002748 3300005563 Bacteria 21663
79 Ga0068855_100008913 3300005563 Bacteria 12128
80 Ga0068855_100163780 3300005563 Bacteria 2522
81 Ga0068855_100361331 3300005563 Bacteria 1597
82 Ga0070664_100170132 3300005564 Bacteria 1933
83 Ga0068857_100000234 3300005577 Bacteria 37184
84 Ga0068854_100011394 3300005578 Bacteria 5786
85 Ga0068856_100200048 3300005614 Bacteria 2012
86 Ga0068852_100002465 3300005616 Bacteria 12738
87 Ga0068861_100402577 3300005719 Bacteria 1215
88 Ga0068862_100001242 3300005844 Bacteria 24005
89 Ga0068862_100185166 3300005844 Bacteria 1871
90 Ga0081455_10005471 3300005937 Bacteria 13923
91 Ga0081455_10009400 3300005937 Bacteria 10057
92 Ga0081455_10055449 3300005937 Bacteria 3371
93 Ga0081538_10000132 3300005981 Bacteria 77110
94 Ga0081538_10000280 3300005981 Bacteria 58428
95 Ga0081538_10003124 3300005981 Bacteria 15747
96 Ga0081538_10004486 3300005981 Bacteria 12856
97 Ga0081538_10008088 3300005981 Bacteria 8979
98 Ga0081538_10015017 3300005981 Bacteria 6023
99 Ga0081538_10027674 3300005981 Bacteria 3922
100 Ga0081539_10002871 3300005985 Bacteria 22885
101 Ga0070717_10438328 3300006028 Bacteria 1176
102 Ga0075364_10000016 3300006051 Bacteria 57197
103 Ga0075432_10007403 3300006058 Bacteria 3738
104 Ga0075432_10019233 3300006058 Bacteria 2332
105 Ga0070715_10049380 3300006163 Bacteria 1802
106 Ga0075367_10156062 3300006178 Bacteria 1418
107 Ga0075369_10065216 3300006186 Bacteria 1596
108 Ga0097621_100024439 3300006237 Bacteria 4718
109 Ga0075428_100069454 3300006844 Bacteria 3851
110 Ga0075430_100045499 3300006846 Bacteria 3708
111 Ga0075431_100103054 3300006847 Bacteria 2945
112 Ga0075431_100103287 3300006847 Bacteria 2942
113 Ga0075431_100200873 3300006847 Bacteria 2039
114 Ga0075433_10051269 3300006852 Bacteria 3593
115 Ga0075434_100000846 3300006871 Bacteria 24336
116 Ga0075429_100040897 3300006880 Bacteria 4036
117 Ga0075436_100010273 3300006914 Bacteria 6410
118 Ga0099794_10009725 3300007265 Bacteria 4058
119 Ga0105251_10000135 3300009011 Bacteria 74718
120 Ga0105251_10004487 3300009011 Bacteria 9472
121 Ga0105244_10024368 3300009036 Bacteria 3303
122 Ga0105240_10009127 3300009093 Bacteria 14078
123 Ga0105240_10051930 3300009093 Bacteria 5156
124 Ga0111539_10028573 3300009094 Bacteria 6802
125 Ga0111539_10057290 3300009094 Bacteria 4628
126 Ga0111539_10113234 3300009094 Bacteria 3182
127 Ga0111539_10349560 3300009094 Bacteria 1721
128 Ga0105245_10003103 3300009098 Bacteria 14866
129 Ga0105245_10173198 3300009098 Bacteria 2056
130 Ga0114129_10013338 3300009147 Bacteria 11707
131 Ga0114129_10042807 3300009147 Bacteria 6373
132 Ga0114129_10108436 3300009147 Bacteria 3833
133 Ga0114129_10239391 3300009147 Bacteria 2440
134 Ga0114129_10493503 3300009147 Bacteria 1600
135 Ga0105243_10022597 3300009148 Bacteria 4782
136 Ga0105243_10051475 3300009148 Bacteria 3257
137 Ga0105241_10162986 3300009174 Bacteria 1834
138 Ga0105242_10131717 3300009176 Bacteria 2159
139 Ga0105242_10355426 3300009176 Bacteria 1354
140 Ga0105248_10353770 3300009177 Bacteria 1654
141 Ga0105237_10029977 3300009545 Bacteria 5527
142 Ga0105237_10053657 3300009545 Bacteria 4043
143 Ga0105238_10259111 3300009551 Bacteria 1718
144 Ga0105249_10022114 3300009553 Bacteria 5696
145 Ga0105239_10045602 3300010375 Bacteria 4805
146 Ga0105239_10124122 3300010375 Bacteria 2869
147 Ga0157373_10152790 3300013100 Bacteria 1624
148 Ga0157373_10172457 3300013100 Bacteria 1522
149 Ga0157371_10001308 3300013102 Bacteria 26174
150 Ga0157371_10076836 3300013102 Bacteria 2364
151 Ga0157371_10084153 3300013102 Bacteria 2253
152 Ga0157370_10004629 3300013104 Bacteria 15729
153 Ga0157370_10022411 3300013104 Bacteria 6284
154 Ga0157370_10054285 3300013104 Bacteria 3819
155 Ga0157369_10014378 3300013105 Bacteria 8937
156 Ga0157369_10031143 3300013105 Bacteria 5878
157 Ga0157369_10037255 3300013105 Bacteria 5325
158 Ga0157369_10037763 3300013105 Bacteria 5287
159 Ga0157369_10103111 3300013105 Bacteria 3039
160 Ga0157369_10302380 3300013105 Bacteria 1664
161 Ga0157378_10027228 3300013297 Bacteria 5045
162 Ga0157372_10007977 3300013307 Bacteria 11260
163 Ga0157375_10247026 3300013308 Bacteria 1945
164 Ga0157380_10049821 3300014326 Bacteria 3305
165 Ga0157380_10074859 3300014326 Bacteria 2750
166 Ga0182008_10014732 3300014497 Bacteria 4089
167 Ga0157379_10186197 3300014968 Bacteria 1876
168 Ga0182006_1015869 3300015261 Bacteria 3220
169 Ga0182006_1058647 3300015261 Bacteria 1459
170 Ga0182007_10000025 3300015262 Bacteria 172058
171 Ga0182005_1000293 3300015265 Bacteria 31203
172 Ga0183360_10003 3300015689 Bacteria 713221
173 Ga0183361_10402 3300016635 Bacteria 1839
174 Ga0163161_10024320 3300017792 Bacteria 4279
175 Ga0206353_11046508 3300020082 Bacteria 7214
176 Ga0206353_11888363 3300020082 Bacteria 2480
177 Ga0213871_10000823 3300021441 Bacteria 4653
178 Ga0207425_1000074 3300025245 Bacteria 108738
179 Ga0207425_1005126 3300025245 Bacteria 3790
180 Ga0209129_1000150 3300025258 Bacteria 113886
181 Ga0209565_1000001 3300025263 Bacteria 2950419
182 Ga0209565_1000037 3300025263 Bacteria 289371
183 Ga0209673_1000001 3300025273 Bacteria 3176258
184 Ga0209673_1000494 3300025273 Bacteria 65078
185 Ga0209673_1007568 3300025273 Bacteria 4973
186 Ga0209130_1004530 3300025284 Bacteria 5228
187 Ga0209675_1000001 3300025291 Bacteria 2950293
188 Ga0209675_1000020 3300025291 Bacteria 335854
189 Ga0209676_1000035 3300025292 Bacteria 459284
190 Ga0209676_1000307 3300025292 Bacteria 96239
191 Ga0209676_1000906 3300025292 Bacteria 37292
192 Ga0209676_1001357 3300025292 Bacteria 24182
193 Ga0209676_1002821 3300025292 Bacteria 11496
194 Ga0209676_1024112 3300025292 Bacteria 1978
195 Ga0209676_1027433 3300025292 Bacteria 1792
196 Ga0209676_1034159 3300025292 Bacteria 1506
197 Ga0209025_1000030 3300025294 Bacteria 441196
198 Ga0209025_1000048 3300025294 Bacteria 335574
199 Ga0209025_1001262 3300025294 Bacteria 34940
200 Ga0209564_1000001 3300025295 Bacteria 3176258
201 Ga0209564_1000993 3300025295 Bacteria 35449
202 Ga0209564_1007388 3300025295 Bacteria 5686
203 Ga0209758_1000056 3300025297 Bacteria 335574
204 Ga0209758_1006559 3300025297 Bacteria 8283
205 Ga0209050_1000429 3300025298 Bacteria 77085
206 Ga0209050_1000670 3300025298 Bacteria 51926
207 Ga0209050_1000711 3300025298 Bacteria 49107
208 Ga0209256_1000006 3300025299 Bacteria 1250310
209 Ga0209256_1003920 3300025299 Bacteria 9816
210 Ga0209256_1004659 3300025299 Bacteria 8438
211 Ga0209256_1014385 3300025299 Bacteria 2851
212 Ga0209256_1037534 3300025299 Bacteria 1261
213 Ga0209051_1001115 3300025303 Bacteria 24576
214 Ga0209051_1016812 3300025303 Bacteria 3289
215 Ga0209257_1000091 3300025304 Bacteria 270637
216 Ga0209257_1000587 3300025304 Bacteria 60909
217 Ga0209257_1001339 3300025304 Bacteria 29896
218 Ga0209257_1017145 3300025304 Bacteria 2874
219 Ga0209257_1040972 3300025304 Bacteria 1377
220 Ga0207655_1044618 3300025728 Bacteria 1861
221 Ga0207713_1000417 3300025735 Bacteria 45375
222 Ga0207713_1003755 3300025735 Bacteria 10197
223 Ga0207653_10000045 3300025885 Bacteria 94691
224 Ga0207680_10135023 3300025903 Bacteria 1630
225 Ga0207699_10133374 3300025906 Bacteria 1623
226 Ga0207705_10025354 3300025909 Bacteria 4234
227 Ga0207705_10070623 3300025909 Bacteria 2531
228 Ga0207705_10190849 3300025909 Bacteria 1549
229 Ga0207684_10000158 3300025910 Bacteria 115693
230 Ga0207684_10000652 3300025910 Bacteria 41078
231 Ga0207695_10011130 3300025913 Bacteria 10919
232 Ga0207695_10041208 3300025913 Bacteria 4943
233 Ga0207671_10017913 3300025914 Bacteria 5448
234 Ga0207693_10019987 3300025915 Bacteria 5327
235 Ga0207693_10020013 3300025915 Bacteria 5324
236 Ga0207693_10079116 3300025915 Bacteria 2572
237 Ga0207693_10219745 3300025915 Bacteria 1493
238 Ga0207657_10013269 3300025919 Bacteria 8084
239 Ga0207652_10107030 3300025921 Bacteria 2476
240 Ga0207652_10117953 3300025921 Bacteria 2358
241 Ga0207652_10275951 3300025921 Bacteria 1516
242 Ga0207646_10060964 3300025922 Bacteria 3368
243 Ga0207681_10094276 3300025923 Bacteria 2145
244 Ga0207694_10087539 3300025924 Bacteria 2454
245 Ga0207650_10001342 3300025925 Bacteria 17794
246 Ga0207650_10153484 3300025925 Bacteria 1819
247 Ga0207659_10114138 3300025926 Bacteria 2059
248 Ga0207700_10206251 3300025928 Bacteria 1659
249 Ga0207664_10234313 3300025929 Bacteria 1597
250 Ga0207664_10292684 3300025929 Bacteria 1431
251 Ga0207644_10219136 3300025931 Bacteria 1507
252 Ga0207706_10005511 3300025933 Bacteria 11800
253 Ga0207709_10002055 3300025935 Bacteria 13012
254 Ga0207709_10085344 3300025935 Bacteria 2047
255 Ga0207669_10165172 3300025937 Bacteria 1569
256 Ga0207665_10002293 3300025939 Bacteria 12916
257 Ga0207665_10013449 3300025939 Bacteria 5381
258 Ga0207691_10001588 3300025940 Bacteria 22555
259 Ga0207661_10016758 3300025944 Bacteria 5410
260 Ga0207679_10290791 3300025945 Bacteria 1405
261 Ga0207667_10000151 3300025949 Bacteria 104054
262 Ga0207667_10108167 3300025949 Bacteria 2869
263 Ga0207651_10180060 3300025960 Bacteria 1676
264 Ga0207712_10032133 3300025961 Bacteria 3541
265 Ga0207668_10012526 3300025972 Bacteria 5194
266 Ga0207668_10015590 3300025972 Bacteria 4724
267 Ga0207668_10022768 3300025972 Bacteria 4016
268 Ga0207640_10009438 3300025981 Bacteria 5465
269 Ga0207640_10170193 3300025981 Bacteria 1622
270 Ga0207677_10295046 3300026023 Bacteria 1337
271 Ga0207639_10104928 3300026041 Bacteria 2292
272 Ga0207708_10005607 3300026075 Bacteria 9263
273 Ga0207708_10277985 3300026075 Bacteria 1356
274 Ga0207648_10041415 3300026089 Bacteria 4044
275 Ga0207648_10220889 3300026089 Bacteria 1684
276 Ga0207648_10425133 3300026089 Bacteria 1207
277 Ga0207674_10002882 3300026116 Bacteria 21375
278 Ga0207683_10001345 3300026121 Bacteria 22193
279 Ga0207683_10128202 3300026121 Bacteria 2281
280 Ga0207698_10015099 3300026142 Bacteria 5162
281 Ga0209371_1000028 3300027312 Bacteria 429688
282 Ga0209983_1000837 3300027665 Bacteria 6741
283 Ga0209588_1075766 3300027671 Bacteria 1087
284 Ga0209971_1000564 3300027682 Bacteria 9701
285 Ga0209974_10022179 3300027876 Bacteria 2103
286 Ga0268266_10353744 3300028379 Bacteria 1381
287 Ga0268265_10001651 3300028380 Bacteria 18273
288 Ga0268265_10171494 3300028380 Bacteria 1855
289 Ga0265337_1026456 3300028556 Bacteria 1758
290 Ga0265319_1002310 3300028563 Bacteria 10520
291 Ga0265318_10014419 3300028577 Bacteria 3317
292 Ga0265322_10002939 3300028654 Bacteria 5192
293 Ga0265322_10007118 3300028654 Bacteria 3277
294 Ga0265338_10021437 3300028800 Bacteria 6737
295 Ga0265338_10060021 3300028800 Bacteria 3346
296 Ga0265338_10110644 3300028800 Bacteria 2213
297 Ga0268256_1000030 3300030500 Bacteria 429688
298 Ga0316177_1093440 3300030731 Bacteria 1334
299 Ga0314311_1115363 3300030733 Bacteria 5402
300 Ga0316178_1075419 3300030735 Bacteria 2059
301 Ga0265329_10046532 3300031242 Bacteria 1386
302 Ga0265331_10065095 3300031250 Bacteria 1715
303 Ga0265327_10003143 3300031251 Bacteria 16217
304 Ga0265327_10004332 3300031251 Bacteria 12650
305 Ga0265316_10142866 3300031344 Bacteria 1797
306 Ga0307513_10041457 3300031456 Bacteria 5080
307 Ga0307513_10283085 3300031456 Bacteria 1434
308 Ga0307408_100012782 3300031548 Bacteria 5567
309 Ga0307408_100038495 3300031548 Bacteria 3375
310 Ga0307408_100184660 3300031548 Bacteria 1675
311 Ga0307408_100245857 3300031548 Bacteria 1473
312 Ga0265314_10031649 3300031711 Bacteria 3901
313 Ga0265342_10030763 3300031712 Bacteria 3323
314 Ga0316576_10047922 3300031727 Unclassified 3097
315 Ga0316578_10079129 3300031728 Bacteria 1954
316 Ga0307405_10070963 3300031731 Bacteria 2240
317 Ga0307405_10081198 3300031731 Bacteria 2119
318 Ga0307413_10036531 3300031824 Bacteria 2829
319 Ga0307410_10104257 3300031852 Bacteria 2039
320 Ga0307406_10000482 3300031901 Bacteria 23030
321 Ga0307406_10074932 3300031901 Bacteria 2231
322 Ga0307406_10166811 3300031901 Bacteria 1589
323 Ga0307406_10169090 3300031901 Bacteria 1580
324 Ga0307412_10012010 3300031911 Bacteria 5032
325 Ga0307412_10018570 3300031911 Bacteria 4188
326 Ga0307409_100013950 3300031995 Bacteria 5200
327 Ga0307409_100125863 3300031995 Bacteria 2179
328 Ga0307409_100303559 3300031995 Bacteria 1486
329 Ga0307409_100403657 3300031995 Bacteria 1306
330 Ga0307416_100020402 3300032002 Bacteria 4727
331 Ga0307416_100022144 3300032002 Bacteria 4580
332 Ga0307416_100121837 3300032002 Bacteria 2326
333 Ga0307416_100170465 3300032002 Bacteria 2025
334 Ga0307416_100248631 3300032002 Bacteria 1729
335 Ga0307416_100479298 3300032002 Bacteria 1304
336 Ga0307414_10001446 3300032004 Bacteria 12337
337 Ga0307414_10003915 3300032004 Bacteria 8024
338 Ga0307414_10005234 3300032004 Bacteria 7127
339 Ga0307414_10012489 3300032004 Bacteria 5023
340 Ga0307414_10038057 3300032004 Bacteria 3226
341 Ga0307414_10075701 3300032004 Bacteria 2443
342 Ga0307414_10077994 3300032004 Bacteria 2413
343 Ga0307414_10131703 3300032004 Bacteria 1942
344 Ga0307414_10196488 3300032004 Bacteria 1637
345 Ga0307411_10128860 3300032005 Bacteria 1845
346 Ga0307415_100000143 3300032126 Bacteria 31696
347 Ga0307415_100082595 3300032126 Bacteria 2299
348 Ga0307415_100147242 3300032126 Bacteria 1807
349 Ga0307415_100206173 3300032126 Bacteria 1564
350 Ga0316580_10041578 3300032139 Unclassified 1419
351 Ga0373932_0026421 3300035112 Bacteria 1579
352 Ga0373932_0045064 3300035112 Bacteria 1289
353 Ga0316574_0003146 3300035398 Bacteria 8446
354 Ga0316574_0015419 3300035398 Bacteria 4434
355 Ga0373933_0129523 3300035724 Bacteria 1586
356 Ga0373947_0063442 3300035725 Bacteria 2251
357 Ga0395899_0001867 3300037312 Bacteria 17398
358 Ga0395899_0002198 3300037312 Bacteria 15987
359 Ga0395899_0018330 3300037312 Bacteria 5321
360 Ga0395899_0021868 3300037312 Bacteria 4852
361 Ga0395899_0032819 3300037312 Bacteria 3901
362 Ga0395899_0068649 3300037312 Bacteria 2598
363 Ga0395899_0142568 3300037312 Bacteria 1704
364 Ga0395899_0199916 3300037312 Bacteria 1394
365 Ga0395900_0003030 3300037418 Bacteria 18287
366 Ga0395900_0006843 3300037418 Bacteria 11828
367 Ga0395900_0011100 3300037418 Bacteria 9207
368 Ga0395900_0026078 3300037418 Bacteria 5984
369 Ga0395900_0039484 3300037418 Bacteria 4864
370 Ga0395900_0049493 3300037418 Bacteria 4330
371 Ga0395900_0061093 3300037418 Bacteria 3875
372 Ga0395900_0065349 3300037418 Bacteria 3737
373 Ga0395900_0111714 3300037418 Bacteria 2806
374 Ga0395900_0130907 3300037418 Bacteria 2571
375 Ga0395900_0132679 3300037418 Bacteria 2552
376 Ga0395900_0207023 3300037418 Bacteria 1982
377 Ga0395898_0003844 3300037466 Bacteria 16633
378 Ga0395898_0003922 3300037466 Bacteria 16418
379 Ga0395898_0004765 3300037466 Bacteria 14766
380 Ga0395898_0022255 3300037466 Bacteria 6423
381 Ga0395898_0028222 3300037466 Bacteria 5627
382 Ga0395898_0043602 3300037466 Bacteria 4419
383 Ga0395898_0075351 3300037466 Bacteria 3259
384 Ga0395898_0102688 3300037466 Bacteria 2744
385 Ga0395898_0185109 3300037466 Bacteria 1990
386 Ga0395898_0205849 3300037466 Bacteria 1877
387 Ga0395898_0207901 3300037466 Bacteria 1868
388 Ga0395898_0297896 3300037466 Bacteria 1538
389 Ga0395905_0001678 3300037471 Bacteria 26104
390 Ga0395905_0003679 3300037471 Bacteria 16247
391 Ga0395905_0017681 3300037471 Bacteria 6768
392 Ga0395905_0023137 3300037471 Bacteria 5874
393 Ga0395905_0025798 3300037471 Bacteria 5540
394 Ga0395905_0044914 3300037471 Bacteria 4144
395 Ga0395905_0082461 3300037471 Bacteria 3013
396 Ga0395905_0446934 3300037471 Bacteria 1190
397 Ga0395901_0003395 3300038443 Bacteria 16041
398 Ga0395901_0033804 3300038443 Bacteria 5279
399 Ga0395901_0035303 3300038443 Bacteria 5165
400 Ga0395901_0035657 3300038443 Bacteria 5140
401 Ga0395901_0037863 3300038443 Bacteria 4987
402 Ga0395901_0041723 3300038443 Bacteria 4756
403 Ga0395901_0048492 3300038443 Bacteria 4411
404 Ga0395901_0061909 3300038443 Bacteria 3894
405 Ga0395901_0063486 3300038443 Bacteria 3844
406 Ga0395901_0066493 3300038443 Bacteria 3754
407 Ga0395901_0085674 3300038443 Bacteria 3294
408 Ga0395901_0137904 3300038443 Bacteria 2564
409 Ga0395901_0193881 3300038443 Bacteria 2130
410 Ga0395901_0219499 3300038443 Bacteria 1987
411 Ga0395901_0304758 3300038443 Bacteria 1651
412 Ga0395901_0548847 3300038443 Bacteria 1171
413 Ga0237819_00061 3300038705 Bacteria 38106
414 Ga0400484_03784 3300038725 Bacteria 19256
415 Ga0400489_65446 3300039093 Bacteria 1602
416 Ga0237816_00232 3300039145 Bacteria 4657
417 Ga0439436_0004143 3300041404 Bacteria 4446
418 Ga0439436_0010636 3300041404 Bacteria 2804
419 Ga0439436_0012266 3300041404 Bacteria 2601
420 Ga0439447_002627 3300041407 Bacteria 6516
421 Ga0439465_0000127 3300041413 Bacteria 18321
422 Ga0439465_0001965 3300041413 Bacteria 6745
423 Ga0439465_0005093 3300041413 Bacteria 4216
424 Ga0451797_0221659 3300041453 Bacteria 1304
425 Ga0439432_015932 3300042006 Bacteria 2532
426 Ga0439449_0004920 3300042007 Bacteria 5144
427 Ga0439449_0018047 3300042007 Bacteria 2649
428 Ga0439449_0019299 3300042007 Bacteria 2555
429 Ga0439449_0024803 3300042007 Bacteria 2241
430 Ga0439449_0039458 3300042007 Bacteria 1755
431 Ga0450911_001216 3300042115 Bacteria 6249
432 Ga0451577_0029445 3300042876 Bacteria 4963
433 Ga0466969_0014427 3300044656 Bacteria 4155
434 Ga0466972_0011785 3300044658 Bacteria 4391
435 Ga0453683_0190476 3300044673 Bacteria 1301
436 Ga0466966_0028489 3300044684 Bacteria 3638
437 Ga0466961_0004981 3300044693 Bacteria 8354
438 Ga0466961_0008653 3300044693 Bacteria 6487
439 Ga0466961_0037271 3300044693 Bacteria 3119
440 Ga0466963_0004507 3300044694 Bacteria 8106
441 Ga0466963_0017812 3300044694 Bacteria 4432
442 Ga0466963_0020278 3300044694 Bacteria 4180
443 Ga0466963_0030453 3300044694 Bacteria 3483
444 Ga0466963_0058030 3300044694 Bacteria 2579
445 Ga0466963_0136879 3300044694 Bacteria 1695
446 Ga0466964_0098914 3300044706 Bacteria 1283
447 Ga0453684_0036612 3300044712 Bacteria 6759
448 Ga0466971_0008317 3300044719 Bacteria 4527
449 Ga0466971_0025090 3300044719 Bacteria 2662
450 Ga0466971_0030874 3300044719 Bacteria 2398
451 Ga0466957_0005089 3300044842 Bacteria 7355
452 Ga0466957_0115968 3300044842 Bacteria 1703
453 Ga0466959_0050755 3300045049 Bacteria 3044
454 Ga0466959_0105492 3300045049 Unclassified 2015
455 Ga0451576_0012693 3300045051 Bacteria 9460
456 Ga0466958_0037262 3300045836 Bacteria 2914
457 Ga0466958_0063667 3300045836 Unclassified 2249
458 Ga0466967_0053604 3300045976 Bacteria 3545
459 Ga0466967_0100175 3300045976 Bacteria 2647
460 Ga0466967_0305226 3300045976 Bacteria 1532
461 Ga0495603_0041890 3300046455 Bacteria 2738
462 Ga0495638_0014897 3300046460 Bacteria 5237
463 Ga0495638_0067672 3300046460 Bacteria 2192
464 Ga0495584_0113104 3300046491 Bacteria 1374
465 Ga0495585_0148869 3300046492 Bacteria 1222
466 Ga0495607_0020327 3300046501 Bacteria 4200
467 Ga0495610_0014871 3300046512 Bacteria 4551
468 Ga0495618_0028394 3300046514 Bacteria 3487
469 Ga0495618_0034493 3300046514 Bacteria 3173
470 Ga0495631_0003909 3300046518 Bacteria 8049
471 Ga0495643_0001494 3300046522 Bacteria 21238
472 Ga0495643_0072356 3300046522 Bacteria 1808
473 Ga0495663_0000563 3300046525 Bacteria 13078
474 Ga0495633_0008243 3300046558 Bacteria 5895
475 Ga0495633_0051720 3300046558 Bacteria 1935
476 Ga0495656_0010234 3300046615 Bacteria 3403
477 Ga0495656_0038148 3300046615 Bacteria 1988
478 Ga0495668_0003552 3300046616 Bacteria 11588
479 Ga0495625_0098783 3300046660 Bacteria 2007
480 Ga0495658_0211468 3300046683 Bacteria 1212
481 Ga0495624_0081552 3300046690 Bacteria 2003
482 Ga0495671_0007904 3300046692 Bacteria 6015
483 Ga0495636_0054559 3300047318 Bacteria 1679
484 Ga0495636_0078857 3300047318 Bacteria 1415
485 Ga0495672_0000594 3300047320 Bacteria 40835
486 Ga0495676_0102427 3300047321 Bacteria 2115
487 Ga0495676_0209623 3300047321 Bacteria 1349
488 Ga0495680_0153142 3300047322 Bacteria 1679
489 Ga0495684_0136386 3300047471 Bacteria 1841
490 Ga0495686_0022158 3300047472 Bacteria 4205
491 Ga0496100_0033464 3300048903 Bacteria 3216
492 Ga0496100_0113532 3300048903 Bacteria 1886
493 Ga0496102_0007168 3300048905 Bacteria 9518
494 Ga0496102_0007577 3300048905 Bacteria 9274
495 Ga0496102_0416014 3300048905 Bacteria 1263
496 Ga0496103_0008200 3300048906 Bacteria 6199
497 Ga0496103_0093917 3300048906 Bacteria 1895
498 Ga0496104_0087302 3300048907 Bacteria 2979
499 Ga0496105_0052365 3300048908 Bacteria 3372
500 Ga0496105_0056707 3300048908 Bacteria 3234
501 Ga0496105_0220928 3300048908 Bacteria 1542
502 Ga0496106_0003316 3300048909 Bacteria 11997
503 Ga0496106_0103323 3300048909 Bacteria 2211
504 Ga0496106_0201475 3300048909 Bacteria 1584
505 Ga0496106_0417840 3300048909 Bacteria 1078
506 Ga0496107_0004360 3300048910 Bacteria 9581
507 Ga0496107_0014375 3300048910 Bacteria 5543
508 Ga0496107_0027828 3300048910 Bacteria 4016
509 Ga0496108_0005735 3300048911 Bacteria 10053
510 Ga0496108_0063679 3300048911 Bacteria 3105
511 Ga0496108_0114985 3300048911 Bacteria 2304
512 Ga0496109_0015790 3300048912 Bacteria 6591
513 Ga0496109_0102809 3300048912 Bacteria 2652
514 Ga0496109_0218782 3300048912 Bacteria 1791
515 Ga0496110_0079573 3300048913 Bacteria 2918
516 Ga0496110_0101263 3300048913 Bacteria 2582
517 Ga0496112_0001751 3300048915 Bacteria 17014
518 Ga0496112_0013805 3300048915 Bacteria 7471
519 Ga0496112_0047465 3300048915 Bacteria 4213
520 Ga0496113_0076553 3300048916 Bacteria 2556
521 Ga0496114_0001241 3300048917 Bacteria 19288
522 Ga0496115_0005999 3300048918 Bacteria 8869
523 Ga0496115_0097841 3300048918 Bacteria 2403
524 Ga0496116_0026626 3300048919 Bacteria 4224
525 Ga0496116_0063433 3300048919 Bacteria 2381
526 Ga0496117_0005821 3300048920 Bacteria 12769
527 Ga0496117_0030989 3300048920 Bacteria 4091
528 Ga0496118_0001226 3300048921 Bacteria 39410
529 Ga0496118_0007402 3300048921 Bacteria 11647
530 Ga0496118_0073764 3300048921 Bacteria 2443
531 Ga0496119_0000303 3300048922 Bacteria 68844
532 Ga0496119_0001216 3300048922 Bacteria 32142
533 Ga0496120_0000437 3300048923 Bacteria 66014
534 Ga0496120_0000710 3300048923 Bacteria 48861
535 Ga0496121_0004776 3300048924 Bacteria 17874
536 Ga0496121_0026510 3300048924 Bacteria 5459
537 Ga0496121_0063685 3300048924 Bacteria 3010
538 Ga0496121_0191780 3300048924 Bacteria 1464
539 Ga0496122_0000379 3300048925 Bacteria 95139
540 Ga0496122_0000915 3300048925 Bacteria 54089
541 Ga0496122_0025501 3300048925 Bacteria 5132
542 Ga0496122_0048381 3300048925 Bacteria 3270
543 Ga0496123_0000313 3300048926 Bacteria 93165
544 Ga0496123_0000635 3300048926 Bacteria 58668
545 Ga0496123_0032869 3300048926 Bacteria 3745
546 Ga0496123_0051997 3300048926 Bacteria 2722
547 Ga0496124_0000115 3300048927 Bacteria 164929
548 Ga0496124_0000398 3300048927 Bacteria 79279
549 Ga0496124_0015628 3300048927 Bacteria 7265
550 Ga0496124_0030831 3300048927 Bacteria 4751
551 Ga0496124_0033677 3300048927 Bacteria 4505
552 Ga0496124_0113215 3300048927 Bacteria 2180
553 Ga0496125_0018256 3300048928 Bacteria 6666
554 Ga0496125_0039444 3300048928 Bacteria 4066
555 Ga0496125_0052087 3300048928 Bacteria 3368
556 Ga0496125_0065331 3300048928 Bacteria 2883
557 Ga0496126_0002933 3300048929 Bacteria 22177
558 Ga0496126_0078862 3300048929 Bacteria 2917
559 Ga0501031_0008297 3300049568 Bacteria 6756
560 Ga0501031_0009504 3300049568 Bacteria 6327
561 Ga0501031_0037607 3300049568 Bacteria 3158
562 Ga0501032_0004860 3300049569 Bacteria 10063
563 Ga0501032_0006583 3300049569 Bacteria 8530
564 Ga0501032_0023619 3300049569 Bacteria 4244
565 Ga0501033_0000751 3300049570 Bacteria 29835
566 Ga0501033_0032264 3300049570 Bacteria 3933
567 Ga0501033_0184119 3300049570 Bacteria 1496
568 Ga0501034_0000309 3300049571 Bacteria 86590
569 Ga0501034_0000311 3300049571 Bacteria 86241
570 Ga0501034_0007516 3300049571 Bacteria 11592
571 Ga0501034_0034158 3300049571 Bacteria 5156
572 Ga0501036_0004153 3300049572 Bacteria 11654
573 Ga0501036_0078377 3300049572 Bacteria 2794
574 Ga0501036_0422091 3300049572 Bacteria 1112
575 Ga0501037_0001504 3300049573 Bacteria 17049
576 Ga0501037_0032274 3300049573 Bacteria 3867
577 Ga0501037_0083448 3300049573 Bacteria 2315
578 Ga0501038_0000399 3300049574 Bacteria 37785
579 Ga0501038_0003005 3300049574 Bacteria 15719
580 Ga0501038_0027118 3300049574 Bacteria 5098
581 Ga0501038_0193745 3300049574 Bacteria 1634
582 Ga0501039_0015934 3300049575 Bacteria 5755
583 Ga0501039_0020428 3300049575 Bacteria 5075
584 Ga0501040_0000991 3300049576 Bacteria 17960
585 Ga0501040_0006195 3300049576 Bacteria 7756
586 Ga0501040_0060491 3300049576 Bacteria 2603
587 Ga0501040_0103026 3300049576 Bacteria 1992
588 Ga0501041_0000643 3300049577 Bacteria 18283
589 Ga0501041_0025337 3300049577 Bacteria 3564
590 Ga0501042_0008464 3300049578 Bacteria 6791
591 Ga0501042_0014784 3300049578 Bacteria 5330
592 Ga0501043_0018319 3300049579 Bacteria 5490
593 Ga0501043_0028920 3300049579 Bacteria 4350
594 Ga0501043_0039265 3300049579 Bacteria 3720
595 Ga0501043_0039441 3300049579 Bacteria 3711
596 Ga0501046_0005323 3300049580 Bacteria 11507
597 Ga0501046_0015319 3300049580 Bacteria 6447
598 Ga0501047_0001290 3300049581 Bacteria 24727
599 Ga0501047_0053749 3300049581 Bacteria 3896
600 Ga0501047_0089639 3300049581 Bacteria 2953
601 Ga0501048_0000176 3300049582 Bacteria 40373
602 Ga0501048_0000668 3300049582 Bacteria 24832
603 Ga0501048_0017781 3300049582 Bacteria 5231
604 Ga0501067_0017766 3300049583 Bacteria 3938
605 Ga0501067_0065319 3300049583 Bacteria 2014
606 Ga0501067_0068449 3300049583 Bacteria 1965
607 Ga0501068_0000266 3300049584 Bacteria 25796
608 Ga0501068_0063823 3300049584 Bacteria 2241
609 Ga0501068_0093288 3300049584 Bacteria 1859
610 Ga0501069_0004227 3300049585 Bacteria 7420
611 Ga0501069_0005669 3300049585 Bacteria 6504
612 Ga0501069_0006582 3300049585 Bacteria 6072
613 Ga0501069_0086462 3300049585 Bacteria 1770
614 Ga0501070_0002030 3300049586 Bacteria 17801
615 Ga0501070_0008772 3300049586 Bacteria 8549
616 Ga0501070_0042887 3300049586 Bacteria 3766
617 Ga0501070_0050585 3300049586 Bacteria 3449
618 Ga0501071_0015981 3300049587 Bacteria 5156
619 Ga0501071_0024158 3300049587 Bacteria 4249
620 Ga0501071_0297207 3300049587 Bacteria 1224
621 Ga0501072_0000870 3300049588 Bacteria 22145
622 Ga0501072_0015504 3300049588 Bacteria 5841
623 Ga0501073_0001604 3300049589 Bacteria 16747
624 Ga0501073_0001742 3300049589 Bacteria 16172
625 Ga0501074_0004583 3300049590 Bacteria 9900
626 Ga0501074_0008266 3300049590 Bacteria 7544
627 Ga0501074_0029258 3300049590 Bacteria 3990
628 Ga0501075_0000298 3300049591 Bacteria 27595
629 Ga0501075_0113468 3300049591 Bacteria 2060
630 Ga0501075_0171788 3300049591 Bacteria 1654
631 Ga0501076_0013602 3300049592 Bacteria 6104
632 Ga0501076_0102840 3300049592 Bacteria 2304
633 Ga0501076_0143235 3300049592 Bacteria 1942
634 Ga0501077_0000718 3300049593 Bacteria 20025
635 Ga0501077_0024815 3300049593 Bacteria 3806
636 Ga0501202_049155 3300049652 Unclassified 930
637 Ga0501079_0009091 3300049741 Bacteria 7523
638 Ga0501079_0062446 3300049741 Bacteria 2874
639 Ga0501079_0062584 3300049741 Bacteria 2870
640 Ga0501079_0126797 3300049741 Bacteria 1985
641 Ga0501080_0000450 3300049742 Bacteria 31992
642 Ga0501080_0007118 3300049742 Bacteria 10101
643 Ga0501080_0065727 3300049742 Bacteria 3373
644 Ga0501081_0000447 3300049743 Bacteria 22828
645 Ga0501081_0009614 3300049743 Bacteria 6302
646 Ga0501081_0052394 3300049743 Bacteria 2816
647 Ga0501083_0001240 3300049744 Bacteria 17307
648 Ga0501083_0008730 3300049744 Bacteria 7150
649 Ga0501083_0009464 3300049744 Bacteria 6883
650 Ga0501265_002107 3300049762 Bacteria 2269
651 Ga0501035_0005550 3300049822 Bacteria 11917
652 Ga0501035_0023125 3300049822 Bacteria 5703
653 Ga0501044_0013823 3300049823 Bacteria 8723
654 Ga0501044_0013996 3300049823 Bacteria 8666
655 Ga0501044_0018071 3300049823 Bacteria 7562
656 Ga0501044_0038281 3300049823 Bacteria 5009
657 Ga0501044_0098980 3300049823 Bacteria 2935
658 Ga0501044_0382898 3300049823 Bacteria 1321
659 Ga0501045_0003128 3300049824 Bacteria 11316
660 Ga0501045_0065941 3300049824 Bacteria 2658
661 Ga0501045_0128325 3300049824 Bacteria 1885
662 nmdc:mga00v17_20464_c1 3300050491 Bacteria 3791
663 nmdc:mga05p37_244362_c1 3300050507 Bacteria 2156
664 nmdc:mga05p37_383015_c1 3300050507 Bacteria 1647
665 nmdc:mga05p37_50983_c1 3300050507 Bacteria 5089
666 nmdc:mga05p37_65045_c1 3300050507 Bacteria 4487
667 nmdc:mga05p37_85673_c1 3300050507 Bacteria 3883
668 nmdc:mga09592_57037_c1 3300050508 Bacteria 3300
669 nmdc:mga0qj67_17327_c1 3300050509 Bacteria 2741
670 nmdc:mga0qj67_193164_c1 3300050509 Bacteria 1654
671 nmdc:mga0qj67_270537_c1 3300050509 Bacteria 1378
672 nmdc:mga06r32_160071_c1 3300050510 Bacteria 2233
673 nmdc:mga06r32_237806_c1 3300050510 Bacteria 1809
674 nmdc:mga06r32_592686_c1 3300050510 Bacteria 1080
675 nmdc:mga08y16_140247_c1 3300050511 Bacteria 2513
676 nmdc:mga08y16_177411_c1 3300050511 Bacteria 2212
677 nmdc:mga08y16_379430_c1 3300050511 Bacteria 1449
678 nmdc:mga08y16_39216_c1 3300050511 Bacteria 4970
679 nmdc:mga08y16_86589_c1 3300050511 Bacteria 3265
680 nmdc:mga0n895_37071_c1 3300050512 Bacteria 4714
681 nmdc:mga0n895_481381_c1 3300050512 Bacteria 1252
682 nmdc:mga0rr50_67012_c1 3300050513 Bacteria 2726
683 nmdc:mga08x19_160219_c1 3300050514 Bacteria 1528
684 Ga0495601_0003616 3300053077 Bacteria 8889
685 Ga0495601_0148344 3300053077 Bacteria 1531
686 Ga0495595_0028648 3300053084 Bacteria 2488
687 Ga0495595_0248197 3300053084 Bacteria 891
688 Ga0495619_0017923 3300053085 Bacteria 4489
689 Ga0500634_0000369 3300053161 Bacteria 14334
690 Ga0501084_0008367 3300054114 Bacteria 8541
691 Ga0501084_0040628 3300054114 Bacteria 3891
692 Ga0501084_0313190 3300054114 Bacteria 1325
693 Ga0501082_0005344 3300060353 Bacteria 11152
694 Ga0501082_0008847 3300060353 Bacteria 8685
695 Ga0501082_0041383 3300060353 Bacteria 3973
696 Ga0501082_0163686 3300060353 Bacteria 1933
697 Ga0466962_0002540 3300061719 Bacteria 8660
698 Ga0466962_0005481 3300061719 Bacteria 6100
699 Ga0466962_0008807 3300061719 Bacteria 4836
700 Ga0466962_0153510 3300061719 Bacteria 1117
701 Ga0530510_0011891 3300061734 Bacteria 6107
702 Ga0530510_0013136 3300061734 Bacteria 5824
703 Ga0530510_0182838 3300061734 Bacteria 1555

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100361331 Ga0068855_1003613312 270
2 3300013104 Ga0157370_10022411 Ga0157370_100224112 270
3 3300013105 Ga0157369_10302380 Ga0157369_103023803 270
4 3300020082 Ga0206353_11888363 Ga0206353_118883632 270
5 3300025909 Ga0207705_10025354 Ga0207705_100253541 270
6 3300025919 Ga0207657_10013269 Ga0207657_100132695 270
7 3300025921 Ga0207652_10275951 Ga0207652_102759512 270
8 3300044694 Ga0466963_0020278 Ga0466963_0020278_1752_2579 270
9 3300045976 Ga0466967_0100175 Ga0466967_0100175_863_1690 270
10 3300053084 Ga0495595_0248197 Ga0495595_0248197_52_879 270
11 3300046683 Ga0495658_0211468 Ga0495658_0211468_21_851 272
12 3300049652 Ga0501202_049155 Ga0501202_049155_81_917 273
13 3300048915 Ga0496112_0047465 Ga0496112_0047465_2108_2947 274
14 3300032126 Ga0307415_100082595 Ga0307415_1000825952 285
15 3300053084 Ga0495595_0028648 Ga0495595_0028648_55_933 285
16 3300044694 Ga0466963_0017812 Ga0466963_0017812_332_1294 289
17 3300044842 Ga0466957_0115968 Ga0466957_0115968_331_1293 289
18 3300061719 Ga0466962_0153510 Ga0466962_0153510_87_1049 289
19 3300028800 Ga0265338_10110644 Ga0265338_101106443 295
20 3300044656 Ga0466969_0014427 Ga0466969_0014427_2529_3491 296
21 3300044693 Ga0466961_0037271 Ga0466961_0037271_1759_2721 296
22 3300044694 Ga0466963_0136879 Ga0466963_0136879_265_1227 296
23 3300044719 Ga0466971_0030874 Ga0466971_0030874_862_1824 296
24 3300045049 Ga0466959_0050755 Ga0466959_0050755_967_1929 296
25 3300061719 Ga0466962_0002540 Ga0466962_0002540_3982_4944 296
26 3300005327 Ga0070658_10069423 Ga0070658_100694234 300
27 3300020082 Ga0206353_11046508 Ga0206353_110465086 300
28 3300049569 Ga0501032_0006583 Ga0501032_0006583_4418_5464 300
29 3300049571 Ga0501034_0034158 Ga0501034_0034158_2648_3694 300
30 3300049574 Ga0501038_0000399 Ga0501038_0000399_4193_5239 300
31 3300049579 Ga0501043_0028920 Ga0501043_0028920_2207_3253 300
32 3300049582 Ga0501048_0000176 Ga0501048_0000176_16563_17609 300
33 3300049586 Ga0501070_0008772 Ga0501070_0008772_13_1059 300
34 3300049823 Ga0501044_0038281 Ga0501044_0038281_3947_4993 300
35 3300060353 Ga0501082_0041383 Ga0501082_0041383_2755_3726 303
36 3300025929 Ga0207664_10292684 Ga0207664_102926842 305
37 3300049583 Ga0501067_0017766 Ga0501067_0017766_2197_3132 305
38 3300049584 Ga0501068_0063823 Ga0501068_0063823_981_1916 305
39 3300049585 Ga0501069_0004227 Ga0501069_0004227_959_1894 305
40 3300025929 Ga0207664_10234313 Ga0207664_102343132 306
41 3300044684 Ga0466966_0028489 Ga0466966_0028489_768_1802 307
42 3300044694 Ga0466963_0030453 Ga0466963_0030453_779_1813 307
43 3300045049 Ga0466959_0105492 Ga0466959_0105492_904_1938 307
44 3300045836 Ga0466958_0063667 Ga0466958_0063667_845_1879 307
45 3300045976 Ga0466967_0305226 Ga0466967_0305226_80_1063 308
46 3300050507 nmdc:mga05p37_383015_c1 nmdc:mga05p37_383015_c1_11_958 308
47 3300013105 Ga0157369_10103111 Ga0157369_101031113 309
48 3300044706 Ga0466964_0098914 Ga0466964_0098914_188_1141 309
49 3300005471 Ga0070698_100022834 Ga0070698_1000228341 311
50 3300044694 Ga0466963_0058030 Ga0466963_0058030_1004_1975 311
51 3300045976 Ga0466967_0053604 Ga0466967_0053604_1921_2892 311
52 3300047321 Ga0495676_0209623 Ga0495676_0209623_129_1094 311
53 3300049583 Ga0501067_0068449 Ga0501067_0068449_896_1867 311
54 3300049586 Ga0501070_0050585 Ga0501070_0050585_2332_3303 311
55 3300049588 Ga0501072_0015504 Ga0501072_0015504_2765_3736 311
56 3300049590 Ga0501074_0029258 Ga0501074_0029258_2796_3767 311
57 3300049742 Ga0501080_0065727 Ga0501080_0065727_1752_2723 311
58 3300049744 Ga0501083_0009464 Ga0501083_0009464_4952_5923 311
59 3300005937 Ga0081455_10009400 Ga0081455_100094002 312
60 3300005981 Ga0081538_10003124 Ga0081538_100031248 312
61 3300005981 Ga0081538_10027674 Ga0081538_100276742 312
62 3300037466 Ga0395898_0205849 Ga0395898_0205849_713_1666 312
63 3300038443 Ga0395901_0193881 Ga0395901_0193881_673_1626 312
64 3300048913 Ga0496110_0079573 Ga0496110_0079573_1870_2856 312
65 3300049576 Ga0501040_0103026 Ga0501040_0103026_150_1106 312
66 3300049741 Ga0501079_0062584 Ga0501079_0062584_690_1646 312
67 3300049743 Ga0501081_0052394 Ga0501081_0052394_1014_1970 312
68 3300054114 Ga0501084_0313190 Ga0501084_0313190_348_1304 312
69 3300005335 Ga0070666_10257039 Ga0070666_102570392 313
70 3300005337 Ga0070682_100011512 Ga0070682_1000115122 313
71 3300005435 Ga0070714_100062593 Ga0070714_1000625932 313
72 3300005436 Ga0070713_100030412 Ga0070713_1000304121 313
73 3300005456 Ga0070678_100038110 Ga0070678_1000381102 313
74 3300005546 Ga0070696_100045575 Ga0070696_1000455752 313
75 3300005614 Ga0068856_100200048 Ga0068856_1002000483 313
76 3300006163 Ga0070715_10049380 Ga0070715_100493802 313
77 3300006237 Ga0097621_100024439 Ga0097621_1000244397 313
78 3300009177 Ga0105248_10353770 Ga0105248_103537702 313
79 3300014968 Ga0157379_10186197 Ga0157379_101861972 313
80 3300025903 Ga0207680_10135023 Ga0207680_101350232 313
81 3300025915 Ga0207693_10019987 Ga0207693_100199872 313
82 3300025915 Ga0207693_10020013 Ga0207693_100200132 313
83 3300025928 Ga0207700_10206251 Ga0207700_102062512 313
84 3300025939 Ga0207665_10002293 Ga0207665_1000229311 313
85 3300026121 Ga0207683_10001345 Ga0207683_1000134511 313
86 3300035112 Ga0373932_0026421 Ga0373932_0026421_256_1245 313
87 3300044693 Ga0466961_0004981 Ga0466961_0004981_5800_6828 313
88 3300048903 Ga0496100_0033464 Ga0496100_0033464_656_1645 313
89 3300048905 Ga0496102_0007168 Ga0496102_0007168_890_1879 313
90 3300048906 Ga0496103_0008200 Ga0496103_0008200_5140_6129 313
91 3300048909 Ga0496106_0103323 Ga0496106_0103323_329_1318 313
92 3300048909 Ga0496106_0201475 Ga0496106_0201475_76_1065 313
93 3300048912 Ga0496109_0218782 Ga0496109_0218782_582_1571 313
94 3300048913 Ga0496110_0101263 Ga0496110_0101263_456_1445 313
95 3300048915 Ga0496112_0013805 Ga0496112_0013805_5846_6835 313
96 3300048918 Ga0496115_0005999 Ga0496115_0005999_6546_7535 313
97 3300048918 Ga0496115_0097841 Ga0496115_0097841_165_1154 313
98 3300005445 Ga0070708_100002202 Ga0070708_1000022022 314
99 3300005468 Ga0070707_100144123 Ga0070707_1001441232 314
100 3300005937 Ga0081455_10055449 Ga0081455_100554493 314
101 3300005981 Ga0081538_10000280 Ga0081538_1000028018 314
102 3300006058 Ga0075432_10007403 Ga0075432_100074031 314
103 3300006847 Ga0075431_100103054 Ga0075431_1001030545 314
104 3300006852 Ga0075433_10051269 Ga0075433_100512692 314
105 3300009094 Ga0111539_10057290 Ga0111539_100572901 314
106 3300013105 Ga0157369_10037255 Ga0157369_100372554 314
107 3300025922 Ga0207646_10060964 Ga0207646_100609642 314
108 3300025939 Ga0207665_10013449 Ga0207665_100134492 314
109 3300028556 Ga0265337_1026456 Ga0265337_10264562 314
110 3300028563 Ga0265319_1002310 Ga0265319_10023102 314
111 3300028577 Ga0265318_10014419 Ga0265318_100144192 314
112 3300028654 Ga0265322_10002939 Ga0265322_100029393 314
113 3300028800 Ga0265338_10021437 Ga0265338_100214373 314
114 3300031242 Ga0265329_10046532 Ga0265329_100465322 314
115 3300031250 Ga0265331_10065095 Ga0265331_100650951 314
116 3300031711 Ga0265314_10031649 Ga0265314_100316492 314
117 3300031712 Ga0265342_10030763 Ga0265342_100307632 314
118 3300032002 Ga0307416_100479298 Ga0307416_1004792982 314
119 3300035724 Ga0373933_0129523 Ga0373933_0129523_382_1344 314
120 3300037418 Ga0395900_0026078 Ga0395900_0026078_711_1673 314
121 3300037418 Ga0395900_0065349 Ga0395900_0065349_1019_1981 314
122 3300037466 Ga0395898_0028222 Ga0395898_0028222_3629_4591 314
123 3300038443 Ga0395901_0037863 Ga0395901_0037863_1820_2782 314
124 3300038443 Ga0395901_0061909 Ga0395901_0061909_2187_3149 314
125 3300038443 Ga0395901_0085674 Ga0395901_0085674_512_1504 314
126 3300038443 Ga0395901_0137904 Ga0395901_0137904_1190_2149 314
127 3300039093 Ga0400489_65446 Ga0400489_65446_49_1077 314
128 3300044693 Ga0466961_0008653 Ga0466961_0008653_289_1251 314
129 3300044694 Ga0466963_0004507 Ga0466963_0004507_127_1089 314
130 3300044719 Ga0466971_0008317 Ga0466971_0008317_1315_2277 314
131 3300046514 Ga0495618_0028394 Ga0495618_0028394_767_1729 314
132 3300047322 Ga0495680_0153142 Ga0495680_0153142_530_1492 314
133 3300047471 Ga0495684_0136386 Ga0495684_0136386_846_1808 314
134 3300048911 Ga0496108_0114985 Ga0496108_0114985_59_1021 314
135 3300050510 nmdc:mga06r32_592686_c1 nmdc:mga06r32_592686_c1_90_1052 314
136 3300050511 nmdc:mga08y16_39216_c1 nmdc:mga08y16_39216_c1_425_1387 314
137 3300050512 nmdc:mga0n895_481381_c1 nmdc:mga0n895_481381_c1_38_1000 314
138 3300053085 Ga0495619_0017923 Ga0495619_0017923_2910_3872 314
139 3300061719 Ga0466962_0008807 Ga0466962_0008807_3796_4758 314
140 3300005356 Ga0070674_100254978 Ga0070674_1002549782 315
141 3300005434 Ga0070709_10021134 Ga0070709_100211342 315
142 3300005471 Ga0070698_100053404 Ga0070698_1000534042 315
143 3300005518 Ga0070699_100132740 Ga0070699_1001327403 315
144 3300005548 Ga0070665_100394780 Ga0070665_1003947801 315
145 3300005981 Ga0081538_10004486 Ga0081538_100044862 315
146 3300006847 Ga0075431_100103287 Ga0075431_1001032872 315
147 3300006847 Ga0075431_100200873 Ga0075431_1002008732 315
148 3300009094 Ga0111539_10113234 Ga0111539_101132345 315
149 3300009098 Ga0105245_10173198 Ga0105245_101731982 315
150 3300009147 Ga0114129_10042807 Ga0114129_100428072 315
151 3300009176 Ga0105242_10131717 Ga0105242_101317172 315
152 3300025915 Ga0207693_10219745 Ga0207693_102197452 315
153 3300028379 Ga0268266_10353744 Ga0268266_103537442 315
154 3300031548 Ga0307408_100038495 Ga0307408_1000384952 315
155 3300031731 Ga0307405_10081198 Ga0307405_100811982 315
156 3300031901 Ga0307406_10074932 Ga0307406_100749322 315
157 3300031995 Ga0307409_100013950 Ga0307409_1000139502 315
158 3300032002 Ga0307416_100020402 Ga0307416_1000204022 315
159 3300032126 Ga0307415_100000143 Ga0307415_1000001439 315
160 3300035725 Ga0373947_0063442 Ga0373947_0063442_1237_2211 315
161 3300037312 Ga0395899_0001867 Ga0395899_0001867_6625_7596 315
162 3300037312 Ga0395899_0068649 Ga0395899_0068649_284_1252 315
163 3300037312 Ga0395899_0199916 Ga0395899_0199916_337_1308 315
164 3300037418 Ga0395900_0011100 Ga0395900_0011100_1266_2237 315
165 3300037418 Ga0395900_0049493 Ga0395900_0049493_1472_2443 315
166 3300037418 Ga0395900_0061093 Ga0395900_0061093_77_1045 315
167 3300037418 Ga0395900_0130907 Ga0395900_0130907_1147_2118 315
168 3300037466 Ga0395898_0003844 Ga0395898_0003844_6971_7942 315
169 3300037466 Ga0395898_0004765 Ga0395898_0004765_11692_12660 315
170 3300037466 Ga0395898_0075351 Ga0395898_0075351_49_1020 315
171 3300037471 Ga0395905_0017681 Ga0395905_0017681_4251_5222 315
172 3300037471 Ga0395905_0023137 Ga0395905_0023137_2524_3495 315
173 3300037471 Ga0395905_0025798 Ga0395905_0025798_2476_3444 315
174 3300037471 Ga0395905_0044914 Ga0395905_0044914_1266_2237 315
175 3300038443 Ga0395901_0033804 Ga0395901_0033804_329_1300 315
176 3300038443 Ga0395901_0219499 Ga0395901_0219499_702_1673 315
177 3300044719 Ga0466971_0025090 Ga0466971_0025090_856_1839 315
178 3300044842 Ga0466957_0005089 Ga0466957_0005089_584_1567 315
179 3300045836 Ga0466958_0037262 Ga0466958_0037262_1334_2317 315
180 3300046690 Ga0495624_0081552 Ga0495624_0081552_593_1576 315
181 3300047321 Ga0495676_0102427 Ga0495676_0102427_958_1941 315
182 3300048909 Ga0496106_0417840 Ga0496106_0417840_14_1006 315
183 3300049568 Ga0501031_0008297 Ga0501031_0008297_2331_3296 315
184 3300049569 Ga0501032_0023619 Ga0501032_0023619_977_1942 315
185 3300049570 Ga0501033_0000751 Ga0501033_0000751_19417_20382 315
186 3300049572 Ga0501036_0004153 Ga0501036_0004153_9980_10945 315
187 3300049573 Ga0501037_0001504 Ga0501037_0001504_13580_14545 315
188 3300049575 Ga0501039_0020428 Ga0501039_0020428_1187_2152 315
189 3300049576 Ga0501040_0000991 Ga0501040_0000991_1482_2447 315
190 3300049577 Ga0501041_0000643 Ga0501041_0000643_16154_17119 315
191 3300049578 Ga0501042_0008464 Ga0501042_0008464_4465_5430 315
192 3300049579 Ga0501043_0018319 Ga0501043_0018319_3548_4513 315
193 3300049580 Ga0501046_0005323 Ga0501046_0005323_10026_10991 315
194 3300049581 Ga0501047_0001290 Ga0501047_0001290_22623_23588 315
195 3300049582 Ga0501048_0000668 Ga0501048_0000668_22908_23873 315
196 3300049584 Ga0501068_0000266 Ga0501068_0000266_10954_11919 315
197 3300049585 Ga0501069_0006582 Ga0501069_0006582_2331_3296 315
198 3300049586 Ga0501070_0002030 Ga0501070_0002030_7415_8380 315
199 3300049587 Ga0501071_0024158 Ga0501071_0024158_2307_3272 315
200 3300049588 Ga0501072_0000870 Ga0501072_0000870_20331_21296 315
201 3300049589 Ga0501073_0001604 Ga0501073_0001604_2303_3268 315
202 3300049590 Ga0501074_0004583 Ga0501074_0004583_948_1913 315
203 3300049591 Ga0501075_0000298 Ga0501075_0000298_23654_24619 315
204 3300049592 Ga0501076_0013602 Ga0501076_0013602_4462_5427 315
205 3300049593 Ga0501077_0000718 Ga0501077_0000718_9610_10575 315
206 3300049741 Ga0501079_0009091 Ga0501079_0009091_4228_5193 315
207 3300049742 Ga0501080_0000450 Ga0501080_0000450_10946_11911 315
208 3300049743 Ga0501081_0000447 Ga0501081_0000447_5710_6675 315
209 3300049744 Ga0501083_0001240 Ga0501083_0001240_2325_3290 315
210 3300049822 Ga0501035_0005550 Ga0501035_0005550_1355_2320 315
211 3300049823 Ga0501044_0013996 Ga0501044_0013996_2313_3278 315
212 3300049824 Ga0501045_0003128 Ga0501045_0003128_9454_10419 315
213 3300050507 nmdc:mga05p37_65045_c1 nmdc:mga05p37_65045_c1_99_1064 315
214 3300050510 nmdc:mga06r32_160071_c1 nmdc:mga06r32_160071_c1_282_1250 315
215 3300050511 nmdc:mga08y16_140247_c1 nmdc:mga08y16_140247_c1_1406_2371 315
216 3300054114 Ga0501084_0008367 Ga0501084_0008367_6412_7377 315
217 3300060353 Ga0501082_0005344 Ga0501082_0005344_9338_10303 315
218 3300061719 Ga0466962_0005481 Ga0466962_0005481_3024_4007 315
219 3300061734 Ga0530510_0011891 Ga0530510_0011891_678_1643 315
220 3300005347 Ga0070668_100019159 Ga0070668_1000191594 316
221 3300005937 Ga0081455_10005471 Ga0081455_100054717 316
222 3300005981 Ga0081538_10008088 Ga0081538_100080882 316
223 3300006846 Ga0075430_100045499 Ga0075430_1000454994 316
224 3300006880 Ga0075429_100040897 Ga0075429_1000408974 316
225 3300009094 Ga0111539_10028573 Ga0111539_100285738 316
226 3300009094 Ga0111539_10349560 Ga0111539_103495602 316
227 3300009098 Ga0105245_10003103 Ga0105245_1000310310 316
228 3300009147 Ga0114129_10013338 Ga0114129_100133385 316
229 3300009147 Ga0114129_10239391 Ga0114129_102393912 316
230 3300009147 Ga0114129_10493503 Ga0114129_104935032 316
231 3300009553 Ga0105249_10022114 Ga0105249_100221146 316
232 3300010375 Ga0105239_10045602 Ga0105239_100456025 316
233 3300025906 Ga0207699_10133374 Ga0207699_101333742 316
234 3300025933 Ga0207706_10005511 Ga0207706_1000551114 316
235 3300025961 Ga0207712_10032133 Ga0207712_100321333 316
236 3300025972 Ga0207668_10015590 Ga0207668_100155905 316
237 3300026075 Ga0207708_10277985 Ga0207708_102779852 316
238 3300031548 Ga0307408_100184660 Ga0307408_1001846602 316
239 3300031852 Ga0307410_10104257 Ga0307410_101042572 316
240 3300031995 Ga0307409_100303559 Ga0307409_1003035591 316
241 3300032002 Ga0307416_100121837 Ga0307416_1001218373 316
242 3300032002 Ga0307416_100170465 Ga0307416_1001704652 316
243 3300035112 Ga0373932_0045064 Ga0373932_0045064_106_1077 316
244 3300037312 Ga0395899_0002198 Ga0395899_0002198_10213_11211 316
245 3300037312 Ga0395899_0021868 Ga0395899_0021868_1280_2248 316
246 3300037312 Ga0395899_0142568 Ga0395899_0142568_711_1679 316
247 3300037418 Ga0395900_0006843 Ga0395900_0006843_3953_4951 316
248 3300037418 Ga0395900_0207023 Ga0395900_0207023_935_1903 316
249 3300037466 Ga0395898_0003922 Ga0395898_0003922_12360_13358 316
250 3300037466 Ga0395898_0022255 Ga0395898_0022255_1707_2675 316
251 3300037466 Ga0395898_0043602 Ga0395898_0043602_2772_3740 316
252 3300037466 Ga0395898_0207901 Ga0395898_0207901_568_1536 316
253 3300037471 Ga0395905_0001678 Ga0395905_0001678_20346_21344 316
254 3300037471 Ga0395905_0082461 Ga0395905_0082461_1350_2318 316
255 3300037471 Ga0395905_0446934 Ga0395905_0446934_118_1086 316
256 3300038443 Ga0395901_0003395 Ga0395901_0003395_10812_11810 316
257 3300038443 Ga0395901_0035303 Ga0395901_0035303_2661_3629 316
258 3300038443 Ga0395901_0041723 Ga0395901_0041723_1893_2861 316
259 3300038443 Ga0395901_0048492 Ga0395901_0048492_3227_4195 316
260 3300038443 Ga0395901_0063486 Ga0395901_0063486_788_1759 316
261 3300038443 Ga0395901_0548847 Ga0395901_0548847_97_1065 316
262 3300049568 Ga0501031_0037607 Ga0501031_0037607_1306_2274 316
263 3300049569 Ga0501032_0004860 Ga0501032_0004860_8840_9808 316
264 3300049570 Ga0501033_0032264 Ga0501033_0032264_679_1647 316
265 3300049572 Ga0501036_0078377 Ga0501036_0078377_1777_2745 316
266 3300049573 Ga0501037_0032274 Ga0501037_0032274_1720_2688 316
267 3300049574 Ga0501038_0003005 Ga0501038_0003005_8840_9808 316
268 3300049575 Ga0501039_0015934 Ga0501039_0015934_2501_3469 316
269 3300049576 Ga0501040_0006195 Ga0501040_0006195_3433_4401 316
270 3300049577 Ga0501041_0025337 Ga0501041_0025337_2045_3013 316
271 3300049578 Ga0501042_0014784 Ga0501042_0014784_1849_2817 316
272 3300049580 Ga0501046_0015319 Ga0501046_0015319_1777_2745 316
273 3300049581 Ga0501047_0053749 Ga0501047_0053749_1193_2161 316
274 3300049582 Ga0501048_0017781 Ga0501048_0017781_1747_2715 316
275 3300049584 Ga0501068_0093288 Ga0501068_0093288_50_1018 316
276 3300049585 Ga0501069_0005669 Ga0501069_0005669_634_1602 316
277 3300049586 Ga0501070_0042887 Ga0501070_0042887_335_1303 316
278 3300049587 Ga0501071_0015981 Ga0501071_0015981_1849_2817 316
279 3300049587 Ga0501071_0297207 Ga0501071_0297207_85_1056 316
280 3300049589 Ga0501073_0001742 Ga0501073_0001742_10548_11516 316
281 3300049590 Ga0501074_0008266 Ga0501074_0008266_4802_5770 316
282 3300049591 Ga0501075_0113468 Ga0501075_0113468_208_1176 316
283 3300049591 Ga0501075_0171788 Ga0501075_0171788_120_1100 316
284 3300049592 Ga0501076_0102840 Ga0501076_0102840_409_1389 316
285 3300049592 Ga0501076_0143235 Ga0501076_0143235_50_1018 316
286 3300049593 Ga0501077_0024815 Ga0501077_0024815_2287_3255 316
287 3300049741 Ga0501079_0062446 Ga0501079_0062446_1150_2130 316
288 3300049741 Ga0501079_0126797 Ga0501079_0126797_133_1101 316
289 3300049742 Ga0501080_0007118 Ga0501080_0007118_4234_5202 316
290 3300049743 Ga0501081_0009614 Ga0501081_0009614_1777_2745 316
291 3300049744 Ga0501083_0008730 Ga0501083_0008730_3690_4658 316
292 3300049822 Ga0501035_0023125 Ga0501035_0023125_3801_4769 316
293 3300049823 Ga0501044_0013823 Ga0501044_0013823_2464_3432 316
294 3300049824 Ga0501045_0065941 Ga0501045_0065941_363_1331 316
295 3300050507 nmdc:mga05p37_50983_c1 nmdc:mga05p37_50983_c1_1861_2832 316
296 3300050507 nmdc:mga05p37_85673_c1 nmdc:mga05p37_85673_c1_1761_2732 316
297 3300050508 nmdc:mga09592_57037_c1 nmdc:mga09592_57037_c1_1696_2667 316
298 3300050509 nmdc:mga0qj67_17327_c1 nmdc:mga0qj67_17327_c1_1447_2418 316
299 3300050509 nmdc:mga0qj67_193164_c1 nmdc:mga0qj67_193164_c1_448_1419 316
300 3300050511 nmdc:mga08y16_177411_c1 nmdc:mga08y16_177411_c1_516_1487 316
301 3300050511 nmdc:mga08y16_379430_c1 nmdc:mga08y16_379430_c1_180_1151 316
302 3300050511 nmdc:mga08y16_86589_c1 nmdc:mga08y16_86589_c1_1850_2821 316
303 3300054114 Ga0501084_0040628 Ga0501084_0040628_1849_2817 316
304 3300060353 Ga0501082_0008847 Ga0501082_0008847_6278_7246 316
305 3300060353 Ga0501082_0163686 Ga0501082_0163686_834_1814 316
306 3300061734 Ga0530510_0013136 Ga0530510_0013136_3663_4631 316
307 3300061734 Ga0530510_0182838 Ga0530510_0182838_473_1453 316
308 3300003373 JGI25407J50210_10045132 JGI25407J50210_100451322 317
309 3300005719 Ga0068861_100402577 Ga0068861_1004025772 317
310 3300005981 Ga0081538_10000132 Ga0081538_1000013266 317
311 3300005981 Ga0081538_10015017 Ga0081538_100150178 317
312 3300005985 Ga0081539_10002871 Ga0081539_1000287121 317
313 3300006058 Ga0075432_10019233 Ga0075432_100192333 317
314 3300006844 Ga0075428_100069454 Ga0075428_1000694541 317
315 3300032002 Ga0307416_100022144 Ga0307416_1000221445 317
316 3300037418 Ga0395900_0039484 Ga0395900_0039484_3177_4157 317
317 3300038443 Ga0395901_0035657 Ga0395901_0035657_3638_4618 317
318 3300049572 Ga0501036_0422091 Ga0501036_0422091_83_1084 317
319 3300049576 Ga0501040_0060491 Ga0501040_0060491_1403_2404 317
320 3300049824 Ga0501045_0128325 Ga0501045_0128325_257_1258 317
321 3300050509 nmdc:mga0qj67_270537_c1 nmdc:mga0qj67_270537_c1_51_1031 317
322 3300050510 nmdc:mga06r32_237806_c1 nmdc:mga06r32_237806_c1_458_1438 317
323 3300005327 Ga0070658_10145276 Ga0070658_101452763 318
324 3300005329 Ga0070683_100060010 Ga0070683_1000600102 318
325 3300005336 Ga0070680_100003170 Ga0070680_1000031705 318
326 3300005339 Ga0070660_100010096 Ga0070660_1000100964 318
327 3300005366 Ga0070659_100001553 Ga0070659_10000155316 318
328 3300009551 Ga0105238_10259111 Ga0105238_102591113 318
329 3300013105 Ga0157369_10014378 Ga0157369_100143784 318
330 3300025909 Ga0207705_10070623 Ga0207705_100706233 318
331 3300025921 Ga0207652_10117953 Ga0207652_101179534 318
332 3300025924 Ga0207694_10087539 Ga0207694_100875393 318
333 3300003781 Ga0055536_1000626 Ga0055536_10006261 319
334 3300005530 Ga0070679_100098566 Ga0070679_1000985661 319
335 3300005547 Ga0070693_100069355 Ga0070693_1000693551 319
336 3300025273 Ga0209673_1007568 Ga0209673_10075687 319
337 3300025292 Ga0209676_1001357 Ga0209676_100135719 319
338 3300025299 Ga0209256_1037534 Ga0209256_10375341 319
339 3300025303 Ga0209051_1016812 Ga0209051_10168125 319
340 3300025304 Ga0209257_1040972 Ga0209257_10409722 319
341 3300025921 Ga0207652_10107030 Ga0207652_101070303 319
342 3300031901 Ga0307406_10169090 Ga0307406_101690902 319
343 3300032002 Ga0307416_100248631 Ga0307416_1002486313 319
344 3300032126 Ga0307415_100147242 Ga0307415_1001472423 319
345 3300048912 Ga0496109_0102809 Ga0496109_0102809_994_1980 319
346 3300003771 Ga0055526_1011939 Ga0055526_10119391 320
347 3300003791 Ga0055530_10002878 Ga0055530_100028784 320
348 3300005535 Ga0070684_100165652 Ga0070684_1001656522 320
349 3300025284 Ga0209130_1004530 Ga0209130_10045304 320
350 3300025292 Ga0209676_1027433 Ga0209676_10274331 320
351 3300025292 Ga0209676_1034159 Ga0209676_10341591 320
352 3300025295 Ga0209564_1007388 Ga0209564_10073885 320
353 3300025298 Ga0209050_1000429 Ga0209050_100042926 320
354 3300025299 Ga0209256_1004659 Ga0209256_10046599 320
355 3300025935 Ga0207709_10085344 Ga0207709_100853443 320
356 3300025944 Ga0207661_10016758 Ga0207661_100167587 320
357 3300025972 Ga0207668_10022768 Ga0207668_100227685 320
358 3300025981 Ga0207640_10170193 Ga0207640_101701931 320
359 3300031995 Ga0307409_100125863 Ga0307409_1001258632 320
360 3300046491 Ga0495584_0113104 Ga0495584_0113104_259_1242 320
361 3300048905 Ga0496102_0416014 Ga0496102_0416014_106_1095 320
362 3300048908 Ga0496105_0220928 Ga0496105_0220928_440_1420 320
363 3300048909 Ga0496106_0003316 Ga0496106_0003316_10968_11948 320
364 3300048910 Ga0496107_0004360 Ga0496107_0004360_4885_5865 320
365 3300049583 Ga0501067_0065319 Ga0501067_0065319_400_1380 320
366 3300049585 Ga0501069_0086462 Ga0501069_0086462_372_1352 320
367 3300003187 JGI25151J46595_10047611 JGI25151J46595_100476112 321
368 3300005439 Ga0070711_100248503 Ga0070711_1002485031 321
369 3300006028 Ga0070717_10438328 Ga0070717_104383282 321
370 3300006871 Ga0075434_100000846 Ga0075434_10000084623 321
371 3300006914 Ga0075436_100010273 Ga0075436_1000102735 321
372 3300025294 Ga0209025_1001262 Ga0209025_10012622 321
373 3300025915 Ga0207693_10079116 Ga0207693_100791164 321
374 3300028800 Ga0265338_10060021 Ga0265338_100600213 321
375 3300031251 Ga0265327_10004332 Ga0265327_1000433215 321
376 3300048905 Ga0496102_0007577 Ga0496102_0007577_4666_5655 321
377 3300048906 Ga0496103_0093917 Ga0496103_0093917_697_1686 321
378 3300048907 Ga0496104_0087302 Ga0496104_0087302_19_1005 321
379 3300048908 Ga0496105_0052365 Ga0496105_0052365_1155_2144 321
380 3300048910 Ga0496107_0027828 Ga0496107_0027828_754_1743 321
381 3300048911 Ga0496108_0005735 Ga0496108_0005735_6888_7877 321
382 3300048912 Ga0496109_0015790 Ga0496109_0015790_2186_3175 321
383 3300048915 Ga0496112_0001751 Ga0496112_0001751_11480_12469 321
384 3300048916 Ga0496113_0076553 Ga0496113_0076553_550_1539 321
385 3300050512 nmdc:mga0n895_37071_c1 nmdc:mga0n895_37071_c1_1510_2499 321
386 3300050513 nmdc:mga0rr50_67012_c1 nmdc:mga0rr50_67012_c1_116_1105 321
387 3300050514 nmdc:mga08x19_160219_c1 nmdc:mga08x19_160219_c1_325_1314 321
388 3300053077 Ga0495601_0148344 Ga0495601_0148344_526_1509 321
389 3300025292 Ga0209676_1024112 Ga0209676_10241121 322
390 3300005356 Ga0070674_100174385 Ga0070674_1001743851 323
391 3300005459 Ga0068867_100193782 Ga0068867_1001937823 323
392 3300009147 Ga0114129_10108436 Ga0114129_101084365 323
393 3300014326 Ga0157380_10074859 Ga0157380_100748592 323
394 3300025937 Ga0207669_10165172 Ga0207669_101651722 323
395 3300026075 Ga0207708_10005607 Ga0207708_100056078 323
396 3300026089 Ga0207648_10220889 Ga0207648_102208893 323
397 iso_pu_bacteria 2547132130 2547499561 323
398 iso_pu_bacteria 2747842428 2747950312 323
399 iso_pu_bacteria 2765235840 2765577333 323
400 3300049573 Ga0501037_0083448 Ga0501037_0083448_829_1827 324
401 iso_pu_bacteria 2884791551 2884792441 324
402 iso_pu_bacteria 2896085136 2896089956 324
403 3300006178 Ga0075367_10156062 Ga0075367_101560622 325
404 3300037312 Ga0395899_0032819 Ga0395899_0032819_2625_3686 325
405 3300037418 Ga0395900_0111714 Ga0395900_0111714_1131_2192 325
406 3300037466 Ga0395898_0297896 Ga0395898_0297896_144_1205 325
407 3300038443 Ga0395901_0066493 Ga0395901_0066493_373_1434 325
408 3300001989 JGI24739J22299_10004160 JGI24739J22299_100041602 326
409 3300003354 JGI25160J50197_1006305 JGI25160J50197_10063052 326
410 3300005339 Ga0070660_100170424 Ga0070660_1001704242 326
411 3300005563 Ga0068855_100008913 Ga0068855_1000089133 326
412 3300005577 Ga0068857_100000234 Ga0068857_10000023428 326
413 3300005578 Ga0068854_100011394 Ga0068854_1000113944 326
414 3300005616 Ga0068852_100002465 Ga0068852_1000024654 326
415 3300009093 Ga0105240_10009127 Ga0105240_1000912714 326
416 3300009093 Ga0105240_10051930 Ga0105240_100519304 326
417 3300009174 Ga0105241_10162986 Ga0105241_101629862 326
418 3300009545 Ga0105237_10029977 Ga0105237_100299774 326
419 3300009545 Ga0105237_10053657 Ga0105237_100536572 326
420 3300013104 Ga0157370_10004629 Ga0157370_100046296 326
421 3300013105 Ga0157369_10031143 Ga0157369_100311435 326
422 3300013307 Ga0157372_10007977 Ga0157372_100079779 326
423 3300021441 Ga0213871_10000823 Ga0213871_100008233 326
424 3300025913 Ga0207695_10011130 Ga0207695_100111305 326
425 3300025913 Ga0207695_10041208 Ga0207695_100412083 326
426 3300025914 Ga0207671_10017913 Ga0207671_100179134 326
427 3300025949 Ga0207667_10000151 Ga0207667_1000015122 326
428 3300025981 Ga0207640_10009438 Ga0207640_100094384 326
429 3300026041 Ga0207639_10104928 Ga0207639_101049282 326
430 3300026116 Ga0207674_10002882 Ga0207674_1000288213 326
431 3300026142 Ga0207698_10015099 Ga0207698_100150992 326
432 3300003320 rootH2_10050576 rootH2_100505765 327
433 3300003773 Ga0055537_1000177 Ga0055537_100017721 327
434 3300003781 Ga0055536_1002286 Ga0055536_10022864 327
435 3300003784 Ga0055534_1000706 Ga0055534_10007062 327
436 3300003784 Ga0055534_1000870 Ga0055534_10008704 327
437 3300003856 Ga0058692_1000026 Ga0058692_10000266 327
438 3300006186 Ga0075369_10065216 Ga0075369_100652161 327
439 3300017792 Ga0163161_10024320 Ga0163161_100243202 327
440 3300025263 Ga0209565_1000037 Ga0209565_1000037234 327
441 3300025273 Ga0209673_1000494 Ga0209673_100049427 327
442 3300025291 Ga0209675_1000020 Ga0209675_1000020269 327
443 3300025292 Ga0209676_1000307 Ga0209676_100030765 327
444 3300025292 Ga0209676_1002821 Ga0209676_10028211 327
445 3300025295 Ga0209564_1000993 Ga0209564_100099333 327
446 3300025298 Ga0209050_1000670 Ga0209050_100067037 327
447 3300025298 Ga0209050_1000711 Ga0209050_100071110 327
448 3300025299 Ga0209256_1003920 Ga0209256_10039201 327
449 3300025299 Ga0209256_1014385 Ga0209256_10143853 327
450 3300025303 Ga0209051_1001115 Ga0209051_10011155 327
451 3300025304 Ga0209257_1000587 Ga0209257_100058711 327
452 3300025728 Ga0207655_1044618 Ga0207655_10446181 327
453 3300025935 Ga0207709_10002055 Ga0207709_100020559 327
454 3300028654 Ga0265322_10007118 Ga0265322_100071181 327
455 3300031344 Ga0265316_10142866 Ga0265316_101428662 327
456 3300032004 Ga0307414_10038057 Ga0307414_100380573 327
457 3300044658 Ga0466972_0011785 Ga0466972_0011785_1476_2495 327
458 3300005347 Ga0070668_100016107 Ga0070668_1000161074 328
459 3300005844 Ga0068862_100001242 Ga0068862_10000124215 328
460 3300028380 Ga0268265_10001651 Ga0268265_100016518 328
461 3300044673 Ga0453683_0190476 Ga0453683_0190476_131_1168 328
462 3300005330 Ga0070690_100036047 Ga0070690_1000360473 330
463 3300005406 Ga0070703_10000599 Ga0070703_100005998 330
464 3300005440 Ga0070705_100030815 Ga0070705_1000308155 330
465 3300005445 Ga0070708_100022520 Ga0070708_1000225203 330
466 3300005467 Ga0070706_100000503 Ga0070706_10000050315 330
467 3300005467 Ga0070706_100208148 Ga0070706_1002081483 330
468 3300005536 Ga0070697_100000833 Ga0070697_1000008332 330
469 3300005549 Ga0070704_100008393 Ga0070704_1000083934 330
470 3300010375 Ga0105239_10124122 Ga0105239_101241224 330
471 3300025885 Ga0207653_10000045 Ga0207653_1000004539 330
472 3300025910 Ga0207684_10000158 Ga0207684_1000015812 330
473 3300025910 Ga0207684_10000652 Ga0207684_100006526 330
474 3300031727 Ga0316576_10047922 Ga0316576_100479222 330
475 3300032139 Ga0316580_10041578 Ga0316580_100415782 330
476 3300046455 Ga0495603_0041890 Ga0495603_0041890_423_1430 330
477 3300046492 Ga0495585_0148869 Ga0495585_0148869_106_1113 330
478 3300048910 Ga0496107_0014375 Ga0496107_0014375_4438_5445 330
479 3300050507 nmdc:mga05p37_244362_c1 nmdc:mga05p37_244362_c1_401_1408 330
480 iso_pu_bacteria 2524614729 2525556335 331
481 iso_pu_bacteria 2627854209 2630649565 331
482 3300005329 Ga0070683_100092653 Ga0070683_1000926532 332
483 3300005563 Ga0068855_100002748 Ga0068855_10000274824 332
484 3300005563 Ga0068855_100163780 Ga0068855_1001637802 332
485 3300025949 Ga0207667_10108167 Ga0207667_101081672 332
486 3300042876 Ga0451577_0029445 Ga0451577_0029445_2229_3284 332
487 3300044712 Ga0453684_0036612 Ga0453684_0036612_1855_2910 332
488 3300045051 Ga0451576_0012693 Ga0451576_0012693_7505_8560 332
489 iso_pu_bacteria 2643221573 2643881415 333
490 iso_pu_bacteria 2643221593 2643977168 333
491 iso_pu_bacteria 2643221720 2644662188 333
492 iso_pu_bacteria 2643221728 2644700330 333
493 iso_pu_bacteria 2941489479 2941494354 333
494 iso_pu_bacteria 2995948881 2995953760 333
495 3300031251 Ga0265327_10003143 Ga0265327_100031435 334
496 3300048927 Ga0496124_0000398 Ga0496124_0000398_16466_17554 334
497 iso_pu_bacteria 2643221695 2644530359 334
498 3300005458 Ga0070681_10223970 Ga0070681_102239701 335
499 3300007265 Ga0099794_10009725 Ga0099794_100097253 335
500 3300016635 Ga0183361_10402 Ga0183361_104021 335
501 3300027671 Ga0209588_1075766 Ga0209588_10757661 335
502 3300031995 Ga0307409_100403657 Ga0307409_1004036572 335
503 3300037312 Ga0395899_0018330 Ga0395899_0018330_455_1516 335
504 3300037418 Ga0395900_0003030 Ga0395900_0003030_9515_10576 335
505 3300037418 Ga0395900_0132679 Ga0395900_0132679_957_1964 335
506 3300037466 Ga0395898_0102688 Ga0395898_0102688_1582_2643 335
507 3300046514 Ga0495618_0034493 Ga0495618_0034493_70_1101 335
508 3300053077 Ga0495601_0003616 Ga0495601_0003616_1471_2502 335
509 3300003187 JGI25151J46595_10000008 JGI25151J46595_1000000853 337
510 3300003771 Ga0055526_1000015 Ga0055526_1000015205 337
511 3300003773 Ga0055537_1000132 Ga0055537_100013239 337
512 3300003775 Ga0055524_1000132 Ga0055524_100013268 337
513 3300003784 Ga0055534_1000055 Ga0055534_10000555 337
514 3300003790 Ga0055528_1000008 Ga0055528_1000008205 337
515 3300013297 Ga0157378_10027228 Ga0157378_100272286 337
516 3300015689 Ga0183360_10003 Ga0183360_10003575 337
517 3300025245 Ga0207425_1005126 Ga0207425_10051264 337
518 3300025263 Ga0209565_1000001 Ga0209565_100000142 337
519 3300025273 Ga0209673_1000001 Ga0209673_100000142 337
520 3300025291 Ga0209675_1000001 Ga0209675_10000012490 337
521 3300025294 Ga0209025_1000030 Ga0209025_100003053 337
522 3300025295 Ga0209564_1000001 Ga0209564_10000012652 337
523 3300025297 Ga0209758_1006559 Ga0209758_10065595 337
524 3300025299 Ga0209256_1000006 Ga0209256_10000061088 337
525 3300031548 Ga0307408_100012782 Ga0307408_1000127821 337
526 3300031728 Ga0316578_10079129 Ga0316578_100791292 337
527 3300031824 Ga0307413_10036531 Ga0307413_100365311 337
528 3300031901 Ga0307406_10000482 Ga0307406_1000048213 337
529 3300032004 Ga0307414_10005234 Ga0307414_100052342 337
530 3300035398 Ga0316574_0003146 Ga0316574_0003146_5894_6913 337
531 3300038725 Ga0400484_03784 Ga0400484_03784_9868_10899 337
532 3300041404 Ga0439436_0004143 Ga0439436_0004143_581_1603 337
533 3300041407 Ga0439447_002627 Ga0439447_002627_1957_2979 337
534 3300046615 Ga0495656_0010234 Ga0495656_0010234_490_1515 337
535 3300046616 Ga0495668_0003552 Ga0495668_0003552_10539_11561 337
536 3300048924 Ga0496121_0004776 Ga0496121_0004776_8610_9632 337
537 iso_pu_bacteria 2571042365 2572256107 337
538 iso_pu_bacteria 2576861471 2578459937 337
539 iso_pu_bacteria 2816332141 2816519961 337
540 iso_pu_bacteria 2842391507 2842395445 337
541 iso_pu_bacteria 2842757796 2842761118 337
542 iso_pu_bacteria 2842780639 2842782930 337
543 iso_pu_bacteria 2852649853 2852653362 337
544 iso_pu_bacteria 2857442823 2857445759 337
545 iso_pu_bacteria 2874220319 2874224215 337
546 iso_pu_bacteria 2919089067 2919092108 337
547 iso_pu_bacteria 2919134579 2919135360 337
548 iso_pu_bacteria 2928496128 2928498741 337
549 iso_pu_bacteria 2931380184 2931382381 337
550 iso_pu_bacteria 2937610967 2937612991 337
551 iso_pu_bacteria 2939589442 2939592288 337
552 iso_pu_bacteria 2939622612 2939625244 337
553 iso_pu_bacteria 2939626828 2939629516 337
554 iso_pu_bacteria 2941475908 2941477644 337
555 iso_pu_bacteria 2961047084 2961050979 337
556 iso_pu_bacteria 2961064222 2961065701 337
557 iso_pu_bacteria 2974307012 2974310369 337
558 iso_pu_bacteria 2977247770 2977251098 337
559 iso_pu_bacteria 2984514374 2984514408 337
560 iso_pu_bacteria 8003014200 8003017696 337
561 3300032004 Ga0307414_10131703 Ga0307414_101317033 338
562 3300032005 Ga0307411_10128860 Ga0307411_101288602 338
563 3300032126 Ga0307415_100206173 Ga0307415_1002061732 338
564 3300035398 Ga0316574_0015419 Ga0316574_0015419_435_1466 338
565 3300042006 Ga0439432_015932 Ga0439432_015932_505_1521 338
566 3300003794 Ga0055531_10011945 Ga0055531_100119456 339
567 3300025304 Ga0209257_1017145 Ga0209257_10171455 339
568 iso_pu_bacteria 2895498888 2895502904 339
569 iso_pu_bacteria 2895511927 2895512943 339
570 iso_pu_bacteria 2895522137 2895522954 339
571 iso_pu_bacteria 2895525241 2895525271 339
572 3300025926 Ga0207659_10114138 Ga0207659_101141382 340
573 3300025960 Ga0207651_10180060 Ga0207651_101800602 340
574 3300026023 Ga0207677_10295046 Ga0207677_102950461 340
575 3300026089 Ga0207648_10425133 Ga0207648_104251332 340
576 3300046558 Ga0495633_0051720 Ga0495633_0051720_170_1192 340
577 iso_pu_bacteria 2919513703 2919514210 340
578 iso_pu_bacteria 2919675420 2919676016 340
579 iso_pu_bacteria 2987605356 2987609131 340
580 3300003771 Ga0055526_1011436 Ga0055526_10114365 341
581 3300003790 Ga0055528_1000045 Ga0055528_100004521 341
582 3300005347 Ga0070668_100031994 Ga0070668_1000319944 341
583 3300005530 Ga0070679_100014388 Ga0070679_1000143884 341
584 3300005564 Ga0070664_100170132 Ga0070664_1001701323 341
585 3300006051 Ga0075364_10000016 Ga0075364_1000001646 341
586 3300009011 Ga0105251_10004487 Ga0105251_100044879 341
587 3300009036 Ga0105244_10024368 Ga0105244_100243681 341
588 3300009148 Ga0105243_10022597 Ga0105243_100225972 341
589 3300013100 Ga0157373_10152790 Ga0157373_101527901 341
590 3300013102 Ga0157371_10001308 Ga0157371_100013081 341
591 3300013102 Ga0157371_10076836 Ga0157371_100768361 341
592 3300013104 Ga0157370_10054285 Ga0157370_100542851 341
593 3300013105 Ga0157369_10037763 Ga0157369_100377634 341
594 3300014497 Ga0182008_10014732 Ga0182008_100147322 341
595 3300015261 Ga0182006_1015869 Ga0182006_10158694 341
596 3300015261 Ga0182006_1058647 Ga0182006_10586472 341
597 3300015262 Ga0182007_10000025 Ga0182007_10000025131 341
598 3300015265 Ga0182005_1000293 Ga0182005_10002934 341
599 3300025292 Ga0209676_1000906 Ga0209676_100090629 341
600 3300025735 Ga0207713_1003755 Ga0207713_10037553 341
601 3300025909 Ga0207705_10190849 Ga0207705_101908492 341
602 3300025923 Ga0207681_10094276 Ga0207681_100942762 341
603 3300025972 Ga0207668_10012526 Ga0207668_100125262 341
604 3300026089 Ga0207648_10041415 Ga0207648_100414152 341
605 3300027312 Ga0209371_1000028 Ga0209371_100002833 341
606 3300030500 Ga0268256_1000030 Ga0268256_1000030360 341
607 3300031548 Ga0307408_100245857 Ga0307408_1002458572 341
608 3300031731 Ga0307405_10070963 Ga0307405_100709632 341
609 3300031901 Ga0307406_10166811 Ga0307406_101668112 341
610 3300031911 Ga0307412_10012010 Ga0307412_100120104 341
611 3300031911 Ga0307412_10018570 Ga0307412_100185704 341
612 3300032004 Ga0307414_10075701 Ga0307414_100757012 341
613 3300032004 Ga0307414_10077994 Ga0307414_100779942 341
614 3300041404 Ga0439436_0012266 Ga0439436_0012266_854_1918 341
615 3300041413 Ga0439465_0001965 Ga0439465_0001965_3596_4660 341
616 3300042007 Ga0439449_0018047 Ga0439449_0018047_805_1896 341
617 3300042007 Ga0439449_0019299 Ga0439449_0019299_707_1771 341
618 3300042115 Ga0450911_001216 Ga0450911_001216_2549_3574 341
619 3300046460 Ga0495638_0014897 Ga0495638_0014897_2970_3995 341
620 3300046518 Ga0495631_0003909 Ga0495631_0003909_2902_3927 341
621 3300046522 Ga0495643_0001494 Ga0495643_0001494_17004_18029 341
622 3300046558 Ga0495633_0008243 Ga0495633_0008243_2791_3816 341
623 3300046660 Ga0495625_0098783 Ga0495625_0098783_819_1844 341
624 3300047320 Ga0495672_0000594 Ga0495672_0000594_39039_40064 341
625 3300048908 Ga0496105_0056707 Ga0496105_0056707_1585_2610 341
626 3300048919 Ga0496116_0026626 Ga0496116_0026626_232_1257 341
627 3300048919 Ga0496116_0063433 Ga0496116_0063433_1237_2262 341
628 3300048920 Ga0496117_0005821 Ga0496117_0005821_11555_12580 341
629 3300048920 Ga0496117_0030989 Ga0496117_0030989_190_1215 341
630 3300048921 Ga0496118_0001226 Ga0496118_0001226_190_1215 341
631 3300048921 Ga0496118_0007402 Ga0496118_0007402_10433_11458 341
632 3300048921 Ga0496118_0073764 Ga0496118_0073764_1193_2218 341
633 3300048922 Ga0496119_0001216 Ga0496119_0001216_3883_4908 341
634 3300048923 Ga0496120_0000710 Ga0496120_0000710_14190_15215 341
635 3300048924 Ga0496121_0026510 Ga0496121_0026510_1797_2822 341
636 3300048924 Ga0496121_0063685 Ga0496121_0063685_175_1200 341
637 3300048924 Ga0496121_0191780 Ga0496121_0191780_284_1309 341
638 3300048925 Ga0496122_0048381 Ga0496122_0048381_206_1231 341
639 3300048926 Ga0496123_0051997 Ga0496123_0051997_740_1765 341
640 3300048927 Ga0496124_0000115 Ga0496124_0000115_121356_122381 341
641 3300048927 Ga0496124_0015628 Ga0496124_0015628_6036_7061 341
642 3300048927 Ga0496124_0030831 Ga0496124_0030831_224_1249 341
643 3300048927 Ga0496124_0033677 Ga0496124_0033677_263_1288 341
644 3300048927 Ga0496124_0113215 Ga0496124_0113215_950_1975 341
645 3300048928 Ga0496125_0039444 Ga0496125_0039444_2811_3836 341
646 3300048928 Ga0496125_0052087 Ga0496125_0052087_193_1218 341
647 3300048928 Ga0496125_0065331 Ga0496125_0065331_203_1228 341
648 3300048929 Ga0496126_0002933 Ga0496126_0002933_3883_4908 341
649 3300048929 Ga0496126_0078862 Ga0496126_0078862_1715_2740 341
650 3300049568 Ga0501031_0009504 Ga0501031_0009504_1592_2632 341
651 3300049571 Ga0501034_0007516 Ga0501034_0007516_6288_7313 341
652 3300049574 Ga0501038_0027118 Ga0501038_0027118_507_1547 341
653 3300049579 Ga0501043_0039265 Ga0501043_0039265_2175_3215 341
654 3300049579 Ga0501043_0039441 Ga0501043_0039441_1106_2143 341
655 3300049581 Ga0501047_0089639 Ga0501047_0089639_1340_2365 341
656 3300049823 Ga0501044_0018071 Ga0501044_0018071_3827_4867 341
657 3300049823 Ga0501044_0098980 Ga0501044_0098980_1606_2646 341
658 iso_pu_bacteria 2643221579 2643907651 341
659 iso_pu_bacteria 2643221581 2643914089 341
660 iso_pu_bacteria 2747842501 2748017671 341
661 iso_pu_bacteria 2923516293 2923516549 341
662 3300005366 Ga0070659_100068955 Ga0070659_1000689552 342
663 3300013100 Ga0157373_10172457 Ga0157373_101724572 342
664 3300013102 Ga0157371_10084153 Ga0157371_100841532 342
665 3300013308 Ga0157375_10247026 Ga0157375_102470263 342
666 3300025931 Ga0207644_10219136 Ga0207644_102191362 342
667 3300037466 Ga0395898_0185109 Ga0395898_0185109_155_1252 342
668 3300037471 Ga0395905_0003679 Ga0395905_0003679_227_1324 342
669 3300038443 Ga0395901_0304758 Ga0395901_0304758_301_1344 342
670 3300038705 Ga0237819_00061 Ga0237819_00061_28943_30010 342
671 3300047318 Ga0495636_0054559 Ga0495636_0054559_184_1221 342
672 3300047318 Ga0495636_0078857 Ga0495636_0078857_151_1188 342
673 3300048903 Ga0496100_0113532 Ga0496100_0113532_771_1802 342
674 3300005331 Ga0070670_100231701 Ga0070670_1002317011 343
675 3300005353 Ga0070669_100049635 Ga0070669_1000496352 343
676 3300005543 Ga0070672_100006123 Ga0070672_1000061238 343
677 3300009148 Ga0105243_10051475 Ga0105243_100514753 343
678 3300009176 Ga0105242_10355426 Ga0105242_103554261 343
679 3300014326 Ga0157380_10049821 Ga0157380_100498212 343
680 3300025925 Ga0207650_10153484 Ga0207650_101534843 343
681 3300025940 Ga0207691_10001588 Ga0207691_100015884 343
682 3300025945 Ga0207679_10290791 Ga0207679_102907912 343
683 3300026121 Ga0207683_10128202 Ga0207683_101282023 343
684 3300032004 Ga0307414_10003915 Ga0307414_100039156 343
685 3300049571 Ga0501034_0000311 Ga0501034_0000311_25117_26148 343
686 3300050491 nmdc:mga00v17_20464_c1 nmdc:mga00v17_20464_c1_2207_3238 343
687 3300002773 JGI25152J39213_1000039 JGI25152J39213_100003922 344
688 3300002774 JGI25150J39212_1000422 JGI25150J39212_100042211 344
689 3300003187 JGI25151J46595_10000154 JGI25151J46595_1000015462 344
690 3300003215 JGI25153J46596_10000120 JGI25153J46596_1000012062 344
691 3300003794 Ga0055531_10014427 Ga0055531_100144273 344
692 3300025245 Ga0207425_1000074 Ga0207425_100007422 344
693 3300025258 Ga0209129_1000150 Ga0209129_100015022 344
694 3300025294 Ga0209025_1000048 Ga0209025_100004822 344
695 3300025297 Ga0209758_1000056 Ga0209758_100005622 344
696 3300025304 Ga0209257_1000091 Ga0209257_100009169 344
697 3300030731 Ga0316177_1093440 Ga0316177_10934401 344
698 3300030733 Ga0314311_1115363 Ga0314311_11153635 344
699 3300030735 Ga0316178_1075419 Ga0316178_10754193 344
700 3300048925 Ga0496122_0000915 Ga0496122_0000915_12312_13346 344
701 3300048926 Ga0496123_0000635 Ga0496123_0000635_40806_41840 344
702 2162886007 SwRhRL2b_contig_24145 SwRhRL2b_0291.00008340 345
703 3300003781 Ga0055536_1007175 Ga0055536_10071755 345
704 3300003794 Ga0055531_10005845 Ga0055531_100058458 345
705 3300005289 Ga0065704_10072580 Ga0065704_100725801 345
706 3300005364 Ga0070673_100110039 Ga0070673_1001100393 345
707 3300005844 Ga0068862_100185166 Ga0068862_1001851663 345
708 3300009011 Ga0105251_10000135 Ga0105251_1000013549 345
709 3300025292 Ga0209676_1000035 Ga0209676_1000035292 345
710 3300025304 Ga0209257_1001339 Ga0209257_10013394 345
711 3300025735 Ga0207713_1000417 Ga0207713_10004176 345
712 3300025925 Ga0207650_10001342 Ga0207650_100013423 345
713 3300027665 Ga0209983_1000837 Ga0209983_10008374 345
714 3300027682 Ga0209971_1000564 Ga0209971_10005643 345
715 3300027876 Ga0209974_10022179 Ga0209974_100221793 345
716 3300028380 Ga0268265_10171494 Ga0268265_101714943 345
717 3300031456 Ga0307513_10041457 Ga0307513_100414572 345
718 3300031456 Ga0307513_10283085 Ga0307513_102830851 345
719 3300032004 Ga0307414_10001446 Ga0307414_100014464 345
720 3300032004 Ga0307414_10012489 Ga0307414_100124892 345
721 3300032004 Ga0307414_10196488 Ga0307414_101964882 345
722 3300039145 Ga0237816_00232 Ga0237816_00232_339_1391 345
723 3300041404 Ga0439436_0010636 Ga0439436_0010636_154_1194 345
724 3300041413 Ga0439465_0000127 Ga0439465_0000127_7793_8833 345
725 3300041413 Ga0439465_0005093 Ga0439465_0005093_87_1124 345
726 3300041453 Ga0451797_0221659 Ga0451797_0221659_36_1166 345
727 3300042007 Ga0439449_0004920 Ga0439449_0004920_3918_4955 345
728 3300042007 Ga0439449_0024803 Ga0439449_0024803_239_1279 345
729 3300042007 Ga0439449_0039458 Ga0439449_0039458_91_1197 345
730 3300046460 Ga0495638_0067672 Ga0495638_0067672_372_1427 345
731 3300046501 Ga0495607_0020327 Ga0495607_0020327_1348_2385 345
732 3300046512 Ga0495610_0014871 Ga0495610_0014871_3230_4267 345
733 3300046522 Ga0495643_0072356 Ga0495643_0072356_208_1260 345
734 3300046525 Ga0495663_0000563 Ga0495663_0000563_9916_10968 345
735 3300046615 Ga0495656_0038148 Ga0495656_0038148_486_1529 345
736 3300046692 Ga0495671_0007904 Ga0495671_0007904_3560_4612 345
737 3300047472 Ga0495686_0022158 Ga0495686_0022158_1131_2207 345
738 3300048911 Ga0496108_0063679 Ga0496108_0063679_274_1317 345
739 3300048917 Ga0496114_0001241 Ga0496114_0001241_17502_18539 345
740 3300048922 Ga0496119_0000303 Ga0496119_0000303_54471_55562 345
741 3300048923 Ga0496120_0000437 Ga0496120_0000437_2917_4008 345
742 3300048925 Ga0496122_0000379 Ga0496122_0000379_61795_62883 345
743 3300048925 Ga0496122_0025501 Ga0496122_0025501_3551_4603 345
744 3300048926 Ga0496123_0000313 Ga0496123_0000313_14682_15770 345
745 3300048926 Ga0496123_0032869 Ga0496123_0032869_2109_3161 345
746 3300048928 Ga0496125_0018256 Ga0496125_0018256_4849_5952 345
747 3300049570 Ga0501033_0184119 Ga0501033_0184119_283_1320 345
748 3300049571 Ga0501034_0000309 Ga0501034_0000309_13267_14304 345
749 3300049574 Ga0501038_0193745 Ga0501038_0193745_543_1595 345
750 3300049762 Ga0501265_002107 Ga0501265_002107_961_2019 345
751 3300049823 Ga0501044_0382898 Ga0501044_0382898_227_1282 345
752 3300053161 Ga0500634_0000369 Ga0500634_0000369_9208_10254 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

62

346

0.97

PF22521

HypF_C_2

Carbamoyltransferase, Kae1-like Domain, second subdomain

231

345

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wq5-assembly1.cif.gz_A ygjd(v85e)-yeaz heterodimer in complex with atp 0.985 1 336
3zeu-assembly2.cif.gz_B structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas 0.9827 1 340
4ydu-assembly1.cif.gz_A crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp 0.9825 1 339
4wq5-assembly1.cif.gz_A ygjd(v85e)-yeaz heterodimer in complex with atp 0.9821 1 336
4wq4-assembly2.cif.gz_B e. coli ygjd(e12a)-yeaz heterodimer in complex with atp 0.9807 1 339
ID Description Score Start End Superfamily
3zeuB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.991 133 296 3.30.420.40
af_P05852_1_106_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9876 1 110 3.30.420.40
3zeuB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9791 133 296 3.30.420.40
af_P05852_1_106_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9785 1 110 3.30.420.40
3zeuB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9781 1 339 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2R7QVQ1-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9973 1 117 GO:0008033
GO:0046872
GO:0061711
AF-A0A836ZSF3-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9963 1 241 GO:0002949
GO:0016746
GO:0046872
AF-D0X787-F1-model_v4 deleted 0.9949 1 342
AF-A0A562BN05-F1-model_v4 tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) 0.9947 1 293 GO:0002949
GO:0004150
GO:0005506
GO:0005737
GO:0046654
GO:0046656
GO:0061711
AF-A0A1G6TZV3-F1-model_v4 tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) 0.9941 1 341 GO:0002949
GO:0005506
GO:0005737
GO:0061711

Feature Viewer

pLDDT pTM Quality
94.14 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map