F479174

General Info

Members Datasets Scaffolds Average Seq Length
752 306 752 114

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0138397|Ga0453684_0138397_809_1159
Length 116
Sequence MGETIFSKIIRKEIPAKIVYEDDEVLAFNDINPQAPVHVLIIPKISEIETTRDIDPERHSALLGSLYKAANKIAKETGISESGFRLVLNCGPDAGQEVYHLHMHLLGGRKMNWPPG

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
197 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
198 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
201 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
202 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
209 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
212 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
213 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
214 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
215 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
216 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
219 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
220 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
223 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
303 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
304 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 2.26
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3700117 2162886006 Bacteria 826
2 MBSR1b_contig_2267242 2162886012 Bacteria 824
3 JGI24746J21847_1009684 3300001977 Bacteria 1435
4 JGI24750J21931_1019248 3300002070 Bacteria 945
5 JGI25406J46586_10003224 3300003203 Bacteria 7675
6 JGI25406J46586_10023568 3300003203 Bacteria 2430
7 Ga0065704_10845341 3300005289 Bacteria 511
8 Ga0065712_10068445 3300005290 Bacteria 10595
9 Ga0065712_10189133 3300005290 Unclassified 1156
10 Ga0065712_10416994 3300005290 Bacteria 715
11 Ga0065712_10567759 3300005290 Bacteria 608
12 Ga0065715_10153179 3300005293 Unclassified 1694
13 Ga0065715_10167581 3300005293 Unclassified 1574
14 Ga0065715_10375280 3300005293 Bacteria 915
15 Ga0065707_10005475 3300005295 Bacteria 3024
16 Ga0065707_10108492 3300005295 Bacteria 2508
17 Ga0065707_10271876 3300005295 Bacteria 1069
18 Ga0065707_10284483 3300005295 Bacteria 1040
19 Ga0065707_10465592 3300005295 Bacteria 787
20 Ga0070658_10285570 3300005327 Bacteria 1405
21 Ga0070676_10030126 3300005328 Bacteria 3092
22 Ga0070676_10068970 3300005328 Bacteria 2118
23 Ga0070676_10087769 3300005328 Bacteria 1899
24 Ga0070676_10179577 3300005328 Bacteria 1375
25 Ga0070676_10923258 3300005328 Bacteria 651
26 Ga0070690_100009587 3300005330 Bacteria 5614
27 Ga0070690_100054918 3300005330 Bacteria 2550
28 Ga0070690_100264292 3300005330 Bacteria 1222
29 Ga0070690_100388770 3300005330 Bacteria 1022
30 Ga0070690_100621591 3300005330 Bacteria 822
31 Ga0070690_100980785 3300005330 Bacteria 665
32 Ga0070670_100004047 3300005331 Bacteria 12240
33 Ga0070670_100192771 3300005331 Bacteria 1770
34 Ga0070670_101878203 3300005331 Bacteria 552
35 Ga0070677_10029226 3300005333 Unclassified 2088
36 Ga0070677_10285652 3300005333 Bacteria 833
37 Ga0070677_10492232 3300005333 Bacteria 663
38 Ga0068869_100066722 3300005334 Bacteria 2652
39 Ga0068869_100201816 3300005334 Bacteria 1568
40 Ga0070666_10584095 3300005335 Bacteria 814
41 Ga0070666_10589738 3300005335 Bacteria 810
42 Ga0070680_100196527 3300005336 Bacteria 1700
43 Ga0070680_100769736 3300005336 Unclassified 829
44 Ga0068868_100092803 3300005338 Unclassified 2433
45 Ga0068868_100226705 3300005338 Bacteria 1566
46 Ga0068868_101460893 3300005338 Bacteria 639
47 Ga0070660_100899750 3300005339 Bacteria 746
48 Ga0070689_100011310 3300005340 Bacteria 6389
49 Ga0070689_100081004 3300005340 Bacteria 2548
50 Ga0070689_100148584 3300005340 Bacteria 1889
51 Ga0070689_100273778 3300005340 Bacteria 1398
52 Ga0070689_100338584 3300005340 Bacteria 1260
53 Ga0070691_10224467 3300005341 Bacteria 997
54 Ga0070687_100002850 3300005343 Bacteria 6608
55 Ga0070687_101174784 3300005343 Bacteria 565
56 Ga0070661_100024630 3300005344 Bacteria 4317
57 Ga0070661_100537523 3300005344 Bacteria 939
58 Ga0070692_10120613 3300005345 Bacteria 1462
59 Ga0070692_10234044 3300005345 Bacteria 1092
60 Ga0070692_10691611 3300005345 Bacteria 685
61 Ga0070668_100043065 3300005347 Bacteria 3461
62 Ga0070668_101020133 3300005347 Unclassified 744
63 Ga0070669_100004013 3300005353 Bacteria 10643
64 Ga0070669_100353027 3300005353 Bacteria 1194
65 Ga0070669_100353550 3300005353 Bacteria 1193
66 Ga0070669_101373622 3300005353 Bacteria 613
67 Ga0070669_101675941 3300005353 Unclassified 554
68 Ga0070675_100000954 3300005354 Bacteria 20626
69 Ga0070675_100011353 3300005354 Bacteria 6971
70 Ga0070675_100031578 3300005354 Bacteria 4283
71 Ga0070675_100074939 3300005354 Unclassified 2812
72 Ga0070675_100179410 3300005354 Bacteria 1830
73 Ga0070675_101407345 3300005354 Bacteria 643
74 Ga0070675_101423968 3300005354 Bacteria 639
75 Ga0070671_100047927 3300005355 Unclassified 3553
76 Ga0070671_100159669 3300005355 Bacteria 1906
77 Ga0070671_100186546 3300005355 Bacteria 1757
78 Ga0070674_101775519 3300005356 Bacteria 559
79 Ga0070673_100005401 3300005364 Bacteria 8174
80 Ga0070673_100008933 3300005364 Bacteria 6700
81 Ga0070673_100009507 3300005364 Bacteria 6528
82 Ga0070673_100730979 3300005364 Bacteria 910
83 Ga0070688_100024757 3300005365 Bacteria 3546
84 Ga0070688_100069382 3300005365 Unclassified 2250
85 Ga0070688_100077561 3300005365 Bacteria 2141
86 Ga0070688_101291562 3300005365 Bacteria 589
87 Ga0070659_100066788 3300005366 Bacteria 2851
88 Ga0070659_100385644 3300005366 Bacteria 1181
89 Ga0070667_100052390 3300005367 Unclassified 3444
90 Ga0070667_101030460 3300005367 Bacteria 768
91 Ga0070667_102147666 3300005367 Bacteria 526
92 Ga0070701_10034413 3300005438 Unclassified 2537
93 Ga0070701_10281094 3300005438 Bacteria 1016
94 Ga0070705_100397678 3300005440 Bacteria 1019
95 Ga0070705_100934581 3300005440 Bacteria 700
96 Ga0070700_100027258 3300005441 Bacteria 3386
97 Ga0070700_100511953 3300005441 Bacteria 925
98 Ga0070700_100525160 3300005441 Bacteria 915
99 Ga0070708_101211310 3300005445 Bacteria 706
100 Ga0070663_100660547 3300005455 Bacteria 885
101 Ga0070663_101658324 3300005455 Unclassified 571
102 Ga0070678_100023931 3300005456 Bacteria 4079
103 Ga0070678_100230091 3300005456 Bacteria 1545
104 Ga0070678_100316544 3300005456 Bacteria 1331
105 Ga0070678_100601196 3300005456 Bacteria 982
106 Ga0070678_100771407 3300005456 Bacteria 871
107 Ga0070662_100004759 3300005457 Bacteria 8598
108 Ga0070662_100040974 3300005457 Bacteria 3301
109 Ga0068867_100061160 3300005459 Bacteria 2795
110 Ga0068867_100126399 3300005459 Bacteria 1982
111 Ga0068867_100749617 3300005459 Bacteria 866
112 Ga0068867_101200470 3300005459 Bacteria 697
113 Ga0068867_102004770 3300005459 Bacteria 547
114 Ga0070685_10029005 3300005466 Unclassified 3072
115 Ga0070685_10079208 3300005466 Bacteria 1966
116 Ga0070685_10149193 3300005466 Bacteria 1480
117 Ga0070707_100267452 3300005468 Bacteria 1663
118 Ga0070707_100497606 3300005468 Bacteria 1180
119 Ga0070698_100253844 3300005471 Bacteria 1691
120 Ga0070699_100021687 3300005518 Bacteria 5538
121 Ga0070699_100935455 3300005518 Unclassified 794
122 Ga0070699_101134414 3300005518 Bacteria 717
123 Ga0070684_100608731 3300005535 Bacteria 1016
124 Ga0070684_100620281 3300005535 Bacteria 1006
125 Ga0068853_100234936 3300005539 Bacteria 1678
126 Ga0070672_100004271 3300005543 Bacteria 9342
127 Ga0070672_100009212 3300005543 Bacteria 6796
128 Ga0070672_100050131 3300005543 Unclassified 3251
129 Ga0070672_100086254 3300005543 Bacteria 2524
130 Ga0070672_100128254 3300005543 Bacteria 2083
131 Ga0070672_100292164 3300005543 Bacteria 1380
132 Ga0070672_100292685 3300005543 Bacteria 1379
133 Ga0070686_100033415 3300005544 Bacteria 3161
134 Ga0070686_100036889 3300005544 Bacteria 3029
135 Ga0070686_100047742 3300005544 Bacteria 2708
136 Ga0070686_100290870 3300005544 Bacteria 1208
137 Ga0070686_100444526 3300005544 Bacteria 995
138 Ga0070695_100124874 3300005545 Bacteria 1766
139 Ga0070695_100688767 3300005545 Bacteria 810
140 Ga0070696_100201191 3300005546 Bacteria 1487
141 Ga0070693_100022486 3300005547 Bacteria 3354
142 Ga0070665_100130869 3300005548 Unclassified 2511
143 Ga0070704_100485040 3300005549 Bacteria 1070
144 Ga0070704_100494603 3300005549 Bacteria 1060
145 Ga0070704_100534883 3300005549 Bacteria 1022
146 Ga0070704_101850060 3300005549 Bacteria 559
147 Ga0068855_101973065 3300005563 Bacteria 590
148 Ga0070664_100016473 3300005564 Bacteria 6059
149 Ga0070664_100123324 3300005564 Bacteria 2270
150 Ga0070664_100157183 3300005564 Bacteria 2009
151 Ga0070664_100453362 3300005564 Bacteria 1178
152 Ga0070664_101059385 3300005564 Bacteria 763
153 Ga0070664_102085364 3300005564 Bacteria 538
154 Ga0070664_102316587 3300005564 Bacteria 509
155 Ga0068857_100405063 3300005577 Unclassified 1270
156 Ga0068854_100070417 3300005578 Bacteria 2556
157 Ga0070702_100050594 3300005615 Bacteria 2374
158 Ga0068852_100021108 3300005616 Bacteria 5191
159 Ga0068852_100241352 3300005616 Unclassified 1727
160 Ga0068852_100429962 3300005616 Bacteria 1304
161 Ga0068859_100001104 3300005617 Bacteria 27503
162 Ga0068859_100047654 3300005617 Bacteria 4306
163 Ga0068859_100073232 3300005617 Bacteria 3463
164 Ga0068859_100119097 3300005617 Bacteria 2706
165 Ga0068859_100168159 3300005617 Bacteria 2273
166 Ga0068859_101615066 3300005617 Unclassified 716
167 Ga0068864_100005659 3300005618 Bacteria 10248
168 Ga0068864_100163792 3300005618 Bacteria 2023
169 Ga0068864_100450538 3300005618 Bacteria 1231
170 Ga0068866_10163468 3300005718 Bacteria 1300
171 Ga0068866_10278757 3300005718 Bacteria 1035
172 Ga0068861_100033352 3300005719 Unclassified 3798
173 Ga0068861_100625816 3300005719 Bacteria 991
174 Ga0068870_10000334 3300005840 Bacteria 17525
175 Ga0068870_10199174 3300005840 Bacteria 1213
176 Ga0068863_100032173 3300005841 Bacteria 5000
177 Ga0068863_102107524 3300005841 Bacteria 574
178 Ga0068858_100041332 3300005842 Unclassified 4275
179 Ga0068858_100222130 3300005842 Bacteria 1789
180 Ga0068860_100033706 3300005843 Bacteria 4913
181 Ga0068860_100188391 3300005843 Bacteria 1996
182 Ga0068862_100007352 3300005844 Bacteria 9143
183 Ga0068862_100387230 3300005844 Unclassified 1305
184 Ga0068862_100440749 3300005844 Bacteria 1226
185 Ga0068862_100966126 3300005844 Bacteria 841
186 Ga0068862_101370880 3300005844 Bacteria 710
187 Ga0081539_10000024 3300005985 Bacteria 354702
188 Ga0081539_10003877 3300005985 Bacteria 17471
189 Ga0075364_10001941 3300006051 Bacteria 11521
190 Ga0075364_10262427 3300006051 Bacteria 1174
191 Ga0070715_10484270 3300006163 Bacteria 705
192 Ga0075362_10001991 3300006177 Bacteria 6723
193 Ga0075367_11103569 3300006178 Unclassified 507
194 Ga0075427_10042471 3300006194 Bacteria 769
195 Ga0075366_10029394 3300006195 Bacteria 3229
196 Ga0075366_10576309 3300006195 Bacteria 697
197 Ga0097621_100037091 3300006237 Bacteria 3903
198 Ga0068871_100058513 3300006358 Bacteria 3138
199 Ga0068871_100083349 3300006358 Bacteria 2652
200 Ga0068871_100114587 3300006358 Bacteria 2271
201 Ga0075428_100001946 3300006844 Bacteria 22190
202 Ga0075428_100014804 3300006844 Bacteria 8668
203 Ga0075428_100031002 3300006844 Bacteria 5913
204 Ga0075428_100214990 3300006844 Unclassified 2077
205 Ga0075428_100257040 3300006844 Bacteria 1881
206 Ga0075430_100000495 3300006846 Bacteria 29612
207 Ga0075430_100002007 3300006846 Bacteria 16762
208 Ga0075430_100029756 3300006846 Bacteria 4636
209 Ga0075430_100059918 3300006846 Bacteria 3199
210 Ga0075430_100447719 3300006846 Bacteria 1066
211 Ga0075430_101476568 3300006846 Bacteria 559
212 Ga0075431_100000501 3300006847 Bacteria 32696
213 Ga0075431_100018901 3300006847 Bacteria 7019
214 Ga0075431_100033557 3300006847 Bacteria 5289
215 Ga0075431_100121049 3300006847 Unclassified 2701
216 Ga0075431_101086657 3300006847 Bacteria 765
217 Ga0075433_10001923 3300006852 Bacteria 15628
218 Ga0075433_10002593 3300006852 Bacteria 13778
219 Ga0075433_10305399 3300006852 Unclassified 1409
220 Ga0075433_10492197 3300006852 Bacteria 1080
221 Ga0075433_10784131 3300006852 Bacteria 833
222 Ga0075433_11159450 3300006852 Unclassified 671
223 Ga0075434_100000863 3300006871 Bacteria 24202
224 Ga0075434_100002413 3300006871 Bacteria 16413
225 Ga0075434_100003202 3300006871 Bacteria 14595
226 Ga0075434_100086925 3300006871 Bacteria 3127
227 Ga0075434_100157985 3300006871 Bacteria 2287
228 Ga0075434_102084094 3300006871 Bacteria 572
229 Ga0075429_100006308 3300006880 Bacteria 10268
230 Ga0075429_100006683 3300006880 Bacteria 9999
231 Ga0075429_100008978 3300006880 Bacteria 8683
232 Ga0075429_100033178 3300006880 Bacteria 4485
233 Ga0075429_100701528 3300006880 Bacteria 886
234 Ga0068865_100033914 3300006881 Bacteria 3420
235 Ga0068865_100062515 3300006881 Bacteria 2614
236 Ga0068865_100100535 3300006881 Bacteria 2116
237 Ga0068865_100368917 3300006881 Bacteria 1168
238 Ga0068865_101538371 3300006881 Bacteria 597
239 Ga0097620_100001104 3300006931 Bacteria 27503
240 Ga0097620_100047654 3300006931 Bacteria 4306
241 Ga0097620_100073234 3300006931 Bacteria 3463
242 Ga0097620_100119087 3300006931 Bacteria 2706
243 Ga0097620_100168175 3300006931 Bacteria 2273
244 Ga0097620_101615130 3300006931 Unclassified 716
245 Ga0075435_100011881 3300007076 Bacteria 6430
246 Ga0105251_10320868 3300009011 Bacteria 704
247 Ga0111539_10000390 3300009094 Bacteria 54308
248 Ga0111539_10004477 3300009094 Bacteria 18271
249 Ga0111539_10031520 3300009094 Bacteria 6439
250 Ga0111539_10066216 3300009094 Bacteria 4267
251 Ga0111539_10160346 3300009094 Bacteria 2631
252 Ga0111539_10523388 3300009094 Bacteria 1381
253 Ga0111539_10688438 3300009094 Bacteria 1190
254 Ga0111539_10821837 3300009094 Bacteria 1081
255 Ga0111539_11273803 3300009094 Unclassified 853
256 Ga0105245_10284861 3300009098 Bacteria 1616
257 Ga0105245_10458585 3300009098 Bacteria 1284
258 Ga0105245_10495012 3300009098 Bacteria 1238
259 Ga0105247_10586347 3300009101 Bacteria 825
260 Ga0114129_10006692 3300009147 Bacteria 16367
261 Ga0114129_10027033 3300009147 Bacteria 8124
262 Ga0114129_10047175 3300009147 Bacteria 6054
263 Ga0114129_10056412 3300009147 Bacteria 5502
264 Ga0114129_10113506 3300009147 Bacteria 3736
265 Ga0114129_10119695 3300009147 Unclassified 3626
266 Ga0114129_10314449 3300009147 Bacteria 2084
267 Ga0114129_10426833 3300009147 Bacteria 1742
268 Ga0114129_11327849 3300009147 Bacteria 890
269 Ga0114129_11421596 3300009147 Bacteria 855
270 Ga0105243_12561138 3300009148 Bacteria 550
271 Ga0105243_12976221 3300009148 Bacteria 514
272 Ga0105241_10411127 3300009174 Bacteria 1189
273 Ga0105241_10433630 3300009174 Bacteria 1159
274 Ga0105241_10441773 3300009174 Bacteria 1149
275 Ga0105242_11323259 3300009176 Bacteria 745
276 Ga0105248_10053811 3300009177 Unclassified 4515
277 Ga0105248_10088868 3300009177 Bacteria 3478
278 Ga0105248_10492110 3300009177 Bacteria 1382
279 Ga0105248_10639906 3300009177 Bacteria 1200
280 Ga0105248_11207319 3300009177 Bacteria 855
281 Ga0105248_12848248 3300009177 Bacteria 552
282 Ga0105249_10009621 3300009553 Bacteria 8469
283 Ga0105249_10561249 3300009553 Bacteria 1193
284 Ga0105249_11142216 3300009553 Bacteria 849
285 Ga0105249_11945873 3300009553 Bacteria 661
286 Ga0105239_10362092 3300010375 Bacteria 1638
287 Ga0105239_11280305 3300010375 Bacteria 846
288 Ga0105239_12040310 3300010375 Bacteria 666
289 Ga0105246_10637124 3300011119 Bacteria 926
290 Ga0105246_11507336 3300011119 Bacteria 632
291 Ga0157338_1042528 3300012515 Bacteria 624
292 Ga0157371_10134538 3300013102 Bacteria 1760
293 Ga0157374_10305256 3300013296 Bacteria 1575
294 Ga0157374_10884514 3300013296 Bacteria 911
295 Ga0163162_10020643 3300013306 Bacteria 6474
296 Ga0157375_10312607 3300013308 Bacteria 1735
297 Ga0157375_10605373 3300013308 Bacteria 1255
298 Ga0157375_10824339 3300013308 Unclassified 1075
299 Ga0157375_10862221 3300013308 Bacteria 1051
300 Ga0157375_11488889 3300013308 Unclassified 799
301 Ga0157375_11811433 3300013308 Bacteria 724
302 Ga0157375_12101770 3300013308 Bacteria 672
303 Ga0163163_10028559 3300014325 Bacteria 5359
304 Ga0163163_11989721 3300014325 Bacteria 641
305 Ga0157380_10009059 3300014326 Bacteria 7111
306 Ga0157380_10353703 3300014326 Bacteria 1376
307 Ga0157380_10459124 3300014326 Bacteria 1226
308 Ga0157380_11102614 3300014326 Bacteria 833
309 Ga0157380_12151191 3300014326 Bacteria 621
310 Ga0157377_10063672 3300014745 Bacteria 2113
311 Ga0157377_10112297 3300014745 Bacteria 1640
312 Ga0157377_10271730 3300014745 Bacteria 1107
313 Ga0157377_10564858 3300014745 Bacteria 806
314 Ga0157379_10098989 3300014968 Unclassified 2618
315 Ga0157376_10118985 3300014969 Unclassified 2338
316 Ga0157376_10591254 3300014969 Bacteria 1104
317 Ga0182007_10162590 3300015262 Bacteria 764
318 Ga0163161_10005023 3300017792 Bacteria 9202
319 Ga0163161_10074017 3300017792 Bacteria 2497
320 Ga0206356_11668982 3300020070 Bacteria 630
321 Ga0213876_10096876 3300021384 Bacteria 1563
322 Ga0207673_1069695 3300025290 Bacteria 502
323 Ga0207697_10000148 3300025315 Bacteria 34368
324 Ga0207697_10113994 3300025315 Bacteria 1159
325 Ga0207697_10434269 3300025315 Bacteria 582
326 Ga0207682_10010863 3300025893 Bacteria 3564
327 Ga0207688_10009342 3300025901 Bacteria 5346
328 Ga0207688_10127853 3300025901 Bacteria 1487
329 Ga0207688_10313555 3300025901 Bacteria 961
330 Ga0207688_10822880 3300025901 Bacteria 588
331 Ga0207680_10088741 3300025903 Bacteria 1961
332 Ga0207680_10694566 3300025903 Bacteria 729
333 Ga0207680_10789117 3300025903 Unclassified 681
334 Ga0207680_11087604 3300025903 Bacteria 572
335 Ga0207680_11297796 3300025903 Bacteria 518
336 Ga0207647_10234908 3300025904 Bacteria 1054
337 Ga0207647_10457862 3300025904 Bacteria 714
338 Ga0207647_10754970 3300025904 Bacteria 526
339 Ga0207645_10000577 3300025907 Bacteria 30396
340 Ga0207645_10007692 3300025907 Bacteria 7589
341 Ga0207643_10000648 3300025908 Bacteria 21726
342 Ga0207705_10867818 3300025909 Bacteria 699
343 Ga0207654_10133807 3300025911 Bacteria 1572
344 Ga0207654_11171981 3300025911 Bacteria 560
345 Ga0207660_10239588 3300025917 Bacteria 1429
346 Ga0207662_10006100 3300025918 Bacteria 6483
347 Ga0207662_10147541 3300025918 Unclassified 1494
348 Ga0207662_10222904 3300025918 Bacteria 1229
349 Ga0207662_10462808 3300025918 Bacteria 869
350 Ga0207662_10776714 3300025918 Bacteria 674
351 Ga0207649_10004041 3300025920 Bacteria 7988
352 Ga0207649_10058671 3300025920 Bacteria 2411
353 Ga0207646_10287923 3300025922 Bacteria 1484
354 Ga0207646_10634210 3300025922 Bacteria 958
355 Ga0207646_10794376 3300025922 Bacteria 843
356 Ga0207681_10021283 3300025923 Bacteria 4120
357 Ga0207681_10114958 3300025923 Bacteria 1964
358 Ga0207681_10243482 3300025923 Bacteria 1401
359 Ga0207650_10018434 3300025925 Bacteria 4898
360 Ga0207650_10278964 3300025925 Bacteria 1360
361 Ga0207650_10817640 3300025925 Bacteria 790
362 Ga0207650_11475658 3300025925 Bacteria 578
363 Ga0207659_10012767 3300025926 Bacteria 5362
364 Ga0207659_10020573 3300025926 Bacteria 4364
365 Ga0207659_10041949 3300025926 Bacteria 3206
366 Ga0207659_10078388 3300025926 Bacteria 2434
367 Ga0207659_10245899 3300025926 Unclassified 1449
368 Ga0207687_10304738 3300025927 Bacteria 1284
369 Ga0207644_10070628 3300025931 Bacteria 2553
370 Ga0207644_10435681 3300025931 Bacteria 1075
371 Ga0207644_10791260 3300025931 Bacteria 793
372 Ga0207690_10134713 3300025932 Unclassified 1812
373 Ga0207706_10003199 3300025933 Bacteria 15718
374 Ga0207706_10025129 3300025933 Bacteria 5340
375 Ga0207706_10077657 3300025933 Bacteria 2920
376 Ga0207706_10112236 3300025933 Bacteria 2398
377 Ga0207686_10167508 3300025934 Bacteria 1546
378 Ga0207709_10794371 3300025935 Bacteria 763
379 Ga0207670_10078603 3300025936 Bacteria 2301
380 Ga0207704_10034303 3300025938 Bacteria 2895
381 Ga0207704_10553942 3300025938 Bacteria 935
382 Ga0207704_11389759 3300025938 Bacteria 601
383 Ga0207704_11807844 3300025938 Bacteria 525
384 Ga0207691_10004463 3300025940 Bacteria 13556
385 Ga0207691_10016775 3300025940 Bacteria 6949
386 Ga0207691_10029052 3300025940 Bacteria 5172
387 Ga0207691_10050130 3300025940 Bacteria 3823
388 Ga0207691_10104982 3300025940 Bacteria 2517
389 Ga0207691_10151630 3300025940 Bacteria 2038
390 Ga0207691_10393097 3300025940 Bacteria 1183
391 Ga0207691_10436354 3300025940 Bacteria 1115
392 Ga0207711_10086861 3300025941 Bacteria 2743
393 Ga0207711_10391697 3300025941 Bacteria 1290
394 Ga0207711_11639216 3300025941 Bacteria 587
395 Ga0207689_10004461 3300025942 Bacteria 12691
396 Ga0207689_10185612 3300025942 Bacteria 1715
397 Ga0207689_10194303 3300025942 Bacteria 1674
398 Ga0207679_10014873 3300025945 Bacteria 5127
399 Ga0207679_10158168 3300025945 Bacteria 1852
400 Ga0207679_10551296 3300025945 Bacteria 1034
401 Ga0207679_10885407 3300025945 Bacteria 816
402 Ga0207667_11415276 3300025949 Bacteria 668
403 Ga0207667_12166823 3300025949 Bacteria 513
404 Ga0207651_10009746 3300025960 Bacteria 5280
405 Ga0207651_10049323 3300025960 Unclassified 2851
406 Ga0207651_10820065 3300025960 Unclassified 825
407 Ga0207651_10828169 3300025960 Bacteria 821
408 Ga0207712_10023764 3300025961 Bacteria 4050
409 Ga0207668_10147791 3300025972 Bacteria 1816
410 Ga0207668_10247360 3300025972 Bacteria 1446
411 Ga0207668_10983768 3300025972 Bacteria 753
412 Ga0207640_10322417 3300025981 Bacteria 1231
413 Ga0207658_10042378 3300025986 Bacteria 3302
414 Ga0207658_10048808 3300025986 Unclassified 3106
415 Ga0207677_10102152 3300026023 Unclassified 2113
416 Ga0207677_11216695 3300026023 Bacteria 690
417 Ga0207677_12180221 3300026023 Bacteria 515
418 Ga0207703_10064563 3300026035 Unclassified 3005
419 Ga0207703_10072197 3300026035 Bacteria 2853
420 Ga0207678_10784578 3300026067 Bacteria 841
421 Ga0207678_11017396 3300026067 Bacteria 733
422 Ga0207708_10014144 3300026075 Bacteria 5966
423 Ga0207708_10169075 3300026075 Bacteria 1730
424 Ga0207708_10663145 3300026075 Bacteria 889
425 Ga0207708_10732103 3300026075 Bacteria 848
426 Ga0207708_10764233 3300026075 Bacteria 830
427 Ga0207641_10017355 3300026088 Bacteria 5892
428 Ga0207641_11138043 3300026088 Bacteria 779
429 Ga0207641_11523724 3300026088 Bacteria 670
430 Ga0207648_10054986 3300026089 Bacteria 3475
431 Ga0207648_10501682 3300026089 Bacteria 1110
432 Ga0207648_10678294 3300026089 Bacteria 954
433 Ga0207648_10761178 3300026089 Bacteria 900
434 Ga0207648_11198608 3300026089 Bacteria 713
435 Ga0207676_10085399 3300026095 Unclassified 2576
436 Ga0207676_10111760 3300026095 Bacteria 2287
437 Ga0207676_10154691 3300026095 Bacteria 1979
438 Ga0207674_10297104 3300026116 Unclassified 1564
439 Ga0207675_100002044 3300026118 Bacteria 20130
440 Ga0207675_100418871 3300026118 Bacteria 1322
441 Ga0207675_100688824 3300026118 Bacteria 1030
442 Ga0207675_100689042 3300026118 Bacteria 1030
443 Ga0207675_101304202 3300026118 Bacteria 746
444 Ga0207683_10015895 3300026121 Bacteria 6410
445 Ga0207683_10261714 3300026121 Bacteria 1579
446 Ga0207683_10362000 3300026121 Bacteria 1332
447 Ga0207683_10774730 3300026121 Bacteria 890
448 Ga0207683_11128927 3300026121 Bacteria 727
449 Ga0207683_12078621 3300026121 Bacteria 516
450 Ga0207698_10015449 3300026142 Bacteria 5112
451 Ga0207698_10854418 3300026142 Bacteria 915
452 Ga0209973_1036971 3300027252 Bacteria 706
453 Ga0210000_1020829 3300027462 Bacteria 1002
454 Ga0209982_1012016 3300027552 Bacteria 1297
455 Ga0209970_1075853 3300027614 Bacteria 628
456 Ga0209971_1022927 3300027682 Unclassified 1488
457 Ga0209974_10232836 3300027876 Bacteria 689
458 Ga0209974_10240177 3300027876 Bacteria 679
459 Ga0207428_10004203 3300027907 Bacteria 13794
460 Ga0207428_10007408 3300027907 Bacteria 10004
461 Ga0207428_10045960 3300027907 Bacteria 3513
462 Ga0207428_10064071 3300027907 Bacteria 2903
463 Ga0207428_10315068 3300027907 Unclassified 1156
464 Ga0207428_10436704 3300027907 Bacteria 955
465 Ga0207428_10444322 3300027907 Bacteria 946
466 Ga0268266_10148985 3300028379 Bacteria 2107
467 Ga0268266_10451263 3300028379 Bacteria 1222
468 Ga0268265_10324676 3300028380 Bacteria 1395
469 Ga0268265_10334700 3300028380 Unclassified 1376
470 Ga0268264_10255994 3300028381 Bacteria 1628
471 Ga0268264_10458574 3300028381 Unclassified 1236
472 Ga0268264_12421181 3300028381 Unclassified 531
473 Ga0307408_100010714 3300031548 Bacteria 6048
474 Ga0307408_100023765 3300031548 Bacteria 4179
475 Ga0307408_100998094 3300031548 Bacteria 771
476 Ga0307408_101044651 3300031548 Bacteria 755
477 Ga0307405_10025301 3300031731 Bacteria 3405
478 Ga0307405_10537244 3300031731 Bacteria 944
479 Ga0307405_11680318 3300031731 Bacteria 562
480 Ga0307413_10027905 3300031824 Bacteria 3136
481 Ga0307413_11046453 3300031824 Bacteria 702
482 Ga0307410_10106421 3300031852 Bacteria 2021
483 Ga0307410_10216265 3300031852 Bacteria 1471
484 Ga0307406_10048622 3300031901 Bacteria 2680
485 Ga0307406_10454145 3300031901 Bacteria 1029
486 Ga0307407_10002294 3300031903 Bacteria 7420
487 Ga0307407_10046830 3300031903 Bacteria 2450
488 Ga0307412_10005218 3300031911 Bacteria 7282
489 Ga0307412_10360484 3300031911 Bacteria 1170
490 Ga0307412_11166788 3300031911 Bacteria 688
491 Ga0307409_100002648 3300031995 Bacteria 9425
492 Ga0307409_100003888 3300031995 Bacteria 8257
493 Ga0307409_100293628 3300031995 Bacteria 1508
494 Ga0307416_100004422 3300032002 Bacteria 8470
495 Ga0307416_100044033 3300032002 Bacteria 3501
496 Ga0307416_100503237 3300032002 Bacteria 1276
497 Ga0307416_100608615 3300032002 Bacteria 1173
498 Ga0307416_101691659 3300032002 Bacteria 737
499 Ga0307416_102358506 3300032002 Bacteria 632
500 Ga0307416_103530889 3300032002 Bacteria 523
501 Ga0307414_10173391 3300032004 Bacteria 1727
502 Ga0307414_10373728 3300032004 Bacteria 1230
503 Ga0307414_10505576 3300032004 Bacteria 1070
504 Ga0307411_10003618 3300032005 Bacteria 7220
505 Ga0307411_10060532 3300032005 Bacteria 2515
506 Ga0307411_11364967 3300032005 Bacteria 648
507 Ga0307415_100001588 3300032126 Bacteria 10961
508 Ga0373948_0020504 3300034817 Bacteria 1259
509 Ga0373958_0086997 3300034819 Bacteria 715
510 Ga0373934_0294081 3300035086 Bacteria 673
511 Ga0373951_0107860 3300035091 Bacteria 746
512 Ga0373936_0207943 3300035113 Bacteria 865
513 Ga0373955_0959760 3300035172 Bacteria 526
514 Ga0373961_0015803 3300035241 Unclassified 1936
515 Ga0373961_0099220 3300035241 Bacteria 941
516 Ga0373962_0008528 3300035242 Bacteria 2524
517 Ga0316574_0000540 3300035398 Bacteria 15560
518 Ga0373931_0085471 3300035691 Bacteria 1749
519 Ga0373935_0195581 3300035692 Bacteria 1395
520 Ga0373937_0471183 3300036401 Bacteria 1193
521 Ga0436365_1109499 3300039437 Bacteria 3884
522 Ga0439436_0153283 3300041404 Bacteria 650
523 Ga0439439_0022822 3300041406 Bacteria 1566
524 Ga0439453_0053654 3300041408 Bacteria 820
525 Ga0439461_0052299 3300041410 Bacteria 909
526 Ga0451800_1468674 3300041459 Bacteria 581
527 Ga0451845_0692508 3300041501 Bacteria 551
528 Ga0451855_1421513 3300041511 Bacteria 567
529 Ga0439433_0014349 3300041999 Bacteria 1744
530 Ga0439449_0045218 3300042007 Bacteria 1632
531 Ga0439450_105714 3300042008 Bacteria 717
532 Ga0439450_115530 3300042008 Bacteria 689
533 Ga0439455_0221034 3300042012 Bacteria 551
534 Ga0439457_121763 3300042014 Unclassified 617
535 Ga0439462_0135062 3300042015 Unclassified 690
536 Ga0439463_139423 3300042016 Bacteria 628
537 Ga0450920_033413 3300042122 Bacteria 1017
538 Ga0450923_011613 3300042125 Bacteria 1587
539 Ga0450897_045601 3300042128 Bacteria 522
540 Ga0450894_001525 3300042131 Bacteria 3295
541 Ga0450896_013722 3300042133 Bacteria 1154
542 Ga0450899_006866 3300042135 Bacteria 1236
543 Ga0439458_0177095 3300042157 Bacteria 578
544 Ga0450908_016885 3300042184 Bacteria 1299
545 Ga0450908_028462 3300042184 Bacteria 973
546 Ga0439434_0058985 3300042435 Bacteria 1198
547 Ga0439435_0029358 3300042436 Unclassified 1484
548 Ga0439435_0214630 3300042436 Bacteria 639
549 Ga0439444_0014234 3300042437 Bacteria 1328
550 Ga0439464_0012276 3300042439 Bacteria 2279
551 Ga0439460_0017292 3300042461 Bacteria 1931
552 Ga0450916_082719 3300042530 Bacteria 550
553 Ga0450918_086013 3300042531 Bacteria 604
554 Ga0439440_0046755 3300042993 Bacteria 1070
555 Ga0439440_0068143 3300042993 Bacteria 921
556 Ga0439440_0196329 3300042993 Unclassified 597
557 Ga0453684_0138397 3300044712 Bacteria 2912
558 Ga0451576_0168098 3300045051 Unclassified 2288
559 Ga0451576_0691529 3300045051 Bacteria 1072
560 Ga0495603_0009409 3300046455 Bacteria 5906
561 Ga0495585_0210084 3300046492 Unclassified 987
562 Ga0495644_0138006 3300046523 Bacteria 931
563 Ga0495652_0938978 3300046529 Bacteria 569
564 Ga0495598_0025338 3300046537 Bacteria 1617
565 Ga0495598_0359488 3300046537 Unclassified 562
566 Ga0495621_0012939 3300046539 Bacteria 2613
567 Ga0495621_0323520 3300046539 Bacteria 643
568 Ga0495667_0120663 3300046559 Bacteria 1693
569 Ga0495635_0442097 3300046663 Bacteria 860
570 Ga0495647_0128875 3300046681 Bacteria 1070
571 Ga0495647_0248656 3300046681 Bacteria 791
572 Ga0495647_0384309 3300046681 Bacteria 643
573 Ga0495658_0161680 3300046683 Unclassified 1381
574 Ga0495658_0163311 3300046683 Bacteria 1375
575 Ga0495658_0394566 3300046683 Bacteria 882
576 Ga0495613_0821395 3300046689 Bacteria 606
577 Ga0495624_0375054 3300046690 Bacteria 855
578 Ga0495676_0035493 3300047321 Bacteria 4169
579 Ga0496101_0157406 3300048904 Bacteria 1741
580 Ga0496101_1250024 3300048904 Bacteria 581
581 Ga0496102_1772011 3300048905 Bacteria 535
582 Ga0496103_0741961 3300048906 Bacteria 621
583 Ga0496104_0018955 3300048907 Bacteria 6285
584 Ga0496105_0068492 3300048908 Bacteria 2932
585 Ga0496105_0619673 3300048908 Bacteria 838
586 Ga0496106_1465036 3300048909 Bacteria 526
587 Ga0496108_0687187 3300048911 Bacteria 888
588 Ga0496109_0009469 3300048912 Bacteria 8305
589 Ga0496110_0050960 3300048913 Bacteria 3637
590 Ga0496110_0519699 3300048913 Bacteria 1083
591 Ga0496113_0477436 3300048916 Bacteria 1001
592 Ga0496114_0020501 3300048917 Bacteria 5365
593 Ga0496114_1116749 3300048917 Bacteria 673
594 Ga0496115_0402221 3300048918 Bacteria 1111
595 Ga0501031_0010734 3300049568 Bacteria 5967
596 Ga0501031_0023383 3300049568 Bacteria 4029
597 Ga0501031_0157403 3300049568 Bacteria 1485
598 Ga0501032_0005618 3300049569 Bacteria 9290
599 Ga0501032_0006127 3300049569 Bacteria 8858
600 Ga0501032_0219971 3300049569 Bacteria 1236
601 Ga0501033_0004378 3300049570 Bacteria 11319
602 Ga0501033_0111320 3300049570 Bacteria 1992
603 Ga0501034_0011197 3300049571 Bacteria 9312
604 Ga0501034_0338271 3300049571 Unclassified 1435
605 Ga0501036_0001297 3300049572 Bacteria 19150
606 Ga0501036_0017537 3300049572 Bacteria 5987
607 Ga0501036_0075889 3300049572 Bacteria 2843
608 Ga0501036_0412435 3300049572 Bacteria 1126
609 Ga0501037_0006772 3300049573 Bacteria 8375
610 Ga0501037_0009354 3300049573 Bacteria 7193
611 Ga0501038_0002744 3300049574 Bacteria 16406
612 Ga0501038_0021329 3300049574 Bacteria 5815
613 Ga0501038_0096331 3300049574 Bacteria 2471
614 Ga0501039_0014643 3300049575 Bacteria 6002
615 Ga0501039_0015444 3300049575 Bacteria 5845
616 Ga0501039_0095532 3300049575 Bacteria 2317
617 Ga0501040_0229575 3300049576 Bacteria 1321
618 Ga0501040_1169021 3300049576 Bacteria 558
619 Ga0501041_0053907 3300049577 Bacteria 2453
620 Ga0501042_0007620 3300049578 Bacteria 7103
621 Ga0501042_0018344 3300049578 Bacteria 4842
622 Ga0501042_0053525 3300049578 Bacteria 2879
623 Ga0501043_0088990 3300049579 Bacteria 2426
624 Ga0501043_0275587 3300049579 Unclassified 1291
625 Ga0501046_0003264 3300049580 Bacteria 14889
626 Ga0501046_0014788 3300049580 Bacteria 6571
627 Ga0501046_0370570 3300049580 Unclassified 1037
628 Ga0501047_0062272 3300049581 Bacteria 3598
629 Ga0501047_0361166 3300049581 Bacteria 1288
630 Ga0501047_0611300 3300049581 Bacteria 911
631 Ga0501048_0002137 3300049582 Bacteria 15063
632 Ga0501048_0018200 3300049582 Bacteria 5169
633 Ga0501048_0058291 3300049582 Bacteria 2737
634 Ga0501048_0085194 3300049582 Bacteria 2229
635 Ga0501067_0029741 3300049583 Bacteria 3027
636 Ga0501067_0056140 3300049583 Bacteria 2182
637 Ga0501068_0001911 3300049584 Bacteria 11077
638 Ga0501068_0651482 3300049584 Bacteria 687
639 Ga0501069_0001824 3300049585 Bacteria 10622
640 Ga0501069_0006550 3300049585 Bacteria 6090
641 Ga0501069_0567547 3300049585 Bacteria 680
642 Ga0501070_0008436 3300049586 Bacteria 8702
643 Ga0501070_0028638 3300049586 Bacteria 4671
644 Ga0501071_0012804 3300049587 Bacteria 5704
645 Ga0501071_0112603 3300049587 Bacteria 2012
646 Ga0501071_0735558 3300049587 Bacteria 760
647 Ga0501072_0052134 3300049588 Bacteria 3221
648 Ga0501072_0152215 3300049588 Bacteria 1844
649 Ga0501073_0003336 3300049589 Bacteria 12066
650 Ga0501073_0150028 3300049589 Unclassified 1615
651 Ga0501073_0810797 3300049589 Bacteria 645
652 Ga0501073_0997904 3300049589 Viruses 576
653 Ga0501074_0006773 3300049590 Bacteria 8270
654 Ga0501074_0211537 3300049590 Bacteria 1381
655 Ga0501075_0002772 3300049591 Bacteria 11744
656 Ga0501075_0073859 3300049591 Bacteria 2579
657 Ga0501075_0304786 3300049591 Bacteria 1214
658 Ga0501075_0402404 3300049591 Bacteria 1044
659 Ga0501075_0444107 3300049591 Bacteria 989
660 Ga0501076_0049675 3300049592 Bacteria 3318
661 Ga0501076_0135828 3300049592 Bacteria 1996
662 Ga0501076_0154132 3300049592 Bacteria 1870
663 Ga0501076_0275459 3300049592 Bacteria 1378
664 Ga0501077_0598311 3300049593 Bacteria 708
665 Ga0501233_224160 3300049668 Bacteria 556
666 Ga0501079_0000894 3300049741 Bacteria 20415
667 Ga0501079_0016945 3300049741 Bacteria 5566
668 Ga0501079_0031859 3300049741 Bacteria 4052
669 Ga0501079_0052684 3300049741 Bacteria 3140
670 Ga0501080_0003760 3300049742 Bacteria 13403
671 Ga0501080_0028173 3300049742 Bacteria 5223
672 Ga0501080_0054487 3300049742 Bacteria 3724
673 Ga0501081_0019001 3300049743 Bacteria 4570
674 Ga0501081_0032255 3300049743 Bacteria 3553
675 Ga0501083_0190369 3300049744 Bacteria 1339
676 Ga0501035_0029910 3300049822 Bacteria 4967
677 Ga0501035_0166617 3300049822 Bacteria 1905
678 Ga0501035_0623680 3300049822 Bacteria 876
679 Ga0501044_0031764 3300049823 Bacteria 5554
680 Ga0501044_0342210 3300049823 Bacteria 1416
681 Ga0501045_0014255 3300049824 Bacteria 5634
682 Ga0501045_0241539 3300049824 Bacteria 1344
683 Ga0501045_0244494 3300049824 Unclassified 1336
684 Ga0501045_0795806 3300049824 Bacteria 696
685 nmdc:mga03683_305711_c1 3300050489 Bacteria 747
686 nmdc:mga00v17_169911_c1 3300050491 Bacteria 1406
687 nmdc:mga0yw44_685417_c1 3300050492 Bacteria 696
688 nmdc:mga0k408_2583_c1 3300050493 Bacteria 9614
689 nmdc:mga05p37_1212421_c1 3300050507 Bacteria 778
690 nmdc:mga05p37_2629_c1 3300050507 Bacteria 20910
691 nmdc:mga05p37_315151_c1 3300050507 Unclassified 1853
692 nmdc:mga05p37_47196_c1 3300050507 Bacteria 5296
693 nmdc:mga05p37_569037_c1 3300050507 Bacteria 1286
694 nmdc:mga05p37_61488_c1 3300050507 Bacteria 4623
695 nmdc:mga05p37_785493_c1 3300050507 Bacteria 1044
696 nmdc:mga09592_11186_c1 3300050508 Bacteria 7302
697 nmdc:mga09592_1151_c1 3300050508 Bacteria 21071
698 nmdc:mga09592_21965_c1 3300050508 Bacteria 5264
699 nmdc:mga09592_680372_c1 3300050508 Bacteria 877
700 nmdc:mga09592_9057_c1 3300050508 Bacteria 8091
701 nmdc:mga09592_99836_c1 3300050508 Bacteria 2485
702 nmdc:mga0qj67_1199761_c1 3300050509 Bacteria 590
703 nmdc:mga0qj67_181061_c1 3300050509 Bacteria 1711
704 nmdc:mga0qj67_1855_c1 3300050509 Bacteria 14979
705 nmdc:mga0qj67_188001_c1 3300050509 Bacteria 1678
706 nmdc:mga0qj67_26899_c1 3300050509 Bacteria 4455
707 nmdc:mga0qj67_320955_c1 3300050509 Bacteria 1254
708 nmdc:mga0qj67_5906_c1 3300050509 Bacteria 8971
709 nmdc:mga0qj67_899_c1 3300050509 Bacteria 20433
710 nmdc:mga06r32_1105309_c1 3300050510 Bacteria 742
711 nmdc:mga06r32_11765_c1 3300050510 Bacteria 7879
712 nmdc:mga06r32_1217_c1 3300050510 Bacteria 23192
713 nmdc:mga06r32_159845_c1 3300050510 Bacteria 2235
714 nmdc:mga06r32_354352_c1 3300050510 Bacteria 1452
715 nmdc:mga06r32_50770_c1 3300050510 Bacteria 3967
716 nmdc:mga06r32_88110_c1 3300050510 Bacteria 3030
717 nmdc:mga08y16_207658_c1 3300050511 Unclassified 2029
718 nmdc:mga08y16_24666_c1 3300050511 Bacteria 6347
719 nmdc:mga08y16_30647_c1 3300050511 Bacteria 5659
720 nmdc:mga08y16_62014_c1 3300050511 Bacteria 3904
721 nmdc:mga08y16_738114_c1 3300050511 Bacteria 982
722 nmdc:mga08y16_87648_c1 3300050511 Bacteria 3243
723 nmdc:mga08y16_953_c1 3300050511 Bacteria 28127
724 nmdc:mga0n895_1256235_c1 3300050512 Bacteria 713
725 nmdc:mga0n895_1590872_c1 3300050512 Bacteria 618
726 nmdc:mga0n895_37083_c1 3300050512 Bacteria 4713
727 nmdc:mga0n895_5337_c1 3300050512 Bacteria 10710
728 nmdc:mga0rr50_167248_c1 3300050513 Unclassified 1789
729 nmdc:mga0a205_102698_c1 3300050515 Bacteria 2757
730 nmdc:mga0a205_14932_c1 3300050515 Bacteria 7247
731 nmdc:mga0a205_233_c1 3300050515 Bacteria 39247
732 nmdc:mga0a205_42735_c1 3300050515 Bacteria 4367
733 nmdc:mga0a205_656870_c1 3300050515 Bacteria 900
734 nmdc:mga0a205_99_c1 3300050515 Bacteria 49204
735 Ga0495601_0029307 3300053077 Bacteria 3413
736 Ga0495595_0144365 3300053084 Bacteria 1169
737 Ga0495619_0053906 3300053085 Bacteria 2661
738 Ga0501084_0007339 3300054114 Bacteria 9081
739 Ga0501084_0019618 3300054114 Bacteria 5633
740 Ga0501084_0037637 3300054114 Bacteria 4043
741 Ga0501084_0079823 3300054114 Bacteria 2743
742 Ga0501084_1570101 3300054114 Bacteria 550
743 Ga0590071_067361 3300059421 Bacteria 880
744 Ga0590071_095472 3300059421 Bacteria 746
745 Ga0590075_022471 3300059424 Bacteria 1578
746 Ga0590077_003880 3300059426 Bacteria 3083
747 Ga0501082_0002081 3300060353 Bacteria 17626
748 Ga0501082_0035816 3300060353 Bacteria 4278
749 Ga0501082_0069156 3300060353 Bacteria 3039
750 Ga0501082_0289949 3300060353 Bacteria 1425
751 Ga0530510_0119762 3300061734 Bacteria 1931
752 Ga0530510_0328277 3300061734 Bacteria 1147

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042184 Ga0450908_028462 Ga0450908_028462_640_957 105
2 3300035398 Ga0316574_0000540 Ga0316574_0000540_10852_11172 106
3 3300046455 Ga0495603_0009409 Ga0495603_0009409_125_445 106
4 3300046681 Ga0495647_0128875 Ga0495647_0128875_350_670 106
5 3300046683 Ga0495658_0161680 Ga0495658_0161680_115_435 106
6 3300046690 Ga0495624_0375054 Ga0495624_0375054_379_699 106
7 3300047321 Ga0495676_0035493 Ga0495676_0035493_3631_3951 106
8 3300041501 Ga0451845_0692508 Ga0451845_0692508_62_409 109
9 3300025940 Ga0207691_10151630 Ga0207691_101516302 110
10 3300005353 Ga0070669_101675941 Ga0070669_1016759412 112
11 3300005518 Ga0070699_101134414 Ga0070699_1011344142 112
12 3300027907 Ga0207428_10064071 Ga0207428_100640712 112
13 3300028381 Ga0268264_12421181 Ga0268264_124211811 112
14 3300044712 Ga0453684_0138397 Ga0453684_0138397_809_1159 112
15 3300005295 Ga0065707_10465592 Ga0065707_104655922 113
16 3300005328 Ga0070676_10923258 Ga0070676_109232582 113
17 3300005331 Ga0070670_100192771 Ga0070670_1001927713 113
18 3300005335 Ga0070666_10589738 Ga0070666_105897381 113
19 3300005338 Ga0068868_101460893 Ga0068868_1014608932 113
20 3300005367 Ga0070667_102147666 Ga0070667_1021476661 113
21 3300005457 Ga0070662_100040974 Ga0070662_1000409742 113
22 3300005466 Ga0070685_10149193 Ga0070685_101491933 113
23 3300005539 Ga0068853_100234936 Ga0068853_1002349361 113
24 3300005544 Ga0070686_100444526 Ga0070686_1004445262 113
25 3300005549 Ga0070704_100534883 Ga0070704_1005348832 113
26 3300005563 Ga0068855_101973065 Ga0068855_1019730651 113
27 3300005718 Ga0068866_10278757 Ga0068866_102787572 113
28 3300006163 Ga0070715_10484270 Ga0070715_104842701 113
29 3300006237 Ga0097621_100037091 Ga0097621_1000370914 113
30 3300006358 Ga0068871_100114587 Ga0068871_1001145872 113
31 3300006881 Ga0068865_100062515 Ga0068865_1000625152 113
32 3300006881 Ga0068865_100368917 Ga0068865_1003689172 113
33 3300009098 Ga0105245_10495012 Ga0105245_104950121 113
34 3300009101 Ga0105247_10586347 Ga0105247_105863472 113
35 3300009148 Ga0105243_12561138 Ga0105243_125611382 113
36 3300009174 Ga0105241_10433630 Ga0105241_104336302 113
37 3300009174 Ga0105241_10441773 Ga0105241_104417732 113
38 3300009177 Ga0105248_10088868 Ga0105248_100888682 113
39 3300009553 Ga0105249_11142216 Ga0105249_111422162 113
40 3300010375 Ga0105239_10362092 Ga0105239_103620923 113
41 3300013296 Ga0157374_10305256 Ga0157374_103052563 113
42 3300013296 Ga0157374_10884514 Ga0157374_108845141 113
43 3300013308 Ga0157375_10312607 Ga0157375_103126071 113
44 3300013308 Ga0157375_10605373 Ga0157375_106053732 113
45 3300014326 Ga0157380_10353703 Ga0157380_103537032 113
46 3300014326 Ga0157380_12151191 Ga0157380_121511911 113
47 3300014745 Ga0157377_10564858 Ga0157377_105648582 113
48 3300017792 Ga0163161_10005023 Ga0163161_100050238 113
49 3300025315 Ga0207697_10113994 Ga0207697_101139942 113
50 3300025903 Ga0207680_10694566 Ga0207680_106945662 113
51 3300025904 Ga0207647_10234908 Ga0207647_102349081 113
52 3300025904 Ga0207647_10457862 Ga0207647_104578622 113
53 3300025911 Ga0207654_10133807 Ga0207654_101338072 113
54 3300025911 Ga0207654_11171981 Ga0207654_111719811 113
55 3300025925 Ga0207650_10278964 Ga0207650_102789642 113
56 3300025933 Ga0207706_10025129 Ga0207706_100251295 113
57 3300025934 Ga0207686_10167508 Ga0207686_101675082 113
58 3300025938 Ga0207704_10553942 Ga0207704_105539422 113
59 3300025938 Ga0207704_11389759 Ga0207704_113897591 113
60 3300025941 Ga0207711_10086861 Ga0207711_100868612 113
61 3300025949 Ga0207667_12166823 Ga0207667_121668231 113
62 3300025972 Ga0207668_10147791 Ga0207668_101477912 113
63 3300026023 Ga0207677_11216695 Ga0207677_112166951 113
64 3300026067 Ga0207678_11017396 Ga0207678_110173962 113
65 3300036401 Ga0373937_0471183 Ga0373937_0471183_440_781 113
66 3300042015 Ga0439462_0135062 Ga0439462_0135062_90_431 113
67 3300042125 Ga0450923_011613 Ga0450923_011613_464_805 113
68 3300042128 Ga0450897_045601 Ga0450897_045601_77_418 113
69 3300042131 Ga0450894_001525 Ga0450894_001525_1646_1987 113
70 3300042133 Ga0450896_013722 Ga0450896_013722_690_1031 113
71 3300042135 Ga0450899_006866 Ga0450899_006866_611_952 113
72 3300042461 Ga0439460_0017292 Ga0439460_0017292_696_1037 113
73 3300046529 Ga0495652_0938978 Ga0495652_0938978_192_533 113
74 3300046681 Ga0495647_0384309 Ga0495647_0384309_242_583 113
75 3300046689 Ga0495613_0821395 Ga0495613_0821395_128_469 113
76 3300048904 Ga0496101_0157406 Ga0496101_0157406_1096_1437 113
77 3300048904 Ga0496101_1250024 Ga0496101_1250024_80_421 113
78 3300048907 Ga0496104_0018955 Ga0496104_0018955_3674_4015 113
79 3300048908 Ga0496105_0068492 Ga0496105_0068492_2302_2643 113
80 3300048913 Ga0496110_0050960 Ga0496110_0050960_1098_1439 113
81 3300048917 Ga0496114_0020501 Ga0496114_0020501_4663_5004 113
82 3300048917 Ga0496114_1116749 Ga0496114_1116749_282_623 113
83 3300048918 Ga0496115_0402221 Ga0496115_0402221_113_454 113
84 3300049568 Ga0501031_0010734 Ga0501031_0010734_4336_4677 113
85 3300049568 Ga0501031_0023383 Ga0501031_0023383_2835_3176 113
86 3300049569 Ga0501032_0005618 Ga0501032_0005618_7831_8172 113
87 3300049569 Ga0501032_0006127 Ga0501032_0006127_2856_3197 113
88 3300049570 Ga0501033_0004378 Ga0501033_0004378_906_1247 113
89 3300049570 Ga0501033_0111320 Ga0501033_0111320_1547_1888 113
90 3300049571 Ga0501034_0338271 Ga0501034_0338271_913_1254 113
91 3300049572 Ga0501036_0001297 Ga0501036_0001297_5842_6183 113
92 3300049572 Ga0501036_0017537 Ga0501036_0017537_4838_5179 113
93 3300049573 Ga0501037_0006772 Ga0501037_0006772_170_511 113
94 3300049573 Ga0501037_0009354 Ga0501037_0009354_4240_4581 113
95 3300049574 Ga0501038_0002744 Ga0501038_0002744_9846_10187 113
96 3300049574 Ga0501038_0021329 Ga0501038_0021329_4588_4929 113
97 3300049575 Ga0501039_0014643 Ga0501039_0014643_920_1261 113
98 3300049576 Ga0501040_1169021 Ga0501040_1169021_19_360 113
99 3300049578 Ga0501042_0007620 Ga0501042_0007620_4308_4649 113
100 3300049579 Ga0501043_0088990 Ga0501043_0088990_795_1136 113
101 3300049579 Ga0501043_0275587 Ga0501043_0275587_61_402 113
102 3300049580 Ga0501046_0003264 Ga0501046_0003264_6306_6647 113
103 3300049580 Ga0501046_0370570 Ga0501046_0370570_509_850 113
104 3300049581 Ga0501047_0062272 Ga0501047_0062272_238_579 113
105 3300049581 Ga0501047_0611300 Ga0501047_0611300_528_869 113
106 3300049582 Ga0501048_0002137 Ga0501048_0002137_8503_8844 113
107 3300049582 Ga0501048_0018200 Ga0501048_0018200_854_1195 113
108 3300049583 Ga0501067_0029741 Ga0501067_0029741_1681_2022 113
109 3300049583 Ga0501067_0056140 Ga0501067_0056140_1091_1432 113
110 3300049584 Ga0501068_0001911 Ga0501068_0001911_9550_9891 113
111 3300049584 Ga0501068_0651482 Ga0501068_0651482_149_490 113
112 3300049585 Ga0501069_0001824 Ga0501069_0001824_6434_6775 113
113 3300049585 Ga0501069_0006550 Ga0501069_0006550_3719_4060 113
114 3300049586 Ga0501070_0008436 Ga0501070_0008436_6085_6426 113
115 3300049586 Ga0501070_0028638 Ga0501070_0028638_913_1254 113
116 3300049587 Ga0501071_0012804 Ga0501071_0012804_4287_4628 113
117 3300049589 Ga0501073_0003336 Ga0501073_0003336_11613_11954 113
118 3300049589 Ga0501073_0150028 Ga0501073_0150028_885_1226 113
119 3300049590 Ga0501074_0006773 Ga0501074_0006773_5527_5868 113
120 3300049590 Ga0501074_0211537 Ga0501074_0211537_917_1258 113
121 3300049591 Ga0501075_0444107 Ga0501075_0444107_344_685 113
122 3300049592 Ga0501076_0275459 Ga0501076_0275459_291_632 113
123 3300049741 Ga0501079_0000894 Ga0501079_0000894_4566_4907 113
124 3300049741 Ga0501079_0016945 Ga0501079_0016945_4414_4755 113
125 3300049742 Ga0501080_0003760 Ga0501080_0003760_5487_5828 113
126 3300049742 Ga0501080_0028173 Ga0501080_0028173_2114_2455 113
127 3300049822 Ga0501035_0029910 Ga0501035_0029910_880_1221 113
128 3300049822 Ga0501035_0623680 Ga0501035_0623680_368_709 113
129 3300049823 Ga0501044_0031764 Ga0501044_0031764_1462_1803 113
130 3300049823 Ga0501044_0342210 Ga0501044_0342210_115_456 113
131 3300049824 Ga0501045_0244494 Ga0501045_0244494_768_1109 113
132 3300053077 Ga0495601_0029307 Ga0495601_0029307_2469_2810 113
133 3300053084 Ga0495595_0144365 Ga0495595_0144365_284_625 113
134 3300054114 Ga0501084_0019618 Ga0501084_0019618_861_1202 113
135 3300054114 Ga0501084_0037637 Ga0501084_0037637_2292_2633 113
136 3300060353 Ga0501082_0002081 Ga0501082_0002081_3778_4119 113
137 3300060353 Ga0501082_0069156 Ga0501082_0069156_2518_2859 113
138 2162886006 SwRhRL3b_contig_3700117 SwRhRL3b_0036.00001100 114
139 2162886012 MBSR1b_contig_2267242 MBSR1b_0761.00003570 114
140 3300001977 JGI24746J21847_1009684 JGI24746J21847_10096842 114
141 3300002070 JGI24750J21931_1019248 JGI24750J21931_10192481 114
142 3300003203 JGI25406J46586_10003224 JGI25406J46586_100032245 114
143 3300003203 JGI25406J46586_10023568 JGI25406J46586_100235682 114
144 3300005289 Ga0065704_10845341 Ga0065704_108453411 114
145 3300005290 Ga0065712_10068445 Ga0065712_100684459 114
146 3300005290 Ga0065712_10189133 Ga0065712_101891332 114
147 3300005290 Ga0065712_10416994 Ga0065712_104169942 114
148 3300005290 Ga0065712_10567759 Ga0065712_105677591 114
149 3300005293 Ga0065715_10153179 Ga0065715_101531794 114
150 3300005293 Ga0065715_10167581 Ga0065715_101675812 114
151 3300005293 Ga0065715_10375280 Ga0065715_103752802 114
152 3300005295 Ga0065707_10005475 Ga0065707_100054754 114
153 3300005295 Ga0065707_10108492 Ga0065707_101084921 114
154 3300005295 Ga0065707_10271876 Ga0065707_102718762 114
155 3300005295 Ga0065707_10284483 Ga0065707_102844832 114
156 3300005327 Ga0070658_10285570 Ga0070658_102855702 114
157 3300005328 Ga0070676_10030126 Ga0070676_100301262 114
158 3300005328 Ga0070676_10068970 Ga0070676_100689703 114
159 3300005328 Ga0070676_10087769 Ga0070676_100877692 114
160 3300005328 Ga0070676_10179577 Ga0070676_101795772 114
161 3300005330 Ga0070690_100009587 Ga0070690_1000095876 114
162 3300005330 Ga0070690_100054918 Ga0070690_1000549183 114
163 3300005330 Ga0070690_100264292 Ga0070690_1002642921 114
164 3300005330 Ga0070690_100388770 Ga0070690_1003887702 114
165 3300005330 Ga0070690_100621591 Ga0070690_1006215912 114
166 3300005330 Ga0070690_100980785 Ga0070690_1009807851 114
167 3300005331 Ga0070670_100004047 Ga0070670_1000040475 114
168 3300005331 Ga0070670_101878203 Ga0070670_1018782031 114
169 3300005333 Ga0070677_10029226 Ga0070677_100292264 114
170 3300005333 Ga0070677_10285652 Ga0070677_102856521 114
171 3300005333 Ga0070677_10492232 Ga0070677_104922321 114
172 3300005334 Ga0068869_100066722 Ga0068869_1000667222 114
173 3300005334 Ga0068869_100201816 Ga0068869_1002018162 114
174 3300005335 Ga0070666_10584095 Ga0070666_105840952 114
175 3300005336 Ga0070680_100196527 Ga0070680_1001965272 114
176 3300005336 Ga0070680_100769736 Ga0070680_1007697361 114
177 3300005338 Ga0068868_100092803 Ga0068868_1000928035 114
178 3300005338 Ga0068868_100226705 Ga0068868_1002267051 114
179 3300005339 Ga0070660_100899750 Ga0070660_1008997502 114
180 3300005340 Ga0070689_100011310 Ga0070689_1000113108 114
181 3300005340 Ga0070689_100081004 Ga0070689_1000810044 114
182 3300005340 Ga0070689_100148584 Ga0070689_1001485842 114
183 3300005340 Ga0070689_100273778 Ga0070689_1002737782 114
184 3300005340 Ga0070689_100338584 Ga0070689_1003385842 114
185 3300005341 Ga0070691_10224467 Ga0070691_102244671 114
186 3300005343 Ga0070687_100002850 Ga0070687_1000028505 114
187 3300005343 Ga0070687_101174784 Ga0070687_1011747841 114
188 3300005344 Ga0070661_100024630 Ga0070661_1000246305 114
189 3300005344 Ga0070661_100537523 Ga0070661_1005375232 114
190 3300005345 Ga0070692_10120613 Ga0070692_101206132 114
191 3300005345 Ga0070692_10234044 Ga0070692_102340442 114
192 3300005345 Ga0070692_10691611 Ga0070692_106916111 114
193 3300005347 Ga0070668_100043065 Ga0070668_1000430655 114
194 3300005347 Ga0070668_101020133 Ga0070668_1010201331 114
195 3300005353 Ga0070669_100004013 Ga0070669_10000401310 114
196 3300005353 Ga0070669_100353027 Ga0070669_1003530271 114
197 3300005353 Ga0070669_100353550 Ga0070669_1003535502 114
198 3300005353 Ga0070669_101373622 Ga0070669_1013736221 114
199 3300005354 Ga0070675_100000954 Ga0070675_10000095416 114
200 3300005354 Ga0070675_100011353 Ga0070675_1000113538 114
201 3300005354 Ga0070675_100031578 Ga0070675_1000315784 114
202 3300005354 Ga0070675_100074939 Ga0070675_1000749395 114
203 3300005354 Ga0070675_100179410 Ga0070675_1001794102 114
204 3300005354 Ga0070675_101407345 Ga0070675_1014073452 114
205 3300005354 Ga0070675_101423968 Ga0070675_1014239681 114
206 3300005355 Ga0070671_100047927 Ga0070671_1000479273 114
207 3300005355 Ga0070671_100159669 Ga0070671_1001596692 114
208 3300005355 Ga0070671_100186546 Ga0070671_1001865462 114
209 3300005356 Ga0070674_101775519 Ga0070674_1017755191 114
210 3300005364 Ga0070673_100005401 Ga0070673_1000054016 114
211 3300005364 Ga0070673_100008933 Ga0070673_1000089333 114
212 3300005364 Ga0070673_100009507 Ga0070673_1000095079 114
213 3300005364 Ga0070673_100730979 Ga0070673_1007309791 114
214 3300005365 Ga0070688_100024757 Ga0070688_1000247573 114
215 3300005365 Ga0070688_100069382 Ga0070688_1000693823 114
216 3300005365 Ga0070688_100077561 Ga0070688_1000775613 114
217 3300005365 Ga0070688_101291562 Ga0070688_1012915621 114
218 3300005366 Ga0070659_100066788 Ga0070659_1000667881 114
219 3300005366 Ga0070659_100385644 Ga0070659_1003856442 114
220 3300005367 Ga0070667_100052390 Ga0070667_1000523903 114
221 3300005367 Ga0070667_101030460 Ga0070667_1010304602 114
222 3300005438 Ga0070701_10034413 Ga0070701_100344131 114
223 3300005438 Ga0070701_10281094 Ga0070701_102810942 114
224 3300005440 Ga0070705_100397678 Ga0070705_1003976782 114
225 3300005440 Ga0070705_100934581 Ga0070705_1009345812 114
226 3300005441 Ga0070700_100027258 Ga0070700_1000272585 114
227 3300005441 Ga0070700_100511953 Ga0070700_1005119532 114
228 3300005441 Ga0070700_100525160 Ga0070700_1005251601 114
229 3300005445 Ga0070708_101211310 Ga0070708_1012113101 114
230 3300005455 Ga0070663_100660547 Ga0070663_1006605472 114
231 3300005455 Ga0070663_101658324 Ga0070663_1016583241 114
232 3300005456 Ga0070678_100023931 Ga0070678_1000239315 114
233 3300005456 Ga0070678_100230091 Ga0070678_1002300912 114
234 3300005456 Ga0070678_100316544 Ga0070678_1003165442 114
235 3300005456 Ga0070678_100601196 Ga0070678_1006011962 114
236 3300005456 Ga0070678_100771407 Ga0070678_1007714072 114
237 3300005457 Ga0070662_100004759 Ga0070662_10000475910 114
238 3300005459 Ga0068867_100061160 Ga0068867_1000611604 114
239 3300005459 Ga0068867_100126399 Ga0068867_1001263992 114
240 3300005459 Ga0068867_100749617 Ga0068867_1007496172 114
241 3300005459 Ga0068867_101200470 Ga0068867_1012004701 114
242 3300005459 Ga0068867_102004770 Ga0068867_1020047701 114
243 3300005466 Ga0070685_10029005 Ga0070685_100290054 114
244 3300005466 Ga0070685_10079208 Ga0070685_100792083 114
245 3300005468 Ga0070707_100267452 Ga0070707_1002674522 114
246 3300005468 Ga0070707_100497606 Ga0070707_1004976061 114
247 3300005471 Ga0070698_100253844 Ga0070698_1002538441 114
248 3300005518 Ga0070699_100021687 Ga0070699_1000216876 114
249 3300005518 Ga0070699_100935455 Ga0070699_1009354551 114
250 3300005535 Ga0070684_100608731 Ga0070684_1006087311 114
251 3300005535 Ga0070684_100620281 Ga0070684_1006202812 114
252 3300005543 Ga0070672_100004271 Ga0070672_10000427110 114
253 3300005543 Ga0070672_100009212 Ga0070672_1000092129 114
254 3300005543 Ga0070672_100050131 Ga0070672_1000501312 114
255 3300005543 Ga0070672_100086254 Ga0070672_1000862543 114
256 3300005543 Ga0070672_100128254 Ga0070672_1001282543 114
257 3300005543 Ga0070672_100292164 Ga0070672_1002921641 114
258 3300005543 Ga0070672_100292685 Ga0070672_1002926852 114
259 3300005544 Ga0070686_100033415 Ga0070686_1000334153 114
260 3300005544 Ga0070686_100036889 Ga0070686_1000368892 114
261 3300005544 Ga0070686_100047742 Ga0070686_1000477422 114
262 3300005544 Ga0070686_100290870 Ga0070686_1002908702 114
263 3300005545 Ga0070695_100124874 Ga0070695_1001248743 114
264 3300005545 Ga0070695_100688767 Ga0070695_1006887672 114
265 3300005546 Ga0070696_100201191 Ga0070696_1002011912 114
266 3300005547 Ga0070693_100022486 Ga0070693_1000224863 114
267 3300005548 Ga0070665_100130869 Ga0070665_1001308695 114
268 3300005549 Ga0070704_100485040 Ga0070704_1004850402 114
269 3300005549 Ga0070704_100494603 Ga0070704_1004946032 114
270 3300005549 Ga0070704_101850060 Ga0070704_1018500601 114
271 3300005564 Ga0070664_100016473 Ga0070664_1000164737 114
272 3300005564 Ga0070664_100123324 Ga0070664_1001233242 114
273 3300005564 Ga0070664_100157183 Ga0070664_1001571833 114
274 3300005564 Ga0070664_100453362 Ga0070664_1004533622 114
275 3300005564 Ga0070664_101059385 Ga0070664_1010593851 114
276 3300005564 Ga0070664_102085364 Ga0070664_1020853641 114
277 3300005564 Ga0070664_102316587 Ga0070664_1023165871 114
278 3300005577 Ga0068857_100405063 Ga0068857_1004050631 114
279 3300005578 Ga0068854_100070417 Ga0068854_1000704173 114
280 3300005615 Ga0070702_100050594 Ga0070702_1000505944 114
281 3300005616 Ga0068852_100021108 Ga0068852_1000211083 114
282 3300005616 Ga0068852_100241352 Ga0068852_1002413522 114
283 3300005616 Ga0068852_100429962 Ga0068852_1004299622 114
284 3300005617 Ga0068859_100001104 Ga0068859_1000011049 114
285 3300005617 Ga0068859_100047654 Ga0068859_1000476542 114
286 3300005617 Ga0068859_100073232 Ga0068859_1000732323 114
287 3300005617 Ga0068859_100119097 Ga0068859_1001190974 114
288 3300005617 Ga0068859_100168159 Ga0068859_1001681593 114
289 3300005617 Ga0068859_101615066 Ga0068859_1016150661 114
290 3300005618 Ga0068864_100005659 Ga0068864_1000056593 114
291 3300005618 Ga0068864_100163792 Ga0068864_1001637923 114
292 3300005618 Ga0068864_100450538 Ga0068864_1004505382 114
293 3300005718 Ga0068866_10163468 Ga0068866_101634682 114
294 3300005719 Ga0068861_100033352 Ga0068861_1000333526 114
295 3300005719 Ga0068861_100625816 Ga0068861_1006258161 114
296 3300005840 Ga0068870_10000334 Ga0068870_1000033410 114
297 3300005840 Ga0068870_10199174 Ga0068870_101991742 114
298 3300005841 Ga0068863_100032173 Ga0068863_1000321735 114
299 3300005841 Ga0068863_102107524 Ga0068863_1021075242 114
300 3300005842 Ga0068858_100041332 Ga0068858_1000413325 114
301 3300005842 Ga0068858_100222130 Ga0068858_1002221302 114
302 3300005843 Ga0068860_100033706 Ga0068860_1000337065 114
303 3300005843 Ga0068860_100188391 Ga0068860_1001883913 114
304 3300005844 Ga0068862_100007352 Ga0068862_1000073527 114
305 3300005844 Ga0068862_100387230 Ga0068862_1003872301 114
306 3300005844 Ga0068862_100440749 Ga0068862_1004407492 114
307 3300005844 Ga0068862_100966126 Ga0068862_1009661262 114
308 3300005844 Ga0068862_101370880 Ga0068862_1013708801 114
309 3300005985 Ga0081539_10000024 Ga0081539_10000024206 114
310 3300005985 Ga0081539_10003877 Ga0081539_100038776 114
311 3300006051 Ga0075364_10001941 Ga0075364_100019415 114
312 3300006051 Ga0075364_10262427 Ga0075364_102624272 114
313 3300006177 Ga0075362_10001991 Ga0075362_100019911 114
314 3300006178 Ga0075367_11103569 Ga0075367_111035691 114
315 3300006194 Ga0075427_10042471 Ga0075427_100424712 114
316 3300006195 Ga0075366_10029394 Ga0075366_100293942 114
317 3300006195 Ga0075366_10576309 Ga0075366_105763092 114
318 3300006358 Ga0068871_100058513 Ga0068871_1000585132 114
319 3300006358 Ga0068871_100083349 Ga0068871_1000833493 114
320 3300006844 Ga0075428_100001946 Ga0075428_10000194618 114
321 3300006844 Ga0075428_100014804 Ga0075428_1000148044 114
322 3300006844 Ga0075428_100031002 Ga0075428_1000310024 114
323 3300006844 Ga0075428_100214990 Ga0075428_1002149903 114
324 3300006844 Ga0075428_100257040 Ga0075428_1002570402 114
325 3300006846 Ga0075430_100000495 Ga0075430_10000049511 114
326 3300006846 Ga0075430_100002007 Ga0075430_1000020075 114
327 3300006846 Ga0075430_100029756 Ga0075430_1000297562 114
328 3300006846 Ga0075430_100059918 Ga0075430_1000599185 114
329 3300006846 Ga0075430_100447719 Ga0075430_1004477192 114
330 3300006846 Ga0075430_101476568 Ga0075430_1014765681 114
331 3300006847 Ga0075431_100000501 Ga0075431_10000050118 114
332 3300006847 Ga0075431_100018901 Ga0075431_1000189015 114
333 3300006847 Ga0075431_100033557 Ga0075431_1000335576 114
334 3300006847 Ga0075431_100121049 Ga0075431_1001210493 114
335 3300006847 Ga0075431_101086657 Ga0075431_1010866572 114
336 3300006852 Ga0075433_10001923 Ga0075433_1000192312 114
337 3300006852 Ga0075433_10002593 Ga0075433_100025937 114
338 3300006852 Ga0075433_10305399 Ga0075433_103053991 114
339 3300006852 Ga0075433_10492197 Ga0075433_104921972 114
340 3300006852 Ga0075433_10784131 Ga0075433_107841312 114
341 3300006852 Ga0075433_11159450 Ga0075433_111594502 114
342 3300006871 Ga0075434_100000863 Ga0075434_10000086313 114
343 3300006871 Ga0075434_100002413 Ga0075434_1000024135 114
344 3300006871 Ga0075434_100003202 Ga0075434_1000032027 114
345 3300006871 Ga0075434_100086925 Ga0075434_1000869253 114
346 3300006871 Ga0075434_100157985 Ga0075434_1001579853 114
347 3300006871 Ga0075434_102084094 Ga0075434_1020840941 114
348 3300006880 Ga0075429_100006308 Ga0075429_10000630810 114
349 3300006880 Ga0075429_100006683 Ga0075429_1000066834 114
350 3300006880 Ga0075429_100008978 Ga0075429_1000089787 114
351 3300006880 Ga0075429_100033178 Ga0075429_1000331783 114
352 3300006880 Ga0075429_100701528 Ga0075429_1007015282 114
353 3300006881 Ga0068865_100033914 Ga0068865_1000339145 114
354 3300006881 Ga0068865_100100535 Ga0068865_1001005353 114
355 3300006881 Ga0068865_101538371 Ga0068865_1015383711 114
356 3300006931 Ga0097620_100001104 Ga0097620_10000110418 114
357 3300006931 Ga0097620_100047654 Ga0097620_1000476545 114
358 3300006931 Ga0097620_100073234 Ga0097620_1000732343 114
359 3300006931 Ga0097620_100119087 Ga0097620_1001190874 114
360 3300006931 Ga0097620_100168175 Ga0097620_1001681752 114
361 3300006931 Ga0097620_101615130 Ga0097620_1016151301 114
362 3300007076 Ga0075435_100011881 Ga0075435_1000118815 114
363 3300009011 Ga0105251_10320868 Ga0105251_103208682 114
364 3300009094 Ga0111539_10000390 Ga0111539_1000039029 114
365 3300009094 Ga0111539_10004477 Ga0111539_1000447721 114
366 3300009094 Ga0111539_10031520 Ga0111539_100315209 114
367 3300009094 Ga0111539_10066216 Ga0111539_100662164 114
368 3300009094 Ga0111539_10160346 Ga0111539_101603463 114
369 3300009094 Ga0111539_10523388 Ga0111539_105233882 114
370 3300009094 Ga0111539_10688438 Ga0111539_106884382 114
371 3300009094 Ga0111539_10821837 Ga0111539_108218372 114
372 3300009094 Ga0111539_11273803 Ga0111539_112738032 114
373 3300009098 Ga0105245_10284861 Ga0105245_102848613 114
374 3300009098 Ga0105245_10458585 Ga0105245_104585853 114
375 3300009147 Ga0114129_10006692 Ga0114129_100066927 114
376 3300009147 Ga0114129_10027033 Ga0114129_100270339 114
377 3300009147 Ga0114129_10047175 Ga0114129_100471754 114
378 3300009147 Ga0114129_10056412 Ga0114129_100564124 114
379 3300009147 Ga0114129_10113506 Ga0114129_101135064 114
380 3300009147 Ga0114129_10119695 Ga0114129_101196952 114
381 3300009147 Ga0114129_10314449 Ga0114129_103144492 114
382 3300009147 Ga0114129_10426833 Ga0114129_104268332 114
383 3300009147 Ga0114129_11327849 Ga0114129_113278492 114
384 3300009147 Ga0114129_11421596 Ga0114129_114215962 114
385 3300009148 Ga0105243_12976221 Ga0105243_129762211 114
386 3300009174 Ga0105241_10411127 Ga0105241_104111272 114
387 3300009176 Ga0105242_11323259 Ga0105242_113232592 114
388 3300009177 Ga0105248_10053811 Ga0105248_100538112 114
389 3300009177 Ga0105248_10492110 Ga0105248_104921102 114
390 3300009177 Ga0105248_10639906 Ga0105248_106399062 114
391 3300009177 Ga0105248_11207319 Ga0105248_112073192 114
392 3300009177 Ga0105248_12848248 Ga0105248_128482481 114
393 3300009553 Ga0105249_10009621 Ga0105249_1000962110 114
394 3300009553 Ga0105249_10561249 Ga0105249_105612492 114
395 3300009553 Ga0105249_11945873 Ga0105249_119458732 114
396 3300010375 Ga0105239_11280305 Ga0105239_112803052 114
397 3300010375 Ga0105239_12040310 Ga0105239_120403102 114
398 3300011119 Ga0105246_10637124 Ga0105246_106371242 114
399 3300011119 Ga0105246_11507336 Ga0105246_115073361 114
400 3300012515 Ga0157338_1042528 Ga0157338_10425282 114
401 3300013102 Ga0157371_10134538 Ga0157371_101345383 114
402 3300013306 Ga0163162_10020643 Ga0163162_100206436 114
403 3300013308 Ga0157375_10824339 Ga0157375_108243392 114
404 3300013308 Ga0157375_10862221 Ga0157375_108622212 114
405 3300013308 Ga0157375_11488889 Ga0157375_114888892 114
406 3300013308 Ga0157375_11811433 Ga0157375_118114332 114
407 3300013308 Ga0157375_12101770 Ga0157375_121017701 114
408 3300014325 Ga0163163_10028559 Ga0163163_100285593 114
409 3300014325 Ga0163163_11989721 Ga0163163_119897212 114
410 3300014326 Ga0157380_10009059 Ga0157380_100090593 114
411 3300014326 Ga0157380_10459124 Ga0157380_104591241 114
412 3300014326 Ga0157380_11102614 Ga0157380_111026142 114
413 3300014745 Ga0157377_10063672 Ga0157377_100636723 114
414 3300014745 Ga0157377_10112297 Ga0157377_101122972 114
415 3300014745 Ga0157377_10271730 Ga0157377_102717302 114
416 3300014968 Ga0157379_10098989 Ga0157379_100989893 114
417 3300014969 Ga0157376_10118985 Ga0157376_101189855 114
418 3300014969 Ga0157376_10591254 Ga0157376_105912541 114
419 3300015262 Ga0182007_10162590 Ga0182007_101625902 114
420 3300017792 Ga0163161_10074017 Ga0163161_100740173 114
421 3300020070 Ga0206356_11668982 Ga0206356_116689822 114
422 3300021384 Ga0213876_10096876 Ga0213876_100968762 114
423 3300025290 Ga0207673_1069695 Ga0207673_10696951 114
424 3300025315 Ga0207697_10000148 Ga0207697_1000014818 114
425 3300025315 Ga0207697_10434269 Ga0207697_104342692 114
426 3300025893 Ga0207682_10010863 Ga0207682_100108633 114
427 3300025901 Ga0207688_10009342 Ga0207688_100093424 114
428 3300025901 Ga0207688_10127853 Ga0207688_101278532 114
429 3300025901 Ga0207688_10313555 Ga0207688_103135552 114
430 3300025901 Ga0207688_10822880 Ga0207688_108228801 114
431 3300025903 Ga0207680_10088741 Ga0207680_100887413 114
432 3300025903 Ga0207680_10789117 Ga0207680_107891171 114
433 3300025903 Ga0207680_11087604 Ga0207680_110876042 114
434 3300025903 Ga0207680_11297796 Ga0207680_112977962 114
435 3300025904 Ga0207647_10754970 Ga0207647_107549701 114
436 3300025907 Ga0207645_10000577 Ga0207645_1000057715 114
437 3300025907 Ga0207645_10007692 Ga0207645_100076922 114
438 3300025908 Ga0207643_10000648 Ga0207643_100006486 114
439 3300025909 Ga0207705_10867818 Ga0207705_108678181 114
440 3300025917 Ga0207660_10239588 Ga0207660_102395882 114
441 3300025918 Ga0207662_10006100 Ga0207662_100061006 114
442 3300025918 Ga0207662_10147541 Ga0207662_101475413 114
443 3300025918 Ga0207662_10222904 Ga0207662_102229042 114
444 3300025918 Ga0207662_10462808 Ga0207662_104628082 114
445 3300025918 Ga0207662_10776714 Ga0207662_107767142 114
446 3300025920 Ga0207649_10004041 Ga0207649_100040413 114
447 3300025920 Ga0207649_10058671 Ga0207649_100586711 114
448 3300025922 Ga0207646_10287923 Ga0207646_102879232 114
449 3300025922 Ga0207646_10634210 Ga0207646_106342101 114
450 3300025922 Ga0207646_10794376 Ga0207646_107943761 114
451 3300025923 Ga0207681_10021283 Ga0207681_100212832 114
452 3300025923 Ga0207681_10114958 Ga0207681_101149583 114
453 3300025923 Ga0207681_10243482 Ga0207681_102434822 114
454 3300025925 Ga0207650_10018434 Ga0207650_100184342 114
455 3300025925 Ga0207650_10817640 Ga0207650_108176402 114
456 3300025925 Ga0207650_11475658 Ga0207650_114756581 114
457 3300025926 Ga0207659_10012767 Ga0207659_100127676 114
458 3300025926 Ga0207659_10020573 Ga0207659_100205733 114
459 3300025926 Ga0207659_10041949 Ga0207659_100419493 114
460 3300025926 Ga0207659_10078388 Ga0207659_100783881 114
461 3300025926 Ga0207659_10245899 Ga0207659_102458992 114
462 3300025927 Ga0207687_10304738 Ga0207687_103047383 114
463 3300025931 Ga0207644_10070628 Ga0207644_100706283 114
464 3300025931 Ga0207644_10435681 Ga0207644_104356812 114
465 3300025931 Ga0207644_10791260 Ga0207644_107912602 114
466 3300025932 Ga0207690_10134713 Ga0207690_101347132 114
467 3300025933 Ga0207706_10003199 Ga0207706_100031992 114
468 3300025933 Ga0207706_10077657 Ga0207706_100776572 114
469 3300025933 Ga0207706_10112236 Ga0207706_101122363 114
470 3300025935 Ga0207709_10794371 Ga0207709_107943712 114
471 3300025936 Ga0207670_10078603 Ga0207670_100786032 114
472 3300025938 Ga0207704_10034303 Ga0207704_100343032 114
473 3300025938 Ga0207704_11807844 Ga0207704_118078441 114
474 3300025940 Ga0207691_10004463 Ga0207691_100044633 114
475 3300025940 Ga0207691_10016775 Ga0207691_1001677510 114
476 3300025940 Ga0207691_10029052 Ga0207691_100290525 114
477 3300025940 Ga0207691_10050130 Ga0207691_100501302 114
478 3300025940 Ga0207691_10104982 Ga0207691_101049823 114
479 3300025940 Ga0207691_10393097 Ga0207691_103930972 114
480 3300025940 Ga0207691_10436354 Ga0207691_104363542 114
481 3300025941 Ga0207711_10391697 Ga0207711_103916972 114
482 3300025941 Ga0207711_11639216 Ga0207711_116392161 114
483 3300025942 Ga0207689_10004461 Ga0207689_1000446112 114
484 3300025942 Ga0207689_10185612 Ga0207689_101856122 114
485 3300025942 Ga0207689_10194303 Ga0207689_101943032 114
486 3300025945 Ga0207679_10014873 Ga0207679_100148737 114
487 3300025945 Ga0207679_10158168 Ga0207679_101581683 114
488 3300025945 Ga0207679_10551296 Ga0207679_105512962 114
489 3300025945 Ga0207679_10885407 Ga0207679_108854072 114
490 3300025949 Ga0207667_11415276 Ga0207667_114152761 114
491 3300025960 Ga0207651_10009746 Ga0207651_100097467 114
492 3300025960 Ga0207651_10049323 Ga0207651_100493235 114
493 3300025960 Ga0207651_10820065 Ga0207651_108200652 114
494 3300025960 Ga0207651_10828169 Ga0207651_108281692 114
495 3300025961 Ga0207712_10023764 Ga0207712_100237643 114
496 3300025972 Ga0207668_10247360 Ga0207668_102473602 114
497 3300025972 Ga0207668_10983768 Ga0207668_109837681 114
498 3300025981 Ga0207640_10322417 Ga0207640_103224172 114
499 3300025986 Ga0207658_10042378 Ga0207658_100423783 114
500 3300025986 Ga0207658_10048808 Ga0207658_100488083 114
501 3300026023 Ga0207677_10102152 Ga0207677_101021523 114
502 3300026023 Ga0207677_12180221 Ga0207677_121802211 114
503 3300026035 Ga0207703_10064563 Ga0207703_100645633 114
504 3300026035 Ga0207703_10072197 Ga0207703_100721972 114
505 3300026067 Ga0207678_10784578 Ga0207678_107845781 114
506 3300026075 Ga0207708_10014144 Ga0207708_100141442 114
507 3300026075 Ga0207708_10169075 Ga0207708_101690751 114
508 3300026075 Ga0207708_10663145 Ga0207708_106631452 114
509 3300026075 Ga0207708_10732103 Ga0207708_107321032 114
510 3300026075 Ga0207708_10764233 Ga0207708_107642331 114
511 3300026088 Ga0207641_10017355 Ga0207641_100173554 114
512 3300026088 Ga0207641_11138043 Ga0207641_111380432 114
513 3300026088 Ga0207641_11523724 Ga0207641_115237241 114
514 3300026089 Ga0207648_10054986 Ga0207648_100549861 114
515 3300026089 Ga0207648_10501682 Ga0207648_105016822 114
516 3300026089 Ga0207648_10678294 Ga0207648_106782941 114
517 3300026089 Ga0207648_10761178 Ga0207648_107611782 114
518 3300026089 Ga0207648_11198608 Ga0207648_111986082 114
519 3300026095 Ga0207676_10085399 Ga0207676_100853993 114
520 3300026095 Ga0207676_10111760 Ga0207676_101117603 114
521 3300026095 Ga0207676_10154691 Ga0207676_101546912 114
522 3300026116 Ga0207674_10297104 Ga0207674_102971041 114
523 3300026118 Ga0207675_100002044 Ga0207675_1000020446 114
524 3300026118 Ga0207675_100418871 Ga0207675_1004188713 114
525 3300026118 Ga0207675_100688824 Ga0207675_1006888242 114
526 3300026118 Ga0207675_100689042 Ga0207675_1006890421 114
527 3300026118 Ga0207675_101304202 Ga0207675_1013042022 114
528 3300026121 Ga0207683_10015895 Ga0207683_100158953 114
529 3300026121 Ga0207683_10261714 Ga0207683_102617142 114
530 3300026121 Ga0207683_10362000 Ga0207683_103620002 114
531 3300026121 Ga0207683_10774730 Ga0207683_107747301 114
532 3300026121 Ga0207683_11128927 Ga0207683_111289272 114
533 3300026121 Ga0207683_12078621 Ga0207683_120786212 114
534 3300026142 Ga0207698_10015449 Ga0207698_100154496 114
535 3300026142 Ga0207698_10854418 Ga0207698_108544182 114
536 3300027252 Ga0209973_1036971 Ga0209973_10369711 114
537 3300027462 Ga0210000_1020829 Ga0210000_10208292 114
538 3300027552 Ga0209982_1012016 Ga0209982_10120163 114
539 3300027614 Ga0209970_1075853 Ga0209970_10758532 114
540 3300027682 Ga0209971_1022927 Ga0209971_10229271 114
541 3300027876 Ga0209974_10232836 Ga0209974_102328361 114
542 3300027876 Ga0209974_10240177 Ga0209974_102401772 114
543 3300027907 Ga0207428_10004203 Ga0207428_100042036 114
544 3300027907 Ga0207428_10007408 Ga0207428_100074087 114
545 3300027907 Ga0207428_10045960 Ga0207428_100459602 114
546 3300027907 Ga0207428_10315068 Ga0207428_103150682 114
547 3300027907 Ga0207428_10436704 Ga0207428_104367042 114
548 3300027907 Ga0207428_10444322 Ga0207428_104443222 114
549 3300028379 Ga0268266_10148985 Ga0268266_101489851 114
550 3300028379 Ga0268266_10451263 Ga0268266_104512632 114
551 3300028380 Ga0268265_10324676 Ga0268265_103246763 114
552 3300028380 Ga0268265_10334700 Ga0268265_103347002 114
553 3300028381 Ga0268264_10255994 Ga0268264_102559943 114
554 3300028381 Ga0268264_10458574 Ga0268264_104585741 114
555 3300031548 Ga0307408_100010714 Ga0307408_1000107142 114
556 3300031548 Ga0307408_100023765 Ga0307408_1000237653 114
557 3300031548 Ga0307408_100998094 Ga0307408_1009980942 114
558 3300031548 Ga0307408_101044651 Ga0307408_1010446512 114
559 3300031731 Ga0307405_10025301 Ga0307405_100253013 114
560 3300031731 Ga0307405_10537244 Ga0307405_105372442 114
561 3300031731 Ga0307405_11680318 Ga0307405_116803182 114
562 3300031824 Ga0307413_10027905 Ga0307413_100279053 114
563 3300031824 Ga0307413_11046453 Ga0307413_110464532 114
564 3300031852 Ga0307410_10106421 Ga0307410_101064212 114
565 3300031852 Ga0307410_10216265 Ga0307410_102162651 114
566 3300031901 Ga0307406_10048622 Ga0307406_100486223 114
567 3300031901 Ga0307406_10454145 Ga0307406_104541452 114
568 3300031903 Ga0307407_10002294 Ga0307407_100022948 114
569 3300031903 Ga0307407_10046830 Ga0307407_100468303 114
570 3300031911 Ga0307412_10005218 Ga0307412_1000521810 114
571 3300031911 Ga0307412_10360484 Ga0307412_103604842 114
572 3300031911 Ga0307412_11166788 Ga0307412_111667882 114
573 3300031995 Ga0307409_100002648 Ga0307409_10000264811 114
574 3300031995 Ga0307409_100003888 Ga0307409_1000038889 114
575 3300031995 Ga0307409_100293628 Ga0307409_1002936283 114
576 3300032002 Ga0307416_100004422 Ga0307416_1000044222 114
577 3300032002 Ga0307416_100044033 Ga0307416_1000440333 114
578 3300032002 Ga0307416_100503237 Ga0307416_1005032372 114
579 3300032002 Ga0307416_100608615 Ga0307416_1006086152 114
580 3300032002 Ga0307416_101691659 Ga0307416_1016916592 114
581 3300032002 Ga0307416_102358506 Ga0307416_1023585062 114
582 3300032002 Ga0307416_103530889 Ga0307416_1035308892 114
583 3300032004 Ga0307414_10173391 Ga0307414_101733912 114
584 3300032004 Ga0307414_10373728 Ga0307414_103737282 114
585 3300032004 Ga0307414_10505576 Ga0307414_105055762 114
586 3300032005 Ga0307411_10003618 Ga0307411_100036185 114
587 3300032005 Ga0307411_10060532 Ga0307411_100605322 114
588 3300032005 Ga0307411_11364967 Ga0307411_113649672 114
589 3300032126 Ga0307415_100001588 Ga0307415_1000015887 114
590 3300034817 Ga0373948_0020504 Ga0373948_0020504_438_782 114
591 3300034819 Ga0373958_0086997 Ga0373958_0086997_32_376 114
592 3300035086 Ga0373934_0294081 Ga0373934_0294081_53_400 114
593 3300035091 Ga0373951_0107860 Ga0373951_0107860_343_687 114
594 3300035113 Ga0373936_0207943 Ga0373936_0207943_204_551 114
595 3300035172 Ga0373955_0959760 Ga0373955_0959760_59_403 114
596 3300035241 Ga0373961_0015803 Ga0373961_0015803_415_759 114
597 3300035241 Ga0373961_0099220 Ga0373961_0099220_186_530 114
598 3300035242 Ga0373962_0008528 Ga0373962_0008528_1825_2169 114
599 3300035691 Ga0373931_0085471 Ga0373931_0085471_946_1290 114
600 3300035692 Ga0373935_0195581 Ga0373935_0195581_390_737 114
601 3300039437 Ga0436365_1109499 Ga0436365_1109499_1529_1873 114
602 3300041404 Ga0439436_0153283 Ga0439436_0153283_124_468 114
603 3300041406 Ga0439439_0022822 Ga0439439_0022822_574_918 114
604 3300041408 Ga0439453_0053654 Ga0439453_0053654_332_676 114
605 3300041410 Ga0439461_0052299 Ga0439461_0052299_202_546 114
606 3300041459 Ga0451800_1468674 Ga0451800_1468674_18_362 114
607 3300041511 Ga0451855_1421513 Ga0451855_1421513_39_383 114
608 3300041999 Ga0439433_0014349 Ga0439433_0014349_296_640 114
609 3300042007 Ga0439449_0045218 Ga0439449_0045218_372_716 114
610 3300042008 Ga0439450_105714 Ga0439450_105714_46_390 114
611 3300042008 Ga0439450_115530 Ga0439450_115530_331_675 114
612 3300042012 Ga0439455_0221034 Ga0439455_0221034_98_442 114
613 3300042014 Ga0439457_121763 Ga0439457_121763_254_598 114
614 3300042016 Ga0439463_139423 Ga0439463_139423_139_483 114
615 3300042122 Ga0450920_033413 Ga0450920_033413_129_473 114
616 3300042157 Ga0439458_0177095 Ga0439458_0177095_157_501 114
617 3300042184 Ga0450908_016885 Ga0450908_016885_123_467 114
618 3300042435 Ga0439434_0058985 Ga0439434_0058985_30_374 114
619 3300042436 Ga0439435_0029358 Ga0439435_0029358_1003_1347 114
620 3300042436 Ga0439435_0214630 Ga0439435_0214630_240_584 114
621 3300042437 Ga0439444_0014234 Ga0439444_0014234_942_1286 114
622 3300042439 Ga0439464_0012276 Ga0439464_0012276_938_1282 114
623 3300042530 Ga0450916_082719 Ga0450916_082719_158_502 114
624 3300042531 Ga0450918_086013 Ga0450918_086013_195_539 114
625 3300042993 Ga0439440_0046755 Ga0439440_0046755_18_362 114
626 3300042993 Ga0439440_0068143 Ga0439440_0068143_66_410 114
627 3300042993 Ga0439440_0196329 Ga0439440_0196329_228_572 114
628 3300045051 Ga0451576_0168098 Ga0451576_0168098_387_731 114
629 3300045051 Ga0451576_0691529 Ga0451576_0691529_673_1017 114
630 3300046492 Ga0495585_0210084 Ga0495585_0210084_460_807 114
631 3300046523 Ga0495644_0138006 Ga0495644_0138006_41_385 114
632 3300046537 Ga0495598_0025338 Ga0495598_0025338_468_812 114
633 3300046537 Ga0495598_0359488 Ga0495598_0359488_157_501 114
634 3300046539 Ga0495621_0012939 Ga0495621_0012939_770_1114 114
635 3300046539 Ga0495621_0323520 Ga0495621_0323520_41_385 114
636 3300046559 Ga0495667_0120663 Ga0495667_0120663_1208_1555 114
637 3300046663 Ga0495635_0442097 Ga0495635_0442097_127_474 114
638 3300046681 Ga0495647_0248656 Ga0495647_0248656_234_578 114
639 3300046683 Ga0495658_0163311 Ga0495658_0163311_295_642 114
640 3300046683 Ga0495658_0394566 Ga0495658_0394566_506_850 114
641 3300048905 Ga0496102_1772011 Ga0496102_1772011_99_443 114
642 3300048906 Ga0496103_0741961 Ga0496103_0741961_200_544 114
643 3300048908 Ga0496105_0619673 Ga0496105_0619673_70_414 114
644 3300048909 Ga0496106_1465036 Ga0496106_1465036_36_380 114
645 3300048911 Ga0496108_0687187 Ga0496108_0687187_165_509 114
646 3300048912 Ga0496109_0009469 Ga0496109_0009469_4487_4831 114
647 3300048913 Ga0496110_0519699 Ga0496110_0519699_194_538 114
648 3300048916 Ga0496113_0477436 Ga0496113_0477436_44_388 114
649 3300049568 Ga0501031_0157403 Ga0501031_0157403_423_767 114
650 3300049569 Ga0501032_0219971 Ga0501032_0219971_573_917 114
651 3300049571 Ga0501034_0011197 Ga0501034_0011197_300_644 114
652 3300049572 Ga0501036_0075889 Ga0501036_0075889_39_383 114
653 3300049572 Ga0501036_0412435 Ga0501036_0412435_86_430 114
654 3300049574 Ga0501038_0096331 Ga0501038_0096331_1043_1387 114
655 3300049575 Ga0501039_0015444 Ga0501039_0015444_3018_3362 114
656 3300049575 Ga0501039_0095532 Ga0501039_0095532_28_372 114
657 3300049576 Ga0501040_0229575 Ga0501040_0229575_125_469 114
658 3300049577 Ga0501041_0053907 Ga0501041_0053907_1775_2119 114
659 3300049578 Ga0501042_0018344 Ga0501042_0018344_3319_3663 114
660 3300049578 Ga0501042_0053525 Ga0501042_0053525_2358_2702 114
661 3300049580 Ga0501046_0014788 Ga0501046_0014788_883_1227 114
662 3300049581 Ga0501047_0361166 Ga0501047_0361166_848_1192 114
663 3300049582 Ga0501048_0058291 Ga0501048_0058291_1184_1528 114
664 3300049582 Ga0501048_0085194 Ga0501048_0085194_1461_1805 114
665 3300049585 Ga0501069_0567547 Ga0501069_0567547_64_408 114
666 3300049587 Ga0501071_0112603 Ga0501071_0112603_1212_1556 114
667 3300049587 Ga0501071_0735558 Ga0501071_0735558_67_411 114
668 3300049588 Ga0501072_0052134 Ga0501072_0052134_76_420 114
669 3300049588 Ga0501072_0152215 Ga0501072_0152215_1016_1360 114
670 3300049589 Ga0501073_0810797 Ga0501073_0810797_114_458 114
671 3300049589 Ga0501073_0997904 Ga0501073_0997904_172_516 114
672 3300049591 Ga0501075_0002772 Ga0501075_0002772_6719_7063 114
673 3300049591 Ga0501075_0073859 Ga0501075_0073859_754_1098 114
674 3300049591 Ga0501075_0304786 Ga0501075_0304786_445_789 114
675 3300049591 Ga0501075_0402404 Ga0501075_0402404_309_653 114
676 3300049592 Ga0501076_0049675 Ga0501076_0049675_2272_2616 114
677 3300049592 Ga0501076_0135828 Ga0501076_0135828_302_646 114
678 3300049592 Ga0501076_0154132 Ga0501076_0154132_66_410 114
679 3300049593 Ga0501077_0598311 Ga0501077_0598311_179_523 114
680 3300049668 Ga0501233_224160 Ga0501233_224160_103_447 114
681 3300049741 Ga0501079_0031859 Ga0501079_0031859_3631_3975 114
682 3300049741 Ga0501079_0052684 Ga0501079_0052684_1889_2233 114
683 3300049742 Ga0501080_0054487 Ga0501080_0054487_1308_1652 114
684 3300049743 Ga0501081_0019001 Ga0501081_0019001_1052_1396 114
685 3300049743 Ga0501081_0032255 Ga0501081_0032255_680_1024 114
686 3300049744 Ga0501083_0190369 Ga0501083_0190369_526_870 114
687 3300049822 Ga0501035_0166617 Ga0501035_0166617_682_1026 114
688 3300049824 Ga0501045_0014255 Ga0501045_0014255_3876_4220 114
689 3300049824 Ga0501045_0241539 Ga0501045_0241539_690_1034 114
690 3300049824 Ga0501045_0795806 Ga0501045_0795806_70_414 114
691 3300050489 nmdc:mga03683_305711_c1 nmdc:mga03683_305711_c1_339_686 114
692 3300050491 nmdc:mga00v17_169911_c1 nmdc:mga00v17_169911_c1_641_988 114
693 3300050492 nmdc:mga0yw44_685417_c1 nmdc:mga0yw44_685417_c1_81_428 114
694 3300050493 nmdc:mga0k408_2583_c1 nmdc:mga0k408_2583_c1_271_618 114
695 3300050507 nmdc:mga05p37_1212421_c1 nmdc:mga05p37_1212421_c1_267_614 114
696 3300050507 nmdc:mga05p37_2629_c1 nmdc:mga05p37_2629_c1_10412_10756 114
697 3300050507 nmdc:mga05p37_315151_c1 nmdc:mga05p37_315151_c1_282_626 114
698 3300050507 nmdc:mga05p37_47196_c1 nmdc:mga05p37_47196_c1_2791_3135 114
699 3300050507 nmdc:mga05p37_569037_c1 nmdc:mga05p37_569037_c1_666_1010 114
700 3300050507 nmdc:mga05p37_61488_c1 nmdc:mga05p37_61488_c1_813_1157 114
701 3300050507 nmdc:mga05p37_785493_c1 nmdc:mga05p37_785493_c1_67_411 114
702 3300050508 nmdc:mga09592_11186_c1 nmdc:mga09592_11186_c1_6067_6411 114
703 3300050508 nmdc:mga09592_1151_c1 nmdc:mga09592_1151_c1_18629_18973 114
704 3300050508 nmdc:mga09592_21965_c1 nmdc:mga09592_21965_c1_518_862 114
705 3300050508 nmdc:mga09592_680372_c1 nmdc:mga09592_680372_c1_25_369 114
706 3300050508 nmdc:mga09592_9057_c1 nmdc:mga09592_9057_c1_1853_2197 114
707 3300050508 nmdc:mga09592_99836_c1 nmdc:mga09592_99836_c1_700_1044 114
708 3300050509 nmdc:mga0qj67_1199761_c1 nmdc:mga0qj67_1199761_c1_208_552 114
709 3300050509 nmdc:mga0qj67_181061_c1 nmdc:mga0qj67_181061_c1_597_941 114
710 3300050509 nmdc:mga0qj67_1855_c1 nmdc:mga0qj67_1855_c1_13870_14214 114
711 3300050509 nmdc:mga0qj67_188001_c1 nmdc:mga0qj67_188001_c1_43_387 114
712 3300050509 nmdc:mga0qj67_26899_c1 nmdc:mga0qj67_26899_c1_1767_2111 114
713 3300050509 nmdc:mga0qj67_320955_c1 nmdc:mga0qj67_320955_c1_427_771 114
714 3300050509 nmdc:mga0qj67_5906_c1 nmdc:mga0qj67_5906_c1_1271_1615 114
715 3300050509 nmdc:mga0qj67_899_c1 nmdc:mga0qj67_899_c1_18810_19154 114
716 3300050510 nmdc:mga06r32_1105309_c1 nmdc:mga06r32_1105309_c1_159_503 114
717 3300050510 nmdc:mga06r32_11765_c1 nmdc:mga06r32_11765_c1_4248_4592 114
718 3300050510 nmdc:mga06r32_1217_c1 nmdc:mga06r32_1217_c1_18931_19275 114
719 3300050510 nmdc:mga06r32_159845_c1 nmdc:mga06r32_159845_c1_1780_2124 114
720 3300050510 nmdc:mga06r32_354352_c1 nmdc:mga06r32_354352_c1_1022_1366 114
721 3300050510 nmdc:mga06r32_50770_c1 nmdc:mga06r32_50770_c1_3604_3948 114
722 3300050510 nmdc:mga06r32_88110_c1 nmdc:mga06r32_88110_c1_1329_1673 114
723 3300050511 nmdc:mga08y16_207658_c1 nmdc:mga08y16_207658_c1_678_1022 114
724 3300050511 nmdc:mga08y16_24666_c1 nmdc:mga08y16_24666_c1_5065_5409 114
725 3300050511 nmdc:mga08y16_30647_c1 nmdc:mga08y16_30647_c1_4070_4414 114
726 3300050511 nmdc:mga08y16_62014_c1 nmdc:mga08y16_62014_c1_524_868 114
727 3300050511 nmdc:mga08y16_738114_c1 nmdc:mga08y16_738114_c1_497_841 114
728 3300050511 nmdc:mga08y16_87648_c1 nmdc:mga08y16_87648_c1_2084_2428 114
729 3300050511 nmdc:mga08y16_953_c1 nmdc:mga08y16_953_c1_20856_21200 114
730 3300050512 nmdc:mga0n895_1256235_c1 nmdc:mga0n895_1256235_c1_225_569 114
731 3300050512 nmdc:mga0n895_1590872_c1 nmdc:mga0n895_1590872_c1_69_416 114
732 3300050512 nmdc:mga0n895_37083_c1 nmdc:mga0n895_37083_c1_938_1282 114
733 3300050512 nmdc:mga0n895_5337_c1 nmdc:mga0n895_5337_c1_380_724 114
734 3300050513 nmdc:mga0rr50_167248_c1 nmdc:mga0rr50_167248_c1_1265_1609 114
735 3300050515 nmdc:mga0a205_102698_c1 nmdc:mga0a205_102698_c1_1999_2343 114
736 3300050515 nmdc:mga0a205_14932_c1 nmdc:mga0a205_14932_c1_964_1308 114
737 3300050515 nmdc:mga0a205_233_c1 nmdc:mga0a205_233_c1_38363_38707 114
738 3300050515 nmdc:mga0a205_42735_c1 nmdc:mga0a205_42735_c1_2068_2412 114
739 3300050515 nmdc:mga0a205_656870_c1 nmdc:mga0a205_656870_c1_98_442 114
740 3300050515 nmdc:mga0a205_99_c1 nmdc:mga0a205_99_c1_42834_43178 114
741 3300053085 Ga0495619_0053906 Ga0495619_0053906_1248_1595 114
742 3300054114 Ga0501084_0007339 Ga0501084_0007339_2422_2766 114
743 3300054114 Ga0501084_0079823 Ga0501084_0079823_948_1292 114
744 3300054114 Ga0501084_1570101 Ga0501084_1570101_127_471 114
745 3300059421 Ga0590071_067361 Ga0590071_067361_161_505 114
746 3300059421 Ga0590071_095472 Ga0590071_095472_243_587 114
747 3300059424 Ga0590075_022471 Ga0590075_022471_1181_1525 114
748 3300059426 Ga0590077_003880 Ga0590077_003880_2170_2514 114
749 3300060353 Ga0501082_0035816 Ga0501082_0035816_2690_3034 114
750 3300060353 Ga0501082_0289949 Ga0501082_0289949_667_1011 114
751 3300061734 Ga0530510_0119762 Ga0530510_0119762_645_989 114
752 3300061734 Ga0530510_0328277 Ga0530510_0328277_520_864 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

11

111

0.95

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

3

113

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9845 3 114
5km6-assembly1.cif.gz_A-2 human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant ara-a nucleoside phosphoramidate substrate complex 0.9784 3 114
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9759 3 114
3qgz-assembly1.cif.gz_A re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine 0.9754 2 114
3o1c-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c38a mutant from rabbit complexed with adenosine 0.974 2 114
ID Description Score Start End Superfamily
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9682 3 114 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9638 18 114 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9631 1 108 3.30.428.10
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9607 1 114 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9597 3 114 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1J4WLC5-F1-model_v4 Histidine triad nucleotide-binding protein 0.9908 3 106 GO:0003824
AF-A0A382LWH9-F1-model_v4 HIT domain-containing protein 0.99 4 114 GO:0003824
AF-S6HKD1-F1-model_v4 Histidine triad (HIT) protein 0.9895 3 110 GO:0003824
AF-A0A1I0GSU7-F1-model_v4 Histidine triad (HIT) family protein 0.9893 3 114 GO:0003824
AF-A0A6N4DIS3-F1-model_v4 Histidine triad nucleotide-binding protein 0.9887 2 114 GO:0003824

Feature Viewer

pLDDT pTM Quality
94.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map