F479174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 752 | 306 | 752 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0138397|Ga0453684_0138397_809_1159 |
| Length | 116 |
| Sequence | MGETIFSKIIRKEIPAKIVYEDDEVLAFNDINPQAPVHVLIIPKISEIETTRDIDPERHSALLGSLYKAANKIAKETGISESGFRLVLNCGPDAGQEVYHLHMHLLGGRKMNWPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 183 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 196 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 197 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 198 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 199 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 201 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 202 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 205 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 206 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 207 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 208 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 209 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 210 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 211 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 212 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 213 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 214 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 215 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 216 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 219 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 220 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 221 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 222 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 223 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 303 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 304 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 0 |
| Rhizoplane | 2.26 |
| Rhizosphere | 95.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_3700117 | 2162886006 | Bacteria | 826 |
| 2 | MBSR1b_contig_2267242 | 2162886012 | Bacteria | 824 |
| 3 | JGI24746J21847_1009684 | 3300001977 | Bacteria | 1435 |
| 4 | JGI24750J21931_1019248 | 3300002070 | Bacteria | 945 |
| 5 | JGI25406J46586_10003224 | 3300003203 | Bacteria | 7675 |
| 6 | JGI25406J46586_10023568 | 3300003203 | Bacteria | 2430 |
| 7 | Ga0065704_10845341 | 3300005289 | Bacteria | 511 |
| 8 | Ga0065712_10068445 | 3300005290 | Bacteria | 10595 |
| 9 | Ga0065712_10189133 | 3300005290 | Unclassified | 1156 |
| 10 | Ga0065712_10416994 | 3300005290 | Bacteria | 715 |
| 11 | Ga0065712_10567759 | 3300005290 | Bacteria | 608 |
| 12 | Ga0065715_10153179 | 3300005293 | Unclassified | 1694 |
| 13 | Ga0065715_10167581 | 3300005293 | Unclassified | 1574 |
| 14 | Ga0065715_10375280 | 3300005293 | Bacteria | 915 |
| 15 | Ga0065707_10005475 | 3300005295 | Bacteria | 3024 |
| 16 | Ga0065707_10108492 | 3300005295 | Bacteria | 2508 |
| 17 | Ga0065707_10271876 | 3300005295 | Bacteria | 1069 |
| 18 | Ga0065707_10284483 | 3300005295 | Bacteria | 1040 |
| 19 | Ga0065707_10465592 | 3300005295 | Bacteria | 787 |
| 20 | Ga0070658_10285570 | 3300005327 | Bacteria | 1405 |
| 21 | Ga0070676_10030126 | 3300005328 | Bacteria | 3092 |
| 22 | Ga0070676_10068970 | 3300005328 | Bacteria | 2118 |
| 23 | Ga0070676_10087769 | 3300005328 | Bacteria | 1899 |
| 24 | Ga0070676_10179577 | 3300005328 | Bacteria | 1375 |
| 25 | Ga0070676_10923258 | 3300005328 | Bacteria | 651 |
| 26 | Ga0070690_100009587 | 3300005330 | Bacteria | 5614 |
| 27 | Ga0070690_100054918 | 3300005330 | Bacteria | 2550 |
| 28 | Ga0070690_100264292 | 3300005330 | Bacteria | 1222 |
| 29 | Ga0070690_100388770 | 3300005330 | Bacteria | 1022 |
| 30 | Ga0070690_100621591 | 3300005330 | Bacteria | 822 |
| 31 | Ga0070690_100980785 | 3300005330 | Bacteria | 665 |
| 32 | Ga0070670_100004047 | 3300005331 | Bacteria | 12240 |
| 33 | Ga0070670_100192771 | 3300005331 | Bacteria | 1770 |
| 34 | Ga0070670_101878203 | 3300005331 | Bacteria | 552 |
| 35 | Ga0070677_10029226 | 3300005333 | Unclassified | 2088 |
| 36 | Ga0070677_10285652 | 3300005333 | Bacteria | 833 |
| 37 | Ga0070677_10492232 | 3300005333 | Bacteria | 663 |
| 38 | Ga0068869_100066722 | 3300005334 | Bacteria | 2652 |
| 39 | Ga0068869_100201816 | 3300005334 | Bacteria | 1568 |
| 40 | Ga0070666_10584095 | 3300005335 | Bacteria | 814 |
| 41 | Ga0070666_10589738 | 3300005335 | Bacteria | 810 |
| 42 | Ga0070680_100196527 | 3300005336 | Bacteria | 1700 |
| 43 | Ga0070680_100769736 | 3300005336 | Unclassified | 829 |
| 44 | Ga0068868_100092803 | 3300005338 | Unclassified | 2433 |
| 45 | Ga0068868_100226705 | 3300005338 | Bacteria | 1566 |
| 46 | Ga0068868_101460893 | 3300005338 | Bacteria | 639 |
| 47 | Ga0070660_100899750 | 3300005339 | Bacteria | 746 |
| 48 | Ga0070689_100011310 | 3300005340 | Bacteria | 6389 |
| 49 | Ga0070689_100081004 | 3300005340 | Bacteria | 2548 |
| 50 | Ga0070689_100148584 | 3300005340 | Bacteria | 1889 |
| 51 | Ga0070689_100273778 | 3300005340 | Bacteria | 1398 |
| 52 | Ga0070689_100338584 | 3300005340 | Bacteria | 1260 |
| 53 | Ga0070691_10224467 | 3300005341 | Bacteria | 997 |
| 54 | Ga0070687_100002850 | 3300005343 | Bacteria | 6608 |
| 55 | Ga0070687_101174784 | 3300005343 | Bacteria | 565 |
| 56 | Ga0070661_100024630 | 3300005344 | Bacteria | 4317 |
| 57 | Ga0070661_100537523 | 3300005344 | Bacteria | 939 |
| 58 | Ga0070692_10120613 | 3300005345 | Bacteria | 1462 |
| 59 | Ga0070692_10234044 | 3300005345 | Bacteria | 1092 |
| 60 | Ga0070692_10691611 | 3300005345 | Bacteria | 685 |
| 61 | Ga0070668_100043065 | 3300005347 | Bacteria | 3461 |
| 62 | Ga0070668_101020133 | 3300005347 | Unclassified | 744 |
| 63 | Ga0070669_100004013 | 3300005353 | Bacteria | 10643 |
| 64 | Ga0070669_100353027 | 3300005353 | Bacteria | 1194 |
| 65 | Ga0070669_100353550 | 3300005353 | Bacteria | 1193 |
| 66 | Ga0070669_101373622 | 3300005353 | Bacteria | 613 |
| 67 | Ga0070669_101675941 | 3300005353 | Unclassified | 554 |
| 68 | Ga0070675_100000954 | 3300005354 | Bacteria | 20626 |
| 69 | Ga0070675_100011353 | 3300005354 | Bacteria | 6971 |
| 70 | Ga0070675_100031578 | 3300005354 | Bacteria | 4283 |
| 71 | Ga0070675_100074939 | 3300005354 | Unclassified | 2812 |
| 72 | Ga0070675_100179410 | 3300005354 | Bacteria | 1830 |
| 73 | Ga0070675_101407345 | 3300005354 | Bacteria | 643 |
| 74 | Ga0070675_101423968 | 3300005354 | Bacteria | 639 |
| 75 | Ga0070671_100047927 | 3300005355 | Unclassified | 3553 |
| 76 | Ga0070671_100159669 | 3300005355 | Bacteria | 1906 |
| 77 | Ga0070671_100186546 | 3300005355 | Bacteria | 1757 |
| 78 | Ga0070674_101775519 | 3300005356 | Bacteria | 559 |
| 79 | Ga0070673_100005401 | 3300005364 | Bacteria | 8174 |
| 80 | Ga0070673_100008933 | 3300005364 | Bacteria | 6700 |
| 81 | Ga0070673_100009507 | 3300005364 | Bacteria | 6528 |
| 82 | Ga0070673_100730979 | 3300005364 | Bacteria | 910 |
| 83 | Ga0070688_100024757 | 3300005365 | Bacteria | 3546 |
| 84 | Ga0070688_100069382 | 3300005365 | Unclassified | 2250 |
| 85 | Ga0070688_100077561 | 3300005365 | Bacteria | 2141 |
| 86 | Ga0070688_101291562 | 3300005365 | Bacteria | 589 |
| 87 | Ga0070659_100066788 | 3300005366 | Bacteria | 2851 |
| 88 | Ga0070659_100385644 | 3300005366 | Bacteria | 1181 |
| 89 | Ga0070667_100052390 | 3300005367 | Unclassified | 3444 |
| 90 | Ga0070667_101030460 | 3300005367 | Bacteria | 768 |
| 91 | Ga0070667_102147666 | 3300005367 | Bacteria | 526 |
| 92 | Ga0070701_10034413 | 3300005438 | Unclassified | 2537 |
| 93 | Ga0070701_10281094 | 3300005438 | Bacteria | 1016 |
| 94 | Ga0070705_100397678 | 3300005440 | Bacteria | 1019 |
| 95 | Ga0070705_100934581 | 3300005440 | Bacteria | 700 |
| 96 | Ga0070700_100027258 | 3300005441 | Bacteria | 3386 |
| 97 | Ga0070700_100511953 | 3300005441 | Bacteria | 925 |
| 98 | Ga0070700_100525160 | 3300005441 | Bacteria | 915 |
| 99 | Ga0070708_101211310 | 3300005445 | Bacteria | 706 |
| 100 | Ga0070663_100660547 | 3300005455 | Bacteria | 885 |
| 101 | Ga0070663_101658324 | 3300005455 | Unclassified | 571 |
| 102 | Ga0070678_100023931 | 3300005456 | Bacteria | 4079 |
| 103 | Ga0070678_100230091 | 3300005456 | Bacteria | 1545 |
| 104 | Ga0070678_100316544 | 3300005456 | Bacteria | 1331 |
| 105 | Ga0070678_100601196 | 3300005456 | Bacteria | 982 |
| 106 | Ga0070678_100771407 | 3300005456 | Bacteria | 871 |
| 107 | Ga0070662_100004759 | 3300005457 | Bacteria | 8598 |
| 108 | Ga0070662_100040974 | 3300005457 | Bacteria | 3301 |
| 109 | Ga0068867_100061160 | 3300005459 | Bacteria | 2795 |
| 110 | Ga0068867_100126399 | 3300005459 | Bacteria | 1982 |
| 111 | Ga0068867_100749617 | 3300005459 | Bacteria | 866 |
| 112 | Ga0068867_101200470 | 3300005459 | Bacteria | 697 |
| 113 | Ga0068867_102004770 | 3300005459 | Bacteria | 547 |
| 114 | Ga0070685_10029005 | 3300005466 | Unclassified | 3072 |
| 115 | Ga0070685_10079208 | 3300005466 | Bacteria | 1966 |
| 116 | Ga0070685_10149193 | 3300005466 | Bacteria | 1480 |
| 117 | Ga0070707_100267452 | 3300005468 | Bacteria | 1663 |
| 118 | Ga0070707_100497606 | 3300005468 | Bacteria | 1180 |
| 119 | Ga0070698_100253844 | 3300005471 | Bacteria | 1691 |
| 120 | Ga0070699_100021687 | 3300005518 | Bacteria | 5538 |
| 121 | Ga0070699_100935455 | 3300005518 | Unclassified | 794 |
| 122 | Ga0070699_101134414 | 3300005518 | Bacteria | 717 |
| 123 | Ga0070684_100608731 | 3300005535 | Bacteria | 1016 |
| 124 | Ga0070684_100620281 | 3300005535 | Bacteria | 1006 |
| 125 | Ga0068853_100234936 | 3300005539 | Bacteria | 1678 |
| 126 | Ga0070672_100004271 | 3300005543 | Bacteria | 9342 |
| 127 | Ga0070672_100009212 | 3300005543 | Bacteria | 6796 |
| 128 | Ga0070672_100050131 | 3300005543 | Unclassified | 3251 |
| 129 | Ga0070672_100086254 | 3300005543 | Bacteria | 2524 |
| 130 | Ga0070672_100128254 | 3300005543 | Bacteria | 2083 |
| 131 | Ga0070672_100292164 | 3300005543 | Bacteria | 1380 |
| 132 | Ga0070672_100292685 | 3300005543 | Bacteria | 1379 |
| 133 | Ga0070686_100033415 | 3300005544 | Bacteria | 3161 |
| 134 | Ga0070686_100036889 | 3300005544 | Bacteria | 3029 |
| 135 | Ga0070686_100047742 | 3300005544 | Bacteria | 2708 |
| 136 | Ga0070686_100290870 | 3300005544 | Bacteria | 1208 |
| 137 | Ga0070686_100444526 | 3300005544 | Bacteria | 995 |
| 138 | Ga0070695_100124874 | 3300005545 | Bacteria | 1766 |
| 139 | Ga0070695_100688767 | 3300005545 | Bacteria | 810 |
| 140 | Ga0070696_100201191 | 3300005546 | Bacteria | 1487 |
| 141 | Ga0070693_100022486 | 3300005547 | Bacteria | 3354 |
| 142 | Ga0070665_100130869 | 3300005548 | Unclassified | 2511 |
| 143 | Ga0070704_100485040 | 3300005549 | Bacteria | 1070 |
| 144 | Ga0070704_100494603 | 3300005549 | Bacteria | 1060 |
| 145 | Ga0070704_100534883 | 3300005549 | Bacteria | 1022 |
| 146 | Ga0070704_101850060 | 3300005549 | Bacteria | 559 |
| 147 | Ga0068855_101973065 | 3300005563 | Bacteria | 590 |
| 148 | Ga0070664_100016473 | 3300005564 | Bacteria | 6059 |
| 149 | Ga0070664_100123324 | 3300005564 | Bacteria | 2270 |
| 150 | Ga0070664_100157183 | 3300005564 | Bacteria | 2009 |
| 151 | Ga0070664_100453362 | 3300005564 | Bacteria | 1178 |
| 152 | Ga0070664_101059385 | 3300005564 | Bacteria | 763 |
| 153 | Ga0070664_102085364 | 3300005564 | Bacteria | 538 |
| 154 | Ga0070664_102316587 | 3300005564 | Bacteria | 509 |
| 155 | Ga0068857_100405063 | 3300005577 | Unclassified | 1270 |
| 156 | Ga0068854_100070417 | 3300005578 | Bacteria | 2556 |
| 157 | Ga0070702_100050594 | 3300005615 | Bacteria | 2374 |
| 158 | Ga0068852_100021108 | 3300005616 | Bacteria | 5191 |
| 159 | Ga0068852_100241352 | 3300005616 | Unclassified | 1727 |
| 160 | Ga0068852_100429962 | 3300005616 | Bacteria | 1304 |
| 161 | Ga0068859_100001104 | 3300005617 | Bacteria | 27503 |
| 162 | Ga0068859_100047654 | 3300005617 | Bacteria | 4306 |
| 163 | Ga0068859_100073232 | 3300005617 | Bacteria | 3463 |
| 164 | Ga0068859_100119097 | 3300005617 | Bacteria | 2706 |
| 165 | Ga0068859_100168159 | 3300005617 | Bacteria | 2273 |
| 166 | Ga0068859_101615066 | 3300005617 | Unclassified | 716 |
| 167 | Ga0068864_100005659 | 3300005618 | Bacteria | 10248 |
| 168 | Ga0068864_100163792 | 3300005618 | Bacteria | 2023 |
| 169 | Ga0068864_100450538 | 3300005618 | Bacteria | 1231 |
| 170 | Ga0068866_10163468 | 3300005718 | Bacteria | 1300 |
| 171 | Ga0068866_10278757 | 3300005718 | Bacteria | 1035 |
| 172 | Ga0068861_100033352 | 3300005719 | Unclassified | 3798 |
| 173 | Ga0068861_100625816 | 3300005719 | Bacteria | 991 |
| 174 | Ga0068870_10000334 | 3300005840 | Bacteria | 17525 |
| 175 | Ga0068870_10199174 | 3300005840 | Bacteria | 1213 |
| 176 | Ga0068863_100032173 | 3300005841 | Bacteria | 5000 |
| 177 | Ga0068863_102107524 | 3300005841 | Bacteria | 574 |
| 178 | Ga0068858_100041332 | 3300005842 | Unclassified | 4275 |
| 179 | Ga0068858_100222130 | 3300005842 | Bacteria | 1789 |
| 180 | Ga0068860_100033706 | 3300005843 | Bacteria | 4913 |
| 181 | Ga0068860_100188391 | 3300005843 | Bacteria | 1996 |
| 182 | Ga0068862_100007352 | 3300005844 | Bacteria | 9143 |
| 183 | Ga0068862_100387230 | 3300005844 | Unclassified | 1305 |
| 184 | Ga0068862_100440749 | 3300005844 | Bacteria | 1226 |
| 185 | Ga0068862_100966126 | 3300005844 | Bacteria | 841 |
| 186 | Ga0068862_101370880 | 3300005844 | Bacteria | 710 |
| 187 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 188 | Ga0081539_10003877 | 3300005985 | Bacteria | 17471 |
| 189 | Ga0075364_10001941 | 3300006051 | Bacteria | 11521 |
| 190 | Ga0075364_10262427 | 3300006051 | Bacteria | 1174 |
| 191 | Ga0070715_10484270 | 3300006163 | Bacteria | 705 |
| 192 | Ga0075362_10001991 | 3300006177 | Bacteria | 6723 |
| 193 | Ga0075367_11103569 | 3300006178 | Unclassified | 507 |
| 194 | Ga0075427_10042471 | 3300006194 | Bacteria | 769 |
| 195 | Ga0075366_10029394 | 3300006195 | Bacteria | 3229 |
| 196 | Ga0075366_10576309 | 3300006195 | Bacteria | 697 |
| 197 | Ga0097621_100037091 | 3300006237 | Bacteria | 3903 |
| 198 | Ga0068871_100058513 | 3300006358 | Bacteria | 3138 |
| 199 | Ga0068871_100083349 | 3300006358 | Bacteria | 2652 |
| 200 | Ga0068871_100114587 | 3300006358 | Bacteria | 2271 |
| 201 | Ga0075428_100001946 | 3300006844 | Bacteria | 22190 |
| 202 | Ga0075428_100014804 | 3300006844 | Bacteria | 8668 |
| 203 | Ga0075428_100031002 | 3300006844 | Bacteria | 5913 |
| 204 | Ga0075428_100214990 | 3300006844 | Unclassified | 2077 |
| 205 | Ga0075428_100257040 | 3300006844 | Bacteria | 1881 |
| 206 | Ga0075430_100000495 | 3300006846 | Bacteria | 29612 |
| 207 | Ga0075430_100002007 | 3300006846 | Bacteria | 16762 |
| 208 | Ga0075430_100029756 | 3300006846 | Bacteria | 4636 |
| 209 | Ga0075430_100059918 | 3300006846 | Bacteria | 3199 |
| 210 | Ga0075430_100447719 | 3300006846 | Bacteria | 1066 |
| 211 | Ga0075430_101476568 | 3300006846 | Bacteria | 559 |
| 212 | Ga0075431_100000501 | 3300006847 | Bacteria | 32696 |
| 213 | Ga0075431_100018901 | 3300006847 | Bacteria | 7019 |
| 214 | Ga0075431_100033557 | 3300006847 | Bacteria | 5289 |
| 215 | Ga0075431_100121049 | 3300006847 | Unclassified | 2701 |
| 216 | Ga0075431_101086657 | 3300006847 | Bacteria | 765 |
| 217 | Ga0075433_10001923 | 3300006852 | Bacteria | 15628 |
| 218 | Ga0075433_10002593 | 3300006852 | Bacteria | 13778 |
| 219 | Ga0075433_10305399 | 3300006852 | Unclassified | 1409 |
| 220 | Ga0075433_10492197 | 3300006852 | Bacteria | 1080 |
| 221 | Ga0075433_10784131 | 3300006852 | Bacteria | 833 |
| 222 | Ga0075433_11159450 | 3300006852 | Unclassified | 671 |
| 223 | Ga0075434_100000863 | 3300006871 | Bacteria | 24202 |
| 224 | Ga0075434_100002413 | 3300006871 | Bacteria | 16413 |
| 225 | Ga0075434_100003202 | 3300006871 | Bacteria | 14595 |
| 226 | Ga0075434_100086925 | 3300006871 | Bacteria | 3127 |
| 227 | Ga0075434_100157985 | 3300006871 | Bacteria | 2287 |
| 228 | Ga0075434_102084094 | 3300006871 | Bacteria | 572 |
| 229 | Ga0075429_100006308 | 3300006880 | Bacteria | 10268 |
| 230 | Ga0075429_100006683 | 3300006880 | Bacteria | 9999 |
| 231 | Ga0075429_100008978 | 3300006880 | Bacteria | 8683 |
| 232 | Ga0075429_100033178 | 3300006880 | Bacteria | 4485 |
| 233 | Ga0075429_100701528 | 3300006880 | Bacteria | 886 |
| 234 | Ga0068865_100033914 | 3300006881 | Bacteria | 3420 |
| 235 | Ga0068865_100062515 | 3300006881 | Bacteria | 2614 |
| 236 | Ga0068865_100100535 | 3300006881 | Bacteria | 2116 |
| 237 | Ga0068865_100368917 | 3300006881 | Bacteria | 1168 |
| 238 | Ga0068865_101538371 | 3300006881 | Bacteria | 597 |
| 239 | Ga0097620_100001104 | 3300006931 | Bacteria | 27503 |
| 240 | Ga0097620_100047654 | 3300006931 | Bacteria | 4306 |
| 241 | Ga0097620_100073234 | 3300006931 | Bacteria | 3463 |
| 242 | Ga0097620_100119087 | 3300006931 | Bacteria | 2706 |
| 243 | Ga0097620_100168175 | 3300006931 | Bacteria | 2273 |
| 244 | Ga0097620_101615130 | 3300006931 | Unclassified | 716 |
| 245 | Ga0075435_100011881 | 3300007076 | Bacteria | 6430 |
| 246 | Ga0105251_10320868 | 3300009011 | Bacteria | 704 |
| 247 | Ga0111539_10000390 | 3300009094 | Bacteria | 54308 |
| 248 | Ga0111539_10004477 | 3300009094 | Bacteria | 18271 |
| 249 | Ga0111539_10031520 | 3300009094 | Bacteria | 6439 |
| 250 | Ga0111539_10066216 | 3300009094 | Bacteria | 4267 |
| 251 | Ga0111539_10160346 | 3300009094 | Bacteria | 2631 |
| 252 | Ga0111539_10523388 | 3300009094 | Bacteria | 1381 |
| 253 | Ga0111539_10688438 | 3300009094 | Bacteria | 1190 |
| 254 | Ga0111539_10821837 | 3300009094 | Bacteria | 1081 |
| 255 | Ga0111539_11273803 | 3300009094 | Unclassified | 853 |
| 256 | Ga0105245_10284861 | 3300009098 | Bacteria | 1616 |
| 257 | Ga0105245_10458585 | 3300009098 | Bacteria | 1284 |
| 258 | Ga0105245_10495012 | 3300009098 | Bacteria | 1238 |
| 259 | Ga0105247_10586347 | 3300009101 | Bacteria | 825 |
| 260 | Ga0114129_10006692 | 3300009147 | Bacteria | 16367 |
| 261 | Ga0114129_10027033 | 3300009147 | Bacteria | 8124 |
| 262 | Ga0114129_10047175 | 3300009147 | Bacteria | 6054 |
| 263 | Ga0114129_10056412 | 3300009147 | Bacteria | 5502 |
| 264 | Ga0114129_10113506 | 3300009147 | Bacteria | 3736 |
| 265 | Ga0114129_10119695 | 3300009147 | Unclassified | 3626 |
| 266 | Ga0114129_10314449 | 3300009147 | Bacteria | 2084 |
| 267 | Ga0114129_10426833 | 3300009147 | Bacteria | 1742 |
| 268 | Ga0114129_11327849 | 3300009147 | Bacteria | 890 |
| 269 | Ga0114129_11421596 | 3300009147 | Bacteria | 855 |
| 270 | Ga0105243_12561138 | 3300009148 | Bacteria | 550 |
| 271 | Ga0105243_12976221 | 3300009148 | Bacteria | 514 |
| 272 | Ga0105241_10411127 | 3300009174 | Bacteria | 1189 |
| 273 | Ga0105241_10433630 | 3300009174 | Bacteria | 1159 |
| 274 | Ga0105241_10441773 | 3300009174 | Bacteria | 1149 |
| 275 | Ga0105242_11323259 | 3300009176 | Bacteria | 745 |
| 276 | Ga0105248_10053811 | 3300009177 | Unclassified | 4515 |
| 277 | Ga0105248_10088868 | 3300009177 | Bacteria | 3478 |
| 278 | Ga0105248_10492110 | 3300009177 | Bacteria | 1382 |
| 279 | Ga0105248_10639906 | 3300009177 | Bacteria | 1200 |
| 280 | Ga0105248_11207319 | 3300009177 | Bacteria | 855 |
| 281 | Ga0105248_12848248 | 3300009177 | Bacteria | 552 |
| 282 | Ga0105249_10009621 | 3300009553 | Bacteria | 8469 |
| 283 | Ga0105249_10561249 | 3300009553 | Bacteria | 1193 |
| 284 | Ga0105249_11142216 | 3300009553 | Bacteria | 849 |
| 285 | Ga0105249_11945873 | 3300009553 | Bacteria | 661 |
| 286 | Ga0105239_10362092 | 3300010375 | Bacteria | 1638 |
| 287 | Ga0105239_11280305 | 3300010375 | Bacteria | 846 |
| 288 | Ga0105239_12040310 | 3300010375 | Bacteria | 666 |
| 289 | Ga0105246_10637124 | 3300011119 | Bacteria | 926 |
| 290 | Ga0105246_11507336 | 3300011119 | Bacteria | 632 |
| 291 | Ga0157338_1042528 | 3300012515 | Bacteria | 624 |
| 292 | Ga0157371_10134538 | 3300013102 | Bacteria | 1760 |
| 293 | Ga0157374_10305256 | 3300013296 | Bacteria | 1575 |
| 294 | Ga0157374_10884514 | 3300013296 | Bacteria | 911 |
| 295 | Ga0163162_10020643 | 3300013306 | Bacteria | 6474 |
| 296 | Ga0157375_10312607 | 3300013308 | Bacteria | 1735 |
| 297 | Ga0157375_10605373 | 3300013308 | Bacteria | 1255 |
| 298 | Ga0157375_10824339 | 3300013308 | Unclassified | 1075 |
| 299 | Ga0157375_10862221 | 3300013308 | Bacteria | 1051 |
| 300 | Ga0157375_11488889 | 3300013308 | Unclassified | 799 |
| 301 | Ga0157375_11811433 | 3300013308 | Bacteria | 724 |
| 302 | Ga0157375_12101770 | 3300013308 | Bacteria | 672 |
| 303 | Ga0163163_10028559 | 3300014325 | Bacteria | 5359 |
| 304 | Ga0163163_11989721 | 3300014325 | Bacteria | 641 |
| 305 | Ga0157380_10009059 | 3300014326 | Bacteria | 7111 |
| 306 | Ga0157380_10353703 | 3300014326 | Bacteria | 1376 |
| 307 | Ga0157380_10459124 | 3300014326 | Bacteria | 1226 |
| 308 | Ga0157380_11102614 | 3300014326 | Bacteria | 833 |
| 309 | Ga0157380_12151191 | 3300014326 | Bacteria | 621 |
| 310 | Ga0157377_10063672 | 3300014745 | Bacteria | 2113 |
| 311 | Ga0157377_10112297 | 3300014745 | Bacteria | 1640 |
| 312 | Ga0157377_10271730 | 3300014745 | Bacteria | 1107 |
| 313 | Ga0157377_10564858 | 3300014745 | Bacteria | 806 |
| 314 | Ga0157379_10098989 | 3300014968 | Unclassified | 2618 |
| 315 | Ga0157376_10118985 | 3300014969 | Unclassified | 2338 |
| 316 | Ga0157376_10591254 | 3300014969 | Bacteria | 1104 |
| 317 | Ga0182007_10162590 | 3300015262 | Bacteria | 764 |
| 318 | Ga0163161_10005023 | 3300017792 | Bacteria | 9202 |
| 319 | Ga0163161_10074017 | 3300017792 | Bacteria | 2497 |
| 320 | Ga0206356_11668982 | 3300020070 | Bacteria | 630 |
| 321 | Ga0213876_10096876 | 3300021384 | Bacteria | 1563 |
| 322 | Ga0207673_1069695 | 3300025290 | Bacteria | 502 |
| 323 | Ga0207697_10000148 | 3300025315 | Bacteria | 34368 |
| 324 | Ga0207697_10113994 | 3300025315 | Bacteria | 1159 |
| 325 | Ga0207697_10434269 | 3300025315 | Bacteria | 582 |
| 326 | Ga0207682_10010863 | 3300025893 | Bacteria | 3564 |
| 327 | Ga0207688_10009342 | 3300025901 | Bacteria | 5346 |
| 328 | Ga0207688_10127853 | 3300025901 | Bacteria | 1487 |
| 329 | Ga0207688_10313555 | 3300025901 | Bacteria | 961 |
| 330 | Ga0207688_10822880 | 3300025901 | Bacteria | 588 |
| 331 | Ga0207680_10088741 | 3300025903 | Bacteria | 1961 |
| 332 | Ga0207680_10694566 | 3300025903 | Bacteria | 729 |
| 333 | Ga0207680_10789117 | 3300025903 | Unclassified | 681 |
| 334 | Ga0207680_11087604 | 3300025903 | Bacteria | 572 |
| 335 | Ga0207680_11297796 | 3300025903 | Bacteria | 518 |
| 336 | Ga0207647_10234908 | 3300025904 | Bacteria | 1054 |
| 337 | Ga0207647_10457862 | 3300025904 | Bacteria | 714 |
| 338 | Ga0207647_10754970 | 3300025904 | Bacteria | 526 |
| 339 | Ga0207645_10000577 | 3300025907 | Bacteria | 30396 |
| 340 | Ga0207645_10007692 | 3300025907 | Bacteria | 7589 |
| 341 | Ga0207643_10000648 | 3300025908 | Bacteria | 21726 |
| 342 | Ga0207705_10867818 | 3300025909 | Bacteria | 699 |
| 343 | Ga0207654_10133807 | 3300025911 | Bacteria | 1572 |
| 344 | Ga0207654_11171981 | 3300025911 | Bacteria | 560 |
| 345 | Ga0207660_10239588 | 3300025917 | Bacteria | 1429 |
| 346 | Ga0207662_10006100 | 3300025918 | Bacteria | 6483 |
| 347 | Ga0207662_10147541 | 3300025918 | Unclassified | 1494 |
| 348 | Ga0207662_10222904 | 3300025918 | Bacteria | 1229 |
| 349 | Ga0207662_10462808 | 3300025918 | Bacteria | 869 |
| 350 | Ga0207662_10776714 | 3300025918 | Bacteria | 674 |
| 351 | Ga0207649_10004041 | 3300025920 | Bacteria | 7988 |
| 352 | Ga0207649_10058671 | 3300025920 | Bacteria | 2411 |
| 353 | Ga0207646_10287923 | 3300025922 | Bacteria | 1484 |
| 354 | Ga0207646_10634210 | 3300025922 | Bacteria | 958 |
| 355 | Ga0207646_10794376 | 3300025922 | Bacteria | 843 |
| 356 | Ga0207681_10021283 | 3300025923 | Bacteria | 4120 |
| 357 | Ga0207681_10114958 | 3300025923 | Bacteria | 1964 |
| 358 | Ga0207681_10243482 | 3300025923 | Bacteria | 1401 |
| 359 | Ga0207650_10018434 | 3300025925 | Bacteria | 4898 |
| 360 | Ga0207650_10278964 | 3300025925 | Bacteria | 1360 |
| 361 | Ga0207650_10817640 | 3300025925 | Bacteria | 790 |
| 362 | Ga0207650_11475658 | 3300025925 | Bacteria | 578 |
| 363 | Ga0207659_10012767 | 3300025926 | Bacteria | 5362 |
| 364 | Ga0207659_10020573 | 3300025926 | Bacteria | 4364 |
| 365 | Ga0207659_10041949 | 3300025926 | Bacteria | 3206 |
| 366 | Ga0207659_10078388 | 3300025926 | Bacteria | 2434 |
| 367 | Ga0207659_10245899 | 3300025926 | Unclassified | 1449 |
| 368 | Ga0207687_10304738 | 3300025927 | Bacteria | 1284 |
| 369 | Ga0207644_10070628 | 3300025931 | Bacteria | 2553 |
| 370 | Ga0207644_10435681 | 3300025931 | Bacteria | 1075 |
| 371 | Ga0207644_10791260 | 3300025931 | Bacteria | 793 |
| 372 | Ga0207690_10134713 | 3300025932 | Unclassified | 1812 |
| 373 | Ga0207706_10003199 | 3300025933 | Bacteria | 15718 |
| 374 | Ga0207706_10025129 | 3300025933 | Bacteria | 5340 |
| 375 | Ga0207706_10077657 | 3300025933 | Bacteria | 2920 |
| 376 | Ga0207706_10112236 | 3300025933 | Bacteria | 2398 |
| 377 | Ga0207686_10167508 | 3300025934 | Bacteria | 1546 |
| 378 | Ga0207709_10794371 | 3300025935 | Bacteria | 763 |
| 379 | Ga0207670_10078603 | 3300025936 | Bacteria | 2301 |
| 380 | Ga0207704_10034303 | 3300025938 | Bacteria | 2895 |
| 381 | Ga0207704_10553942 | 3300025938 | Bacteria | 935 |
| 382 | Ga0207704_11389759 | 3300025938 | Bacteria | 601 |
| 383 | Ga0207704_11807844 | 3300025938 | Bacteria | 525 |
| 384 | Ga0207691_10004463 | 3300025940 | Bacteria | 13556 |
| 385 | Ga0207691_10016775 | 3300025940 | Bacteria | 6949 |
| 386 | Ga0207691_10029052 | 3300025940 | Bacteria | 5172 |
| 387 | Ga0207691_10050130 | 3300025940 | Bacteria | 3823 |
| 388 | Ga0207691_10104982 | 3300025940 | Bacteria | 2517 |
| 389 | Ga0207691_10151630 | 3300025940 | Bacteria | 2038 |
| 390 | Ga0207691_10393097 | 3300025940 | Bacteria | 1183 |
| 391 | Ga0207691_10436354 | 3300025940 | Bacteria | 1115 |
| 392 | Ga0207711_10086861 | 3300025941 | Bacteria | 2743 |
| 393 | Ga0207711_10391697 | 3300025941 | Bacteria | 1290 |
| 394 | Ga0207711_11639216 | 3300025941 | Bacteria | 587 |
| 395 | Ga0207689_10004461 | 3300025942 | Bacteria | 12691 |
| 396 | Ga0207689_10185612 | 3300025942 | Bacteria | 1715 |
| 397 | Ga0207689_10194303 | 3300025942 | Bacteria | 1674 |
| 398 | Ga0207679_10014873 | 3300025945 | Bacteria | 5127 |
| 399 | Ga0207679_10158168 | 3300025945 | Bacteria | 1852 |
| 400 | Ga0207679_10551296 | 3300025945 | Bacteria | 1034 |
| 401 | Ga0207679_10885407 | 3300025945 | Bacteria | 816 |
| 402 | Ga0207667_11415276 | 3300025949 | Bacteria | 668 |
| 403 | Ga0207667_12166823 | 3300025949 | Bacteria | 513 |
| 404 | Ga0207651_10009746 | 3300025960 | Bacteria | 5280 |
| 405 | Ga0207651_10049323 | 3300025960 | Unclassified | 2851 |
| 406 | Ga0207651_10820065 | 3300025960 | Unclassified | 825 |
| 407 | Ga0207651_10828169 | 3300025960 | Bacteria | 821 |
| 408 | Ga0207712_10023764 | 3300025961 | Bacteria | 4050 |
| 409 | Ga0207668_10147791 | 3300025972 | Bacteria | 1816 |
| 410 | Ga0207668_10247360 | 3300025972 | Bacteria | 1446 |
| 411 | Ga0207668_10983768 | 3300025972 | Bacteria | 753 |
| 412 | Ga0207640_10322417 | 3300025981 | Bacteria | 1231 |
| 413 | Ga0207658_10042378 | 3300025986 | Bacteria | 3302 |
| 414 | Ga0207658_10048808 | 3300025986 | Unclassified | 3106 |
| 415 | Ga0207677_10102152 | 3300026023 | Unclassified | 2113 |
| 416 | Ga0207677_11216695 | 3300026023 | Bacteria | 690 |
| 417 | Ga0207677_12180221 | 3300026023 | Bacteria | 515 |
| 418 | Ga0207703_10064563 | 3300026035 | Unclassified | 3005 |
| 419 | Ga0207703_10072197 | 3300026035 | Bacteria | 2853 |
| 420 | Ga0207678_10784578 | 3300026067 | Bacteria | 841 |
| 421 | Ga0207678_11017396 | 3300026067 | Bacteria | 733 |
| 422 | Ga0207708_10014144 | 3300026075 | Bacteria | 5966 |
| 423 | Ga0207708_10169075 | 3300026075 | Bacteria | 1730 |
| 424 | Ga0207708_10663145 | 3300026075 | Bacteria | 889 |
| 425 | Ga0207708_10732103 | 3300026075 | Bacteria | 848 |
| 426 | Ga0207708_10764233 | 3300026075 | Bacteria | 830 |
| 427 | Ga0207641_10017355 | 3300026088 | Bacteria | 5892 |
| 428 | Ga0207641_11138043 | 3300026088 | Bacteria | 779 |
| 429 | Ga0207641_11523724 | 3300026088 | Bacteria | 670 |
| 430 | Ga0207648_10054986 | 3300026089 | Bacteria | 3475 |
| 431 | Ga0207648_10501682 | 3300026089 | Bacteria | 1110 |
| 432 | Ga0207648_10678294 | 3300026089 | Bacteria | 954 |
| 433 | Ga0207648_10761178 | 3300026089 | Bacteria | 900 |
| 434 | Ga0207648_11198608 | 3300026089 | Bacteria | 713 |
| 435 | Ga0207676_10085399 | 3300026095 | Unclassified | 2576 |
| 436 | Ga0207676_10111760 | 3300026095 | Bacteria | 2287 |
| 437 | Ga0207676_10154691 | 3300026095 | Bacteria | 1979 |
| 438 | Ga0207674_10297104 | 3300026116 | Unclassified | 1564 |
| 439 | Ga0207675_100002044 | 3300026118 | Bacteria | 20130 |
| 440 | Ga0207675_100418871 | 3300026118 | Bacteria | 1322 |
| 441 | Ga0207675_100688824 | 3300026118 | Bacteria | 1030 |
| 442 | Ga0207675_100689042 | 3300026118 | Bacteria | 1030 |
| 443 | Ga0207675_101304202 | 3300026118 | Bacteria | 746 |
| 444 | Ga0207683_10015895 | 3300026121 | Bacteria | 6410 |
| 445 | Ga0207683_10261714 | 3300026121 | Bacteria | 1579 |
| 446 | Ga0207683_10362000 | 3300026121 | Bacteria | 1332 |
| 447 | Ga0207683_10774730 | 3300026121 | Bacteria | 890 |
| 448 | Ga0207683_11128927 | 3300026121 | Bacteria | 727 |
| 449 | Ga0207683_12078621 | 3300026121 | Bacteria | 516 |
| 450 | Ga0207698_10015449 | 3300026142 | Bacteria | 5112 |
| 451 | Ga0207698_10854418 | 3300026142 | Bacteria | 915 |
| 452 | Ga0209973_1036971 | 3300027252 | Bacteria | 706 |
| 453 | Ga0210000_1020829 | 3300027462 | Bacteria | 1002 |
| 454 | Ga0209982_1012016 | 3300027552 | Bacteria | 1297 |
| 455 | Ga0209970_1075853 | 3300027614 | Bacteria | 628 |
| 456 | Ga0209971_1022927 | 3300027682 | Unclassified | 1488 |
| 457 | Ga0209974_10232836 | 3300027876 | Bacteria | 689 |
| 458 | Ga0209974_10240177 | 3300027876 | Bacteria | 679 |
| 459 | Ga0207428_10004203 | 3300027907 | Bacteria | 13794 |
| 460 | Ga0207428_10007408 | 3300027907 | Bacteria | 10004 |
| 461 | Ga0207428_10045960 | 3300027907 | Bacteria | 3513 |
| 462 | Ga0207428_10064071 | 3300027907 | Bacteria | 2903 |
| 463 | Ga0207428_10315068 | 3300027907 | Unclassified | 1156 |
| 464 | Ga0207428_10436704 | 3300027907 | Bacteria | 955 |
| 465 | Ga0207428_10444322 | 3300027907 | Bacteria | 946 |
| 466 | Ga0268266_10148985 | 3300028379 | Bacteria | 2107 |
| 467 | Ga0268266_10451263 | 3300028379 | Bacteria | 1222 |
| 468 | Ga0268265_10324676 | 3300028380 | Bacteria | 1395 |
| 469 | Ga0268265_10334700 | 3300028380 | Unclassified | 1376 |
| 470 | Ga0268264_10255994 | 3300028381 | Bacteria | 1628 |
| 471 | Ga0268264_10458574 | 3300028381 | Unclassified | 1236 |
| 472 | Ga0268264_12421181 | 3300028381 | Unclassified | 531 |
| 473 | Ga0307408_100010714 | 3300031548 | Bacteria | 6048 |
| 474 | Ga0307408_100023765 | 3300031548 | Bacteria | 4179 |
| 475 | Ga0307408_100998094 | 3300031548 | Bacteria | 771 |
| 476 | Ga0307408_101044651 | 3300031548 | Bacteria | 755 |
| 477 | Ga0307405_10025301 | 3300031731 | Bacteria | 3405 |
| 478 | Ga0307405_10537244 | 3300031731 | Bacteria | 944 |
| 479 | Ga0307405_11680318 | 3300031731 | Bacteria | 562 |
| 480 | Ga0307413_10027905 | 3300031824 | Bacteria | 3136 |
| 481 | Ga0307413_11046453 | 3300031824 | Bacteria | 702 |
| 482 | Ga0307410_10106421 | 3300031852 | Bacteria | 2021 |
| 483 | Ga0307410_10216265 | 3300031852 | Bacteria | 1471 |
| 484 | Ga0307406_10048622 | 3300031901 | Bacteria | 2680 |
| 485 | Ga0307406_10454145 | 3300031901 | Bacteria | 1029 |
| 486 | Ga0307407_10002294 | 3300031903 | Bacteria | 7420 |
| 487 | Ga0307407_10046830 | 3300031903 | Bacteria | 2450 |
| 488 | Ga0307412_10005218 | 3300031911 | Bacteria | 7282 |
| 489 | Ga0307412_10360484 | 3300031911 | Bacteria | 1170 |
| 490 | Ga0307412_11166788 | 3300031911 | Bacteria | 688 |
| 491 | Ga0307409_100002648 | 3300031995 | Bacteria | 9425 |
| 492 | Ga0307409_100003888 | 3300031995 | Bacteria | 8257 |
| 493 | Ga0307409_100293628 | 3300031995 | Bacteria | 1508 |
| 494 | Ga0307416_100004422 | 3300032002 | Bacteria | 8470 |
| 495 | Ga0307416_100044033 | 3300032002 | Bacteria | 3501 |
| 496 | Ga0307416_100503237 | 3300032002 | Bacteria | 1276 |
| 497 | Ga0307416_100608615 | 3300032002 | Bacteria | 1173 |
| 498 | Ga0307416_101691659 | 3300032002 | Bacteria | 737 |
| 499 | Ga0307416_102358506 | 3300032002 | Bacteria | 632 |
| 500 | Ga0307416_103530889 | 3300032002 | Bacteria | 523 |
| 501 | Ga0307414_10173391 | 3300032004 | Bacteria | 1727 |
| 502 | Ga0307414_10373728 | 3300032004 | Bacteria | 1230 |
| 503 | Ga0307414_10505576 | 3300032004 | Bacteria | 1070 |
| 504 | Ga0307411_10003618 | 3300032005 | Bacteria | 7220 |
| 505 | Ga0307411_10060532 | 3300032005 | Bacteria | 2515 |
| 506 | Ga0307411_11364967 | 3300032005 | Bacteria | 648 |
| 507 | Ga0307415_100001588 | 3300032126 | Bacteria | 10961 |
| 508 | Ga0373948_0020504 | 3300034817 | Bacteria | 1259 |
| 509 | Ga0373958_0086997 | 3300034819 | Bacteria | 715 |
| 510 | Ga0373934_0294081 | 3300035086 | Bacteria | 673 |
| 511 | Ga0373951_0107860 | 3300035091 | Bacteria | 746 |
| 512 | Ga0373936_0207943 | 3300035113 | Bacteria | 865 |
| 513 | Ga0373955_0959760 | 3300035172 | Bacteria | 526 |
| 514 | Ga0373961_0015803 | 3300035241 | Unclassified | 1936 |
| 515 | Ga0373961_0099220 | 3300035241 | Bacteria | 941 |
| 516 | Ga0373962_0008528 | 3300035242 | Bacteria | 2524 |
| 517 | Ga0316574_0000540 | 3300035398 | Bacteria | 15560 |
| 518 | Ga0373931_0085471 | 3300035691 | Bacteria | 1749 |
| 519 | Ga0373935_0195581 | 3300035692 | Bacteria | 1395 |
| 520 | Ga0373937_0471183 | 3300036401 | Bacteria | 1193 |
| 521 | Ga0436365_1109499 | 3300039437 | Bacteria | 3884 |
| 522 | Ga0439436_0153283 | 3300041404 | Bacteria | 650 |
| 523 | Ga0439439_0022822 | 3300041406 | Bacteria | 1566 |
| 524 | Ga0439453_0053654 | 3300041408 | Bacteria | 820 |
| 525 | Ga0439461_0052299 | 3300041410 | Bacteria | 909 |
| 526 | Ga0451800_1468674 | 3300041459 | Bacteria | 581 |
| 527 | Ga0451845_0692508 | 3300041501 | Bacteria | 551 |
| 528 | Ga0451855_1421513 | 3300041511 | Bacteria | 567 |
| 529 | Ga0439433_0014349 | 3300041999 | Bacteria | 1744 |
| 530 | Ga0439449_0045218 | 3300042007 | Bacteria | 1632 |
| 531 | Ga0439450_105714 | 3300042008 | Bacteria | 717 |
| 532 | Ga0439450_115530 | 3300042008 | Bacteria | 689 |
| 533 | Ga0439455_0221034 | 3300042012 | Bacteria | 551 |
| 534 | Ga0439457_121763 | 3300042014 | Unclassified | 617 |
| 535 | Ga0439462_0135062 | 3300042015 | Unclassified | 690 |
| 536 | Ga0439463_139423 | 3300042016 | Bacteria | 628 |
| 537 | Ga0450920_033413 | 3300042122 | Bacteria | 1017 |
| 538 | Ga0450923_011613 | 3300042125 | Bacteria | 1587 |
| 539 | Ga0450897_045601 | 3300042128 | Bacteria | 522 |
| 540 | Ga0450894_001525 | 3300042131 | Bacteria | 3295 |
| 541 | Ga0450896_013722 | 3300042133 | Bacteria | 1154 |
| 542 | Ga0450899_006866 | 3300042135 | Bacteria | 1236 |
| 543 | Ga0439458_0177095 | 3300042157 | Bacteria | 578 |
| 544 | Ga0450908_016885 | 3300042184 | Bacteria | 1299 |
| 545 | Ga0450908_028462 | 3300042184 | Bacteria | 973 |
| 546 | Ga0439434_0058985 | 3300042435 | Bacteria | 1198 |
| 547 | Ga0439435_0029358 | 3300042436 | Unclassified | 1484 |
| 548 | Ga0439435_0214630 | 3300042436 | Bacteria | 639 |
| 549 | Ga0439444_0014234 | 3300042437 | Bacteria | 1328 |
| 550 | Ga0439464_0012276 | 3300042439 | Bacteria | 2279 |
| 551 | Ga0439460_0017292 | 3300042461 | Bacteria | 1931 |
| 552 | Ga0450916_082719 | 3300042530 | Bacteria | 550 |
| 553 | Ga0450918_086013 | 3300042531 | Bacteria | 604 |
| 554 | Ga0439440_0046755 | 3300042993 | Bacteria | 1070 |
| 555 | Ga0439440_0068143 | 3300042993 | Bacteria | 921 |
| 556 | Ga0439440_0196329 | 3300042993 | Unclassified | 597 |
| 557 | Ga0453684_0138397 | 3300044712 | Bacteria | 2912 |
| 558 | Ga0451576_0168098 | 3300045051 | Unclassified | 2288 |
| 559 | Ga0451576_0691529 | 3300045051 | Bacteria | 1072 |
| 560 | Ga0495603_0009409 | 3300046455 | Bacteria | 5906 |
| 561 | Ga0495585_0210084 | 3300046492 | Unclassified | 987 |
| 562 | Ga0495644_0138006 | 3300046523 | Bacteria | 931 |
| 563 | Ga0495652_0938978 | 3300046529 | Bacteria | 569 |
| 564 | Ga0495598_0025338 | 3300046537 | Bacteria | 1617 |
| 565 | Ga0495598_0359488 | 3300046537 | Unclassified | 562 |
| 566 | Ga0495621_0012939 | 3300046539 | Bacteria | 2613 |
| 567 | Ga0495621_0323520 | 3300046539 | Bacteria | 643 |
| 568 | Ga0495667_0120663 | 3300046559 | Bacteria | 1693 |
| 569 | Ga0495635_0442097 | 3300046663 | Bacteria | 860 |
| 570 | Ga0495647_0128875 | 3300046681 | Bacteria | 1070 |
| 571 | Ga0495647_0248656 | 3300046681 | Bacteria | 791 |
| 572 | Ga0495647_0384309 | 3300046681 | Bacteria | 643 |
| 573 | Ga0495658_0161680 | 3300046683 | Unclassified | 1381 |
| 574 | Ga0495658_0163311 | 3300046683 | Bacteria | 1375 |
| 575 | Ga0495658_0394566 | 3300046683 | Bacteria | 882 |
| 576 | Ga0495613_0821395 | 3300046689 | Bacteria | 606 |
| 577 | Ga0495624_0375054 | 3300046690 | Bacteria | 855 |
| 578 | Ga0495676_0035493 | 3300047321 | Bacteria | 4169 |
| 579 | Ga0496101_0157406 | 3300048904 | Bacteria | 1741 |
| 580 | Ga0496101_1250024 | 3300048904 | Bacteria | 581 |
| 581 | Ga0496102_1772011 | 3300048905 | Bacteria | 535 |
| 582 | Ga0496103_0741961 | 3300048906 | Bacteria | 621 |
| 583 | Ga0496104_0018955 | 3300048907 | Bacteria | 6285 |
| 584 | Ga0496105_0068492 | 3300048908 | Bacteria | 2932 |
| 585 | Ga0496105_0619673 | 3300048908 | Bacteria | 838 |
| 586 | Ga0496106_1465036 | 3300048909 | Bacteria | 526 |
| 587 | Ga0496108_0687187 | 3300048911 | Bacteria | 888 |
| 588 | Ga0496109_0009469 | 3300048912 | Bacteria | 8305 |
| 589 | Ga0496110_0050960 | 3300048913 | Bacteria | 3637 |
| 590 | Ga0496110_0519699 | 3300048913 | Bacteria | 1083 |
| 591 | Ga0496113_0477436 | 3300048916 | Bacteria | 1001 |
| 592 | Ga0496114_0020501 | 3300048917 | Bacteria | 5365 |
| 593 | Ga0496114_1116749 | 3300048917 | Bacteria | 673 |
| 594 | Ga0496115_0402221 | 3300048918 | Bacteria | 1111 |
| 595 | Ga0501031_0010734 | 3300049568 | Bacteria | 5967 |
| 596 | Ga0501031_0023383 | 3300049568 | Bacteria | 4029 |
| 597 | Ga0501031_0157403 | 3300049568 | Bacteria | 1485 |
| 598 | Ga0501032_0005618 | 3300049569 | Bacteria | 9290 |
| 599 | Ga0501032_0006127 | 3300049569 | Bacteria | 8858 |
| 600 | Ga0501032_0219971 | 3300049569 | Bacteria | 1236 |
| 601 | Ga0501033_0004378 | 3300049570 | Bacteria | 11319 |
| 602 | Ga0501033_0111320 | 3300049570 | Bacteria | 1992 |
| 603 | Ga0501034_0011197 | 3300049571 | Bacteria | 9312 |
| 604 | Ga0501034_0338271 | 3300049571 | Unclassified | 1435 |
| 605 | Ga0501036_0001297 | 3300049572 | Bacteria | 19150 |
| 606 | Ga0501036_0017537 | 3300049572 | Bacteria | 5987 |
| 607 | Ga0501036_0075889 | 3300049572 | Bacteria | 2843 |
| 608 | Ga0501036_0412435 | 3300049572 | Bacteria | 1126 |
| 609 | Ga0501037_0006772 | 3300049573 | Bacteria | 8375 |
| 610 | Ga0501037_0009354 | 3300049573 | Bacteria | 7193 |
| 611 | Ga0501038_0002744 | 3300049574 | Bacteria | 16406 |
| 612 | Ga0501038_0021329 | 3300049574 | Bacteria | 5815 |
| 613 | Ga0501038_0096331 | 3300049574 | Bacteria | 2471 |
| 614 | Ga0501039_0014643 | 3300049575 | Bacteria | 6002 |
| 615 | Ga0501039_0015444 | 3300049575 | Bacteria | 5845 |
| 616 | Ga0501039_0095532 | 3300049575 | Bacteria | 2317 |
| 617 | Ga0501040_0229575 | 3300049576 | Bacteria | 1321 |
| 618 | Ga0501040_1169021 | 3300049576 | Bacteria | 558 |
| 619 | Ga0501041_0053907 | 3300049577 | Bacteria | 2453 |
| 620 | Ga0501042_0007620 | 3300049578 | Bacteria | 7103 |
| 621 | Ga0501042_0018344 | 3300049578 | Bacteria | 4842 |
| 622 | Ga0501042_0053525 | 3300049578 | Bacteria | 2879 |
| 623 | Ga0501043_0088990 | 3300049579 | Bacteria | 2426 |
| 624 | Ga0501043_0275587 | 3300049579 | Unclassified | 1291 |
| 625 | Ga0501046_0003264 | 3300049580 | Bacteria | 14889 |
| 626 | Ga0501046_0014788 | 3300049580 | Bacteria | 6571 |
| 627 | Ga0501046_0370570 | 3300049580 | Unclassified | 1037 |
| 628 | Ga0501047_0062272 | 3300049581 | Bacteria | 3598 |
| 629 | Ga0501047_0361166 | 3300049581 | Bacteria | 1288 |
| 630 | Ga0501047_0611300 | 3300049581 | Bacteria | 911 |
| 631 | Ga0501048_0002137 | 3300049582 | Bacteria | 15063 |
| 632 | Ga0501048_0018200 | 3300049582 | Bacteria | 5169 |
| 633 | Ga0501048_0058291 | 3300049582 | Bacteria | 2737 |
| 634 | Ga0501048_0085194 | 3300049582 | Bacteria | 2229 |
| 635 | Ga0501067_0029741 | 3300049583 | Bacteria | 3027 |
| 636 | Ga0501067_0056140 | 3300049583 | Bacteria | 2182 |
| 637 | Ga0501068_0001911 | 3300049584 | Bacteria | 11077 |
| 638 | Ga0501068_0651482 | 3300049584 | Bacteria | 687 |
| 639 | Ga0501069_0001824 | 3300049585 | Bacteria | 10622 |
| 640 | Ga0501069_0006550 | 3300049585 | Bacteria | 6090 |
| 641 | Ga0501069_0567547 | 3300049585 | Bacteria | 680 |
| 642 | Ga0501070_0008436 | 3300049586 | Bacteria | 8702 |
| 643 | Ga0501070_0028638 | 3300049586 | Bacteria | 4671 |
| 644 | Ga0501071_0012804 | 3300049587 | Bacteria | 5704 |
| 645 | Ga0501071_0112603 | 3300049587 | Bacteria | 2012 |
| 646 | Ga0501071_0735558 | 3300049587 | Bacteria | 760 |
| 647 | Ga0501072_0052134 | 3300049588 | Bacteria | 3221 |
| 648 | Ga0501072_0152215 | 3300049588 | Bacteria | 1844 |
| 649 | Ga0501073_0003336 | 3300049589 | Bacteria | 12066 |
| 650 | Ga0501073_0150028 | 3300049589 | Unclassified | 1615 |
| 651 | Ga0501073_0810797 | 3300049589 | Bacteria | 645 |
| 652 | Ga0501073_0997904 | 3300049589 | Viruses | 576 |
| 653 | Ga0501074_0006773 | 3300049590 | Bacteria | 8270 |
| 654 | Ga0501074_0211537 | 3300049590 | Bacteria | 1381 |
| 655 | Ga0501075_0002772 | 3300049591 | Bacteria | 11744 |
| 656 | Ga0501075_0073859 | 3300049591 | Bacteria | 2579 |
| 657 | Ga0501075_0304786 | 3300049591 | Bacteria | 1214 |
| 658 | Ga0501075_0402404 | 3300049591 | Bacteria | 1044 |
| 659 | Ga0501075_0444107 | 3300049591 | Bacteria | 989 |
| 660 | Ga0501076_0049675 | 3300049592 | Bacteria | 3318 |
| 661 | Ga0501076_0135828 | 3300049592 | Bacteria | 1996 |
| 662 | Ga0501076_0154132 | 3300049592 | Bacteria | 1870 |
| 663 | Ga0501076_0275459 | 3300049592 | Bacteria | 1378 |
| 664 | Ga0501077_0598311 | 3300049593 | Bacteria | 708 |
| 665 | Ga0501233_224160 | 3300049668 | Bacteria | 556 |
| 666 | Ga0501079_0000894 | 3300049741 | Bacteria | 20415 |
| 667 | Ga0501079_0016945 | 3300049741 | Bacteria | 5566 |
| 668 | Ga0501079_0031859 | 3300049741 | Bacteria | 4052 |
| 669 | Ga0501079_0052684 | 3300049741 | Bacteria | 3140 |
| 670 | Ga0501080_0003760 | 3300049742 | Bacteria | 13403 |
| 671 | Ga0501080_0028173 | 3300049742 | Bacteria | 5223 |
| 672 | Ga0501080_0054487 | 3300049742 | Bacteria | 3724 |
| 673 | Ga0501081_0019001 | 3300049743 | Bacteria | 4570 |
| 674 | Ga0501081_0032255 | 3300049743 | Bacteria | 3553 |
| 675 | Ga0501083_0190369 | 3300049744 | Bacteria | 1339 |
| 676 | Ga0501035_0029910 | 3300049822 | Bacteria | 4967 |
| 677 | Ga0501035_0166617 | 3300049822 | Bacteria | 1905 |
| 678 | Ga0501035_0623680 | 3300049822 | Bacteria | 876 |
| 679 | Ga0501044_0031764 | 3300049823 | Bacteria | 5554 |
| 680 | Ga0501044_0342210 | 3300049823 | Bacteria | 1416 |
| 681 | Ga0501045_0014255 | 3300049824 | Bacteria | 5634 |
| 682 | Ga0501045_0241539 | 3300049824 | Bacteria | 1344 |
| 683 | Ga0501045_0244494 | 3300049824 | Unclassified | 1336 |
| 684 | Ga0501045_0795806 | 3300049824 | Bacteria | 696 |
| 685 | nmdc:mga03683_305711_c1 | 3300050489 | Bacteria | 747 |
| 686 | nmdc:mga00v17_169911_c1 | 3300050491 | Bacteria | 1406 |
| 687 | nmdc:mga0yw44_685417_c1 | 3300050492 | Bacteria | 696 |
| 688 | nmdc:mga0k408_2583_c1 | 3300050493 | Bacteria | 9614 |
| 689 | nmdc:mga05p37_1212421_c1 | 3300050507 | Bacteria | 778 |
| 690 | nmdc:mga05p37_2629_c1 | 3300050507 | Bacteria | 20910 |
| 691 | nmdc:mga05p37_315151_c1 | 3300050507 | Unclassified | 1853 |
| 692 | nmdc:mga05p37_47196_c1 | 3300050507 | Bacteria | 5296 |
| 693 | nmdc:mga05p37_569037_c1 | 3300050507 | Bacteria | 1286 |
| 694 | nmdc:mga05p37_61488_c1 | 3300050507 | Bacteria | 4623 |
| 695 | nmdc:mga05p37_785493_c1 | 3300050507 | Bacteria | 1044 |
| 696 | nmdc:mga09592_11186_c1 | 3300050508 | Bacteria | 7302 |
| 697 | nmdc:mga09592_1151_c1 | 3300050508 | Bacteria | 21071 |
| 698 | nmdc:mga09592_21965_c1 | 3300050508 | Bacteria | 5264 |
| 699 | nmdc:mga09592_680372_c1 | 3300050508 | Bacteria | 877 |
| 700 | nmdc:mga09592_9057_c1 | 3300050508 | Bacteria | 8091 |
| 701 | nmdc:mga09592_99836_c1 | 3300050508 | Bacteria | 2485 |
| 702 | nmdc:mga0qj67_1199761_c1 | 3300050509 | Bacteria | 590 |
| 703 | nmdc:mga0qj67_181061_c1 | 3300050509 | Bacteria | 1711 |
| 704 | nmdc:mga0qj67_1855_c1 | 3300050509 | Bacteria | 14979 |
| 705 | nmdc:mga0qj67_188001_c1 | 3300050509 | Bacteria | 1678 |
| 706 | nmdc:mga0qj67_26899_c1 | 3300050509 | Bacteria | 4455 |
| 707 | nmdc:mga0qj67_320955_c1 | 3300050509 | Bacteria | 1254 |
| 708 | nmdc:mga0qj67_5906_c1 | 3300050509 | Bacteria | 8971 |
| 709 | nmdc:mga0qj67_899_c1 | 3300050509 | Bacteria | 20433 |
| 710 | nmdc:mga06r32_1105309_c1 | 3300050510 | Bacteria | 742 |
| 711 | nmdc:mga06r32_11765_c1 | 3300050510 | Bacteria | 7879 |
| 712 | nmdc:mga06r32_1217_c1 | 3300050510 | Bacteria | 23192 |
| 713 | nmdc:mga06r32_159845_c1 | 3300050510 | Bacteria | 2235 |
| 714 | nmdc:mga06r32_354352_c1 | 3300050510 | Bacteria | 1452 |
| 715 | nmdc:mga06r32_50770_c1 | 3300050510 | Bacteria | 3967 |
| 716 | nmdc:mga06r32_88110_c1 | 3300050510 | Bacteria | 3030 |
| 717 | nmdc:mga08y16_207658_c1 | 3300050511 | Unclassified | 2029 |
| 718 | nmdc:mga08y16_24666_c1 | 3300050511 | Bacteria | 6347 |
| 719 | nmdc:mga08y16_30647_c1 | 3300050511 | Bacteria | 5659 |
| 720 | nmdc:mga08y16_62014_c1 | 3300050511 | Bacteria | 3904 |
| 721 | nmdc:mga08y16_738114_c1 | 3300050511 | Bacteria | 982 |
| 722 | nmdc:mga08y16_87648_c1 | 3300050511 | Bacteria | 3243 |
| 723 | nmdc:mga08y16_953_c1 | 3300050511 | Bacteria | 28127 |
| 724 | nmdc:mga0n895_1256235_c1 | 3300050512 | Bacteria | 713 |
| 725 | nmdc:mga0n895_1590872_c1 | 3300050512 | Bacteria | 618 |
| 726 | nmdc:mga0n895_37083_c1 | 3300050512 | Bacteria | 4713 |
| 727 | nmdc:mga0n895_5337_c1 | 3300050512 | Bacteria | 10710 |
| 728 | nmdc:mga0rr50_167248_c1 | 3300050513 | Unclassified | 1789 |
| 729 | nmdc:mga0a205_102698_c1 | 3300050515 | Bacteria | 2757 |
| 730 | nmdc:mga0a205_14932_c1 | 3300050515 | Bacteria | 7247 |
| 731 | nmdc:mga0a205_233_c1 | 3300050515 | Bacteria | 39247 |
| 732 | nmdc:mga0a205_42735_c1 | 3300050515 | Bacteria | 4367 |
| 733 | nmdc:mga0a205_656870_c1 | 3300050515 | Bacteria | 900 |
| 734 | nmdc:mga0a205_99_c1 | 3300050515 | Bacteria | 49204 |
| 735 | Ga0495601_0029307 | 3300053077 | Bacteria | 3413 |
| 736 | Ga0495595_0144365 | 3300053084 | Bacteria | 1169 |
| 737 | Ga0495619_0053906 | 3300053085 | Bacteria | 2661 |
| 738 | Ga0501084_0007339 | 3300054114 | Bacteria | 9081 |
| 739 | Ga0501084_0019618 | 3300054114 | Bacteria | 5633 |
| 740 | Ga0501084_0037637 | 3300054114 | Bacteria | 4043 |
| 741 | Ga0501084_0079823 | 3300054114 | Bacteria | 2743 |
| 742 | Ga0501084_1570101 | 3300054114 | Bacteria | 550 |
| 743 | Ga0590071_067361 | 3300059421 | Bacteria | 880 |
| 744 | Ga0590071_095472 | 3300059421 | Bacteria | 746 |
| 745 | Ga0590075_022471 | 3300059424 | Bacteria | 1578 |
| 746 | Ga0590077_003880 | 3300059426 | Bacteria | 3083 |
| 747 | Ga0501082_0002081 | 3300060353 | Bacteria | 17626 |
| 748 | Ga0501082_0035816 | 3300060353 | Bacteria | 4278 |
| 749 | Ga0501082_0069156 | 3300060353 | Bacteria | 3039 |
| 750 | Ga0501082_0289949 | 3300060353 | Bacteria | 1425 |
| 751 | Ga0530510_0119762 | 3300061734 | Bacteria | 1931 |
| 752 | Ga0530510_0328277 | 3300061734 | Bacteria | 1147 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042184 | Ga0450908_028462 | Ga0450908_028462_640_957 | 105 |
| 2 | 3300035398 | Ga0316574_0000540 | Ga0316574_0000540_10852_11172 | 106 |
| 3 | 3300046455 | Ga0495603_0009409 | Ga0495603_0009409_125_445 | 106 |
| 4 | 3300046681 | Ga0495647_0128875 | Ga0495647_0128875_350_670 | 106 |
| 5 | 3300046683 | Ga0495658_0161680 | Ga0495658_0161680_115_435 | 106 |
| 6 | 3300046690 | Ga0495624_0375054 | Ga0495624_0375054_379_699 | 106 |
| 7 | 3300047321 | Ga0495676_0035493 | Ga0495676_0035493_3631_3951 | 106 |
| 8 | 3300041501 | Ga0451845_0692508 | Ga0451845_0692508_62_409 | 109 |
| 9 | 3300025940 | Ga0207691_10151630 | Ga0207691_101516302 | 110 |
| 10 | 3300005353 | Ga0070669_101675941 | Ga0070669_1016759412 | 112 |
| 11 | 3300005518 | Ga0070699_101134414 | Ga0070699_1011344142 | 112 |
| 12 | 3300027907 | Ga0207428_10064071 | Ga0207428_100640712 | 112 |
| 13 | 3300028381 | Ga0268264_12421181 | Ga0268264_124211811 | 112 |
| 14 | 3300044712 | Ga0453684_0138397 | Ga0453684_0138397_809_1159 | 112 |
| 15 | 3300005295 | Ga0065707_10465592 | Ga0065707_104655922 | 113 |
| 16 | 3300005328 | Ga0070676_10923258 | Ga0070676_109232582 | 113 |
| 17 | 3300005331 | Ga0070670_100192771 | Ga0070670_1001927713 | 113 |
| 18 | 3300005335 | Ga0070666_10589738 | Ga0070666_105897381 | 113 |
| 19 | 3300005338 | Ga0068868_101460893 | Ga0068868_1014608932 | 113 |
| 20 | 3300005367 | Ga0070667_102147666 | Ga0070667_1021476661 | 113 |
| 21 | 3300005457 | Ga0070662_100040974 | Ga0070662_1000409742 | 113 |
| 22 | 3300005466 | Ga0070685_10149193 | Ga0070685_101491933 | 113 |
| 23 | 3300005539 | Ga0068853_100234936 | Ga0068853_1002349361 | 113 |
| 24 | 3300005544 | Ga0070686_100444526 | Ga0070686_1004445262 | 113 |
| 25 | 3300005549 | Ga0070704_100534883 | Ga0070704_1005348832 | 113 |
| 26 | 3300005563 | Ga0068855_101973065 | Ga0068855_1019730651 | 113 |
| 27 | 3300005718 | Ga0068866_10278757 | Ga0068866_102787572 | 113 |
| 28 | 3300006163 | Ga0070715_10484270 | Ga0070715_104842701 | 113 |
| 29 | 3300006237 | Ga0097621_100037091 | Ga0097621_1000370914 | 113 |
| 30 | 3300006358 | Ga0068871_100114587 | Ga0068871_1001145872 | 113 |
| 31 | 3300006881 | Ga0068865_100062515 | Ga0068865_1000625152 | 113 |
| 32 | 3300006881 | Ga0068865_100368917 | Ga0068865_1003689172 | 113 |
| 33 | 3300009098 | Ga0105245_10495012 | Ga0105245_104950121 | 113 |
| 34 | 3300009101 | Ga0105247_10586347 | Ga0105247_105863472 | 113 |
| 35 | 3300009148 | Ga0105243_12561138 | Ga0105243_125611382 | 113 |
| 36 | 3300009174 | Ga0105241_10433630 | Ga0105241_104336302 | 113 |
| 37 | 3300009174 | Ga0105241_10441773 | Ga0105241_104417732 | 113 |
| 38 | 3300009177 | Ga0105248_10088868 | Ga0105248_100888682 | 113 |
| 39 | 3300009553 | Ga0105249_11142216 | Ga0105249_111422162 | 113 |
| 40 | 3300010375 | Ga0105239_10362092 | Ga0105239_103620923 | 113 |
| 41 | 3300013296 | Ga0157374_10305256 | Ga0157374_103052563 | 113 |
| 42 | 3300013296 | Ga0157374_10884514 | Ga0157374_108845141 | 113 |
| 43 | 3300013308 | Ga0157375_10312607 | Ga0157375_103126071 | 113 |
| 44 | 3300013308 | Ga0157375_10605373 | Ga0157375_106053732 | 113 |
| 45 | 3300014326 | Ga0157380_10353703 | Ga0157380_103537032 | 113 |
| 46 | 3300014326 | Ga0157380_12151191 | Ga0157380_121511911 | 113 |
| 47 | 3300014745 | Ga0157377_10564858 | Ga0157377_105648582 | 113 |
| 48 | 3300017792 | Ga0163161_10005023 | Ga0163161_100050238 | 113 |
| 49 | 3300025315 | Ga0207697_10113994 | Ga0207697_101139942 | 113 |
| 50 | 3300025903 | Ga0207680_10694566 | Ga0207680_106945662 | 113 |
| 51 | 3300025904 | Ga0207647_10234908 | Ga0207647_102349081 | 113 |
| 52 | 3300025904 | Ga0207647_10457862 | Ga0207647_104578622 | 113 |
| 53 | 3300025911 | Ga0207654_10133807 | Ga0207654_101338072 | 113 |
| 54 | 3300025911 | Ga0207654_11171981 | Ga0207654_111719811 | 113 |
| 55 | 3300025925 | Ga0207650_10278964 | Ga0207650_102789642 | 113 |
| 56 | 3300025933 | Ga0207706_10025129 | Ga0207706_100251295 | 113 |
| 57 | 3300025934 | Ga0207686_10167508 | Ga0207686_101675082 | 113 |
| 58 | 3300025938 | Ga0207704_10553942 | Ga0207704_105539422 | 113 |
| 59 | 3300025938 | Ga0207704_11389759 | Ga0207704_113897591 | 113 |
| 60 | 3300025941 | Ga0207711_10086861 | Ga0207711_100868612 | 113 |
| 61 | 3300025949 | Ga0207667_12166823 | Ga0207667_121668231 | 113 |
| 62 | 3300025972 | Ga0207668_10147791 | Ga0207668_101477912 | 113 |
| 63 | 3300026023 | Ga0207677_11216695 | Ga0207677_112166951 | 113 |
| 64 | 3300026067 | Ga0207678_11017396 | Ga0207678_110173962 | 113 |
| 65 | 3300036401 | Ga0373937_0471183 | Ga0373937_0471183_440_781 | 113 |
| 66 | 3300042015 | Ga0439462_0135062 | Ga0439462_0135062_90_431 | 113 |
| 67 | 3300042125 | Ga0450923_011613 | Ga0450923_011613_464_805 | 113 |
| 68 | 3300042128 | Ga0450897_045601 | Ga0450897_045601_77_418 | 113 |
| 69 | 3300042131 | Ga0450894_001525 | Ga0450894_001525_1646_1987 | 113 |
| 70 | 3300042133 | Ga0450896_013722 | Ga0450896_013722_690_1031 | 113 |
| 71 | 3300042135 | Ga0450899_006866 | Ga0450899_006866_611_952 | 113 |
| 72 | 3300042461 | Ga0439460_0017292 | Ga0439460_0017292_696_1037 | 113 |
| 73 | 3300046529 | Ga0495652_0938978 | Ga0495652_0938978_192_533 | 113 |
| 74 | 3300046681 | Ga0495647_0384309 | Ga0495647_0384309_242_583 | 113 |
| 75 | 3300046689 | Ga0495613_0821395 | Ga0495613_0821395_128_469 | 113 |
| 76 | 3300048904 | Ga0496101_0157406 | Ga0496101_0157406_1096_1437 | 113 |
| 77 | 3300048904 | Ga0496101_1250024 | Ga0496101_1250024_80_421 | 113 |
| 78 | 3300048907 | Ga0496104_0018955 | Ga0496104_0018955_3674_4015 | 113 |
| 79 | 3300048908 | Ga0496105_0068492 | Ga0496105_0068492_2302_2643 | 113 |
| 80 | 3300048913 | Ga0496110_0050960 | Ga0496110_0050960_1098_1439 | 113 |
| 81 | 3300048917 | Ga0496114_0020501 | Ga0496114_0020501_4663_5004 | 113 |
| 82 | 3300048917 | Ga0496114_1116749 | Ga0496114_1116749_282_623 | 113 |
| 83 | 3300048918 | Ga0496115_0402221 | Ga0496115_0402221_113_454 | 113 |
| 84 | 3300049568 | Ga0501031_0010734 | Ga0501031_0010734_4336_4677 | 113 |
| 85 | 3300049568 | Ga0501031_0023383 | Ga0501031_0023383_2835_3176 | 113 |
| 86 | 3300049569 | Ga0501032_0005618 | Ga0501032_0005618_7831_8172 | 113 |
| 87 | 3300049569 | Ga0501032_0006127 | Ga0501032_0006127_2856_3197 | 113 |
| 88 | 3300049570 | Ga0501033_0004378 | Ga0501033_0004378_906_1247 | 113 |
| 89 | 3300049570 | Ga0501033_0111320 | Ga0501033_0111320_1547_1888 | 113 |
| 90 | 3300049571 | Ga0501034_0338271 | Ga0501034_0338271_913_1254 | 113 |
| 91 | 3300049572 | Ga0501036_0001297 | Ga0501036_0001297_5842_6183 | 113 |
| 92 | 3300049572 | Ga0501036_0017537 | Ga0501036_0017537_4838_5179 | 113 |
| 93 | 3300049573 | Ga0501037_0006772 | Ga0501037_0006772_170_511 | 113 |
| 94 | 3300049573 | Ga0501037_0009354 | Ga0501037_0009354_4240_4581 | 113 |
| 95 | 3300049574 | Ga0501038_0002744 | Ga0501038_0002744_9846_10187 | 113 |
| 96 | 3300049574 | Ga0501038_0021329 | Ga0501038_0021329_4588_4929 | 113 |
| 97 | 3300049575 | Ga0501039_0014643 | Ga0501039_0014643_920_1261 | 113 |
| 98 | 3300049576 | Ga0501040_1169021 | Ga0501040_1169021_19_360 | 113 |
| 99 | 3300049578 | Ga0501042_0007620 | Ga0501042_0007620_4308_4649 | 113 |
| 100 | 3300049579 | Ga0501043_0088990 | Ga0501043_0088990_795_1136 | 113 |
| 101 | 3300049579 | Ga0501043_0275587 | Ga0501043_0275587_61_402 | 113 |
| 102 | 3300049580 | Ga0501046_0003264 | Ga0501046_0003264_6306_6647 | 113 |
| 103 | 3300049580 | Ga0501046_0370570 | Ga0501046_0370570_509_850 | 113 |
| 104 | 3300049581 | Ga0501047_0062272 | Ga0501047_0062272_238_579 | 113 |
| 105 | 3300049581 | Ga0501047_0611300 | Ga0501047_0611300_528_869 | 113 |
| 106 | 3300049582 | Ga0501048_0002137 | Ga0501048_0002137_8503_8844 | 113 |
| 107 | 3300049582 | Ga0501048_0018200 | Ga0501048_0018200_854_1195 | 113 |
| 108 | 3300049583 | Ga0501067_0029741 | Ga0501067_0029741_1681_2022 | 113 |
| 109 | 3300049583 | Ga0501067_0056140 | Ga0501067_0056140_1091_1432 | 113 |
| 110 | 3300049584 | Ga0501068_0001911 | Ga0501068_0001911_9550_9891 | 113 |
| 111 | 3300049584 | Ga0501068_0651482 | Ga0501068_0651482_149_490 | 113 |
| 112 | 3300049585 | Ga0501069_0001824 | Ga0501069_0001824_6434_6775 | 113 |
| 113 | 3300049585 | Ga0501069_0006550 | Ga0501069_0006550_3719_4060 | 113 |
| 114 | 3300049586 | Ga0501070_0008436 | Ga0501070_0008436_6085_6426 | 113 |
| 115 | 3300049586 | Ga0501070_0028638 | Ga0501070_0028638_913_1254 | 113 |
| 116 | 3300049587 | Ga0501071_0012804 | Ga0501071_0012804_4287_4628 | 113 |
| 117 | 3300049589 | Ga0501073_0003336 | Ga0501073_0003336_11613_11954 | 113 |
| 118 | 3300049589 | Ga0501073_0150028 | Ga0501073_0150028_885_1226 | 113 |
| 119 | 3300049590 | Ga0501074_0006773 | Ga0501074_0006773_5527_5868 | 113 |
| 120 | 3300049590 | Ga0501074_0211537 | Ga0501074_0211537_917_1258 | 113 |
| 121 | 3300049591 | Ga0501075_0444107 | Ga0501075_0444107_344_685 | 113 |
| 122 | 3300049592 | Ga0501076_0275459 | Ga0501076_0275459_291_632 | 113 |
| 123 | 3300049741 | Ga0501079_0000894 | Ga0501079_0000894_4566_4907 | 113 |
| 124 | 3300049741 | Ga0501079_0016945 | Ga0501079_0016945_4414_4755 | 113 |
| 125 | 3300049742 | Ga0501080_0003760 | Ga0501080_0003760_5487_5828 | 113 |
| 126 | 3300049742 | Ga0501080_0028173 | Ga0501080_0028173_2114_2455 | 113 |
| 127 | 3300049822 | Ga0501035_0029910 | Ga0501035_0029910_880_1221 | 113 |
| 128 | 3300049822 | Ga0501035_0623680 | Ga0501035_0623680_368_709 | 113 |
| 129 | 3300049823 | Ga0501044_0031764 | Ga0501044_0031764_1462_1803 | 113 |
| 130 | 3300049823 | Ga0501044_0342210 | Ga0501044_0342210_115_456 | 113 |
| 131 | 3300049824 | Ga0501045_0244494 | Ga0501045_0244494_768_1109 | 113 |
| 132 | 3300053077 | Ga0495601_0029307 | Ga0495601_0029307_2469_2810 | 113 |
| 133 | 3300053084 | Ga0495595_0144365 | Ga0495595_0144365_284_625 | 113 |
| 134 | 3300054114 | Ga0501084_0019618 | Ga0501084_0019618_861_1202 | 113 |
| 135 | 3300054114 | Ga0501084_0037637 | Ga0501084_0037637_2292_2633 | 113 |
| 136 | 3300060353 | Ga0501082_0002081 | Ga0501082_0002081_3778_4119 | 113 |
| 137 | 3300060353 | Ga0501082_0069156 | Ga0501082_0069156_2518_2859 | 113 |
| 138 | 2162886006 | SwRhRL3b_contig_3700117 | SwRhRL3b_0036.00001100 | 114 |
| 139 | 2162886012 | MBSR1b_contig_2267242 | MBSR1b_0761.00003570 | 114 |
| 140 | 3300001977 | JGI24746J21847_1009684 | JGI24746J21847_10096842 | 114 |
| 141 | 3300002070 | JGI24750J21931_1019248 | JGI24750J21931_10192481 | 114 |
| 142 | 3300003203 | JGI25406J46586_10003224 | JGI25406J46586_100032245 | 114 |
| 143 | 3300003203 | JGI25406J46586_10023568 | JGI25406J46586_100235682 | 114 |
| 144 | 3300005289 | Ga0065704_10845341 | Ga0065704_108453411 | 114 |
| 145 | 3300005290 | Ga0065712_10068445 | Ga0065712_100684459 | 114 |
| 146 | 3300005290 | Ga0065712_10189133 | Ga0065712_101891332 | 114 |
| 147 | 3300005290 | Ga0065712_10416994 | Ga0065712_104169942 | 114 |
| 148 | 3300005290 | Ga0065712_10567759 | Ga0065712_105677591 | 114 |
| 149 | 3300005293 | Ga0065715_10153179 | Ga0065715_101531794 | 114 |
| 150 | 3300005293 | Ga0065715_10167581 | Ga0065715_101675812 | 114 |
| 151 | 3300005293 | Ga0065715_10375280 | Ga0065715_103752802 | 114 |
| 152 | 3300005295 | Ga0065707_10005475 | Ga0065707_100054754 | 114 |
| 153 | 3300005295 | Ga0065707_10108492 | Ga0065707_101084921 | 114 |
| 154 | 3300005295 | Ga0065707_10271876 | Ga0065707_102718762 | 114 |
| 155 | 3300005295 | Ga0065707_10284483 | Ga0065707_102844832 | 114 |
| 156 | 3300005327 | Ga0070658_10285570 | Ga0070658_102855702 | 114 |
| 157 | 3300005328 | Ga0070676_10030126 | Ga0070676_100301262 | 114 |
| 158 | 3300005328 | Ga0070676_10068970 | Ga0070676_100689703 | 114 |
| 159 | 3300005328 | Ga0070676_10087769 | Ga0070676_100877692 | 114 |
| 160 | 3300005328 | Ga0070676_10179577 | Ga0070676_101795772 | 114 |
| 161 | 3300005330 | Ga0070690_100009587 | Ga0070690_1000095876 | 114 |
| 162 | 3300005330 | Ga0070690_100054918 | Ga0070690_1000549183 | 114 |
| 163 | 3300005330 | Ga0070690_100264292 | Ga0070690_1002642921 | 114 |
| 164 | 3300005330 | Ga0070690_100388770 | Ga0070690_1003887702 | 114 |
| 165 | 3300005330 | Ga0070690_100621591 | Ga0070690_1006215912 | 114 |
| 166 | 3300005330 | Ga0070690_100980785 | Ga0070690_1009807851 | 114 |
| 167 | 3300005331 | Ga0070670_100004047 | Ga0070670_1000040475 | 114 |
| 168 | 3300005331 | Ga0070670_101878203 | Ga0070670_1018782031 | 114 |
| 169 | 3300005333 | Ga0070677_10029226 | Ga0070677_100292264 | 114 |
| 170 | 3300005333 | Ga0070677_10285652 | Ga0070677_102856521 | 114 |
| 171 | 3300005333 | Ga0070677_10492232 | Ga0070677_104922321 | 114 |
| 172 | 3300005334 | Ga0068869_100066722 | Ga0068869_1000667222 | 114 |
| 173 | 3300005334 | Ga0068869_100201816 | Ga0068869_1002018162 | 114 |
| 174 | 3300005335 | Ga0070666_10584095 | Ga0070666_105840952 | 114 |
| 175 | 3300005336 | Ga0070680_100196527 | Ga0070680_1001965272 | 114 |
| 176 | 3300005336 | Ga0070680_100769736 | Ga0070680_1007697361 | 114 |
| 177 | 3300005338 | Ga0068868_100092803 | Ga0068868_1000928035 | 114 |
| 178 | 3300005338 | Ga0068868_100226705 | Ga0068868_1002267051 | 114 |
| 179 | 3300005339 | Ga0070660_100899750 | Ga0070660_1008997502 | 114 |
| 180 | 3300005340 | Ga0070689_100011310 | Ga0070689_1000113108 | 114 |
| 181 | 3300005340 | Ga0070689_100081004 | Ga0070689_1000810044 | 114 |
| 182 | 3300005340 | Ga0070689_100148584 | Ga0070689_1001485842 | 114 |
| 183 | 3300005340 | Ga0070689_100273778 | Ga0070689_1002737782 | 114 |
| 184 | 3300005340 | Ga0070689_100338584 | Ga0070689_1003385842 | 114 |
| 185 | 3300005341 | Ga0070691_10224467 | Ga0070691_102244671 | 114 |
| 186 | 3300005343 | Ga0070687_100002850 | Ga0070687_1000028505 | 114 |
| 187 | 3300005343 | Ga0070687_101174784 | Ga0070687_1011747841 | 114 |
| 188 | 3300005344 | Ga0070661_100024630 | Ga0070661_1000246305 | 114 |
| 189 | 3300005344 | Ga0070661_100537523 | Ga0070661_1005375232 | 114 |
| 190 | 3300005345 | Ga0070692_10120613 | Ga0070692_101206132 | 114 |
| 191 | 3300005345 | Ga0070692_10234044 | Ga0070692_102340442 | 114 |
| 192 | 3300005345 | Ga0070692_10691611 | Ga0070692_106916111 | 114 |
| 193 | 3300005347 | Ga0070668_100043065 | Ga0070668_1000430655 | 114 |
| 194 | 3300005347 | Ga0070668_101020133 | Ga0070668_1010201331 | 114 |
| 195 | 3300005353 | Ga0070669_100004013 | Ga0070669_10000401310 | 114 |
| 196 | 3300005353 | Ga0070669_100353027 | Ga0070669_1003530271 | 114 |
| 197 | 3300005353 | Ga0070669_100353550 | Ga0070669_1003535502 | 114 |
| 198 | 3300005353 | Ga0070669_101373622 | Ga0070669_1013736221 | 114 |
| 199 | 3300005354 | Ga0070675_100000954 | Ga0070675_10000095416 | 114 |
| 200 | 3300005354 | Ga0070675_100011353 | Ga0070675_1000113538 | 114 |
| 201 | 3300005354 | Ga0070675_100031578 | Ga0070675_1000315784 | 114 |
| 202 | 3300005354 | Ga0070675_100074939 | Ga0070675_1000749395 | 114 |
| 203 | 3300005354 | Ga0070675_100179410 | Ga0070675_1001794102 | 114 |
| 204 | 3300005354 | Ga0070675_101407345 | Ga0070675_1014073452 | 114 |
| 205 | 3300005354 | Ga0070675_101423968 | Ga0070675_1014239681 | 114 |
| 206 | 3300005355 | Ga0070671_100047927 | Ga0070671_1000479273 | 114 |
| 207 | 3300005355 | Ga0070671_100159669 | Ga0070671_1001596692 | 114 |
| 208 | 3300005355 | Ga0070671_100186546 | Ga0070671_1001865462 | 114 |
| 209 | 3300005356 | Ga0070674_101775519 | Ga0070674_1017755191 | 114 |
| 210 | 3300005364 | Ga0070673_100005401 | Ga0070673_1000054016 | 114 |
| 211 | 3300005364 | Ga0070673_100008933 | Ga0070673_1000089333 | 114 |
| 212 | 3300005364 | Ga0070673_100009507 | Ga0070673_1000095079 | 114 |
| 213 | 3300005364 | Ga0070673_100730979 | Ga0070673_1007309791 | 114 |
| 214 | 3300005365 | Ga0070688_100024757 | Ga0070688_1000247573 | 114 |
| 215 | 3300005365 | Ga0070688_100069382 | Ga0070688_1000693823 | 114 |
| 216 | 3300005365 | Ga0070688_100077561 | Ga0070688_1000775613 | 114 |
| 217 | 3300005365 | Ga0070688_101291562 | Ga0070688_1012915621 | 114 |
| 218 | 3300005366 | Ga0070659_100066788 | Ga0070659_1000667881 | 114 |
| 219 | 3300005366 | Ga0070659_100385644 | Ga0070659_1003856442 | 114 |
| 220 | 3300005367 | Ga0070667_100052390 | Ga0070667_1000523903 | 114 |
| 221 | 3300005367 | Ga0070667_101030460 | Ga0070667_1010304602 | 114 |
| 222 | 3300005438 | Ga0070701_10034413 | Ga0070701_100344131 | 114 |
| 223 | 3300005438 | Ga0070701_10281094 | Ga0070701_102810942 | 114 |
| 224 | 3300005440 | Ga0070705_100397678 | Ga0070705_1003976782 | 114 |
| 225 | 3300005440 | Ga0070705_100934581 | Ga0070705_1009345812 | 114 |
| 226 | 3300005441 | Ga0070700_100027258 | Ga0070700_1000272585 | 114 |
| 227 | 3300005441 | Ga0070700_100511953 | Ga0070700_1005119532 | 114 |
| 228 | 3300005441 | Ga0070700_100525160 | Ga0070700_1005251601 | 114 |
| 229 | 3300005445 | Ga0070708_101211310 | Ga0070708_1012113101 | 114 |
| 230 | 3300005455 | Ga0070663_100660547 | Ga0070663_1006605472 | 114 |
| 231 | 3300005455 | Ga0070663_101658324 | Ga0070663_1016583241 | 114 |
| 232 | 3300005456 | Ga0070678_100023931 | Ga0070678_1000239315 | 114 |
| 233 | 3300005456 | Ga0070678_100230091 | Ga0070678_1002300912 | 114 |
| 234 | 3300005456 | Ga0070678_100316544 | Ga0070678_1003165442 | 114 |
| 235 | 3300005456 | Ga0070678_100601196 | Ga0070678_1006011962 | 114 |
| 236 | 3300005456 | Ga0070678_100771407 | Ga0070678_1007714072 | 114 |
| 237 | 3300005457 | Ga0070662_100004759 | Ga0070662_10000475910 | 114 |
| 238 | 3300005459 | Ga0068867_100061160 | Ga0068867_1000611604 | 114 |
| 239 | 3300005459 | Ga0068867_100126399 | Ga0068867_1001263992 | 114 |
| 240 | 3300005459 | Ga0068867_100749617 | Ga0068867_1007496172 | 114 |
| 241 | 3300005459 | Ga0068867_101200470 | Ga0068867_1012004701 | 114 |
| 242 | 3300005459 | Ga0068867_102004770 | Ga0068867_1020047701 | 114 |
| 243 | 3300005466 | Ga0070685_10029005 | Ga0070685_100290054 | 114 |
| 244 | 3300005466 | Ga0070685_10079208 | Ga0070685_100792083 | 114 |
| 245 | 3300005468 | Ga0070707_100267452 | Ga0070707_1002674522 | 114 |
| 246 | 3300005468 | Ga0070707_100497606 | Ga0070707_1004976061 | 114 |
| 247 | 3300005471 | Ga0070698_100253844 | Ga0070698_1002538441 | 114 |
| 248 | 3300005518 | Ga0070699_100021687 | Ga0070699_1000216876 | 114 |
| 249 | 3300005518 | Ga0070699_100935455 | Ga0070699_1009354551 | 114 |
| 250 | 3300005535 | Ga0070684_100608731 | Ga0070684_1006087311 | 114 |
| 251 | 3300005535 | Ga0070684_100620281 | Ga0070684_1006202812 | 114 |
| 252 | 3300005543 | Ga0070672_100004271 | Ga0070672_10000427110 | 114 |
| 253 | 3300005543 | Ga0070672_100009212 | Ga0070672_1000092129 | 114 |
| 254 | 3300005543 | Ga0070672_100050131 | Ga0070672_1000501312 | 114 |
| 255 | 3300005543 | Ga0070672_100086254 | Ga0070672_1000862543 | 114 |
| 256 | 3300005543 | Ga0070672_100128254 | Ga0070672_1001282543 | 114 |
| 257 | 3300005543 | Ga0070672_100292164 | Ga0070672_1002921641 | 114 |
| 258 | 3300005543 | Ga0070672_100292685 | Ga0070672_1002926852 | 114 |
| 259 | 3300005544 | Ga0070686_100033415 | Ga0070686_1000334153 | 114 |
| 260 | 3300005544 | Ga0070686_100036889 | Ga0070686_1000368892 | 114 |
| 261 | 3300005544 | Ga0070686_100047742 | Ga0070686_1000477422 | 114 |
| 262 | 3300005544 | Ga0070686_100290870 | Ga0070686_1002908702 | 114 |
| 263 | 3300005545 | Ga0070695_100124874 | Ga0070695_1001248743 | 114 |
| 264 | 3300005545 | Ga0070695_100688767 | Ga0070695_1006887672 | 114 |
| 265 | 3300005546 | Ga0070696_100201191 | Ga0070696_1002011912 | 114 |
| 266 | 3300005547 | Ga0070693_100022486 | Ga0070693_1000224863 | 114 |
| 267 | 3300005548 | Ga0070665_100130869 | Ga0070665_1001308695 | 114 |
| 268 | 3300005549 | Ga0070704_100485040 | Ga0070704_1004850402 | 114 |
| 269 | 3300005549 | Ga0070704_100494603 | Ga0070704_1004946032 | 114 |
| 270 | 3300005549 | Ga0070704_101850060 | Ga0070704_1018500601 | 114 |
| 271 | 3300005564 | Ga0070664_100016473 | Ga0070664_1000164737 | 114 |
| 272 | 3300005564 | Ga0070664_100123324 | Ga0070664_1001233242 | 114 |
| 273 | 3300005564 | Ga0070664_100157183 | Ga0070664_1001571833 | 114 |
| 274 | 3300005564 | Ga0070664_100453362 | Ga0070664_1004533622 | 114 |
| 275 | 3300005564 | Ga0070664_101059385 | Ga0070664_1010593851 | 114 |
| 276 | 3300005564 | Ga0070664_102085364 | Ga0070664_1020853641 | 114 |
| 277 | 3300005564 | Ga0070664_102316587 | Ga0070664_1023165871 | 114 |
| 278 | 3300005577 | Ga0068857_100405063 | Ga0068857_1004050631 | 114 |
| 279 | 3300005578 | Ga0068854_100070417 | Ga0068854_1000704173 | 114 |
| 280 | 3300005615 | Ga0070702_100050594 | Ga0070702_1000505944 | 114 |
| 281 | 3300005616 | Ga0068852_100021108 | Ga0068852_1000211083 | 114 |
| 282 | 3300005616 | Ga0068852_100241352 | Ga0068852_1002413522 | 114 |
| 283 | 3300005616 | Ga0068852_100429962 | Ga0068852_1004299622 | 114 |
| 284 | 3300005617 | Ga0068859_100001104 | Ga0068859_1000011049 | 114 |
| 285 | 3300005617 | Ga0068859_100047654 | Ga0068859_1000476542 | 114 |
| 286 | 3300005617 | Ga0068859_100073232 | Ga0068859_1000732323 | 114 |
| 287 | 3300005617 | Ga0068859_100119097 | Ga0068859_1001190974 | 114 |
| 288 | 3300005617 | Ga0068859_100168159 | Ga0068859_1001681593 | 114 |
| 289 | 3300005617 | Ga0068859_101615066 | Ga0068859_1016150661 | 114 |
| 290 | 3300005618 | Ga0068864_100005659 | Ga0068864_1000056593 | 114 |
| 291 | 3300005618 | Ga0068864_100163792 | Ga0068864_1001637923 | 114 |
| 292 | 3300005618 | Ga0068864_100450538 | Ga0068864_1004505382 | 114 |
| 293 | 3300005718 | Ga0068866_10163468 | Ga0068866_101634682 | 114 |
| 294 | 3300005719 | Ga0068861_100033352 | Ga0068861_1000333526 | 114 |
| 295 | 3300005719 | Ga0068861_100625816 | Ga0068861_1006258161 | 114 |
| 296 | 3300005840 | Ga0068870_10000334 | Ga0068870_1000033410 | 114 |
| 297 | 3300005840 | Ga0068870_10199174 | Ga0068870_101991742 | 114 |
| 298 | 3300005841 | Ga0068863_100032173 | Ga0068863_1000321735 | 114 |
| 299 | 3300005841 | Ga0068863_102107524 | Ga0068863_1021075242 | 114 |
| 300 | 3300005842 | Ga0068858_100041332 | Ga0068858_1000413325 | 114 |
| 301 | 3300005842 | Ga0068858_100222130 | Ga0068858_1002221302 | 114 |
| 302 | 3300005843 | Ga0068860_100033706 | Ga0068860_1000337065 | 114 |
| 303 | 3300005843 | Ga0068860_100188391 | Ga0068860_1001883913 | 114 |
| 304 | 3300005844 | Ga0068862_100007352 | Ga0068862_1000073527 | 114 |
| 305 | 3300005844 | Ga0068862_100387230 | Ga0068862_1003872301 | 114 |
| 306 | 3300005844 | Ga0068862_100440749 | Ga0068862_1004407492 | 114 |
| 307 | 3300005844 | Ga0068862_100966126 | Ga0068862_1009661262 | 114 |
| 308 | 3300005844 | Ga0068862_101370880 | Ga0068862_1013708801 | 114 |
| 309 | 3300005985 | Ga0081539_10000024 | Ga0081539_10000024206 | 114 |
| 310 | 3300005985 | Ga0081539_10003877 | Ga0081539_100038776 | 114 |
| 311 | 3300006051 | Ga0075364_10001941 | Ga0075364_100019415 | 114 |
| 312 | 3300006051 | Ga0075364_10262427 | Ga0075364_102624272 | 114 |
| 313 | 3300006177 | Ga0075362_10001991 | Ga0075362_100019911 | 114 |
| 314 | 3300006178 | Ga0075367_11103569 | Ga0075367_111035691 | 114 |
| 315 | 3300006194 | Ga0075427_10042471 | Ga0075427_100424712 | 114 |
| 316 | 3300006195 | Ga0075366_10029394 | Ga0075366_100293942 | 114 |
| 317 | 3300006195 | Ga0075366_10576309 | Ga0075366_105763092 | 114 |
| 318 | 3300006358 | Ga0068871_100058513 | Ga0068871_1000585132 | 114 |
| 319 | 3300006358 | Ga0068871_100083349 | Ga0068871_1000833493 | 114 |
| 320 | 3300006844 | Ga0075428_100001946 | Ga0075428_10000194618 | 114 |
| 321 | 3300006844 | Ga0075428_100014804 | Ga0075428_1000148044 | 114 |
| 322 | 3300006844 | Ga0075428_100031002 | Ga0075428_1000310024 | 114 |
| 323 | 3300006844 | Ga0075428_100214990 | Ga0075428_1002149903 | 114 |
| 324 | 3300006844 | Ga0075428_100257040 | Ga0075428_1002570402 | 114 |
| 325 | 3300006846 | Ga0075430_100000495 | Ga0075430_10000049511 | 114 |
| 326 | 3300006846 | Ga0075430_100002007 | Ga0075430_1000020075 | 114 |
| 327 | 3300006846 | Ga0075430_100029756 | Ga0075430_1000297562 | 114 |
| 328 | 3300006846 | Ga0075430_100059918 | Ga0075430_1000599185 | 114 |
| 329 | 3300006846 | Ga0075430_100447719 | Ga0075430_1004477192 | 114 |
| 330 | 3300006846 | Ga0075430_101476568 | Ga0075430_1014765681 | 114 |
| 331 | 3300006847 | Ga0075431_100000501 | Ga0075431_10000050118 | 114 |
| 332 | 3300006847 | Ga0075431_100018901 | Ga0075431_1000189015 | 114 |
| 333 | 3300006847 | Ga0075431_100033557 | Ga0075431_1000335576 | 114 |
| 334 | 3300006847 | Ga0075431_100121049 | Ga0075431_1001210493 | 114 |
| 335 | 3300006847 | Ga0075431_101086657 | Ga0075431_1010866572 | 114 |
| 336 | 3300006852 | Ga0075433_10001923 | Ga0075433_1000192312 | 114 |
| 337 | 3300006852 | Ga0075433_10002593 | Ga0075433_100025937 | 114 |
| 338 | 3300006852 | Ga0075433_10305399 | Ga0075433_103053991 | 114 |
| 339 | 3300006852 | Ga0075433_10492197 | Ga0075433_104921972 | 114 |
| 340 | 3300006852 | Ga0075433_10784131 | Ga0075433_107841312 | 114 |
| 341 | 3300006852 | Ga0075433_11159450 | Ga0075433_111594502 | 114 |
| 342 | 3300006871 | Ga0075434_100000863 | Ga0075434_10000086313 | 114 |
| 343 | 3300006871 | Ga0075434_100002413 | Ga0075434_1000024135 | 114 |
| 344 | 3300006871 | Ga0075434_100003202 | Ga0075434_1000032027 | 114 |
| 345 | 3300006871 | Ga0075434_100086925 | Ga0075434_1000869253 | 114 |
| 346 | 3300006871 | Ga0075434_100157985 | Ga0075434_1001579853 | 114 |
| 347 | 3300006871 | Ga0075434_102084094 | Ga0075434_1020840941 | 114 |
| 348 | 3300006880 | Ga0075429_100006308 | Ga0075429_10000630810 | 114 |
| 349 | 3300006880 | Ga0075429_100006683 | Ga0075429_1000066834 | 114 |
| 350 | 3300006880 | Ga0075429_100008978 | Ga0075429_1000089787 | 114 |
| 351 | 3300006880 | Ga0075429_100033178 | Ga0075429_1000331783 | 114 |
| 352 | 3300006880 | Ga0075429_100701528 | Ga0075429_1007015282 | 114 |
| 353 | 3300006881 | Ga0068865_100033914 | Ga0068865_1000339145 | 114 |
| 354 | 3300006881 | Ga0068865_100100535 | Ga0068865_1001005353 | 114 |
| 355 | 3300006881 | Ga0068865_101538371 | Ga0068865_1015383711 | 114 |
| 356 | 3300006931 | Ga0097620_100001104 | Ga0097620_10000110418 | 114 |
| 357 | 3300006931 | Ga0097620_100047654 | Ga0097620_1000476545 | 114 |
| 358 | 3300006931 | Ga0097620_100073234 | Ga0097620_1000732343 | 114 |
| 359 | 3300006931 | Ga0097620_100119087 | Ga0097620_1001190874 | 114 |
| 360 | 3300006931 | Ga0097620_100168175 | Ga0097620_1001681752 | 114 |
| 361 | 3300006931 | Ga0097620_101615130 | Ga0097620_1016151301 | 114 |
| 362 | 3300007076 | Ga0075435_100011881 | Ga0075435_1000118815 | 114 |
| 363 | 3300009011 | Ga0105251_10320868 | Ga0105251_103208682 | 114 |
| 364 | 3300009094 | Ga0111539_10000390 | Ga0111539_1000039029 | 114 |
| 365 | 3300009094 | Ga0111539_10004477 | Ga0111539_1000447721 | 114 |
| 366 | 3300009094 | Ga0111539_10031520 | Ga0111539_100315209 | 114 |
| 367 | 3300009094 | Ga0111539_10066216 | Ga0111539_100662164 | 114 |
| 368 | 3300009094 | Ga0111539_10160346 | Ga0111539_101603463 | 114 |
| 369 | 3300009094 | Ga0111539_10523388 | Ga0111539_105233882 | 114 |
| 370 | 3300009094 | Ga0111539_10688438 | Ga0111539_106884382 | 114 |
| 371 | 3300009094 | Ga0111539_10821837 | Ga0111539_108218372 | 114 |
| 372 | 3300009094 | Ga0111539_11273803 | Ga0111539_112738032 | 114 |
| 373 | 3300009098 | Ga0105245_10284861 | Ga0105245_102848613 | 114 |
| 374 | 3300009098 | Ga0105245_10458585 | Ga0105245_104585853 | 114 |
| 375 | 3300009147 | Ga0114129_10006692 | Ga0114129_100066927 | 114 |
| 376 | 3300009147 | Ga0114129_10027033 | Ga0114129_100270339 | 114 |
| 377 | 3300009147 | Ga0114129_10047175 | Ga0114129_100471754 | 114 |
| 378 | 3300009147 | Ga0114129_10056412 | Ga0114129_100564124 | 114 |
| 379 | 3300009147 | Ga0114129_10113506 | Ga0114129_101135064 | 114 |
| 380 | 3300009147 | Ga0114129_10119695 | Ga0114129_101196952 | 114 |
| 381 | 3300009147 | Ga0114129_10314449 | Ga0114129_103144492 | 114 |
| 382 | 3300009147 | Ga0114129_10426833 | Ga0114129_104268332 | 114 |
| 383 | 3300009147 | Ga0114129_11327849 | Ga0114129_113278492 | 114 |
| 384 | 3300009147 | Ga0114129_11421596 | Ga0114129_114215962 | 114 |
| 385 | 3300009148 | Ga0105243_12976221 | Ga0105243_129762211 | 114 |
| 386 | 3300009174 | Ga0105241_10411127 | Ga0105241_104111272 | 114 |
| 387 | 3300009176 | Ga0105242_11323259 | Ga0105242_113232592 | 114 |
| 388 | 3300009177 | Ga0105248_10053811 | Ga0105248_100538112 | 114 |
| 389 | 3300009177 | Ga0105248_10492110 | Ga0105248_104921102 | 114 |
| 390 | 3300009177 | Ga0105248_10639906 | Ga0105248_106399062 | 114 |
| 391 | 3300009177 | Ga0105248_11207319 | Ga0105248_112073192 | 114 |
| 392 | 3300009177 | Ga0105248_12848248 | Ga0105248_128482481 | 114 |
| 393 | 3300009553 | Ga0105249_10009621 | Ga0105249_1000962110 | 114 |
| 394 | 3300009553 | Ga0105249_10561249 | Ga0105249_105612492 | 114 |
| 395 | 3300009553 | Ga0105249_11945873 | Ga0105249_119458732 | 114 |
| 396 | 3300010375 | Ga0105239_11280305 | Ga0105239_112803052 | 114 |
| 397 | 3300010375 | Ga0105239_12040310 | Ga0105239_120403102 | 114 |
| 398 | 3300011119 | Ga0105246_10637124 | Ga0105246_106371242 | 114 |
| 399 | 3300011119 | Ga0105246_11507336 | Ga0105246_115073361 | 114 |
| 400 | 3300012515 | Ga0157338_1042528 | Ga0157338_10425282 | 114 |
| 401 | 3300013102 | Ga0157371_10134538 | Ga0157371_101345383 | 114 |
| 402 | 3300013306 | Ga0163162_10020643 | Ga0163162_100206436 | 114 |
| 403 | 3300013308 | Ga0157375_10824339 | Ga0157375_108243392 | 114 |
| 404 | 3300013308 | Ga0157375_10862221 | Ga0157375_108622212 | 114 |
| 405 | 3300013308 | Ga0157375_11488889 | Ga0157375_114888892 | 114 |
| 406 | 3300013308 | Ga0157375_11811433 | Ga0157375_118114332 | 114 |
| 407 | 3300013308 | Ga0157375_12101770 | Ga0157375_121017701 | 114 |
| 408 | 3300014325 | Ga0163163_10028559 | Ga0163163_100285593 | 114 |
| 409 | 3300014325 | Ga0163163_11989721 | Ga0163163_119897212 | 114 |
| 410 | 3300014326 | Ga0157380_10009059 | Ga0157380_100090593 | 114 |
| 411 | 3300014326 | Ga0157380_10459124 | Ga0157380_104591241 | 114 |
| 412 | 3300014326 | Ga0157380_11102614 | Ga0157380_111026142 | 114 |
| 413 | 3300014745 | Ga0157377_10063672 | Ga0157377_100636723 | 114 |
| 414 | 3300014745 | Ga0157377_10112297 | Ga0157377_101122972 | 114 |
| 415 | 3300014745 | Ga0157377_10271730 | Ga0157377_102717302 | 114 |
| 416 | 3300014968 | Ga0157379_10098989 | Ga0157379_100989893 | 114 |
| 417 | 3300014969 | Ga0157376_10118985 | Ga0157376_101189855 | 114 |
| 418 | 3300014969 | Ga0157376_10591254 | Ga0157376_105912541 | 114 |
| 419 | 3300015262 | Ga0182007_10162590 | Ga0182007_101625902 | 114 |
| 420 | 3300017792 | Ga0163161_10074017 | Ga0163161_100740173 | 114 |
| 421 | 3300020070 | Ga0206356_11668982 | Ga0206356_116689822 | 114 |
| 422 | 3300021384 | Ga0213876_10096876 | Ga0213876_100968762 | 114 |
| 423 | 3300025290 | Ga0207673_1069695 | Ga0207673_10696951 | 114 |
| 424 | 3300025315 | Ga0207697_10000148 | Ga0207697_1000014818 | 114 |
| 425 | 3300025315 | Ga0207697_10434269 | Ga0207697_104342692 | 114 |
| 426 | 3300025893 | Ga0207682_10010863 | Ga0207682_100108633 | 114 |
| 427 | 3300025901 | Ga0207688_10009342 | Ga0207688_100093424 | 114 |
| 428 | 3300025901 | Ga0207688_10127853 | Ga0207688_101278532 | 114 |
| 429 | 3300025901 | Ga0207688_10313555 | Ga0207688_103135552 | 114 |
| 430 | 3300025901 | Ga0207688_10822880 | Ga0207688_108228801 | 114 |
| 431 | 3300025903 | Ga0207680_10088741 | Ga0207680_100887413 | 114 |
| 432 | 3300025903 | Ga0207680_10789117 | Ga0207680_107891171 | 114 |
| 433 | 3300025903 | Ga0207680_11087604 | Ga0207680_110876042 | 114 |
| 434 | 3300025903 | Ga0207680_11297796 | Ga0207680_112977962 | 114 |
| 435 | 3300025904 | Ga0207647_10754970 | Ga0207647_107549701 | 114 |
| 436 | 3300025907 | Ga0207645_10000577 | Ga0207645_1000057715 | 114 |
| 437 | 3300025907 | Ga0207645_10007692 | Ga0207645_100076922 | 114 |
| 438 | 3300025908 | Ga0207643_10000648 | Ga0207643_100006486 | 114 |
| 439 | 3300025909 | Ga0207705_10867818 | Ga0207705_108678181 | 114 |
| 440 | 3300025917 | Ga0207660_10239588 | Ga0207660_102395882 | 114 |
| 441 | 3300025918 | Ga0207662_10006100 | Ga0207662_100061006 | 114 |
| 442 | 3300025918 | Ga0207662_10147541 | Ga0207662_101475413 | 114 |
| 443 | 3300025918 | Ga0207662_10222904 | Ga0207662_102229042 | 114 |
| 444 | 3300025918 | Ga0207662_10462808 | Ga0207662_104628082 | 114 |
| 445 | 3300025918 | Ga0207662_10776714 | Ga0207662_107767142 | 114 |
| 446 | 3300025920 | Ga0207649_10004041 | Ga0207649_100040413 | 114 |
| 447 | 3300025920 | Ga0207649_10058671 | Ga0207649_100586711 | 114 |
| 448 | 3300025922 | Ga0207646_10287923 | Ga0207646_102879232 | 114 |
| 449 | 3300025922 | Ga0207646_10634210 | Ga0207646_106342101 | 114 |
| 450 | 3300025922 | Ga0207646_10794376 | Ga0207646_107943761 | 114 |
| 451 | 3300025923 | Ga0207681_10021283 | Ga0207681_100212832 | 114 |
| 452 | 3300025923 | Ga0207681_10114958 | Ga0207681_101149583 | 114 |
| 453 | 3300025923 | Ga0207681_10243482 | Ga0207681_102434822 | 114 |
| 454 | 3300025925 | Ga0207650_10018434 | Ga0207650_100184342 | 114 |
| 455 | 3300025925 | Ga0207650_10817640 | Ga0207650_108176402 | 114 |
| 456 | 3300025925 | Ga0207650_11475658 | Ga0207650_114756581 | 114 |
| 457 | 3300025926 | Ga0207659_10012767 | Ga0207659_100127676 | 114 |
| 458 | 3300025926 | Ga0207659_10020573 | Ga0207659_100205733 | 114 |
| 459 | 3300025926 | Ga0207659_10041949 | Ga0207659_100419493 | 114 |
| 460 | 3300025926 | Ga0207659_10078388 | Ga0207659_100783881 | 114 |
| 461 | 3300025926 | Ga0207659_10245899 | Ga0207659_102458992 | 114 |
| 462 | 3300025927 | Ga0207687_10304738 | Ga0207687_103047383 | 114 |
| 463 | 3300025931 | Ga0207644_10070628 | Ga0207644_100706283 | 114 |
| 464 | 3300025931 | Ga0207644_10435681 | Ga0207644_104356812 | 114 |
| 465 | 3300025931 | Ga0207644_10791260 | Ga0207644_107912602 | 114 |
| 466 | 3300025932 | Ga0207690_10134713 | Ga0207690_101347132 | 114 |
| 467 | 3300025933 | Ga0207706_10003199 | Ga0207706_100031992 | 114 |
| 468 | 3300025933 | Ga0207706_10077657 | Ga0207706_100776572 | 114 |
| 469 | 3300025933 | Ga0207706_10112236 | Ga0207706_101122363 | 114 |
| 470 | 3300025935 | Ga0207709_10794371 | Ga0207709_107943712 | 114 |
| 471 | 3300025936 | Ga0207670_10078603 | Ga0207670_100786032 | 114 |
| 472 | 3300025938 | Ga0207704_10034303 | Ga0207704_100343032 | 114 |
| 473 | 3300025938 | Ga0207704_11807844 | Ga0207704_118078441 | 114 |
| 474 | 3300025940 | Ga0207691_10004463 | Ga0207691_100044633 | 114 |
| 475 | 3300025940 | Ga0207691_10016775 | Ga0207691_1001677510 | 114 |
| 476 | 3300025940 | Ga0207691_10029052 | Ga0207691_100290525 | 114 |
| 477 | 3300025940 | Ga0207691_10050130 | Ga0207691_100501302 | 114 |
| 478 | 3300025940 | Ga0207691_10104982 | Ga0207691_101049823 | 114 |
| 479 | 3300025940 | Ga0207691_10393097 | Ga0207691_103930972 | 114 |
| 480 | 3300025940 | Ga0207691_10436354 | Ga0207691_104363542 | 114 |
| 481 | 3300025941 | Ga0207711_10391697 | Ga0207711_103916972 | 114 |
| 482 | 3300025941 | Ga0207711_11639216 | Ga0207711_116392161 | 114 |
| 483 | 3300025942 | Ga0207689_10004461 | Ga0207689_1000446112 | 114 |
| 484 | 3300025942 | Ga0207689_10185612 | Ga0207689_101856122 | 114 |
| 485 | 3300025942 | Ga0207689_10194303 | Ga0207689_101943032 | 114 |
| 486 | 3300025945 | Ga0207679_10014873 | Ga0207679_100148737 | 114 |
| 487 | 3300025945 | Ga0207679_10158168 | Ga0207679_101581683 | 114 |
| 488 | 3300025945 | Ga0207679_10551296 | Ga0207679_105512962 | 114 |
| 489 | 3300025945 | Ga0207679_10885407 | Ga0207679_108854072 | 114 |
| 490 | 3300025949 | Ga0207667_11415276 | Ga0207667_114152761 | 114 |
| 491 | 3300025960 | Ga0207651_10009746 | Ga0207651_100097467 | 114 |
| 492 | 3300025960 | Ga0207651_10049323 | Ga0207651_100493235 | 114 |
| 493 | 3300025960 | Ga0207651_10820065 | Ga0207651_108200652 | 114 |
| 494 | 3300025960 | Ga0207651_10828169 | Ga0207651_108281692 | 114 |
| 495 | 3300025961 | Ga0207712_10023764 | Ga0207712_100237643 | 114 |
| 496 | 3300025972 | Ga0207668_10247360 | Ga0207668_102473602 | 114 |
| 497 | 3300025972 | Ga0207668_10983768 | Ga0207668_109837681 | 114 |
| 498 | 3300025981 | Ga0207640_10322417 | Ga0207640_103224172 | 114 |
| 499 | 3300025986 | Ga0207658_10042378 | Ga0207658_100423783 | 114 |
| 500 | 3300025986 | Ga0207658_10048808 | Ga0207658_100488083 | 114 |
| 501 | 3300026023 | Ga0207677_10102152 | Ga0207677_101021523 | 114 |
| 502 | 3300026023 | Ga0207677_12180221 | Ga0207677_121802211 | 114 |
| 503 | 3300026035 | Ga0207703_10064563 | Ga0207703_100645633 | 114 |
| 504 | 3300026035 | Ga0207703_10072197 | Ga0207703_100721972 | 114 |
| 505 | 3300026067 | Ga0207678_10784578 | Ga0207678_107845781 | 114 |
| 506 | 3300026075 | Ga0207708_10014144 | Ga0207708_100141442 | 114 |
| 507 | 3300026075 | Ga0207708_10169075 | Ga0207708_101690751 | 114 |
| 508 | 3300026075 | Ga0207708_10663145 | Ga0207708_106631452 | 114 |
| 509 | 3300026075 | Ga0207708_10732103 | Ga0207708_107321032 | 114 |
| 510 | 3300026075 | Ga0207708_10764233 | Ga0207708_107642331 | 114 |
| 511 | 3300026088 | Ga0207641_10017355 | Ga0207641_100173554 | 114 |
| 512 | 3300026088 | Ga0207641_11138043 | Ga0207641_111380432 | 114 |
| 513 | 3300026088 | Ga0207641_11523724 | Ga0207641_115237241 | 114 |
| 514 | 3300026089 | Ga0207648_10054986 | Ga0207648_100549861 | 114 |
| 515 | 3300026089 | Ga0207648_10501682 | Ga0207648_105016822 | 114 |
| 516 | 3300026089 | Ga0207648_10678294 | Ga0207648_106782941 | 114 |
| 517 | 3300026089 | Ga0207648_10761178 | Ga0207648_107611782 | 114 |
| 518 | 3300026089 | Ga0207648_11198608 | Ga0207648_111986082 | 114 |
| 519 | 3300026095 | Ga0207676_10085399 | Ga0207676_100853993 | 114 |
| 520 | 3300026095 | Ga0207676_10111760 | Ga0207676_101117603 | 114 |
| 521 | 3300026095 | Ga0207676_10154691 | Ga0207676_101546912 | 114 |
| 522 | 3300026116 | Ga0207674_10297104 | Ga0207674_102971041 | 114 |
| 523 | 3300026118 | Ga0207675_100002044 | Ga0207675_1000020446 | 114 |
| 524 | 3300026118 | Ga0207675_100418871 | Ga0207675_1004188713 | 114 |
| 525 | 3300026118 | Ga0207675_100688824 | Ga0207675_1006888242 | 114 |
| 526 | 3300026118 | Ga0207675_100689042 | Ga0207675_1006890421 | 114 |
| 527 | 3300026118 | Ga0207675_101304202 | Ga0207675_1013042022 | 114 |
| 528 | 3300026121 | Ga0207683_10015895 | Ga0207683_100158953 | 114 |
| 529 | 3300026121 | Ga0207683_10261714 | Ga0207683_102617142 | 114 |
| 530 | 3300026121 | Ga0207683_10362000 | Ga0207683_103620002 | 114 |
| 531 | 3300026121 | Ga0207683_10774730 | Ga0207683_107747301 | 114 |
| 532 | 3300026121 | Ga0207683_11128927 | Ga0207683_111289272 | 114 |
| 533 | 3300026121 | Ga0207683_12078621 | Ga0207683_120786212 | 114 |
| 534 | 3300026142 | Ga0207698_10015449 | Ga0207698_100154496 | 114 |
| 535 | 3300026142 | Ga0207698_10854418 | Ga0207698_108544182 | 114 |
| 536 | 3300027252 | Ga0209973_1036971 | Ga0209973_10369711 | 114 |
| 537 | 3300027462 | Ga0210000_1020829 | Ga0210000_10208292 | 114 |
| 538 | 3300027552 | Ga0209982_1012016 | Ga0209982_10120163 | 114 |
| 539 | 3300027614 | Ga0209970_1075853 | Ga0209970_10758532 | 114 |
| 540 | 3300027682 | Ga0209971_1022927 | Ga0209971_10229271 | 114 |
| 541 | 3300027876 | Ga0209974_10232836 | Ga0209974_102328361 | 114 |
| 542 | 3300027876 | Ga0209974_10240177 | Ga0209974_102401772 | 114 |
| 543 | 3300027907 | Ga0207428_10004203 | Ga0207428_100042036 | 114 |
| 544 | 3300027907 | Ga0207428_10007408 | Ga0207428_100074087 | 114 |
| 545 | 3300027907 | Ga0207428_10045960 | Ga0207428_100459602 | 114 |
| 546 | 3300027907 | Ga0207428_10315068 | Ga0207428_103150682 | 114 |
| 547 | 3300027907 | Ga0207428_10436704 | Ga0207428_104367042 | 114 |
| 548 | 3300027907 | Ga0207428_10444322 | Ga0207428_104443222 | 114 |
| 549 | 3300028379 | Ga0268266_10148985 | Ga0268266_101489851 | 114 |
| 550 | 3300028379 | Ga0268266_10451263 | Ga0268266_104512632 | 114 |
| 551 | 3300028380 | Ga0268265_10324676 | Ga0268265_103246763 | 114 |
| 552 | 3300028380 | Ga0268265_10334700 | Ga0268265_103347002 | 114 |
| 553 | 3300028381 | Ga0268264_10255994 | Ga0268264_102559943 | 114 |
| 554 | 3300028381 | Ga0268264_10458574 | Ga0268264_104585741 | 114 |
| 555 | 3300031548 | Ga0307408_100010714 | Ga0307408_1000107142 | 114 |
| 556 | 3300031548 | Ga0307408_100023765 | Ga0307408_1000237653 | 114 |
| 557 | 3300031548 | Ga0307408_100998094 | Ga0307408_1009980942 | 114 |
| 558 | 3300031548 | Ga0307408_101044651 | Ga0307408_1010446512 | 114 |
| 559 | 3300031731 | Ga0307405_10025301 | Ga0307405_100253013 | 114 |
| 560 | 3300031731 | Ga0307405_10537244 | Ga0307405_105372442 | 114 |
| 561 | 3300031731 | Ga0307405_11680318 | Ga0307405_116803182 | 114 |
| 562 | 3300031824 | Ga0307413_10027905 | Ga0307413_100279053 | 114 |
| 563 | 3300031824 | Ga0307413_11046453 | Ga0307413_110464532 | 114 |
| 564 | 3300031852 | Ga0307410_10106421 | Ga0307410_101064212 | 114 |
| 565 | 3300031852 | Ga0307410_10216265 | Ga0307410_102162651 | 114 |
| 566 | 3300031901 | Ga0307406_10048622 | Ga0307406_100486223 | 114 |
| 567 | 3300031901 | Ga0307406_10454145 | Ga0307406_104541452 | 114 |
| 568 | 3300031903 | Ga0307407_10002294 | Ga0307407_100022948 | 114 |
| 569 | 3300031903 | Ga0307407_10046830 | Ga0307407_100468303 | 114 |
| 570 | 3300031911 | Ga0307412_10005218 | Ga0307412_1000521810 | 114 |
| 571 | 3300031911 | Ga0307412_10360484 | Ga0307412_103604842 | 114 |
| 572 | 3300031911 | Ga0307412_11166788 | Ga0307412_111667882 | 114 |
| 573 | 3300031995 | Ga0307409_100002648 | Ga0307409_10000264811 | 114 |
| 574 | 3300031995 | Ga0307409_100003888 | Ga0307409_1000038889 | 114 |
| 575 | 3300031995 | Ga0307409_100293628 | Ga0307409_1002936283 | 114 |
| 576 | 3300032002 | Ga0307416_100004422 | Ga0307416_1000044222 | 114 |
| 577 | 3300032002 | Ga0307416_100044033 | Ga0307416_1000440333 | 114 |
| 578 | 3300032002 | Ga0307416_100503237 | Ga0307416_1005032372 | 114 |
| 579 | 3300032002 | Ga0307416_100608615 | Ga0307416_1006086152 | 114 |
| 580 | 3300032002 | Ga0307416_101691659 | Ga0307416_1016916592 | 114 |
| 581 | 3300032002 | Ga0307416_102358506 | Ga0307416_1023585062 | 114 |
| 582 | 3300032002 | Ga0307416_103530889 | Ga0307416_1035308892 | 114 |
| 583 | 3300032004 | Ga0307414_10173391 | Ga0307414_101733912 | 114 |
| 584 | 3300032004 | Ga0307414_10373728 | Ga0307414_103737282 | 114 |
| 585 | 3300032004 | Ga0307414_10505576 | Ga0307414_105055762 | 114 |
| 586 | 3300032005 | Ga0307411_10003618 | Ga0307411_100036185 | 114 |
| 587 | 3300032005 | Ga0307411_10060532 | Ga0307411_100605322 | 114 |
| 588 | 3300032005 | Ga0307411_11364967 | Ga0307411_113649672 | 114 |
| 589 | 3300032126 | Ga0307415_100001588 | Ga0307415_1000015887 | 114 |
| 590 | 3300034817 | Ga0373948_0020504 | Ga0373948_0020504_438_782 | 114 |
| 591 | 3300034819 | Ga0373958_0086997 | Ga0373958_0086997_32_376 | 114 |
| 592 | 3300035086 | Ga0373934_0294081 | Ga0373934_0294081_53_400 | 114 |
| 593 | 3300035091 | Ga0373951_0107860 | Ga0373951_0107860_343_687 | 114 |
| 594 | 3300035113 | Ga0373936_0207943 | Ga0373936_0207943_204_551 | 114 |
| 595 | 3300035172 | Ga0373955_0959760 | Ga0373955_0959760_59_403 | 114 |
| 596 | 3300035241 | Ga0373961_0015803 | Ga0373961_0015803_415_759 | 114 |
| 597 | 3300035241 | Ga0373961_0099220 | Ga0373961_0099220_186_530 | 114 |
| 598 | 3300035242 | Ga0373962_0008528 | Ga0373962_0008528_1825_2169 | 114 |
| 599 | 3300035691 | Ga0373931_0085471 | Ga0373931_0085471_946_1290 | 114 |
| 600 | 3300035692 | Ga0373935_0195581 | Ga0373935_0195581_390_737 | 114 |
| 601 | 3300039437 | Ga0436365_1109499 | Ga0436365_1109499_1529_1873 | 114 |
| 602 | 3300041404 | Ga0439436_0153283 | Ga0439436_0153283_124_468 | 114 |
| 603 | 3300041406 | Ga0439439_0022822 | Ga0439439_0022822_574_918 | 114 |
| 604 | 3300041408 | Ga0439453_0053654 | Ga0439453_0053654_332_676 | 114 |
| 605 | 3300041410 | Ga0439461_0052299 | Ga0439461_0052299_202_546 | 114 |
| 606 | 3300041459 | Ga0451800_1468674 | Ga0451800_1468674_18_362 | 114 |
| 607 | 3300041511 | Ga0451855_1421513 | Ga0451855_1421513_39_383 | 114 |
| 608 | 3300041999 | Ga0439433_0014349 | Ga0439433_0014349_296_640 | 114 |
| 609 | 3300042007 | Ga0439449_0045218 | Ga0439449_0045218_372_716 | 114 |
| 610 | 3300042008 | Ga0439450_105714 | Ga0439450_105714_46_390 | 114 |
| 611 | 3300042008 | Ga0439450_115530 | Ga0439450_115530_331_675 | 114 |
| 612 | 3300042012 | Ga0439455_0221034 | Ga0439455_0221034_98_442 | 114 |
| 613 | 3300042014 | Ga0439457_121763 | Ga0439457_121763_254_598 | 114 |
| 614 | 3300042016 | Ga0439463_139423 | Ga0439463_139423_139_483 | 114 |
| 615 | 3300042122 | Ga0450920_033413 | Ga0450920_033413_129_473 | 114 |
| 616 | 3300042157 | Ga0439458_0177095 | Ga0439458_0177095_157_501 | 114 |
| 617 | 3300042184 | Ga0450908_016885 | Ga0450908_016885_123_467 | 114 |
| 618 | 3300042435 | Ga0439434_0058985 | Ga0439434_0058985_30_374 | 114 |
| 619 | 3300042436 | Ga0439435_0029358 | Ga0439435_0029358_1003_1347 | 114 |
| 620 | 3300042436 | Ga0439435_0214630 | Ga0439435_0214630_240_584 | 114 |
| 621 | 3300042437 | Ga0439444_0014234 | Ga0439444_0014234_942_1286 | 114 |
| 622 | 3300042439 | Ga0439464_0012276 | Ga0439464_0012276_938_1282 | 114 |
| 623 | 3300042530 | Ga0450916_082719 | Ga0450916_082719_158_502 | 114 |
| 624 | 3300042531 | Ga0450918_086013 | Ga0450918_086013_195_539 | 114 |
| 625 | 3300042993 | Ga0439440_0046755 | Ga0439440_0046755_18_362 | 114 |
| 626 | 3300042993 | Ga0439440_0068143 | Ga0439440_0068143_66_410 | 114 |
| 627 | 3300042993 | Ga0439440_0196329 | Ga0439440_0196329_228_572 | 114 |
| 628 | 3300045051 | Ga0451576_0168098 | Ga0451576_0168098_387_731 | 114 |
| 629 | 3300045051 | Ga0451576_0691529 | Ga0451576_0691529_673_1017 | 114 |
| 630 | 3300046492 | Ga0495585_0210084 | Ga0495585_0210084_460_807 | 114 |
| 631 | 3300046523 | Ga0495644_0138006 | Ga0495644_0138006_41_385 | 114 |
| 632 | 3300046537 | Ga0495598_0025338 | Ga0495598_0025338_468_812 | 114 |
| 633 | 3300046537 | Ga0495598_0359488 | Ga0495598_0359488_157_501 | 114 |
| 634 | 3300046539 | Ga0495621_0012939 | Ga0495621_0012939_770_1114 | 114 |
| 635 | 3300046539 | Ga0495621_0323520 | Ga0495621_0323520_41_385 | 114 |
| 636 | 3300046559 | Ga0495667_0120663 | Ga0495667_0120663_1208_1555 | 114 |
| 637 | 3300046663 | Ga0495635_0442097 | Ga0495635_0442097_127_474 | 114 |
| 638 | 3300046681 | Ga0495647_0248656 | Ga0495647_0248656_234_578 | 114 |
| 639 | 3300046683 | Ga0495658_0163311 | Ga0495658_0163311_295_642 | 114 |
| 640 | 3300046683 | Ga0495658_0394566 | Ga0495658_0394566_506_850 | 114 |
| 641 | 3300048905 | Ga0496102_1772011 | Ga0496102_1772011_99_443 | 114 |
| 642 | 3300048906 | Ga0496103_0741961 | Ga0496103_0741961_200_544 | 114 |
| 643 | 3300048908 | Ga0496105_0619673 | Ga0496105_0619673_70_414 | 114 |
| 644 | 3300048909 | Ga0496106_1465036 | Ga0496106_1465036_36_380 | 114 |
| 645 | 3300048911 | Ga0496108_0687187 | Ga0496108_0687187_165_509 | 114 |
| 646 | 3300048912 | Ga0496109_0009469 | Ga0496109_0009469_4487_4831 | 114 |
| 647 | 3300048913 | Ga0496110_0519699 | Ga0496110_0519699_194_538 | 114 |
| 648 | 3300048916 | Ga0496113_0477436 | Ga0496113_0477436_44_388 | 114 |
| 649 | 3300049568 | Ga0501031_0157403 | Ga0501031_0157403_423_767 | 114 |
| 650 | 3300049569 | Ga0501032_0219971 | Ga0501032_0219971_573_917 | 114 |
| 651 | 3300049571 | Ga0501034_0011197 | Ga0501034_0011197_300_644 | 114 |
| 652 | 3300049572 | Ga0501036_0075889 | Ga0501036_0075889_39_383 | 114 |
| 653 | 3300049572 | Ga0501036_0412435 | Ga0501036_0412435_86_430 | 114 |
| 654 | 3300049574 | Ga0501038_0096331 | Ga0501038_0096331_1043_1387 | 114 |
| 655 | 3300049575 | Ga0501039_0015444 | Ga0501039_0015444_3018_3362 | 114 |
| 656 | 3300049575 | Ga0501039_0095532 | Ga0501039_0095532_28_372 | 114 |
| 657 | 3300049576 | Ga0501040_0229575 | Ga0501040_0229575_125_469 | 114 |
| 658 | 3300049577 | Ga0501041_0053907 | Ga0501041_0053907_1775_2119 | 114 |
| 659 | 3300049578 | Ga0501042_0018344 | Ga0501042_0018344_3319_3663 | 114 |
| 660 | 3300049578 | Ga0501042_0053525 | Ga0501042_0053525_2358_2702 | 114 |
| 661 | 3300049580 | Ga0501046_0014788 | Ga0501046_0014788_883_1227 | 114 |
| 662 | 3300049581 | Ga0501047_0361166 | Ga0501047_0361166_848_1192 | 114 |
| 663 | 3300049582 | Ga0501048_0058291 | Ga0501048_0058291_1184_1528 | 114 |
| 664 | 3300049582 | Ga0501048_0085194 | Ga0501048_0085194_1461_1805 | 114 |
| 665 | 3300049585 | Ga0501069_0567547 | Ga0501069_0567547_64_408 | 114 |
| 666 | 3300049587 | Ga0501071_0112603 | Ga0501071_0112603_1212_1556 | 114 |
| 667 | 3300049587 | Ga0501071_0735558 | Ga0501071_0735558_67_411 | 114 |
| 668 | 3300049588 | Ga0501072_0052134 | Ga0501072_0052134_76_420 | 114 |
| 669 | 3300049588 | Ga0501072_0152215 | Ga0501072_0152215_1016_1360 | 114 |
| 670 | 3300049589 | Ga0501073_0810797 | Ga0501073_0810797_114_458 | 114 |
| 671 | 3300049589 | Ga0501073_0997904 | Ga0501073_0997904_172_516 | 114 |
| 672 | 3300049591 | Ga0501075_0002772 | Ga0501075_0002772_6719_7063 | 114 |
| 673 | 3300049591 | Ga0501075_0073859 | Ga0501075_0073859_754_1098 | 114 |
| 674 | 3300049591 | Ga0501075_0304786 | Ga0501075_0304786_445_789 | 114 |
| 675 | 3300049591 | Ga0501075_0402404 | Ga0501075_0402404_309_653 | 114 |
| 676 | 3300049592 | Ga0501076_0049675 | Ga0501076_0049675_2272_2616 | 114 |
| 677 | 3300049592 | Ga0501076_0135828 | Ga0501076_0135828_302_646 | 114 |
| 678 | 3300049592 | Ga0501076_0154132 | Ga0501076_0154132_66_410 | 114 |
| 679 | 3300049593 | Ga0501077_0598311 | Ga0501077_0598311_179_523 | 114 |
| 680 | 3300049668 | Ga0501233_224160 | Ga0501233_224160_103_447 | 114 |
| 681 | 3300049741 | Ga0501079_0031859 | Ga0501079_0031859_3631_3975 | 114 |
| 682 | 3300049741 | Ga0501079_0052684 | Ga0501079_0052684_1889_2233 | 114 |
| 683 | 3300049742 | Ga0501080_0054487 | Ga0501080_0054487_1308_1652 | 114 |
| 684 | 3300049743 | Ga0501081_0019001 | Ga0501081_0019001_1052_1396 | 114 |
| 685 | 3300049743 | Ga0501081_0032255 | Ga0501081_0032255_680_1024 | 114 |
| 686 | 3300049744 | Ga0501083_0190369 | Ga0501083_0190369_526_870 | 114 |
| 687 | 3300049822 | Ga0501035_0166617 | Ga0501035_0166617_682_1026 | 114 |
| 688 | 3300049824 | Ga0501045_0014255 | Ga0501045_0014255_3876_4220 | 114 |
| 689 | 3300049824 | Ga0501045_0241539 | Ga0501045_0241539_690_1034 | 114 |
| 690 | 3300049824 | Ga0501045_0795806 | Ga0501045_0795806_70_414 | 114 |
| 691 | 3300050489 | nmdc:mga03683_305711_c1 | nmdc:mga03683_305711_c1_339_686 | 114 |
| 692 | 3300050491 | nmdc:mga00v17_169911_c1 | nmdc:mga00v17_169911_c1_641_988 | 114 |
| 693 | 3300050492 | nmdc:mga0yw44_685417_c1 | nmdc:mga0yw44_685417_c1_81_428 | 114 |
| 694 | 3300050493 | nmdc:mga0k408_2583_c1 | nmdc:mga0k408_2583_c1_271_618 | 114 |
| 695 | 3300050507 | nmdc:mga05p37_1212421_c1 | nmdc:mga05p37_1212421_c1_267_614 | 114 |
| 696 | 3300050507 | nmdc:mga05p37_2629_c1 | nmdc:mga05p37_2629_c1_10412_10756 | 114 |
| 697 | 3300050507 | nmdc:mga05p37_315151_c1 | nmdc:mga05p37_315151_c1_282_626 | 114 |
| 698 | 3300050507 | nmdc:mga05p37_47196_c1 | nmdc:mga05p37_47196_c1_2791_3135 | 114 |
| 699 | 3300050507 | nmdc:mga05p37_569037_c1 | nmdc:mga05p37_569037_c1_666_1010 | 114 |
| 700 | 3300050507 | nmdc:mga05p37_61488_c1 | nmdc:mga05p37_61488_c1_813_1157 | 114 |
| 701 | 3300050507 | nmdc:mga05p37_785493_c1 | nmdc:mga05p37_785493_c1_67_411 | 114 |
| 702 | 3300050508 | nmdc:mga09592_11186_c1 | nmdc:mga09592_11186_c1_6067_6411 | 114 |
| 703 | 3300050508 | nmdc:mga09592_1151_c1 | nmdc:mga09592_1151_c1_18629_18973 | 114 |
| 704 | 3300050508 | nmdc:mga09592_21965_c1 | nmdc:mga09592_21965_c1_518_862 | 114 |
| 705 | 3300050508 | nmdc:mga09592_680372_c1 | nmdc:mga09592_680372_c1_25_369 | 114 |
| 706 | 3300050508 | nmdc:mga09592_9057_c1 | nmdc:mga09592_9057_c1_1853_2197 | 114 |
| 707 | 3300050508 | nmdc:mga09592_99836_c1 | nmdc:mga09592_99836_c1_700_1044 | 114 |
| 708 | 3300050509 | nmdc:mga0qj67_1199761_c1 | nmdc:mga0qj67_1199761_c1_208_552 | 114 |
| 709 | 3300050509 | nmdc:mga0qj67_181061_c1 | nmdc:mga0qj67_181061_c1_597_941 | 114 |
| 710 | 3300050509 | nmdc:mga0qj67_1855_c1 | nmdc:mga0qj67_1855_c1_13870_14214 | 114 |
| 711 | 3300050509 | nmdc:mga0qj67_188001_c1 | nmdc:mga0qj67_188001_c1_43_387 | 114 |
| 712 | 3300050509 | nmdc:mga0qj67_26899_c1 | nmdc:mga0qj67_26899_c1_1767_2111 | 114 |
| 713 | 3300050509 | nmdc:mga0qj67_320955_c1 | nmdc:mga0qj67_320955_c1_427_771 | 114 |
| 714 | 3300050509 | nmdc:mga0qj67_5906_c1 | nmdc:mga0qj67_5906_c1_1271_1615 | 114 |
| 715 | 3300050509 | nmdc:mga0qj67_899_c1 | nmdc:mga0qj67_899_c1_18810_19154 | 114 |
| 716 | 3300050510 | nmdc:mga06r32_1105309_c1 | nmdc:mga06r32_1105309_c1_159_503 | 114 |
| 717 | 3300050510 | nmdc:mga06r32_11765_c1 | nmdc:mga06r32_11765_c1_4248_4592 | 114 |
| 718 | 3300050510 | nmdc:mga06r32_1217_c1 | nmdc:mga06r32_1217_c1_18931_19275 | 114 |
| 719 | 3300050510 | nmdc:mga06r32_159845_c1 | nmdc:mga06r32_159845_c1_1780_2124 | 114 |
| 720 | 3300050510 | nmdc:mga06r32_354352_c1 | nmdc:mga06r32_354352_c1_1022_1366 | 114 |
| 721 | 3300050510 | nmdc:mga06r32_50770_c1 | nmdc:mga06r32_50770_c1_3604_3948 | 114 |
| 722 | 3300050510 | nmdc:mga06r32_88110_c1 | nmdc:mga06r32_88110_c1_1329_1673 | 114 |
| 723 | 3300050511 | nmdc:mga08y16_207658_c1 | nmdc:mga08y16_207658_c1_678_1022 | 114 |
| 724 | 3300050511 | nmdc:mga08y16_24666_c1 | nmdc:mga08y16_24666_c1_5065_5409 | 114 |
| 725 | 3300050511 | nmdc:mga08y16_30647_c1 | nmdc:mga08y16_30647_c1_4070_4414 | 114 |
| 726 | 3300050511 | nmdc:mga08y16_62014_c1 | nmdc:mga08y16_62014_c1_524_868 | 114 |
| 727 | 3300050511 | nmdc:mga08y16_738114_c1 | nmdc:mga08y16_738114_c1_497_841 | 114 |
| 728 | 3300050511 | nmdc:mga08y16_87648_c1 | nmdc:mga08y16_87648_c1_2084_2428 | 114 |
| 729 | 3300050511 | nmdc:mga08y16_953_c1 | nmdc:mga08y16_953_c1_20856_21200 | 114 |
| 730 | 3300050512 | nmdc:mga0n895_1256235_c1 | nmdc:mga0n895_1256235_c1_225_569 | 114 |
| 731 | 3300050512 | nmdc:mga0n895_1590872_c1 | nmdc:mga0n895_1590872_c1_69_416 | 114 |
| 732 | 3300050512 | nmdc:mga0n895_37083_c1 | nmdc:mga0n895_37083_c1_938_1282 | 114 |
| 733 | 3300050512 | nmdc:mga0n895_5337_c1 | nmdc:mga0n895_5337_c1_380_724 | 114 |
| 734 | 3300050513 | nmdc:mga0rr50_167248_c1 | nmdc:mga0rr50_167248_c1_1265_1609 | 114 |
| 735 | 3300050515 | nmdc:mga0a205_102698_c1 | nmdc:mga0a205_102698_c1_1999_2343 | 114 |
| 736 | 3300050515 | nmdc:mga0a205_14932_c1 | nmdc:mga0a205_14932_c1_964_1308 | 114 |
| 737 | 3300050515 | nmdc:mga0a205_233_c1 | nmdc:mga0a205_233_c1_38363_38707 | 114 |
| 738 | 3300050515 | nmdc:mga0a205_42735_c1 | nmdc:mga0a205_42735_c1_2068_2412 | 114 |
| 739 | 3300050515 | nmdc:mga0a205_656870_c1 | nmdc:mga0a205_656870_c1_98_442 | 114 |
| 740 | 3300050515 | nmdc:mga0a205_99_c1 | nmdc:mga0a205_99_c1_42834_43178 | 114 |
| 741 | 3300053085 | Ga0495619_0053906 | Ga0495619_0053906_1248_1595 | 114 |
| 742 | 3300054114 | Ga0501084_0007339 | Ga0501084_0007339_2422_2766 | 114 |
| 743 | 3300054114 | Ga0501084_0079823 | Ga0501084_0079823_948_1292 | 114 |
| 744 | 3300054114 | Ga0501084_1570101 | Ga0501084_1570101_127_471 | 114 |
| 745 | 3300059421 | Ga0590071_067361 | Ga0590071_067361_161_505 | 114 |
| 746 | 3300059421 | Ga0590071_095472 | Ga0590071_095472_243_587 | 114 |
| 747 | 3300059424 | Ga0590075_022471 | Ga0590075_022471_1181_1525 | 114 |
| 748 | 3300059426 | Ga0590077_003880 | Ga0590077_003880_2170_2514 | 114 |
| 749 | 3300060353 | Ga0501082_0035816 | Ga0501082_0035816_2690_3034 | 114 |
| 750 | 3300060353 | Ga0501082_0289949 | Ga0501082_0289949_667_1011 | 114 |
| 751 | 3300061734 | Ga0530510_0119762 | Ga0530510_0119762_645_989 | 114 |
| 752 | 3300061734 | Ga0530510_0328277 | Ga0530510_0328277_520_864 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6d6j-assembly1.cif.gz_A | crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 | 0.9845 | 3 | 114 |
| 5km6-assembly1.cif.gz_A-2 | human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant ara-a nucleoside phosphoramidate substrate complex | 0.9784 | 3 | 114 |
| 6d6j-assembly1.cif.gz_A | crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 | 0.9759 | 3 | 114 |
| 3qgz-assembly1.cif.gz_A | re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine | 0.9754 | 2 | 114 |
| 3o1c-assembly1.cif.gz_A-2 | high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c38a mutant from rabbit complexed with adenosine | 0.974 | 2 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kpcB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9682 | 3 | 114 | 3.30.428.10 |
| 4njyA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9638 | 18 | 114 | 3.30.428.10 |
| 5uvmA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9631 | 1 | 108 | 3.30.428.10 |
| af_Q8STA5_22_150_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9607 | 1 | 114 | 3.30.428.10 |
| 1kpcB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9597 | 3 | 114 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J4WLC5-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9908 | 3 | 106 |
GO:0003824
|
| AF-A0A382LWH9-F1-model_v4 | HIT domain-containing protein | 0.99 | 4 | 114 |
GO:0003824
|
| AF-S6HKD1-F1-model_v4 | Histidine triad (HIT) protein | 0.9895 | 3 | 110 |
GO:0003824
|
| AF-A0A1I0GSU7-F1-model_v4 | Histidine triad (HIT) family protein | 0.9893 | 3 | 114 |
GO:0003824
|
| AF-A0A6N4DIS3-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9887 | 2 | 114 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar