F479192
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 753 | 323 | 744 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_101092134|Ga0070668_1010921341 |
| Length | 155 |
| Sequence | MGVERMDLRKLKTLIELVETSGIAELEIQEGEERVRITRAPMSGTQTVMLPAAAPTAPPPTGGPHNMGSEPTAPAKPEGHVVKSPMVGTFYRAASPGAKSFVEVGDTVAQGDALCIIEAMKLMNEIEADAAGTVKAILAENGQAVEFGQPLFVIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 3 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 4 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 5 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 6 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 7 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 8 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 9 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 237 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 238 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 239 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 243 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 311 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 316 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 317 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 318 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 319 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 320 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 323 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 0 |
| Isolates | 1.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.97 |
| Nodule | 0 |
| Rhizoplane | 4.65 |
| Rhizosphere | 85.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_12253474 | 2162886012 | Bacteria | 818 |
| 2 | JGI24746J21847_1016548 | 3300001977 | Bacteria | 1053 |
| 3 | JGI24739J22299_10048713 | 3300001989 | Bacteria | 1376 |
| 4 | JGI24743J22301_10008375 | 3300001991 | Bacteria | 1813 |
| 5 | JGI24750J21931_1064877 | 3300002070 | Bacteria | 589 |
| 6 | JGI24745J21846_1006246 | 3300002073 | Bacteria | 1317 |
| 7 | JGI24749J21850_1003215 | 3300002076 | Bacteria | 2279 |
| 8 | JGI24035J26624_1004552 | 3300002126 | Bacteria | 1317 |
| 9 | JGI24034J26672_10016582 | 3300002239 | Bacteria | 1135 |
| 10 | JGI24751J29686_10035823 | 3300002459 | Bacteria | 1029 |
| 11 | Ga0065714_10193261 | 3300005288 | Bacteria | 920 |
| 12 | Ga0065712_10223299 | 3300005290 | Bacteria | 1034 |
| 13 | Ga0065715_10179257 | 3300005293 | Bacteria | 1488 |
| 14 | Ga0070658_10021365 | 3300005327 | Bacteria | 5188 |
| 15 | Ga0070658_10071691 | 3300005327 | Bacteria | 2838 |
| 16 | Ga0070658_10307238 | 3300005327 | Bacteria | 1353 |
| 17 | Ga0070676_10000960 | 3300005328 | Bacteria | 14331 |
| 18 | Ga0070676_10033470 | 3300005328 | Bacteria | 2949 |
| 19 | Ga0070676_10072032 | 3300005328 | Bacteria | 2077 |
| 20 | Ga0070683_100265746 | 3300005329 | Bacteria | 1632 |
| 21 | Ga0070683_100519812 | 3300005329 | Bacteria | 1137 |
| 22 | Ga0070683_100527023 | 3300005329 | Bacteria | 1129 |
| 23 | Ga0070683_100890111 | 3300005329 | Bacteria | 854 |
| 24 | Ga0070683_101075073 | 3300005329 | Bacteria | 773 |
| 25 | Ga0070690_100025876 | 3300005330 | Bacteria | 3616 |
| 26 | Ga0070690_100099592 | 3300005330 | Bacteria | 1925 |
| 27 | Ga0070670_100006913 | 3300005331 | Bacteria | 9618 |
| 28 | Ga0070670_100065242 | 3300005331 | Bacteria | 3124 |
| 29 | Ga0070670_100144933 | 3300005331 | Bacteria | 2054 |
| 30 | Ga0070670_100164559 | 3300005331 | Bacteria | 1923 |
| 31 | Ga0070670_100314225 | 3300005331 | Bacteria | 1372 |
| 32 | Ga0070670_100725220 | 3300005331 | Bacteria | 895 |
| 33 | Ga0070670_101179392 | 3300005331 | Bacteria | 699 |
| 34 | Ga0070677_10002708 | 3300005333 | Bacteria | 5664 |
| 35 | Ga0070677_10299167 | 3300005333 | Bacteria | 817 |
| 36 | Ga0068869_100005133 | 3300005334 | Bacteria | 8210 |
| 37 | Ga0068869_100027628 | 3300005334 | Bacteria | 3959 |
| 38 | Ga0068869_100060461 | 3300005334 | Bacteria | 2777 |
| 39 | Ga0068869_101181838 | 3300005334 | Bacteria | 672 |
| 40 | Ga0070666_10043834 | 3300005335 | Bacteria | 2996 |
| 41 | Ga0070666_10183324 | 3300005335 | Bacteria | 1469 |
| 42 | Ga0070666_10200253 | 3300005335 | Bacteria | 1405 |
| 43 | Ga0070666_10222514 | 3300005335 | Bacteria | 1331 |
| 44 | Ga0070666_10237666 | 3300005335 | Bacteria | 1288 |
| 45 | Ga0070666_10724877 | 3300005335 | Bacteria | 730 |
| 46 | Ga0070680_100073905 | 3300005336 | Bacteria | 2804 |
| 47 | Ga0070680_100615924 | 3300005336 | Bacteria | 932 |
| 48 | Ga0068868_100022592 | 3300005338 | Bacteria | 4750 |
| 49 | Ga0068868_100040730 | 3300005338 | Bacteria | 3616 |
| 50 | Ga0068868_100350139 | 3300005338 | Bacteria | 1265 |
| 51 | Ga0068868_100472683 | 3300005338 | Bacteria | 1094 |
| 52 | Ga0068868_101676148 | 3300005338 | Bacteria | 599 |
| 53 | Ga0070660_100007268 | 3300005339 | Bacteria | 7712 |
| 54 | Ga0070660_100086675 | 3300005339 | Bacteria | 2464 |
| 55 | Ga0070660_100139677 | 3300005339 | Bacteria | 1943 |
| 56 | Ga0070660_100401362 | 3300005339 | Bacteria | 1134 |
| 57 | Ga0070689_100242576 | 3300005340 | Bacteria | 1484 |
| 58 | Ga0070689_100780834 | 3300005340 | Bacteria | 839 |
| 59 | Ga0070687_100005303 | 3300005343 | Bacteria | 5208 |
| 60 | Ga0070661_100000647 | 3300005344 | Bacteria | 25720 |
| 61 | Ga0070661_100038455 | 3300005344 | Bacteria | 3483 |
| 62 | Ga0070661_100043695 | 3300005344 | Bacteria | 3273 |
| 63 | Ga0070661_100776962 | 3300005344 | Bacteria | 785 |
| 64 | Ga0070692_10016920 | 3300005345 | Bacteria | 3476 |
| 65 | Ga0070668_100002954 | 3300005347 | Bacteria | 12568 |
| 66 | Ga0070668_100014646 | 3300005347 | Bacteria | 5861 |
| 67 | Ga0070668_100049662 | 3300005347 | Bacteria | 3227 |
| 68 | Ga0070668_100133822 | 3300005347 | Bacteria | 1992 |
| 69 | Ga0070668_100312651 | 3300005347 | Bacteria | 1320 |
| 70 | Ga0070668_100508264 | 3300005347 | Bacteria | 1044 |
| 71 | Ga0070668_101092134 | 3300005347 | Bacteria | 720 |
| 72 | Ga0070669_100039508 | 3300005353 | Bacteria | 3429 |
| 73 | Ga0070669_100408028 | 3300005353 | Bacteria | 1113 |
| 74 | Ga0070675_100194089 | 3300005354 | Bacteria | 1760 |
| 75 | Ga0070675_100210830 | 3300005354 | Bacteria | 1688 |
| 76 | Ga0070675_100252687 | 3300005354 | Bacteria | 1543 |
| 77 | Ga0070671_100001559 | 3300005355 | Bacteria | 17239 |
| 78 | Ga0070671_100004694 | 3300005355 | Bacteria | 10847 |
| 79 | Ga0070671_100005899 | 3300005355 | Bacteria | 9760 |
| 80 | Ga0070671_100010054 | 3300005355 | Bacteria | 7600 |
| 81 | Ga0070671_100020026 | 3300005355 | Bacteria | 5451 |
| 82 | Ga0070671_100101070 | 3300005355 | Bacteria | 2419 |
| 83 | Ga0070671_100109552 | 3300005355 | Bacteria | 2319 |
| 84 | Ga0070671_100298043 | 3300005355 | Bacteria | 1373 |
| 85 | Ga0070674_100000204 | 3300005356 | Bacteria | 28346 |
| 86 | Ga0070674_100013274 | 3300005356 | Bacteria | 5088 |
| 87 | Ga0070674_100164076 | 3300005356 | Bacteria | 1688 |
| 88 | Ga0070673_100002026 | 3300005364 | Bacteria | 12223 |
| 89 | Ga0070673_100072245 | 3300005364 | Bacteria | 2774 |
| 90 | Ga0070673_101095924 | 3300005364 | Bacteria | 744 |
| 91 | Ga0070688_100000913 | 3300005365 | Bacteria | 14739 |
| 92 | Ga0070659_100003383 | 3300005366 | Bacteria | 11356 |
| 93 | Ga0070659_100110159 | 3300005366 | Bacteria | 2222 |
| 94 | Ga0070659_100307523 | 3300005366 | Bacteria | 1323 |
| 95 | Ga0070659_100403249 | 3300005366 | Bacteria | 1155 |
| 96 | Ga0070659_100544700 | 3300005366 | Bacteria | 993 |
| 97 | Ga0070659_100687545 | 3300005366 | Bacteria | 884 |
| 98 | Ga0070659_101722105 | 3300005366 | Bacteria | 561 |
| 99 | Ga0070667_100002207 | 3300005367 | Bacteria | 17131 |
| 100 | Ga0070667_100010447 | 3300005367 | Bacteria | 7665 |
| 101 | Ga0070667_100121649 | 3300005367 | Bacteria | 2270 |
| 102 | Ga0070667_100441752 | 3300005367 | Bacteria | 1188 |
| 103 | Ga0070667_101460580 | 3300005367 | Bacteria | 642 |
| 104 | Ga0070709_10021902 | 3300005434 | Bacteria | 3730 |
| 105 | Ga0070714_100012010 | 3300005435 | Bacteria | 6893 |
| 106 | Ga0070714_100496667 | 3300005435 | Bacteria | 1163 |
| 107 | Ga0070713_100550705 | 3300005436 | Bacteria | 1092 |
| 108 | Ga0070710_10029598 | 3300005437 | Bacteria | 2940 |
| 109 | Ga0070701_10040923 | 3300005438 | Bacteria | 2358 |
| 110 | Ga0070711_100011567 | 3300005439 | Bacteria | 5487 |
| 111 | Ga0070705_101104513 | 3300005440 | Bacteria | 649 |
| 112 | Ga0070700_100008875 | 3300005441 | Bacteria | 5496 |
| 113 | Ga0070700_100235235 | 3300005441 | Bacteria | 1306 |
| 114 | Ga0070700_100259366 | 3300005441 | Bacteria | 1251 |
| 115 | Ga0070700_100445496 | 3300005441 | Bacteria | 984 |
| 116 | Ga0070694_100318116 | 3300005444 | Bacteria | 1197 |
| 117 | Ga0070663_100009567 | 3300005455 | Bacteria | 6006 |
| 118 | Ga0070663_100050386 | 3300005455 | Bacteria | 2961 |
| 119 | Ga0070663_100121318 | 3300005455 | Bacteria | 1975 |
| 120 | Ga0070663_100131355 | 3300005455 | Bacteria | 1902 |
| 121 | Ga0070663_102005742 | 3300005455 | Bacteria | 521 |
| 122 | Ga0070678_100003071 | 3300005456 | Bacteria | 9257 |
| 123 | Ga0070678_100050601 | 3300005456 | Bacteria | 3007 |
| 124 | Ga0070678_100314447 | 3300005456 | Bacteria | 1335 |
| 125 | Ga0070662_100002390 | 3300005457 | Bacteria | 11527 |
| 126 | Ga0070662_100027760 | 3300005457 | Bacteria | 3934 |
| 127 | Ga0070662_100033344 | 3300005457 | Bacteria | 3625 |
| 128 | Ga0070662_100231707 | 3300005457 | Bacteria | 1478 |
| 129 | Ga0070662_100280264 | 3300005457 | Bacteria | 1349 |
| 130 | Ga0070662_100564625 | 3300005457 | Bacteria | 955 |
| 131 | Ga0070681_10335357 | 3300005458 | Bacteria | 1422 |
| 132 | Ga0070681_10441529 | 3300005458 | Bacteria | 1213 |
| 133 | Ga0068867_100001405 | 3300005459 | Bacteria | 16635 |
| 134 | Ga0068867_100139217 | 3300005459 | Bacteria | 1895 |
| 135 | Ga0068867_100164038 | 3300005459 | Bacteria | 1754 |
| 136 | Ga0068867_100693266 | 3300005459 | Bacteria | 898 |
| 137 | Ga0070685_10128595 | 3300005466 | Bacteria | 1581 |
| 138 | Ga0070699_100016121 | 3300005518 | Bacteria | 6415 |
| 139 | Ga0070679_100016850 | 3300005530 | Bacteria | 7063 |
| 140 | Ga0070679_100379215 | 3300005530 | Bacteria | 1361 |
| 141 | Ga0070679_101062564 | 3300005530 | Bacteria | 754 |
| 142 | Ga0070684_100039111 | 3300005535 | Bacteria | 4079 |
| 143 | Ga0070684_100078517 | 3300005535 | Bacteria | 2917 |
| 144 | Ga0068853_100000497 | 3300005539 | Bacteria | 26925 |
| 145 | Ga0068853_100001509 | 3300005539 | Bacteria | 16913 |
| 146 | Ga0068853_100298889 | 3300005539 | Bacteria | 1487 |
| 147 | Ga0068853_101167865 | 3300005539 | Bacteria | 743 |
| 148 | Ga0070672_100001609 | 3300005543 | Bacteria | 14033 |
| 149 | Ga0070672_100012934 | 3300005543 | Bacteria | 5882 |
| 150 | Ga0070672_100040879 | 3300005543 | Bacteria | 3561 |
| 151 | Ga0070672_100053025 | 3300005543 | Bacteria | 3169 |
| 152 | Ga0070672_100091772 | 3300005543 | Bacteria | 2451 |
| 153 | Ga0070672_100553560 | 3300005543 | Bacteria | 999 |
| 154 | Ga0070672_100620866 | 3300005543 | Bacteria | 942 |
| 155 | Ga0070686_100006318 | 3300005544 | Bacteria | 6579 |
| 156 | Ga0070696_100002259 | 3300005546 | Bacteria | 12698 |
| 157 | Ga0070696_100543194 | 3300005546 | Bacteria | 930 |
| 158 | Ga0070696_101882501 | 3300005546 | Bacteria | 518 |
| 159 | Ga0070693_100059945 | 3300005547 | Bacteria | 2208 |
| 160 | Ga0070693_100132356 | 3300005547 | Bacteria | 1561 |
| 161 | Ga0070693_100234524 | 3300005547 | Bacteria | 1209 |
| 162 | Ga0070665_100003522 | 3300005548 | Bacteria | 16646 |
| 163 | Ga0070665_100420928 | 3300005548 | Bacteria | 1344 |
| 164 | Ga0070665_100559771 | 3300005548 | Bacteria | 1156 |
| 165 | Ga0070665_101135543 | 3300005548 | Bacteria | 793 |
| 166 | Ga0068855_100000863 | 3300005563 | Bacteria | 37650 |
| 167 | Ga0068855_100019281 | 3300005563 | Bacteria | 8199 |
| 168 | Ga0068855_100028328 | 3300005563 | Bacteria | 6700 |
| 169 | Ga0068855_100265487 | 3300005563 | Bacteria | 1911 |
| 170 | Ga0068855_100272281 | 3300005563 | Bacteria | 1883 |
| 171 | Ga0070664_100009745 | 3300005564 | Bacteria | 7785 |
| 172 | Ga0070664_100023353 | 3300005564 | Bacteria | 5107 |
| 173 | Ga0070664_100087464 | 3300005564 | Bacteria | 2694 |
| 174 | Ga0070664_100155015 | 3300005564 | Bacteria | 2024 |
| 175 | Ga0070664_100203255 | 3300005564 | Bacteria | 1768 |
| 176 | Ga0070664_100413405 | 3300005564 | Bacteria | 1235 |
| 177 | Ga0070664_100805473 | 3300005564 | Bacteria | 878 |
| 178 | Ga0068857_100017820 | 3300005577 | Bacteria | 6227 |
| 179 | Ga0068857_100552661 | 3300005577 | Bacteria | 1085 |
| 180 | Ga0068854_100011019 | 3300005578 | Bacteria | 5869 |
| 181 | Ga0068854_100029326 | 3300005578 | Bacteria | 3809 |
| 182 | Ga0068856_100000517 | 3300005614 | Bacteria | 42558 |
| 183 | Ga0068856_100006194 | 3300005614 | Bacteria | 11737 |
| 184 | Ga0068856_100593609 | 3300005614 | Bacteria | 1129 |
| 185 | Ga0068856_101791642 | 3300005614 | Bacteria | 626 |
| 186 | Ga0070702_100044523 | 3300005615 | Bacteria | 2506 |
| 187 | Ga0070702_100087906 | 3300005615 | Bacteria | 1878 |
| 188 | Ga0068852_100003761 | 3300005616 | Bacteria | 10642 |
| 189 | Ga0068852_100007263 | 3300005616 | Bacteria | 8077 |
| 190 | Ga0068852_100175973 | 3300005616 | Bacteria | 2009 |
| 191 | Ga0068852_100444949 | 3300005616 | Bacteria | 1282 |
| 192 | Ga0068852_100452759 | 3300005616 | Bacteria | 1271 |
| 193 | Ga0068852_100510344 | 3300005616 | Bacteria | 1198 |
| 194 | Ga0068852_100616032 | 3300005616 | Bacteria | 1091 |
| 195 | Ga0068859_100029685 | 3300005617 | Bacteria | 5487 |
| 196 | Ga0068859_100047138 | 3300005617 | Bacteria | 4329 |
| 197 | Ga0068864_100007512 | 3300005618 | Bacteria | 8980 |
| 198 | Ga0068864_100072581 | 3300005618 | Bacteria | 3000 |
| 199 | Ga0068864_100353945 | 3300005618 | Bacteria | 1386 |
| 200 | Ga0068864_100380204 | 3300005618 | Bacteria | 1338 |
| 201 | Ga0068861_100035853 | 3300005719 | Bacteria | 3677 |
| 202 | Ga0068861_100105613 | 3300005719 | Bacteria | 2249 |
| 203 | Ga0068861_100801566 | 3300005719 | Bacteria | 884 |
| 204 | Ga0068861_100975864 | 3300005719 | Bacteria | 807 |
| 205 | Ga0068851_10000352 | 3300005834 | Bacteria | 20740 |
| 206 | Ga0068851_10011745 | 3300005834 | Bacteria | 4112 |
| 207 | Ga0068851_10018402 | 3300005834 | Bacteria | 3364 |
| 208 | Ga0068851_10040994 | 3300005834 | Bacteria | 2328 |
| 209 | Ga0068870_10009194 | 3300005840 | Bacteria | 4482 |
| 210 | Ga0068870_10028835 | 3300005840 | Bacteria | 2791 |
| 211 | Ga0068870_10083129 | 3300005840 | Bacteria | 1774 |
| 212 | Ga0068863_100041440 | 3300005841 | Bacteria | 4379 |
| 213 | Ga0068863_100128979 | 3300005841 | Bacteria | 2414 |
| 214 | Ga0068863_100152703 | 3300005841 | Bacteria | 2210 |
| 215 | Ga0068863_100477094 | 3300005841 | Bacteria | 1226 |
| 216 | Ga0068858_100001192 | 3300005842 | Bacteria | 26912 |
| 217 | Ga0068858_100074043 | 3300005842 | Bacteria | 3162 |
| 218 | Ga0068858_100141183 | 3300005842 | Bacteria | 2261 |
| 219 | Ga0068858_102249861 | 3300005842 | Bacteria | 539 |
| 220 | Ga0068860_100035947 | 3300005843 | Bacteria | 4750 |
| 221 | Ga0068860_100266280 | 3300005843 | Bacteria | 1671 |
| 222 | Ga0068860_100293724 | 3300005843 | Bacteria | 1591 |
| 223 | Ga0068860_100295570 | 3300005843 | Bacteria | 1586 |
| 224 | Ga0068862_100017424 | 3300005844 | Bacteria | 5983 |
| 225 | Ga0068862_101258900 | 3300005844 | Bacteria | 740 |
| 226 | Ga0075365_10003706 | 3300006038 | Bacteria | 7943 |
| 227 | Ga0075365_10250582 | 3300006038 | Bacteria | 1244 |
| 228 | Ga0075368_10027148 | 3300006042 | Bacteria | 2206 |
| 229 | Ga0075363_100064664 | 3300006048 | Bacteria | 1976 |
| 230 | Ga0075363_100154028 | 3300006048 | Bacteria | 1298 |
| 231 | Ga0075363_100571815 | 3300006048 | Bacteria | 675 |
| 232 | Ga0075364_10012996 | 3300006051 | Bacteria | 5109 |
| 233 | Ga0075432_10100361 | 3300006058 | Bacteria | 1069 |
| 234 | Ga0075362_10003105 | 3300006177 | Bacteria | 5728 |
| 235 | Ga0075362_10046064 | 3300006177 | Bacteria | 1938 |
| 236 | Ga0075367_10005132 | 3300006178 | Bacteria | 6467 |
| 237 | Ga0075367_10010956 | 3300006178 | Bacteria | 4778 |
| 238 | Ga0075367_10043488 | 3300006178 | Bacteria | 2631 |
| 239 | Ga0075369_10070905 | 3300006186 | Bacteria | 1533 |
| 240 | Ga0075369_10503377 | 3300006186 | Bacteria | 576 |
| 241 | Ga0075366_10005214 | 3300006195 | Bacteria | 7032 |
| 242 | Ga0097621_100011274 | 3300006237 | Bacteria | 6581 |
| 243 | Ga0097621_100036310 | 3300006237 | Bacteria | 3942 |
| 244 | Ga0097621_100168703 | 3300006237 | Bacteria | 1885 |
| 245 | Ga0097621_100728342 | 3300006237 | Bacteria | 915 |
| 246 | Ga0075370_10018855 | 3300006353 | Bacteria | 3746 |
| 247 | Ga0075370_10025431 | 3300006353 | Bacteria | 3275 |
| 248 | Ga0075370_10076855 | 3300006353 | Bacteria | 1915 |
| 249 | Ga0075370_10108700 | 3300006353 | Bacteria | 1609 |
| 250 | Ga0068871_100023453 | 3300006358 | Bacteria | 4774 |
| 251 | Ga0068871_100025961 | 3300006358 | Bacteria | 4565 |
| 252 | Ga0075428_100164264 | 3300006844 | Bacteria | 2409 |
| 253 | Ga0075430_100392330 | 3300006846 | Bacteria | 1145 |
| 254 | Ga0075434_100702292 | 3300006871 | Bacteria | 1029 |
| 255 | Ga0068865_100004033 | 3300006881 | Bacteria | 8818 |
| 256 | Ga0068865_100074333 | 3300006881 | Bacteria | 2420 |
| 257 | Ga0075436_100267954 | 3300006914 | Bacteria | 1219 |
| 258 | Ga0097620_100029687 | 3300006931 | Bacteria | 5487 |
| 259 | Ga0097620_100047142 | 3300006931 | Bacteria | 4329 |
| 260 | Ga0097620_101257159 | 3300006931 | Bacteria | 816 |
| 261 | Ga0105240_10005257 | 3300009093 | Bacteria | 19332 |
| 262 | Ga0105240_10088641 | 3300009093 | Bacteria | 3785 |
| 263 | Ga0111539_10036798 | 3300009094 | Bacteria | 5914 |
| 264 | Ga0105245_10050653 | 3300009098 | Bacteria | 3722 |
| 265 | Ga0105245_10752605 | 3300009098 | Bacteria | 1010 |
| 266 | Ga0105245_11109313 | 3300009098 | Bacteria | 838 |
| 267 | Ga0105245_11375244 | 3300009098 | Bacteria | 756 |
| 268 | Ga0105245_11399483 | 3300009098 | Bacteria | 749 |
| 269 | Ga0105247_10040897 | 3300009101 | Bacteria | 2835 |
| 270 | Ga0105247_10141463 | 3300009101 | Bacteria | 1577 |
| 271 | Ga0114129_10728414 | 3300009147 | Bacteria | 1272 |
| 272 | Ga0105243_10000717 | 3300009148 | Bacteria | 31849 |
| 273 | Ga0105243_10100809 | 3300009148 | Bacteria | 2397 |
| 274 | Ga0105242_10179651 | 3300009176 | Bacteria | 1866 |
| 275 | Ga0105242_10459619 | 3300009176 | Bacteria | 1202 |
| 276 | Ga0105248_10008736 | 3300009177 | Bacteria | 11130 |
| 277 | Ga0105248_10017366 | 3300009177 | Bacteria | 7932 |
| 278 | Ga0105248_10124188 | 3300009177 | Bacteria | 2911 |
| 279 | Ga0105248_10314314 | 3300009177 | Bacteria | 1764 |
| 280 | Ga0105237_10400735 | 3300009545 | Bacteria | 1377 |
| 281 | Ga0105237_10527052 | 3300009545 | Bacteria | 1188 |
| 282 | Ga0105237_10866371 | 3300009545 | Bacteria | 910 |
| 283 | Ga0105238_10007543 | 3300009551 | Bacteria | 10893 |
| 284 | Ga0105249_10075013 | 3300009553 | Bacteria | 3132 |
| 285 | Ga0105239_10100855 | 3300010375 | Bacteria | 3194 |
| 286 | Ga0105239_10316310 | 3300010375 | Bacteria | 1760 |
| 287 | Ga0105239_10383179 | 3300010375 | Bacteria | 1590 |
| 288 | Ga0105246_10125023 | 3300011119 | Bacteria | 1912 |
| 289 | Ga0105246_10463951 | 3300011119 | Bacteria | 1067 |
| 290 | Ga0157316_1018409 | 3300012510 | Bacteria | 738 |
| 291 | Ga0157373_10018753 | 3300013100 | Bacteria | 5034 |
| 292 | Ga0157373_10021443 | 3300013100 | Bacteria | 4693 |
| 293 | Ga0157373_10174425 | 3300013100 | Bacteria | 1513 |
| 294 | Ga0157373_10552640 | 3300013100 | Bacteria | 835 |
| 295 | Ga0157371_10000228 | 3300013102 | Bacteria | 81797 |
| 296 | Ga0157371_10437407 | 3300013102 | Bacteria | 960 |
| 297 | Ga0157370_10004497 | 3300013104 | Bacteria | 15981 |
| 298 | Ga0157370_10009919 | 3300013104 | Bacteria | 10088 |
| 299 | Ga0157370_10025967 | 3300013104 | Bacteria | 5790 |
| 300 | Ga0157370_10026752 | 3300013104 | Bacteria | 5692 |
| 301 | Ga0157370_10064964 | 3300013104 | Bacteria | 3453 |
| 302 | Ga0157369_10001339 | 3300013105 | Bacteria | 30420 |
| 303 | Ga0157369_10069250 | 3300013105 | Bacteria | 3791 |
| 304 | Ga0157374_10040499 | 3300013296 | Bacteria | 4291 |
| 305 | Ga0157374_10082171 | 3300013296 | Bacteria | 3059 |
| 306 | Ga0157374_10432791 | 3300013296 | Bacteria | 1315 |
| 307 | Ga0157374_10529900 | 3300013296 | Bacteria | 1184 |
| 308 | Ga0157374_10969223 | 3300013296 | Bacteria | 869 |
| 309 | Ga0157378_10058168 | 3300013297 | Bacteria | 3447 |
| 310 | Ga0157378_10098654 | 3300013297 | Bacteria | 2664 |
| 311 | Ga0157378_12056440 | 3300013297 | Bacteria | 621 |
| 312 | Ga0163162_10027363 | 3300013306 | Bacteria | 5639 |
| 313 | Ga0163162_10420494 | 3300013306 | Bacteria | 1469 |
| 314 | Ga0163162_10704553 | 3300013306 | Bacteria | 1131 |
| 315 | Ga0163162_12754149 | 3300013306 | Bacteria | 566 |
| 316 | Ga0157372_10003161 | 3300013307 | Bacteria | 17754 |
| 317 | Ga0157372_10012931 | 3300013307 | Bacteria | 8898 |
| 318 | Ga0157372_10048886 | 3300013307 | Bacteria | 4701 |
| 319 | Ga0157372_10134589 | 3300013307 | Bacteria | 2845 |
| 320 | Ga0157372_10322599 | 3300013307 | Bacteria | 1798 |
| 321 | Ga0157372_10345199 | 3300013307 | Bacteria | 1734 |
| 322 | Ga0157372_10556880 | 3300013307 | Bacteria | 1336 |
| 323 | Ga0157372_10849500 | 3300013307 | Bacteria | 1060 |
| 324 | Ga0157375_10001806 | 3300013308 | Bacteria | 18332 |
| 325 | Ga0157375_10057807 | 3300013308 | Bacteria | 3835 |
| 326 | Ga0157375_10177219 | 3300013308 | Bacteria | 2282 |
| 327 | Ga0157375_10266678 | 3300013308 | Bacteria | 1874 |
| 328 | Ga0157375_10461970 | 3300013308 | Bacteria | 1435 |
| 329 | Ga0157375_11033190 | 3300013308 | Bacteria | 960 |
| 330 | Ga0163163_10170434 | 3300014325 | Bacteria | 2223 |
| 331 | Ga0163163_10535438 | 3300014325 | Bacteria | 1234 |
| 332 | Ga0163163_11420944 | 3300014325 | Bacteria | 755 |
| 333 | Ga0157380_10019617 | 3300014326 | Bacteria | 5040 |
| 334 | Ga0157380_10832430 | 3300014326 | Bacteria | 943 |
| 335 | Ga0157377_10000032 | 3300014745 | Bacteria | 121003 |
| 336 | Ga0157377_10048912 | 3300014745 | Bacteria | 2374 |
| 337 | Ga0157379_10001262 | 3300014968 | Bacteria | 20560 |
| 338 | Ga0157379_10003453 | 3300014968 | Bacteria | 13373 |
| 339 | Ga0157379_10077414 | 3300014968 | Bacteria | 2978 |
| 340 | Ga0157379_10125205 | 3300014968 | Bacteria | 2312 |
| 341 | Ga0157376_10416592 | 3300014969 | Bacteria | 1302 |
| 342 | Ga0157376_11978470 | 3300014969 | Bacteria | 620 |
| 343 | Ga0157376_12370891 | 3300014969 | Bacteria | 570 |
| 344 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 345 | Ga0163161_10030497 | 3300017792 | Bacteria | 3839 |
| 346 | Ga0163161_10320921 | 3300017792 | Bacteria | 1224 |
| 347 | Ga0207673_1017036 | 3300025290 | Bacteria | 968 |
| 348 | Ga0209051_1003446 | 3300025303 | Bacteria | 10364 |
| 349 | Ga0209257_1020496 | 3300025304 | Bacteria | 2441 |
| 350 | Ga0207697_10000237 | 3300025315 | Bacteria | 30060 |
| 351 | Ga0207656_10000916 | 3300025321 | Bacteria | 9617 |
| 352 | Ga0207656_10142107 | 3300025321 | Bacteria | 1132 |
| 353 | Ga0207682_10000059 | 3300025893 | Bacteria | 48172 |
| 354 | Ga0207682_10000203 | 3300025893 | Bacteria | 26888 |
| 355 | Ga0207692_10016249 | 3300025898 | Bacteria | 3291 |
| 356 | Ga0207642_10466740 | 3300025899 | Bacteria | 767 |
| 357 | Ga0207710_10044390 | 3300025900 | Bacteria | 1979 |
| 358 | Ga0207688_10000362 | 3300025901 | Bacteria | 21159 |
| 359 | Ga0207688_10515457 | 3300025901 | Bacteria | 750 |
| 360 | Ga0207680_10077134 | 3300025903 | Bacteria | 2083 |
| 361 | Ga0207680_10086904 | 3300025903 | Bacteria | 1978 |
| 362 | Ga0207680_10234132 | 3300025903 | Bacteria | 1263 |
| 363 | Ga0207680_10234417 | 3300025903 | Bacteria | 1262 |
| 364 | Ga0207647_10091523 | 3300025904 | Bacteria | 1814 |
| 365 | Ga0207699_10017799 | 3300025906 | Bacteria | 3751 |
| 366 | Ga0207645_10000407 | 3300025907 | Bacteria | 35586 |
| 367 | Ga0207645_10006246 | 3300025907 | Bacteria | 8560 |
| 368 | Ga0207645_10121750 | 3300025907 | Bacteria | 1694 |
| 369 | Ga0207645_10308135 | 3300025907 | Bacteria | 1055 |
| 370 | Ga0207643_10003120 | 3300025908 | Bacteria | 8914 |
| 371 | Ga0207643_10005194 | 3300025908 | Bacteria | 6965 |
| 372 | Ga0207643_10009218 | 3300025908 | Bacteria | 5300 |
| 373 | Ga0207705_10364539 | 3300025909 | Bacteria | 1115 |
| 374 | Ga0207654_10140450 | 3300025911 | Bacteria | 1539 |
| 375 | Ga0207654_10534414 | 3300025911 | Bacteria | 831 |
| 376 | Ga0207707_10209460 | 3300025912 | Bacteria | 1699 |
| 377 | Ga0207707_10228832 | 3300025912 | Bacteria | 1618 |
| 378 | Ga0207695_10023026 | 3300025913 | Bacteria | 7052 |
| 379 | Ga0207695_10049858 | 3300025913 | Bacteria | 4408 |
| 380 | Ga0207695_10321865 | 3300025913 | Bacteria | 1436 |
| 381 | Ga0207695_10355936 | 3300025913 | Bacteria | 1350 |
| 382 | Ga0207671_10142411 | 3300025914 | Bacteria | 1848 |
| 383 | Ga0207671_10414859 | 3300025914 | Bacteria | 1071 |
| 384 | Ga0207660_10164370 | 3300025917 | Bacteria | 1714 |
| 385 | Ga0207660_10538697 | 3300025917 | Bacteria | 949 |
| 386 | Ga0207662_10007415 | 3300025918 | Bacteria | 5971 |
| 387 | Ga0207662_11082769 | 3300025918 | Bacteria | 570 |
| 388 | Ga0207657_10001657 | 3300025919 | Bacteria | 24031 |
| 389 | Ga0207657_10012397 | 3300025919 | Bacteria | 8423 |
| 390 | Ga0207657_10023410 | 3300025919 | Bacteria | 5751 |
| 391 | Ga0207657_10027297 | 3300025919 | Bacteria | 5230 |
| 392 | Ga0207649_10004347 | 3300025920 | Bacteria | 7691 |
| 393 | Ga0207649_10017583 | 3300025920 | Bacteria | 4053 |
| 394 | Ga0207649_10034478 | 3300025920 | Bacteria | 3033 |
| 395 | Ga0207649_10232409 | 3300025920 | Bacteria | 1319 |
| 396 | Ga0207649_10373875 | 3300025920 | Bacteria | 1060 |
| 397 | Ga0207649_10665064 | 3300025920 | Bacteria | 806 |
| 398 | Ga0207652_10067951 | 3300025921 | Bacteria | 3091 |
| 399 | Ga0207652_10323300 | 3300025921 | Bacteria | 1393 |
| 400 | Ga0207652_10850963 | 3300025921 | Bacteria | 808 |
| 401 | Ga0207681_10019992 | 3300025923 | Bacteria | 4241 |
| 402 | Ga0207681_10111611 | 3300025923 | Bacteria | 1989 |
| 403 | Ga0207681_10539065 | 3300025923 | Bacteria | 959 |
| 404 | Ga0207681_10874420 | 3300025923 | Bacteria | 752 |
| 405 | Ga0207694_10007840 | 3300025924 | Bacteria | 8085 |
| 406 | Ga0207650_10002859 | 3300025925 | Bacteria | 11921 |
| 407 | Ga0207650_10004599 | 3300025925 | Bacteria | 9438 |
| 408 | Ga0207650_10039595 | 3300025925 | Bacteria | 3444 |
| 409 | Ga0207650_10152272 | 3300025925 | Bacteria | 1826 |
| 410 | Ga0207650_10212532 | 3300025925 | Bacteria | 1554 |
| 411 | Ga0207650_10217612 | 3300025925 | Bacteria | 1536 |
| 412 | Ga0207650_10367924 | 3300025925 | Bacteria | 1185 |
| 413 | Ga0207650_10463446 | 3300025925 | Bacteria | 1056 |
| 414 | Ga0207659_10070771 | 3300025926 | Bacteria | 2545 |
| 415 | Ga0207659_10300457 | 3300025926 | Bacteria | 1318 |
| 416 | Ga0207659_10521429 | 3300025926 | Bacteria | 1008 |
| 417 | Ga0207700_10078442 | 3300025928 | Bacteria | 2569 |
| 418 | Ga0207664_10003381 | 3300025929 | Bacteria | 10612 |
| 419 | Ga0207664_10062211 | 3300025929 | Bacteria | 2980 |
| 420 | Ga0207644_10000991 | 3300025931 | Bacteria | 18125 |
| 421 | Ga0207644_10003117 | 3300025931 | Bacteria | 10667 |
| 422 | Ga0207644_10022346 | 3300025931 | Bacteria | 4321 |
| 423 | Ga0207644_10044579 | 3300025931 | Bacteria | 3151 |
| 424 | Ga0207644_10053037 | 3300025931 | Bacteria | 2917 |
| 425 | Ga0207644_10058927 | 3300025931 | Bacteria | 2776 |
| 426 | Ga0207644_10109903 | 3300025931 | Bacteria | 2083 |
| 427 | Ga0207644_10283117 | 3300025931 | Bacteria | 1331 |
| 428 | Ga0207644_10526752 | 3300025931 | Bacteria | 977 |
| 429 | Ga0207690_10000837 | 3300025932 | Bacteria | 19691 |
| 430 | Ga0207690_10074183 | 3300025932 | Bacteria | 2356 |
| 431 | Ga0207690_10158828 | 3300025932 | Bacteria | 1683 |
| 432 | Ga0207690_10167937 | 3300025932 | Bacteria | 1641 |
| 433 | Ga0207690_10270068 | 3300025932 | Bacteria | 1321 |
| 434 | Ga0207690_10293804 | 3300025932 | Bacteria | 1269 |
| 435 | Ga0207690_10547410 | 3300025932 | Bacteria | 940 |
| 436 | Ga0207690_10624045 | 3300025932 | Bacteria | 881 |
| 437 | Ga0207706_10000014 | 3300025933 | Bacteria | 177082 |
| 438 | Ga0207706_10000486 | 3300025933 | Bacteria | 42324 |
| 439 | Ga0207706_10021040 | 3300025933 | Bacteria | 5860 |
| 440 | Ga0207706_10032489 | 3300025933 | Bacteria | 4648 |
| 441 | Ga0207706_10206669 | 3300025933 | Bacteria | 1722 |
| 442 | Ga0207706_10457979 | 3300025933 | Bacteria | 1103 |
| 443 | Ga0207709_10001051 | 3300025935 | Bacteria | 20412 |
| 444 | Ga0207670_10196906 | 3300025936 | Bacteria | 1528 |
| 445 | Ga0207670_10689843 | 3300025936 | Bacteria | 845 |
| 446 | Ga0207669_10015701 | 3300025937 | Bacteria | 3826 |
| 447 | Ga0207669_10036718 | 3300025937 | Bacteria | 2803 |
| 448 | Ga0207669_10724602 | 3300025937 | Bacteria | 819 |
| 449 | Ga0207704_10007005 | 3300025938 | Bacteria | 5296 |
| 450 | Ga0207704_10040706 | 3300025938 | Bacteria | 2719 |
| 451 | Ga0207704_10063437 | 3300025938 | Bacteria | 2303 |
| 452 | Ga0207691_10001188 | 3300025940 | Bacteria | 25899 |
| 453 | Ga0207691_10003887 | 3300025940 | Bacteria | 14504 |
| 454 | Ga0207691_10004275 | 3300025940 | Bacteria | 13875 |
| 455 | Ga0207691_10023447 | 3300025940 | Bacteria | 5810 |
| 456 | Ga0207691_10026911 | 3300025940 | Bacteria | 5396 |
| 457 | Ga0207691_10109650 | 3300025940 | Bacteria | 2456 |
| 458 | Ga0207691_10315707 | 3300025940 | Bacteria | 1340 |
| 459 | Ga0207711_10003826 | 3300025941 | Bacteria | 12946 |
| 460 | Ga0207711_10013604 | 3300025941 | Bacteria | 6760 |
| 461 | Ga0207711_10015597 | 3300025941 | Bacteria | 6306 |
| 462 | Ga0207711_10106255 | 3300025941 | Bacteria | 2491 |
| 463 | Ga0207711_10320982 | 3300025941 | Bacteria | 1431 |
| 464 | Ga0207711_10464991 | 3300025941 | Bacteria | 1178 |
| 465 | Ga0207711_10589185 | 3300025941 | Bacteria | 1037 |
| 466 | Ga0207711_10821868 | 3300025941 | Bacteria | 865 |
| 467 | Ga0207711_10825860 | 3300025941 | Bacteria | 863 |
| 468 | Ga0207711_11207785 | 3300025941 | Bacteria | 698 |
| 469 | Ga0207711_11503213 | 3300025941 | Bacteria | 616 |
| 470 | Ga0207689_10000468 | 3300025942 | Bacteria | 37877 |
| 471 | Ga0207689_10021262 | 3300025942 | Bacteria | 5455 |
| 472 | Ga0207689_10037438 | 3300025942 | Bacteria | 4023 |
| 473 | Ga0207689_10665793 | 3300025942 | Bacteria | 877 |
| 474 | Ga0207661_10035912 | 3300025944 | Bacteria | 3865 |
| 475 | Ga0207661_10056016 | 3300025944 | Bacteria | 3164 |
| 476 | Ga0207661_10422422 | 3300025944 | Bacteria | 1211 |
| 477 | Ga0207661_11431346 | 3300025944 | Bacteria | 634 |
| 478 | Ga0207679_10003858 | 3300025945 | Bacteria | 9298 |
| 479 | Ga0207679_10175984 | 3300025945 | Bacteria | 1766 |
| 480 | Ga0207679_10235097 | 3300025945 | Bacteria | 1549 |
| 481 | Ga0207679_10266911 | 3300025945 | Bacteria | 1462 |
| 482 | Ga0207679_10347343 | 3300025945 | Bacteria | 1292 |
| 483 | Ga0207679_10523135 | 3300025945 | Bacteria | 1061 |
| 484 | Ga0207679_11068954 | 3300025945 | Bacteria | 740 |
| 485 | Ga0207667_10001506 | 3300025949 | Bacteria | 29228 |
| 486 | Ga0207667_10009870 | 3300025949 | Bacteria | 11204 |
| 487 | Ga0207651_10012010 | 3300025960 | Bacteria | 4877 |
| 488 | Ga0207651_10028559 | 3300025960 | Bacteria | 3521 |
| 489 | Ga0207651_10033373 | 3300025960 | Bacteria | 3320 |
| 490 | Ga0207651_10057300 | 3300025960 | Bacteria | 2686 |
| 491 | Ga0207651_10791119 | 3300025960 | Bacteria | 840 |
| 492 | Ga0207651_10798769 | 3300025960 | Bacteria | 836 |
| 493 | Ga0207712_10199969 | 3300025961 | Bacteria | 1584 |
| 494 | Ga0207668_10017135 | 3300025972 | Bacteria | 4533 |
| 495 | Ga0207668_10259469 | 3300025972 | Bacteria | 1415 |
| 496 | Ga0207668_10436415 | 3300025972 | Bacteria | 1114 |
| 497 | Ga0207668_10889730 | 3300025972 | Bacteria | 792 |
| 498 | Ga0207668_10970657 | 3300025972 | Bacteria | 758 |
| 499 | Ga0207640_10026816 | 3300025981 | Bacteria | 3503 |
| 500 | Ga0207640_10118133 | 3300025981 | Bacteria | 1894 |
| 501 | Ga0207640_11494608 | 3300025981 | Bacteria | 607 |
| 502 | Ga0207658_10009698 | 3300025986 | Bacteria | 6536 |
| 503 | Ga0207658_10024430 | 3300025986 | Bacteria | 4228 |
| 504 | Ga0207658_10091867 | 3300025986 | Bacteria | 2356 |
| 505 | Ga0207658_10219113 | 3300025986 | Bacteria | 1600 |
| 506 | Ga0207658_10490356 | 3300025986 | Bacteria | 1093 |
| 507 | Ga0207658_10815514 | 3300025986 | Bacteria | 847 |
| 508 | Ga0207658_11357196 | 3300025986 | Bacteria | 650 |
| 509 | Ga0207677_10088754 | 3300026023 | Bacteria | 2243 |
| 510 | Ga0207677_10123367 | 3300026023 | Bacteria | 1953 |
| 511 | Ga0207677_10280257 | 3300026023 | Bacteria | 1368 |
| 512 | Ga0207677_10459309 | 3300026023 | Bacteria | 1093 |
| 513 | Ga0207677_11069650 | 3300026023 | Bacteria | 734 |
| 514 | Ga0207703_10024981 | 3300026035 | Bacteria | 4699 |
| 515 | Ga0207703_10049969 | 3300026035 | Bacteria | 3382 |
| 516 | Ga0207703_10059509 | 3300026035 | Bacteria | 3120 |
| 517 | Ga0207703_10061814 | 3300026035 | Bacteria | 3067 |
| 518 | Ga0207639_10061501 | 3300026041 | Bacteria | 2901 |
| 519 | Ga0207639_10096743 | 3300026041 | Bacteria | 2376 |
| 520 | Ga0207639_10214445 | 3300026041 | Bacteria | 1659 |
| 521 | Ga0207639_10593689 | 3300026041 | Bacteria | 1021 |
| 522 | Ga0207639_11107964 | 3300026041 | Bacteria | 742 |
| 523 | Ga0207639_11252630 | 3300026041 | Bacteria | 696 |
| 524 | Ga0207678_10001272 | 3300026067 | Bacteria | 23314 |
| 525 | Ga0207678_10002753 | 3300026067 | Bacteria | 15920 |
| 526 | Ga0207678_10035695 | 3300026067 | Bacteria | 4329 |
| 527 | Ga0207678_10157206 | 3300026067 | Bacteria | 1941 |
| 528 | Ga0207678_10591625 | 3300026067 | Bacteria | 972 |
| 529 | Ga0207708_10000650 | 3300026075 | Bacteria | 26677 |
| 530 | Ga0207708_10185694 | 3300026075 | Bacteria | 1652 |
| 531 | Ga0207708_10820976 | 3300026075 | Bacteria | 801 |
| 532 | Ga0207702_10006552 | 3300026078 | Bacteria | 10017 |
| 533 | Ga0207702_10016238 | 3300026078 | Bacteria | 6161 |
| 534 | Ga0207702_11076942 | 3300026078 | Bacteria | 798 |
| 535 | Ga0207641_10044803 | 3300026088 | Bacteria | 3721 |
| 536 | Ga0207641_10059200 | 3300026088 | Bacteria | 3261 |
| 537 | Ga0207641_10178458 | 3300026088 | Bacteria | 1943 |
| 538 | Ga0207641_10355973 | 3300026088 | Bacteria | 1396 |
| 539 | Ga0207641_10805647 | 3300026088 | Bacteria | 929 |
| 540 | Ga0207641_10925608 | 3300026088 | Bacteria | 866 |
| 541 | Ga0207648_10000790 | 3300026089 | Bacteria | 35657 |
| 542 | Ga0207648_10001780 | 3300026089 | Bacteria | 23603 |
| 543 | Ga0207648_10001903 | 3300026089 | Bacteria | 22822 |
| 544 | Ga0207648_10208927 | 3300026089 | Bacteria | 1732 |
| 545 | Ga0207648_10226970 | 3300026089 | Bacteria | 1661 |
| 546 | Ga0207648_10609498 | 3300026089 | Bacteria | 1007 |
| 547 | Ga0207676_10040308 | 3300026095 | Bacteria | 3579 |
| 548 | Ga0207676_10042494 | 3300026095 | Bacteria | 3497 |
| 549 | Ga0207676_10089512 | 3300026095 | Bacteria | 2522 |
| 550 | Ga0207676_10151579 | 3300026095 | Bacteria | 1997 |
| 551 | Ga0207674_10000020 | 3300026116 | Bacteria | 162474 |
| 552 | Ga0207674_10000769 | 3300026116 | Bacteria | 41860 |
| 553 | Ga0207674_10611643 | 3300026116 | Bacteria | 1052 |
| 554 | Ga0207675_100003290 | 3300026118 | Bacteria | 15823 |
| 555 | Ga0207675_100099444 | 3300026118 | Bacteria | 2739 |
| 556 | Ga0207675_102258999 | 3300026118 | Bacteria | 558 |
| 557 | Ga0207683_10000170 | 3300026121 | Bacteria | 56059 |
| 558 | Ga0207683_10004396 | 3300026121 | Bacteria | 12182 |
| 559 | Ga0207683_10050242 | 3300026121 | Bacteria | 3652 |
| 560 | Ga0207683_10316434 | 3300026121 | Bacteria | 1429 |
| 561 | Ga0207698_10003199 | 3300026142 | Bacteria | 9829 |
| 562 | Ga0207698_10068931 | 3300026142 | Bacteria | 2795 |
| 563 | Ga0207698_10201862 | 3300026142 | Bacteria | 1781 |
| 564 | Ga0207698_10432361 | 3300026142 | Bacteria | 1266 |
| 565 | Ga0207698_10448922 | 3300026142 | Bacteria | 1244 |
| 566 | Ga0207698_11398871 | 3300026142 | Bacteria | 715 |
| 567 | Ga0207698_12184961 | 3300026142 | Bacteria | 566 |
| 568 | Ga0209982_1023903 | 3300027552 | Bacteria | 946 |
| 569 | Ga0209970_1002539 | 3300027614 | Bacteria | 3093 |
| 570 | Ga0209971_1032422 | 3300027682 | Bacteria | 1254 |
| 571 | Ga0209813_10002074 | 3300027866 | Bacteria | 4555 |
| 572 | Ga0209974_10008587 | 3300027876 | Bacteria | 3488 |
| 573 | Ga0209974_10035220 | 3300027876 | Bacteria | 1662 |
| 574 | Ga0207428_10275602 | 3300027907 | Bacteria | 1250 |
| 575 | Ga0268266_10003715 | 3300028379 | Bacteria | 15019 |
| 576 | Ga0268266_10249989 | 3300028379 | Bacteria | 1639 |
| 577 | Ga0268266_10414528 | 3300028379 | Bacteria | 1276 |
| 578 | Ga0268266_10505674 | 3300028379 | Bacteria | 1154 |
| 579 | Ga0268265_10520221 | 3300028380 | Bacteria | 1124 |
| 580 | Ga0268264_10103364 | 3300028381 | Bacteria | 2481 |
| 581 | Ga0268264_10371939 | 3300028381 | Bacteria | 1366 |
| 582 | Ga0268264_10614334 | 3300028381 | Bacteria | 1073 |
| 583 | Ga0268264_10697939 | 3300028381 | Bacteria | 1008 |
| 584 | Ga0307517_10221513 | 3300028786 | Bacteria | 1149 |
| 585 | Ga0307515_10070717 | 3300028794 | Bacteria | 4744 |
| 586 | Ga0307513_10071439 | 3300031456 | Bacteria | 3622 |
| 587 | Ga0307408_100434930 | 3300031548 | Bacteria | 1135 |
| 588 | Ga0265314_10052900 | 3300031711 | Bacteria | 2820 |
| 589 | Ga0307516_10001407 | 3300031730 | Bacteria | 33232 |
| 590 | Ga0307405_10296149 | 3300031731 | Bacteria | 1225 |
| 591 | Ga0307405_11399538 | 3300031731 | Bacteria | 611 |
| 592 | Ga0316577_10010632 | 3300031733 | Bacteria | 4973 |
| 593 | Ga0307413_10251883 | 3300031824 | Bacteria | 1310 |
| 594 | Ga0307410_10006187 | 3300031852 | Bacteria | 6431 |
| 595 | Ga0307410_10795009 | 3300031852 | Bacteria | 804 |
| 596 | Ga0307407_10011388 | 3300031903 | Bacteria | 4232 |
| 597 | Ga0307412_11235791 | 3300031911 | Bacteria | 670 |
| 598 | Ga0307409_100167196 | 3300031995 | Bacteria | 1931 |
| 599 | Ga0307409_101239130 | 3300031995 | Bacteria | 770 |
| 600 | Ga0307416_100555362 | 3300032002 | Bacteria | 1222 |
| 601 | Ga0307416_101225842 | 3300032002 | Bacteria | 856 |
| 602 | Ga0307416_101963368 | 3300032002 | Bacteria | 688 |
| 603 | Ga0307414_10066774 | 3300032004 | Bacteria | 2573 |
| 604 | Ga0307411_10003633 | 3300032005 | Bacteria | 7210 |
| 605 | Ga0307415_100337589 | 3300032126 | Bacteria | 1263 |
| 606 | Ga0373930_0084915 | 3300034816 | Bacteria | 736 |
| 607 | Ga0373940_0380984 | 3300035088 | Bacteria | 500 |
| 608 | Ga0373949_0108164 | 3300035090 | Bacteria | 769 |
| 609 | Ga0373954_0333030 | 3300035118 | Bacteria | 749 |
| 610 | Ga0373943_0281323 | 3300035170 | Bacteria | 941 |
| 611 | Ga0373955_0301755 | 3300035172 | Bacteria | 966 |
| 612 | Ga0373935_0526039 | 3300035692 | Bacteria | 860 |
| 613 | Ga0373933_0142857 | 3300035724 | Bacteria | 1512 |
| 614 | Ga0373933_0464782 | 3300035724 | Bacteria | 828 |
| 615 | Ga0373937_0361569 | 3300036401 | Bacteria | 1375 |
| 616 | Ga0373937_0609217 | 3300036401 | Bacteria | 1037 |
| 617 | Ga0395899_0291734 | 3300037312 | Bacteria | 1106 |
| 618 | Ga0395900_0045365 | 3300037418 | Bacteria | 4528 |
| 619 | Ga0395898_0283198 | 3300037466 | Bacteria | 1581 |
| 620 | Ga0395905_0170223 | 3300037471 | Bacteria | 2046 |
| 621 | Ga0395901_0175307 | 3300038443 | Bacteria | 2249 |
| 622 | Ga0395901_1380088 | 3300038443 | Bacteria | 664 |
| 623 | Ga0400487_24476 | 3300039110 | Bacteria | 32520 |
| 624 | Ga0451847_0032384 | 3300041503 | Bacteria | 764 |
| 625 | Ga0439433_0128000 | 3300041999 | Bacteria | 644 |
| 626 | Ga0439432_095221 | 3300042006 | Bacteria | 894 |
| 627 | Ga0439446_0086139 | 3300042156 | Bacteria | 978 |
| 628 | Ga0439434_0027955 | 3300042435 | Bacteria | 1707 |
| 629 | Ga0439435_0177806 | 3300042436 | Bacteria | 694 |
| 630 | Ga0450893_0039994 | 3300042532 | Bacteria | 857 |
| 631 | Ga0451577_0199148 | 3300042876 | Bacteria | 1808 |
| 632 | Ga0453683_1167688 | 3300044673 | Bacteria | 515 |
| 633 | Ga0466963_0440725 | 3300044694 | Bacteria | 919 |
| 634 | Ga0466964_0038869 | 3300044706 | Bacteria | 1915 |
| 635 | Ga0453684_1787323 | 3300044712 | Bacteria | 625 |
| 636 | Ga0466960_0057022 | 3300044901 | Bacteria | 1903 |
| 637 | Ga0466967_1348845 | 3300045976 | Bacteria | 710 |
| 638 | Ga0495629_0653271 | 3300046459 | Bacteria | 701 |
| 639 | Ga0495638_0185393 | 3300046460 | Bacteria | 1184 |
| 640 | Ga0495651_0210621 | 3300046462 | Bacteria | 1353 |
| 641 | Ga0495580_0099435 | 3300046472 | Bacteria | 2024 |
| 642 | Ga0495639_0027818 | 3300046475 | Bacteria | 2503 |
| 643 | Ga0495618_0304135 | 3300046514 | Bacteria | 991 |
| 644 | Ga0495628_0162644 | 3300046516 | Bacteria | 1696 |
| 645 | Ga0495632_0149053 | 3300046519 | Bacteria | 1082 |
| 646 | Ga0495586_0267458 | 3300046535 | Bacteria | 977 |
| 647 | Ga0495625_0605781 | 3300046660 | Bacteria | 657 |
| 648 | Ga0495600_0646228 | 3300046809 | Bacteria | 640 |
| 649 | Ga0496100_0071661 | 3300048903 | Bacteria | 2314 |
| 650 | Ga0496100_0283197 | 3300048903 | Bacteria | 1236 |
| 651 | Ga0496101_0005661 | 3300048904 | Bacteria | 7971 |
| 652 | Ga0496101_1106689 | 3300048904 | Bacteria | 622 |
| 653 | Ga0496102_0001837 | 3300048905 | Bacteria | 18347 |
| 654 | Ga0496102_0670851 | 3300048905 | Bacteria | 960 |
| 655 | Ga0496103_0189967 | 3300048906 | Bacteria | 1321 |
| 656 | Ga0496104_0421698 | 3300048907 | Bacteria | 1246 |
| 657 | Ga0496105_0004196 | 3300048908 | Bacteria | 10822 |
| 658 | Ga0496105_0193083 | 3300048908 | Bacteria | 1664 |
| 659 | Ga0496106_0001298 | 3300048909 | Bacteria | 18768 |
| 660 | Ga0496106_0061077 | 3300048909 | Bacteria | 2858 |
| 661 | Ga0496107_0039852 | 3300048910 | Bacteria | 3370 |
| 662 | Ga0496107_0547220 | 3300048910 | Bacteria | 857 |
| 663 | Ga0496108_0045525 | 3300048911 | Bacteria | 3665 |
| 664 | Ga0496108_0156924 | 3300048911 | Bacteria | 1965 |
| 665 | Ga0496108_0165028 | 3300048911 | Bacteria | 1915 |
| 666 | Ga0496108_0485409 | 3300048911 | Bacteria | 1079 |
| 667 | Ga0496109_0137535 | 3300048912 | Bacteria | 2283 |
| 668 | Ga0496109_0416688 | 3300048912 | Bacteria | 1269 |
| 669 | Ga0496109_1602704 | 3300048912 | Bacteria | 585 |
| 670 | Ga0496110_0028281 | 3300048913 | Bacteria | 4814 |
| 671 | Ga0496110_0386624 | 3300048913 | Bacteria | 1275 |
| 672 | Ga0496110_0882286 | 3300048913 | Bacteria | 800 |
| 673 | Ga0496110_1060855 | 3300048913 | Bacteria | 718 |
| 674 | Ga0496110_1281321 | 3300048913 | Bacteria | 642 |
| 675 | Ga0496111_0499287 | 3300048914 | Bacteria | 896 |
| 676 | Ga0496112_0004682 | 3300048915 | Bacteria | 11639 |
| 677 | Ga0496112_0013189 | 3300048915 | Bacteria | 7625 |
| 678 | Ga0496112_0920539 | 3300048915 | Bacteria | 796 |
| 679 | Ga0496113_0178682 | 3300048916 | Bacteria | 1682 |
| 680 | Ga0496113_0259091 | 3300048916 | Bacteria | 1389 |
| 681 | Ga0496114_0252923 | 3300048917 | Bacteria | 1550 |
| 682 | Ga0496114_0567162 | 3300048917 | Bacteria | 1002 |
| 683 | Ga0496115_0445171 | 3300048918 | Bacteria | 1047 |
| 684 | Ga0496122_0031207 | 3300048925 | Bacteria | 4441 |
| 685 | Ga0496123_0101350 | 3300048926 | Bacteria | 1674 |
| 686 | Ga0496124_0038111 | 3300048927 | Bacteria | 4175 |
| 687 | Ga0496126_0118975 | 3300048929 | Bacteria | 2293 |
| 688 | Ga0501034_0103580 | 3300049571 | Bacteria | 2839 |
| 689 | Ga0501038_0442894 | 3300049574 | Bacteria | 1000 |
| 690 | Ga0501043_0281422 | 3300049579 | Bacteria | 1275 |
| 691 | Ga0501046_0159879 | 3300049580 | Bacteria | 1695 |
| 692 | Ga0501047_0384104 | 3300049581 | Bacteria | 1238 |
| 693 | Ga0501068_0253599 | 3300049584 | Bacteria | 1122 |
| 694 | Ga0501072_0511435 | 3300049588 | Bacteria | 950 |
| 695 | Ga0501073_0516134 | 3300049589 | Bacteria | 826 |
| 696 | Ga0501241_055227 | 3300049758 | Bacteria | 790 |
| 697 | Ga0501035_0320439 | 3300049822 | Bacteria | 1302 |
| 698 | Ga0501044_0452432 | 3300049823 | Bacteria | 1190 |
| 699 | nmdc:mga03683_3317_c1 | 3300050489 | Bacteria | 5170 |
| 700 | nmdc:mga03683_89830_c1 | 3300050489 | Bacteria | 1338 |
| 701 | nmdc:mga03n38_186883_c1 | 3300050490 | Bacteria | 1065 |
| 702 | nmdc:mga03n38_854280_c1 | 3300050490 | Bacteria | 532 |
| 703 | nmdc:mga03n38_94418_c1 | 3300050490 | Bacteria | 1431 |
| 704 | nmdc:mga00v17_20264_c1 | 3300050491 | Bacteria | 3807 |
| 705 | nmdc:mga0yw44_54687_c1 | 3300050492 | Bacteria | 2427 |
| 706 | nmdc:mga0k408_15682_c1 | 3300050493 | Bacteria | 4194 |
| 707 | nmdc:mga0k408_180_c1 | 3300050493 | Bacteria | 33189 |
| 708 | nmdc:mga0k408_1901_c1 | 3300050493 | Bacteria | 11173 |
| 709 | nmdc:mga0k408_2769_c1 | 3300050493 | Bacteria | 9320 |
| 710 | nmdc:mga06z11_207697_c1 | 3300050494 | Bacteria | 1140 |
| 711 | nmdc:mga06z11_30142_c1 | 3300050494 | Bacteria | 2622 |
| 712 | nmdc:mga04h51_16959_c1 | 3300050495 | Bacteria | 2122 |
| 713 | nmdc:mga04h51_93716_c1 | 3300050495 | Bacteria | 1084 |
| 714 | nmdc:mga07m45_225995_c1 | 3300050496 | Bacteria | 1089 |
| 715 | nmdc:mga07m45_260_c1 | 3300050496 | Bacteria | 21450 |
| 716 | nmdc:mga07m45_293840_c1 | 3300050496 | Bacteria | 945 |
| 717 | nmdc:mga07m45_452398_c1 | 3300050496 | Bacteria | 745 |
| 718 | nmdc:mga07m45_4942_c1 | 3300050496 | Bacteria | 6572 |
| 719 | nmdc:mga05p37_1073528_c1 | 3300050507 | Bacteria | 846 |
| 720 | nmdc:mga09592_714568_c1 | 3300050508 | Bacteria | 852 |
| 721 | nmdc:mga06r32_935035_c1 | 3300050510 | Bacteria | 822 |
| 722 | nmdc:mga08y16_72716_c1 | 3300050511 | Bacteria | 3583 |
| 723 | nmdc:mga0n895_1140852_c1 | 3300050512 | Bacteria | 755 |
| 724 | nmdc:mga0n895_725427_c1 | 3300050512 | Bacteria | 988 |
| 725 | nmdc:mga08x19_97942_c1 | 3300050514 | Bacteria | 1942 |
| 726 | nmdc:mga0sz30_186555_c1 | 3300050516 | Bacteria | 921 |
| 727 | nmdc:mga0sz30_70874_c1 | 3300050516 | Bacteria | 1500 |
| 728 | Ga0495619_0139960 | 3300053085 | Bacteria | 1666 |
| 729 | Ga0500644_0069331 | 3300053088 | Bacteria | 1266 |
| 730 | Ga0500646_0023215 | 3300053090 | Bacteria | 1662 |
| 731 | Ga0500583_0058484 | 3300053092 | Bacteria | 1813 |
| 732 | Ga0500583_0149219 | 3300053092 | Bacteria | 1163 |
| 733 | Ga0500641_0354935 | 3300053096 | Bacteria | 588 |
| 734 | Ga0500650_0149800 | 3300053098 | Bacteria | 1079 |
| 735 | Ga0500650_0212710 | 3300053098 | Bacteria | 877 |
| 736 | Ga0500594_0004456 | 3300053118 | Bacteria | 3087 |
| 737 | Ga0500642_0030478 | 3300053130 | Bacteria | 2245 |
| 738 | Ga0500655_011334 | 3300053133 | Bacteria | 1614 |
| 739 | Ga0500568_0023510 | 3300053139 | Bacteria | 2621 |
| 740 | Ga0500577_0020647 | 3300053142 | Bacteria | 2159 |
| 741 | Ga0500586_080182 | 3300053145 | Bacteria | 1145 |
| 742 | Ga0500604_0003317 | 3300053151 | Bacteria | 4332 |
| 743 | Ga0500616_0123281 | 3300053153 | Bacteria | 1234 |
| 744 | Ga0500645_017536 | 3300053730 | Bacteria | 2242 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042435 | Ga0439434_0027955 | Ga0439434_0027955_389_847 | 92 |
| 2 | 3300005546 | Ga0070696_101882501 | Ga0070696_1018825011 | 94 |
| 3 | 3300005355 | Ga0070671_100005899 | Ga0070671_1000058993 | 97 |
| 4 | 3300005618 | Ga0068864_100380204 | Ga0068864_1003802041 | 97 |
| 5 | 3300005841 | Ga0068863_100128979 | Ga0068863_1001289791 | 97 |
| 6 | 3300009101 | Ga0105247_10141463 | Ga0105247_101414631 | 97 |
| 7 | 3300009177 | Ga0105248_10017366 | Ga0105248_100173664 | 97 |
| 8 | 3300025931 | Ga0207644_10053037 | Ga0207644_100530373 | 98 |
| 9 | 3300025941 | Ga0207711_10013604 | Ga0207711_100136047 | 98 |
| 10 | 3300026088 | Ga0207641_10355973 | Ga0207641_103559732 | 98 |
| 11 | 3300026095 | Ga0207676_10151579 | Ga0207676_101515792 | 98 |
| 12 | 3300048907 | Ga0496104_0421698 | Ga0496104_0421698_73_540 | 98 |
| 13 | 3300048908 | Ga0496105_0193083 | Ga0496105_0193083_971_1438 | 98 |
| 14 | 3300048911 | Ga0496108_0045525 | Ga0496108_0045525_387_854 | 98 |
| 15 | 3300048915 | Ga0496112_0004682 | Ga0496112_0004682_7408_7875 | 98 |
| 16 | 3300048916 | Ga0496113_0178682 | Ga0496113_0178682_150_617 | 98 |
| 17 | 3300028794 | Ga0307515_10070717 | Ga0307515_100707174 | 102 |
| 18 | 3300046460 | Ga0495638_0185393 | Ga0495638_0185393_267_713 | 102 |
| 19 | 3300046519 | Ga0495632_0149053 | Ga0495632_0149053_362_811 | 102 |
| 20 | 3300053092 | Ga0500583_0058484 | Ga0500583_0058484_617_1063 | 102 |
| 21 | 3300053098 | Ga0500650_0149800 | Ga0500650_0149800_352_798 | 102 |
| 22 | 3300006931 | Ga0097620_101257159 | Ga0097620_1012571592 | 106 |
| 23 | 3300006038 | Ga0075365_10003706 | Ga0075365_100037067 | 111 |
| 24 | 3300006042 | Ga0075368_10027148 | Ga0075368_100271482 | 111 |
| 25 | 3300006048 | Ga0075363_100571815 | Ga0075363_1005718151 | 111 |
| 26 | 3300006178 | Ga0075367_10010956 | Ga0075367_100109565 | 111 |
| 27 | 3300006353 | Ga0075370_10025431 | Ga0075370_100254312 | 111 |
| 28 | 3300053096 | Ga0500641_0354935 | Ga0500641_0354935_21_452 | 112 |
| 29 | 3300025303 | Ga0209051_1003446 | Ga0209051_100344610 | 113 |
| 30 | 3300025304 | Ga0209257_1020496 | Ga0209257_10204962 | 113 |
| 31 | 3300005841 | Ga0068863_100477094 | Ga0068863_1004770942 | 114 |
| 32 | 3300009148 | Ga0105243_10000717 | Ga0105243_100007179 | 114 |
| 33 | 3300014745 | Ga0157377_10000032 | Ga0157377_1000003277 | 114 |
| 34 | 3300025935 | Ga0207709_10001051 | Ga0207709_100010515 | 114 |
| 35 | 3300026088 | Ga0207641_10805647 | Ga0207641_108056471 | 114 |
| 36 | 3300026089 | Ga0207648_10000790 | Ga0207648_100007908 | 114 |
| 37 | 3300032002 | Ga0307416_101225842 | Ga0307416_1012258422 | 114 |
| 38 | 3300005335 | Ga0070666_10724877 | Ga0070666_107248771 | 115 |
| 39 | 3300031711 | Ga0265314_10052900 | Ga0265314_100529004 | 115 |
| 40 | 3300053090 | Ga0500646_0023215 | Ga0500646_0023215_829_1287 | 115 |
| 41 | 3300053092 | Ga0500583_0149219 | Ga0500583_0149219_143_601 | 115 |
| 42 | 3300053098 | Ga0500650_0212710 | Ga0500650_0212710_327_785 | 115 |
| 43 | 3300053130 | Ga0500642_0030478 | Ga0500642_0030478_269_727 | 115 |
| 44 | 3300053133 | Ga0500655_011334 | Ga0500655_011334_333_791 | 115 |
| 45 | 3300053139 | Ga0500568_0023510 | Ga0500568_0023510_1862_2320 | 115 |
| 46 | 3300053142 | Ga0500577_0020647 | Ga0500577_0020647_1627_2091 | 115 |
| 47 | 3300053151 | Ga0500604_0003317 | Ga0500604_0003317_2723_3181 | 115 |
| 48 | 3300053730 | Ga0500645_017536 | Ga0500645_017536_98_556 | 115 |
| 49 | 3300005329 | Ga0070683_100265746 | Ga0070683_1002657462 | 116 |
| 50 | 3300005330 | Ga0070690_100025876 | Ga0070690_1000258762 | 116 |
| 51 | 3300005331 | Ga0070670_100144933 | Ga0070670_1001449333 | 116 |
| 52 | 3300005334 | Ga0068869_100060461 | Ga0068869_1000604614 | 116 |
| 53 | 3300005355 | Ga0070671_100004694 | Ga0070671_1000046947 | 116 |
| 54 | 3300005364 | Ga0070673_100072245 | Ga0070673_1000722453 | 116 |
| 55 | 3300005367 | Ga0070667_101460580 | Ga0070667_1014605801 | 116 |
| 56 | 3300005456 | Ga0070678_100314447 | Ga0070678_1003144472 | 116 |
| 57 | 3300005457 | Ga0070662_100027760 | Ga0070662_1000277605 | 116 |
| 58 | 3300005457 | Ga0070662_100564625 | Ga0070662_1005646252 | 116 |
| 59 | 3300005543 | Ga0070672_100053025 | Ga0070672_1000530254 | 116 |
| 60 | 3300005548 | Ga0070665_101135543 | Ga0070665_1011355431 | 116 |
| 61 | 3300005616 | Ga0068852_100444949 | Ga0068852_1004449493 | 116 |
| 62 | 3300005719 | Ga0068861_100105613 | Ga0068861_1001056134 | 116 |
| 63 | 3300005843 | Ga0068860_100295570 | Ga0068860_1002955702 | 116 |
| 64 | 3300005844 | Ga0068862_101258900 | Ga0068862_1012589001 | 116 |
| 65 | 3300006237 | Ga0097621_100036310 | Ga0097621_1000363102 | 116 |
| 66 | 3300006358 | Ga0068871_100023453 | Ga0068871_1000234535 | 116 |
| 67 | 3300009098 | Ga0105245_10752605 | Ga0105245_107526052 | 116 |
| 68 | 3300009177 | Ga0105248_10008736 | Ga0105248_100087368 | 116 |
| 69 | 3300011119 | Ga0105246_10125023 | Ga0105246_101250232 | 116 |
| 70 | 3300013296 | Ga0157374_10529900 | Ga0157374_105299002 | 116 |
| 71 | 3300013297 | Ga0157378_10058168 | Ga0157378_100581682 | 116 |
| 72 | 3300013297 | Ga0157378_12056440 | Ga0157378_120564401 | 116 |
| 73 | 3300013308 | Ga0157375_10461970 | Ga0157375_104619701 | 116 |
| 74 | 3300025901 | Ga0207688_10515457 | Ga0207688_105154572 | 116 |
| 75 | 3300025925 | Ga0207650_10039595 | Ga0207650_100395953 | 116 |
| 76 | 3300025925 | Ga0207650_10463446 | Ga0207650_104634462 | 116 |
| 77 | 3300025931 | Ga0207644_10000991 | Ga0207644_100009915 | 116 |
| 78 | 3300025933 | Ga0207706_10457979 | Ga0207706_104579792 | 116 |
| 79 | 3300025941 | Ga0207711_10003826 | Ga0207711_100038268 | 116 |
| 80 | 3300025941 | Ga0207711_10320982 | Ga0207711_103209822 | 116 |
| 81 | 3300025942 | Ga0207689_10037438 | Ga0207689_100374382 | 116 |
| 82 | 3300025944 | Ga0207661_10422422 | Ga0207661_104224221 | 116 |
| 83 | 3300025945 | Ga0207679_10235097 | Ga0207679_102350972 | 116 |
| 84 | 3300025960 | Ga0207651_10033373 | Ga0207651_100333734 | 116 |
| 85 | 3300026023 | Ga0207677_10459309 | Ga0207677_104593092 | 116 |
| 86 | 3300026088 | Ga0207641_10925608 | Ga0207641_109256081 | 116 |
| 87 | 3300026118 | Ga0207675_100099444 | Ga0207675_1000994444 | 116 |
| 88 | 3300026121 | Ga0207683_10050242 | Ga0207683_100502422 | 116 |
| 89 | 3300026121 | Ga0207683_10316434 | Ga0207683_103164342 | 116 |
| 90 | 3300026142 | Ga0207698_11398871 | Ga0207698_113988711 | 116 |
| 91 | 3300028379 | Ga0268266_10414528 | Ga0268266_104145282 | 116 |
| 92 | 3300028381 | Ga0268264_10103364 | Ga0268264_101033643 | 116 |
| 93 | 3300031730 | Ga0307516_10001407 | Ga0307516_1000140726 | 116 |
| 94 | 3300035118 | Ga0373954_0333030 | Ga0373954_0333030_13_462 | 116 |
| 95 | 3300042436 | Ga0439435_0177806 | Ga0439435_0177806_21_527 | 116 |
| 96 | 3300046462 | Ga0495651_0210621 | Ga0495651_0210621_584_1057 | 116 |
| 97 | 3300046475 | Ga0495639_0027818 | Ga0495639_0027818_724_1197 | 116 |
| 98 | 3300046514 | Ga0495618_0304135 | Ga0495618_0304135_283_732 | 116 |
| 99 | 3300046516 | Ga0495628_0162644 | Ga0495628_0162644_1148_1597 | 116 |
| 100 | 3300046535 | Ga0495586_0267458 | Ga0495586_0267458_39_488 | 116 |
| 101 | 3300046809 | Ga0495600_0646228 | Ga0495600_0646228_116_565 | 116 |
| 102 | 3300048911 | Ga0496108_0485409 | Ga0496108_0485409_508_960 | 116 |
| 103 | 3300050496 | nmdc:mga07m45_225995_c1 | nmdc:mga07m45_225995_c1_171_641 | 116 |
| 104 | 3300005331 | Ga0070670_100314225 | Ga0070670_1003142251 | 117 |
| 105 | 3300005459 | Ga0068867_100693266 | Ga0068867_1006932662 | 117 |
| 106 | 3300025925 | Ga0207650_10217612 | Ga0207650_102176122 | 117 |
| 107 | 3300041999 | Ga0439433_0128000 | Ga0439433_0128000_145_600 | 117 |
| 108 | 3300006177 | Ga0075362_10046064 | Ga0075362_100460643 | 118 |
| 109 | 3300012510 | Ga0157316_1018409 | Ga0157316_10184091 | 118 |
| 110 | 3300042006 | Ga0439432_095221 | Ga0439432_095221_311_781 | 118 |
| 111 | 3300042156 | Ga0439446_0086139 | Ga0439446_0086139_365_835 | 118 |
| 112 | 3300042532 | Ga0450893_0039994 | Ga0450893_0039994_351_821 | 118 |
| 113 | 3300046459 | Ga0495629_0653271 | Ga0495629_0653271_68_520 | 118 |
| 114 | 3300050489 | nmdc:mga03683_3317_c1 | nmdc:mga03683_3317_c1_3682_4152 | 118 |
| 115 | 3300050490 | nmdc:mga03n38_186883_c1 | nmdc:mga03n38_186883_c1_441_911 | 118 |
| 116 | iso_pu_bacteria | 2932422444 | 2932425454 | 118 |
| 117 | 3300006186 | Ga0075369_10503377 | Ga0075369_105033771 | 119 |
| 118 | 3300026075 | Ga0207708_10820976 | Ga0207708_108209761 | 119 |
| 119 | 3300035724 | Ga0373933_0142857 | Ga0373933_0142857_930_1391 | 119 |
| 120 | 3300036401 | Ga0373937_0609217 | Ga0373937_0609217_353_814 | 119 |
| 121 | 3300053145 | Ga0500586_080182 | Ga0500586_080182_437_889 | 119 |
| 122 | 3300053153 | Ga0500616_0123281 | Ga0500616_0123281_627_1082 | 119 |
| 123 | iso_pu_bacteria | 2831265667 | 2831269799 | 119 |
| 124 | iso_pu_bacteria | 2842733646 | 2842734024 | 119 |
| 125 | iso_pu_bacteria | 2842747753 | 2842749696 | 119 |
| 126 | iso_pu_bacteria | 2928115317 | 2928117226 | 119 |
| 127 | 3300005331 | Ga0070670_100065242 | Ga0070670_1000652424 | 120 |
| 128 | 3300005543 | Ga0070672_100553560 | Ga0070672_1005535601 | 120 |
| 129 | 3300005618 | Ga0068864_100353945 | Ga0068864_1003539452 | 120 |
| 130 | 3300005719 | Ga0068861_100975864 | Ga0068861_1009758642 | 120 |
| 131 | 3300005841 | Ga0068863_100152703 | Ga0068863_1001527032 | 120 |
| 132 | 3300025925 | Ga0207650_10152272 | Ga0207650_101522722 | 120 |
| 133 | 3300025940 | Ga0207691_10109650 | Ga0207691_101096502 | 120 |
| 134 | 3300025941 | Ga0207711_11503213 | Ga0207711_115032131 | 120 |
| 135 | 3300025986 | Ga0207658_11357196 | Ga0207658_113571962 | 120 |
| 136 | 3300026041 | Ga0207639_10096743 | Ga0207639_100967434 | 120 |
| 137 | 3300026088 | Ga0207641_10044803 | Ga0207641_100448032 | 120 |
| 138 | 3300026095 | Ga0207676_10042494 | Ga0207676_100424942 | 120 |
| 139 | 3300026118 | Ga0207675_102258999 | Ga0207675_1022589991 | 120 |
| 140 | 3300053088 | Ga0500644_0069331 | Ga0500644_0069331_586_1041 | 120 |
| 141 | 3300053118 | Ga0500594_0004456 | Ga0500594_0004456_598_1053 | 120 |
| 142 | iso_pu_bacteria | 2643221654 | 2644301338 | 120 |
| 143 | iso_pu_bacteria | 2904479285 | 2904479686 | 120 |
| 144 | 3300005334 | Ga0068869_101181838 | Ga0068869_1011818381 | 121 |
| 145 | 3300005347 | Ga0070668_100133822 | Ga0070668_1001338222 | 121 |
| 146 | 3300005367 | Ga0070667_100010447 | Ga0070667_1000104478 | 121 |
| 147 | 3300005548 | Ga0070665_100559771 | Ga0070665_1005597713 | 121 |
| 148 | 3300005843 | Ga0068860_100293724 | Ga0068860_1002937244 | 121 |
| 149 | 3300006237 | Ga0097621_100728342 | Ga0097621_1007283421 | 121 |
| 150 | 3300009098 | Ga0105245_11399483 | Ga0105245_113994831 | 121 |
| 151 | 3300013308 | Ga0157375_10177219 | Ga0157375_101772192 | 121 |
| 152 | 3300014968 | Ga0157379_10077414 | Ga0157379_100774144 | 121 |
| 153 | 3300025918 | Ga0207662_11082769 | Ga0207662_110827691 | 121 |
| 154 | 3300025972 | Ga0207668_10259469 | Ga0207668_102594692 | 121 |
| 155 | 3300025986 | Ga0207658_10009698 | Ga0207658_100096987 | 121 |
| 156 | 3300028379 | Ga0268266_10505674 | Ga0268266_105056742 | 121 |
| 157 | 3300044712 | Ga0453684_1787323 | Ga0453684_1787323_50_502 | 121 |
| 158 | 3300049571 | Ga0501034_0103580 | Ga0501034_0103580_315_791 | 121 |
| 159 | 3300049574 | Ga0501038_0442894 | Ga0501038_0442894_389_865 | 121 |
| 160 | 3300049579 | Ga0501043_0281422 | Ga0501043_0281422_408_884 | 121 |
| 161 | 3300049580 | Ga0501046_0159879 | Ga0501046_0159879_1055_1531 | 121 |
| 162 | 3300049581 | Ga0501047_0384104 | Ga0501047_0384104_430_906 | 121 |
| 163 | 3300049588 | Ga0501072_0511435 | Ga0501072_0511435_64_540 | 121 |
| 164 | 3300049589 | Ga0501073_0516134 | Ga0501073_0516134_253_729 | 121 |
| 165 | 3300049822 | Ga0501035_0320439 | Ga0501035_0320439_312_788 | 121 |
| 166 | 3300049823 | Ga0501044_0452432 | Ga0501044_0452432_432_908 | 121 |
| 167 | 3300050508 | nmdc:mga09592_714568_c1 | nmdc:mga09592_714568_c1_81_605 | 121 |
| 168 | 3300005327 | Ga0070658_10021365 | Ga0070658_100213652 | 122 |
| 169 | 3300005329 | Ga0070683_100527023 | Ga0070683_1005270232 | 122 |
| 170 | 3300005338 | Ga0068868_100472683 | Ga0068868_1004726831 | 122 |
| 171 | 3300005339 | Ga0070660_100086675 | Ga0070660_1000866755 | 122 |
| 172 | 3300005344 | Ga0070661_100000647 | Ga0070661_1000006472 | 122 |
| 173 | 3300005366 | Ga0070659_101722105 | Ga0070659_1017221051 | 122 |
| 174 | 3300005435 | Ga0070714_100012010 | Ga0070714_1000120109 | 122 |
| 175 | 3300005436 | Ga0070713_100550705 | Ga0070713_1005507051 | 122 |
| 176 | 3300005530 | Ga0070679_100016850 | Ga0070679_1000168502 | 122 |
| 177 | 3300005535 | Ga0070684_100039111 | Ga0070684_1000391114 | 122 |
| 178 | 3300005563 | Ga0068855_100019281 | Ga0068855_1000192813 | 122 |
| 179 | 3300005564 | Ga0070664_100023353 | Ga0070664_1000233535 | 122 |
| 180 | 3300005564 | Ga0070664_100413405 | Ga0070664_1004134052 | 122 |
| 181 | 3300005578 | Ga0068854_100011019 | Ga0068854_1000110195 | 122 |
| 182 | 3300005614 | Ga0068856_100006194 | Ga0068856_1000061943 | 122 |
| 183 | 3300005616 | Ga0068852_100003761 | Ga0068852_10000376113 | 122 |
| 184 | 3300006038 | Ga0075365_10250582 | Ga0075365_102505822 | 122 |
| 185 | 3300006048 | Ga0075363_100064664 | Ga0075363_1000646642 | 122 |
| 186 | 3300006051 | Ga0075364_10012996 | Ga0075364_100129963 | 122 |
| 187 | 3300006177 | Ga0075362_10003105 | Ga0075362_100031056 | 122 |
| 188 | 3300006178 | Ga0075367_10005132 | Ga0075367_100051325 | 122 |
| 189 | 3300006186 | Ga0075369_10070905 | Ga0075369_100709052 | 122 |
| 190 | 3300006353 | Ga0075370_10018855 | Ga0075370_100188552 | 122 |
| 191 | 3300006353 | Ga0075370_10076855 | Ga0075370_100768553 | 122 |
| 192 | 3300009093 | Ga0105240_10005257 | Ga0105240_1000525720 | 122 |
| 193 | 3300009098 | Ga0105245_11375244 | Ga0105245_113752441 | 122 |
| 194 | 3300009545 | Ga0105237_10527052 | Ga0105237_105270522 | 122 |
| 195 | 3300009551 | Ga0105238_10007543 | Ga0105238_100075434 | 122 |
| 196 | 3300010375 | Ga0105239_10383179 | Ga0105239_103831792 | 122 |
| 197 | 3300013100 | Ga0157373_10018753 | Ga0157373_100187532 | 122 |
| 198 | 3300013104 | Ga0157370_10064964 | Ga0157370_100649642 | 122 |
| 199 | 3300013105 | Ga0157369_10001339 | Ga0157369_100013398 | 122 |
| 200 | 3300013296 | Ga0157374_10432791 | Ga0157374_104327913 | 122 |
| 201 | 3300013306 | Ga0163162_12754149 | Ga0163162_127541491 | 122 |
| 202 | 3300013307 | Ga0157372_10012931 | Ga0157372_100129319 | 122 |
| 203 | 3300025907 | Ga0207645_10308135 | Ga0207645_103081351 | 122 |
| 204 | 3300025911 | Ga0207654_10140450 | Ga0207654_101404502 | 122 |
| 205 | 3300025913 | Ga0207695_10023026 | Ga0207695_100230268 | 122 |
| 206 | 3300025913 | Ga0207695_10355936 | Ga0207695_103559362 | 122 |
| 207 | 3300025919 | Ga0207657_10023410 | Ga0207657_100234104 | 122 |
| 208 | 3300025920 | Ga0207649_10017583 | Ga0207649_100175834 | 122 |
| 209 | 3300025924 | Ga0207694_10007840 | Ga0207694_100078403 | 122 |
| 210 | 3300025929 | Ga0207664_10003381 | Ga0207664_100033814 | 122 |
| 211 | 3300025932 | Ga0207690_10293804 | Ga0207690_102938041 | 122 |
| 212 | 3300025933 | Ga0207706_10032489 | Ga0207706_100324892 | 122 |
| 213 | 3300025942 | Ga0207689_10665793 | Ga0207689_106657932 | 122 |
| 214 | 3300025944 | Ga0207661_10056016 | Ga0207661_100560162 | 122 |
| 215 | 3300025945 | Ga0207679_10266911 | Ga0207679_102669112 | 122 |
| 216 | 3300025945 | Ga0207679_10347343 | Ga0207679_103473432 | 122 |
| 217 | 3300025949 | Ga0207667_10009870 | Ga0207667_100098705 | 122 |
| 218 | 3300025960 | Ga0207651_10798769 | Ga0207651_107987691 | 122 |
| 219 | 3300025981 | Ga0207640_10026816 | Ga0207640_100268162 | 122 |
| 220 | 3300026078 | Ga0207702_10006552 | Ga0207702_100065525 | 122 |
| 221 | 3300026089 | Ga0207648_10226970 | Ga0207648_102269702 | 122 |
| 222 | 3300026116 | Ga0207674_10000020 | Ga0207674_10000020112 | 122 |
| 223 | 3300026142 | Ga0207698_10003199 | Ga0207698_100031999 | 122 |
| 224 | 3300027866 | Ga0209813_10002074 | Ga0209813_100020743 | 122 |
| 225 | 3300028786 | Ga0307517_10221513 | Ga0307517_102215132 | 122 |
| 226 | 3300031456 | Ga0307513_10071439 | Ga0307513_100714395 | 122 |
| 227 | 3300031548 | Ga0307408_100434930 | Ga0307408_1004349301 | 122 |
| 228 | 3300031731 | Ga0307405_10296149 | Ga0307405_102961492 | 122 |
| 229 | 3300031852 | Ga0307410_10795009 | Ga0307410_107950091 | 122 |
| 230 | 3300031911 | Ga0307412_11235791 | Ga0307412_112357911 | 122 |
| 231 | 3300031995 | Ga0307409_101239130 | Ga0307409_1012391301 | 122 |
| 232 | 3300032002 | Ga0307416_101963368 | Ga0307416_1019633681 | 122 |
| 233 | 3300038443 | Ga0395901_1380088 | Ga0395901_1380088_97_555 | 122 |
| 234 | 3300039110 | Ga0400487_24476 | Ga0400487_24476_28276_28737 | 122 |
| 235 | 3300050490 | nmdc:mga03n38_854280_c1 | nmdc:mga03n38_854280_c1_22_477 | 122 |
| 236 | 3300050490 | nmdc:mga03n38_94418_c1 | nmdc:mga03n38_94418_c1_515_976 | 122 |
| 237 | 3300050491 | nmdc:mga00v17_20264_c1 | nmdc:mga00v17_20264_c1_2384_2836 | 122 |
| 238 | 3300050492 | nmdc:mga0yw44_54687_c1 | nmdc:mga0yw44_54687_c1_692_1153 | 122 |
| 239 | 3300050493 | nmdc:mga0k408_180_c1 | nmdc:mga0k408_180_c1_26430_26891 | 122 |
| 240 | 3300050493 | nmdc:mga0k408_1901_c1 | nmdc:mga0k408_1901_c1_4661_5125 | 122 |
| 241 | 3300050493 | nmdc:mga0k408_2769_c1 | nmdc:mga0k408_2769_c1_4850_5302 | 122 |
| 242 | 3300050494 | nmdc:mga06z11_30142_c1 | nmdc:mga06z11_30142_c1_1708_2160 | 122 |
| 243 | 3300050495 | nmdc:mga04h51_16959_c1 | nmdc:mga04h51_16959_c1_1420_1881 | 122 |
| 244 | 3300050496 | nmdc:mga07m45_260_c1 | nmdc:mga07m45_260_c1_638_1102 | 122 |
| 245 | 3300050496 | nmdc:mga07m45_293840_c1 | nmdc:mga07m45_293840_c1_119_565 | 122 |
| 246 | 3300050496 | nmdc:mga07m45_452398_c1 | nmdc:mga07m45_452398_c1_130_582 | 122 |
| 247 | 3300050516 | nmdc:mga0sz30_186555_c1 | nmdc:mga0sz30_186555_c1_265_726 | 122 |
| 248 | 3300050516 | nmdc:mga0sz30_70874_c1 | nmdc:mga0sz30_70874_c1_369_821 | 122 |
| 249 | iso_pu_bacteria | 2891633521 | 2891635515 | 122 |
| 250 | iso_pu_bacteria | 639633007 | 639785982 | 122 |
| 251 | 3300005329 | Ga0070683_101075073 | Ga0070683_1010750732 | 123 |
| 252 | 3300005331 | Ga0070670_101179392 | Ga0070670_1011793921 | 123 |
| 253 | 3300005339 | Ga0070660_100401362 | Ga0070660_1004013622 | 123 |
| 254 | 3300005347 | Ga0070668_100014646 | Ga0070668_1000146462 | 123 |
| 255 | 3300005367 | Ga0070667_100121649 | Ga0070667_1001216492 | 123 |
| 256 | 3300005616 | Ga0068852_100175973 | Ga0068852_1001759731 | 123 |
| 257 | 3300005616 | Ga0068852_100616032 | Ga0068852_1006160321 | 123 |
| 258 | 3300005842 | Ga0068858_100001192 | Ga0068858_1000011925 | 123 |
| 259 | 3300005843 | Ga0068860_100266280 | Ga0068860_1002662802 | 123 |
| 260 | 3300006048 | Ga0075363_100154028 | Ga0075363_1001540282 | 123 |
| 261 | 3300006178 | Ga0075367_10043488 | Ga0075367_100434883 | 123 |
| 262 | 3300006195 | Ga0075366_10005214 | Ga0075366_100052143 | 123 |
| 263 | 3300006353 | Ga0075370_10108700 | Ga0075370_101087002 | 123 |
| 264 | 3300009101 | Ga0105247_10040897 | Ga0105247_100408975 | 123 |
| 265 | 3300013104 | Ga0157370_10025967 | Ga0157370_100259676 | 123 |
| 266 | 3300014968 | Ga0157379_10003453 | Ga0157379_100034532 | 123 |
| 267 | 3300015683 | Ga0183362_10003 | Ga0183362_10003856 | 123 |
| 268 | 3300025899 | Ga0207642_10466740 | Ga0207642_104667401 | 123 |
| 269 | 3300025900 | Ga0207710_10044390 | Ga0207710_100443903 | 123 |
| 270 | 3300025919 | Ga0207657_10012397 | Ga0207657_100123972 | 123 |
| 271 | 3300025926 | Ga0207659_10521429 | Ga0207659_105214292 | 123 |
| 272 | 3300025986 | Ga0207658_10490356 | Ga0207658_104903562 | 123 |
| 273 | 3300026035 | Ga0207703_10024981 | Ga0207703_100249815 | 123 |
| 274 | 3300026041 | Ga0207639_11252630 | Ga0207639_112526301 | 123 |
| 275 | 3300026142 | Ga0207698_10448922 | Ga0207698_104489222 | 123 |
| 276 | 3300028381 | Ga0268264_10614334 | Ga0268264_106143342 | 123 |
| 277 | 3300031731 | Ga0307405_11399538 | Ga0307405_113995381 | 123 |
| 278 | 3300044901 | Ga0466960_0057022 | Ga0466960_0057022_1075_1548 | 123 |
| 279 | 3300045976 | Ga0466967_1348845 | Ga0466967_1348845_244_696 | 123 |
| 280 | 3300046660 | Ga0495625_0605781 | Ga0495625_0605781_81_545 | 123 |
| 281 | 3300048912 | Ga0496109_1602704 | Ga0496109_1602704_43_504 | 123 |
| 282 | 3300048913 | Ga0496110_0882286 | Ga0496110_0882286_17_478 | 123 |
| 283 | 3300048925 | Ga0496122_0031207 | Ga0496122_0031207_3889_4338 | 123 |
| 284 | 3300048926 | Ga0496123_0101350 | Ga0496123_0101350_1069_1524 | 123 |
| 285 | 3300048927 | Ga0496124_0038111 | Ga0496124_0038111_3414_3863 | 123 |
| 286 | 3300048929 | Ga0496126_0118975 | Ga0496126_0118975_319_768 | 123 |
| 287 | 3300049758 | Ga0501241_055227 | Ga0501241_055227_257_706 | 123 |
| 288 | 3300050489 | nmdc:mga03683_89830_c1 | nmdc:mga03683_89830_c1_321_776 | 123 |
| 289 | 3300050493 | nmdc:mga0k408_15682_c1 | nmdc:mga0k408_15682_c1_3213_3668 | 123 |
| 290 | 3300050494 | nmdc:mga06z11_207697_c1 | nmdc:mga06z11_207697_c1_170_625 | 123 |
| 291 | 3300050495 | nmdc:mga04h51_93716_c1 | nmdc:mga04h51_93716_c1_529_984 | 123 |
| 292 | 3300050496 | nmdc:mga07m45_4942_c1 | nmdc:mga07m45_4942_c1_4769_5224 | 123 |
| 293 | 3300005366 | Ga0070659_100307523 | Ga0070659_1003075232 | 124 |
| 294 | 3300005441 | Ga0070700_100235235 | Ga0070700_1002352352 | 124 |
| 295 | 3300005444 | Ga0070694_100318116 | Ga0070694_1003181161 | 124 |
| 296 | 3300005459 | Ga0068867_100164038 | Ga0068867_1001640382 | 124 |
| 297 | 3300005530 | Ga0070679_101062564 | Ga0070679_1010625641 | 124 |
| 298 | 3300005543 | Ga0070672_100040879 | Ga0070672_1000408793 | 124 |
| 299 | 3300005840 | Ga0068870_10009194 | Ga0068870_100091946 | 124 |
| 300 | 3300013307 | Ga0157372_10556880 | Ga0157372_105568802 | 124 |
| 301 | 3300013308 | Ga0157375_10266678 | Ga0157375_102666782 | 124 |
| 302 | 3300025908 | Ga0207643_10003120 | Ga0207643_100031207 | 124 |
| 303 | 3300025920 | Ga0207649_10665064 | Ga0207649_106650641 | 124 |
| 304 | 3300025921 | Ga0207652_10850963 | Ga0207652_108509632 | 124 |
| 305 | 3300025923 | Ga0207681_10019992 | Ga0207681_100199925 | 124 |
| 306 | 3300025932 | Ga0207690_10167937 | Ga0207690_101679372 | 124 |
| 307 | 3300025938 | Ga0207704_10040706 | Ga0207704_100407062 | 124 |
| 308 | 3300025940 | Ga0207691_10003887 | Ga0207691_1000388712 | 124 |
| 309 | 3300026089 | Ga0207648_10208927 | Ga0207648_102089272 | 124 |
| 310 | 3300031733 | Ga0316577_10010632 | Ga0316577_100106322 | 124 |
| 311 | 3300044706 | Ga0466964_0038869 | Ga0466964_0038869_662_1114 | 124 |
| 312 | 3300001977 | JGI24746J21847_1016548 | JGI24746J21847_10165482 | 125 |
| 313 | 3300001991 | JGI24743J22301_10008375 | JGI24743J22301_100083752 | 125 |
| 314 | 3300002070 | JGI24750J21931_1064877 | JGI24750J21931_10648771 | 125 |
| 315 | 3300002073 | JGI24745J21846_1006246 | JGI24745J21846_10062462 | 125 |
| 316 | 3300002076 | JGI24749J21850_1003215 | JGI24749J21850_10032152 | 125 |
| 317 | 3300002126 | JGI24035J26624_1004552 | JGI24035J26624_10045521 | 125 |
| 318 | 3300002239 | JGI24034J26672_10016582 | JGI24034J26672_100165822 | 125 |
| 319 | 3300002459 | JGI24751J29686_10035823 | JGI24751J29686_100358232 | 125 |
| 320 | 3300005288 | Ga0065714_10193261 | Ga0065714_101932611 | 125 |
| 321 | 3300005290 | Ga0065712_10223299 | Ga0065712_102232991 | 125 |
| 322 | 3300005327 | Ga0070658_10307238 | Ga0070658_103072382 | 125 |
| 323 | 3300005328 | Ga0070676_10033470 | Ga0070676_100334703 | 125 |
| 324 | 3300005329 | Ga0070683_100519812 | Ga0070683_1005198122 | 125 |
| 325 | 3300005330 | Ga0070690_100099592 | Ga0070690_1000995922 | 125 |
| 326 | 3300005331 | Ga0070670_100006913 | Ga0070670_1000069138 | 125 |
| 327 | 3300005331 | Ga0070670_100725220 | Ga0070670_1007252201 | 125 |
| 328 | 3300005334 | Ga0068869_100005133 | Ga0068869_1000051332 | 125 |
| 329 | 3300005335 | Ga0070666_10222514 | Ga0070666_102225142 | 125 |
| 330 | 3300005338 | Ga0068868_100022592 | Ga0068868_1000225922 | 125 |
| 331 | 3300005339 | Ga0070660_100139677 | Ga0070660_1001396772 | 125 |
| 332 | 3300005340 | Ga0070689_100242576 | Ga0070689_1002425762 | 125 |
| 333 | 3300005343 | Ga0070687_100005303 | Ga0070687_1000053032 | 125 |
| 334 | 3300005344 | Ga0070661_100038455 | Ga0070661_1000384556 | 125 |
| 335 | 3300005345 | Ga0070692_10016920 | Ga0070692_100169201 | 125 |
| 336 | 3300005347 | Ga0070668_100049662 | Ga0070668_1000496622 | 125 |
| 337 | 3300005353 | Ga0070669_100039508 | Ga0070669_1000395085 | 125 |
| 338 | 3300005354 | Ga0070675_100194089 | Ga0070675_1001940892 | 125 |
| 339 | 3300005355 | Ga0070671_100109552 | Ga0070671_1001095522 | 125 |
| 340 | 3300005356 | Ga0070674_100013274 | Ga0070674_1000132744 | 125 |
| 341 | 3300005365 | Ga0070688_100000913 | Ga0070688_1000009134 | 125 |
| 342 | 3300005366 | Ga0070659_100403249 | Ga0070659_1004032491 | 125 |
| 343 | 3300005438 | Ga0070701_10040923 | Ga0070701_100409232 | 125 |
| 344 | 3300005440 | Ga0070705_101104513 | Ga0070705_1011045131 | 125 |
| 345 | 3300005441 | Ga0070700_100008875 | Ga0070700_1000088752 | 125 |
| 346 | 3300005455 | Ga0070663_100009567 | Ga0070663_1000095675 | 125 |
| 347 | 3300005456 | Ga0070678_100050601 | Ga0070678_1000506015 | 125 |
| 348 | 3300005457 | Ga0070662_100033344 | Ga0070662_1000333442 | 125 |
| 349 | 3300005459 | Ga0068867_100139217 | Ga0068867_1001392172 | 125 |
| 350 | 3300005466 | Ga0070685_10128595 | Ga0070685_101285952 | 125 |
| 351 | 3300005535 | Ga0070684_100078517 | Ga0070684_1000785175 | 125 |
| 352 | 3300005539 | Ga0068853_100298889 | Ga0068853_1002988892 | 125 |
| 353 | 3300005544 | Ga0070686_100006318 | Ga0070686_1000063182 | 125 |
| 354 | 3300005547 | Ga0070693_100059945 | Ga0070693_1000599452 | 125 |
| 355 | 3300005547 | Ga0070693_100132356 | Ga0070693_1001323563 | 125 |
| 356 | 3300005548 | Ga0070665_100420928 | Ga0070665_1004209282 | 125 |
| 357 | 3300005563 | Ga0068855_100272281 | Ga0068855_1002722811 | 125 |
| 358 | 3300005564 | Ga0070664_100203255 | Ga0070664_1002032552 | 125 |
| 359 | 3300005577 | Ga0068857_100017820 | Ga0068857_1000178203 | 125 |
| 360 | 3300005578 | Ga0068854_100029326 | Ga0068854_1000293262 | 125 |
| 361 | 3300005614 | Ga0068856_101791642 | Ga0068856_1017916421 | 125 |
| 362 | 3300005615 | Ga0070702_100044523 | Ga0070702_1000445232 | 125 |
| 363 | 3300005616 | Ga0068852_100510344 | Ga0068852_1005103442 | 125 |
| 364 | 3300005617 | Ga0068859_100029685 | Ga0068859_1000296853 | 125 |
| 365 | 3300005618 | Ga0068864_100072581 | Ga0068864_1000725812 | 125 |
| 366 | 3300005719 | Ga0068861_100035853 | Ga0068861_1000358531 | 125 |
| 367 | 3300005834 | Ga0068851_10011745 | Ga0068851_100117453 | 125 |
| 368 | 3300005840 | Ga0068870_10083129 | Ga0068870_100831292 | 125 |
| 369 | 3300005842 | Ga0068858_100141183 | Ga0068858_1001411833 | 125 |
| 370 | 3300005844 | Ga0068862_100017424 | Ga0068862_1000174246 | 125 |
| 371 | 3300006237 | Ga0097621_100168703 | Ga0097621_1001687032 | 125 |
| 372 | 3300006881 | Ga0068865_100004033 | Ga0068865_1000040332 | 125 |
| 373 | 3300006931 | Ga0097620_100029687 | Ga0097620_1000296873 | 125 |
| 374 | 3300009094 | Ga0111539_10036798 | Ga0111539_100367985 | 125 |
| 375 | 3300009098 | Ga0105245_10050653 | Ga0105245_100506532 | 125 |
| 376 | 3300009148 | Ga0105243_10100809 | Ga0105243_101008093 | 125 |
| 377 | 3300009176 | Ga0105242_10179651 | Ga0105242_101796512 | 125 |
| 378 | 3300009545 | Ga0105237_10866371 | Ga0105237_108663712 | 125 |
| 379 | 3300009553 | Ga0105249_10075013 | Ga0105249_100750133 | 125 |
| 380 | 3300010375 | Ga0105239_10316310 | Ga0105239_103163101 | 125 |
| 381 | 3300011119 | Ga0105246_10463951 | Ga0105246_104639512 | 125 |
| 382 | 3300013100 | Ga0157373_10552640 | Ga0157373_105526401 | 125 |
| 383 | 3300013102 | Ga0157371_10437407 | Ga0157371_104374072 | 125 |
| 384 | 3300013296 | Ga0157374_10040499 | Ga0157374_100404993 | 125 |
| 385 | 3300013297 | Ga0157378_10098654 | Ga0157378_100986543 | 125 |
| 386 | 3300013307 | Ga0157372_10322599 | Ga0157372_103225992 | 125 |
| 387 | 3300014325 | Ga0163163_10170434 | Ga0163163_101704342 | 125 |
| 388 | 3300014326 | Ga0157380_10019617 | Ga0157380_100196173 | 125 |
| 389 | 3300014745 | Ga0157377_10048912 | Ga0157377_100489122 | 125 |
| 390 | 3300014968 | Ga0157379_10001262 | Ga0157379_1000126219 | 125 |
| 391 | 3300014969 | Ga0157376_11978470 | Ga0157376_119784701 | 125 |
| 392 | 3300017792 | Ga0163161_10320921 | Ga0163161_103209212 | 125 |
| 393 | 3300025290 | Ga0207673_1017036 | Ga0207673_10170362 | 125 |
| 394 | 3300025315 | Ga0207697_10000237 | Ga0207697_1000023717 | 125 |
| 395 | 3300025321 | Ga0207656_10000916 | Ga0207656_100009163 | 125 |
| 396 | 3300025893 | Ga0207682_10000203 | Ga0207682_1000020310 | 125 |
| 397 | 3300025901 | Ga0207688_10000362 | Ga0207688_1000036214 | 125 |
| 398 | 3300025903 | Ga0207680_10077134 | Ga0207680_100771343 | 125 |
| 399 | 3300025907 | Ga0207645_10006246 | Ga0207645_100062469 | 125 |
| 400 | 3300025908 | Ga0207643_10009218 | Ga0207643_100092184 | 125 |
| 401 | 3300025909 | Ga0207705_10364539 | Ga0207705_103645392 | 125 |
| 402 | 3300025918 | Ga0207662_10007415 | Ga0207662_100074158 | 125 |
| 403 | 3300025919 | Ga0207657_10027297 | Ga0207657_100272972 | 125 |
| 404 | 3300025920 | Ga0207649_10232409 | Ga0207649_102324092 | 125 |
| 405 | 3300025923 | Ga0207681_10111611 | Ga0207681_101116113 | 125 |
| 406 | 3300025925 | Ga0207650_10002859 | Ga0207650_100028599 | 125 |
| 407 | 3300025925 | Ga0207650_10004599 | Ga0207650_100045998 | 125 |
| 408 | 3300025925 | Ga0207650_10367924 | Ga0207650_103679241 | 125 |
| 409 | 3300025926 | Ga0207659_10300457 | Ga0207659_103004571 | 125 |
| 410 | 3300025931 | Ga0207644_10283117 | Ga0207644_102831171 | 125 |
| 411 | 3300025932 | Ga0207690_10158828 | Ga0207690_101588282 | 125 |
| 412 | 3300025933 | Ga0207706_10000486 | Ga0207706_1000048614 | 125 |
| 413 | 3300025936 | Ga0207670_10196906 | Ga0207670_101969062 | 125 |
| 414 | 3300025937 | Ga0207669_10036718 | Ga0207669_100367182 | 125 |
| 415 | 3300025938 | Ga0207704_10007005 | Ga0207704_100070053 | 125 |
| 416 | 3300025940 | Ga0207691_10004275 | Ga0207691_1000427515 | 125 |
| 417 | 3300025941 | Ga0207711_10821868 | Ga0207711_108218682 | 125 |
| 418 | 3300025942 | Ga0207689_10000468 | Ga0207689_1000046820 | 125 |
| 419 | 3300025944 | Ga0207661_10035912 | Ga0207661_100359122 | 125 |
| 420 | 3300025945 | Ga0207679_10175984 | Ga0207679_101759842 | 125 |
| 421 | 3300025960 | Ga0207651_10057300 | Ga0207651_100573003 | 125 |
| 422 | 3300025961 | Ga0207712_10199969 | Ga0207712_101999692 | 125 |
| 423 | 3300025972 | Ga0207668_10436415 | Ga0207668_104364152 | 125 |
| 424 | 3300025986 | Ga0207658_10091867 | Ga0207658_100918672 | 125 |
| 425 | 3300026023 | Ga0207677_10123367 | Ga0207677_101233672 | 125 |
| 426 | 3300026035 | Ga0207703_10049969 | Ga0207703_100499691 | 125 |
| 427 | 3300026067 | Ga0207678_10001272 | Ga0207678_100012725 | 125 |
| 428 | 3300026075 | Ga0207708_10000650 | Ga0207708_100006507 | 125 |
| 429 | 3300026088 | Ga0207641_10178458 | Ga0207641_101784582 | 125 |
| 430 | 3300026089 | Ga0207648_10001903 | Ga0207648_1000190312 | 125 |
| 431 | 3300026095 | Ga0207676_10089512 | Ga0207676_100895125 | 125 |
| 432 | 3300026116 | Ga0207674_10000769 | Ga0207674_1000076922 | 125 |
| 433 | 3300026118 | Ga0207675_100003290 | Ga0207675_10000329012 | 125 |
| 434 | 3300026121 | Ga0207683_10004396 | Ga0207683_1000439612 | 125 |
| 435 | 3300026142 | Ga0207698_10432361 | Ga0207698_104323612 | 125 |
| 436 | 3300027907 | Ga0207428_10275602 | Ga0207428_102756022 | 125 |
| 437 | 3300028379 | Ga0268266_10249989 | Ga0268266_102499892 | 125 |
| 438 | 3300028380 | Ga0268265_10520221 | Ga0268265_105202211 | 125 |
| 439 | 3300028381 | Ga0268264_10371939 | Ga0268264_103719391 | 125 |
| 440 | 3300032002 | Ga0307416_100555362 | Ga0307416_1005553622 | 125 |
| 441 | 3300035170 | Ga0373943_0281323 | Ga0373943_0281323_232_693 | 125 |
| 442 | 3300044694 | Ga0466963_0440725 | Ga0466963_0440725_140_589 | 125 |
| 443 | 3300048903 | Ga0496100_0071661 | Ga0496100_0071661_898_1359 | 125 |
| 444 | 3300048904 | Ga0496101_0005661 | Ga0496101_0005661_5893_6354 | 125 |
| 445 | 3300048905 | Ga0496102_0670851 | Ga0496102_0670851_400_861 | 125 |
| 446 | 3300048908 | Ga0496105_0004196 | Ga0496105_0004196_8337_8798 | 125 |
| 447 | 3300048909 | Ga0496106_0061077 | Ga0496106_0061077_38_499 | 125 |
| 448 | 3300048910 | Ga0496107_0547220 | Ga0496107_0547220_193_654 | 125 |
| 449 | 3300048911 | Ga0496108_0156924 | Ga0496108_0156924_651_1112 | 125 |
| 450 | 3300048912 | Ga0496109_0137535 | Ga0496109_0137535_425_886 | 125 |
| 451 | 3300048913 | Ga0496110_0028281 | Ga0496110_0028281_1609_2070 | 125 |
| 452 | 3300048914 | Ga0496111_0499287 | Ga0496111_0499287_190_651 | 125 |
| 453 | 3300048915 | Ga0496112_0920539 | Ga0496112_0920539_71_532 | 125 |
| 454 | 3300048917 | Ga0496114_0252923 | Ga0496114_0252923_649_1110 | 125 |
| 455 | 3300048918 | Ga0496115_0445171 | Ga0496115_0445171_475_936 | 125 |
| 456 | 3300049584 | Ga0501068_0253599 | Ga0501068_0253599_476_925 | 125 |
| 457 | 3300050511 | nmdc:mga08y16_72716_c1 | nmdc:mga08y16_72716_c1_100_561 | 125 |
| 458 | 2162886012 | MBSR1b_contig_12253474 | MBSR1b_0335.00003510 | 126 |
| 459 | 3300001989 | JGI24739J22299_10048713 | JGI24739J22299_100487132 | 126 |
| 460 | 3300005293 | Ga0065715_10179257 | Ga0065715_101792572 | 126 |
| 461 | 3300005327 | Ga0070658_10071691 | Ga0070658_100716912 | 126 |
| 462 | 3300005328 | Ga0070676_10000960 | Ga0070676_100009604 | 126 |
| 463 | 3300005328 | Ga0070676_10072032 | Ga0070676_100720322 | 126 |
| 464 | 3300005329 | Ga0070683_100890111 | Ga0070683_1008901112 | 126 |
| 465 | 3300005331 | Ga0070670_100164559 | Ga0070670_1001645592 | 126 |
| 466 | 3300005333 | Ga0070677_10002708 | Ga0070677_100027087 | 126 |
| 467 | 3300005333 | Ga0070677_10299167 | Ga0070677_102991671 | 126 |
| 468 | 3300005334 | Ga0068869_100027628 | Ga0068869_1000276282 | 126 |
| 469 | 3300005335 | Ga0070666_10043834 | Ga0070666_100438343 | 126 |
| 470 | 3300005335 | Ga0070666_10183324 | Ga0070666_101833241 | 126 |
| 471 | 3300005335 | Ga0070666_10200253 | Ga0070666_102002532 | 126 |
| 472 | 3300005335 | Ga0070666_10237666 | Ga0070666_102376662 | 126 |
| 473 | 3300005336 | Ga0070680_100073905 | Ga0070680_1000739052 | 126 |
| 474 | 3300005336 | Ga0070680_100615924 | Ga0070680_1006159241 | 126 |
| 475 | 3300005338 | Ga0068868_100040730 | Ga0068868_1000407302 | 126 |
| 476 | 3300005338 | Ga0068868_100350139 | Ga0068868_1003501392 | 126 |
| 477 | 3300005338 | Ga0068868_101676148 | Ga0068868_1016761481 | 126 |
| 478 | 3300005339 | Ga0070660_100007268 | Ga0070660_1000072685 | 126 |
| 479 | 3300005340 | Ga0070689_100780834 | Ga0070689_1007808342 | 126 |
| 480 | 3300005344 | Ga0070661_100043695 | Ga0070661_1000436953 | 126 |
| 481 | 3300005344 | Ga0070661_100776962 | Ga0070661_1007769622 | 126 |
| 482 | 3300005347 | Ga0070668_100002954 | Ga0070668_1000029545 | 126 |
| 483 | 3300005347 | Ga0070668_100312651 | Ga0070668_1003126511 | 126 |
| 484 | 3300005347 | Ga0070668_100508264 | Ga0070668_1005082642 | 126 |
| 485 | 3300005347 | Ga0070668_101092134 | Ga0070668_1010921341 | 126 |
| 486 | 3300005353 | Ga0070669_100408028 | Ga0070669_1004080282 | 126 |
| 487 | 3300005354 | Ga0070675_100210830 | Ga0070675_1002108302 | 126 |
| 488 | 3300005354 | Ga0070675_100252687 | Ga0070675_1002526872 | 126 |
| 489 | 3300005355 | Ga0070671_100001559 | Ga0070671_1000015598 | 126 |
| 490 | 3300005355 | Ga0070671_100010054 | Ga0070671_1000100547 | 126 |
| 491 | 3300005355 | Ga0070671_100020026 | Ga0070671_1000200264 | 126 |
| 492 | 3300005355 | Ga0070671_100101070 | Ga0070671_1001010702 | 126 |
| 493 | 3300005355 | Ga0070671_100298043 | Ga0070671_1002980432 | 126 |
| 494 | 3300005356 | Ga0070674_100000204 | Ga0070674_10000020415 | 126 |
| 495 | 3300005356 | Ga0070674_100164076 | Ga0070674_1001640761 | 126 |
| 496 | 3300005364 | Ga0070673_100002026 | Ga0070673_1000020269 | 126 |
| 497 | 3300005364 | Ga0070673_101095924 | Ga0070673_1010959241 | 126 |
| 498 | 3300005366 | Ga0070659_100003383 | Ga0070659_10000338312 | 126 |
| 499 | 3300005366 | Ga0070659_100110159 | Ga0070659_1001101592 | 126 |
| 500 | 3300005366 | Ga0070659_100544700 | Ga0070659_1005447002 | 126 |
| 501 | 3300005366 | Ga0070659_100687545 | Ga0070659_1006875451 | 126 |
| 502 | 3300005367 | Ga0070667_100002207 | Ga0070667_1000022078 | 126 |
| 503 | 3300005367 | Ga0070667_100441752 | Ga0070667_1004417522 | 126 |
| 504 | 3300005434 | Ga0070709_10021902 | Ga0070709_100219026 | 126 |
| 505 | 3300005435 | Ga0070714_100496667 | Ga0070714_1004966671 | 126 |
| 506 | 3300005437 | Ga0070710_10029598 | Ga0070710_100295983 | 126 |
| 507 | 3300005439 | Ga0070711_100011567 | Ga0070711_1000115673 | 126 |
| 508 | 3300005441 | Ga0070700_100259366 | Ga0070700_1002593661 | 126 |
| 509 | 3300005441 | Ga0070700_100445496 | Ga0070700_1004454961 | 126 |
| 510 | 3300005455 | Ga0070663_100050386 | Ga0070663_1000503865 | 126 |
| 511 | 3300005455 | Ga0070663_100121318 | Ga0070663_1001213182 | 126 |
| 512 | 3300005455 | Ga0070663_100131355 | Ga0070663_1001313552 | 126 |
| 513 | 3300005455 | Ga0070663_102005742 | Ga0070663_1020057421 | 126 |
| 514 | 3300005456 | Ga0070678_100003071 | Ga0070678_1000030715 | 126 |
| 515 | 3300005457 | Ga0070662_100002390 | Ga0070662_1000023905 | 126 |
| 516 | 3300005457 | Ga0070662_100231707 | Ga0070662_1002317072 | 126 |
| 517 | 3300005457 | Ga0070662_100280264 | Ga0070662_1002802642 | 126 |
| 518 | 3300005458 | Ga0070681_10335357 | Ga0070681_103353572 | 126 |
| 519 | 3300005458 | Ga0070681_10441529 | Ga0070681_104415291 | 126 |
| 520 | 3300005459 | Ga0068867_100001405 | Ga0068867_1000014055 | 126 |
| 521 | 3300005518 | Ga0070699_100016121 | Ga0070699_1000161213 | 126 |
| 522 | 3300005530 | Ga0070679_100379215 | Ga0070679_1003792152 | 126 |
| 523 | 3300005539 | Ga0068853_100000497 | Ga0068853_10000049711 | 126 |
| 524 | 3300005539 | Ga0068853_100001509 | Ga0068853_1000015092 | 126 |
| 525 | 3300005539 | Ga0068853_101167865 | Ga0068853_1011678652 | 126 |
| 526 | 3300005543 | Ga0070672_100001609 | Ga0070672_1000016092 | 126 |
| 527 | 3300005543 | Ga0070672_100012934 | Ga0070672_1000129343 | 126 |
| 528 | 3300005543 | Ga0070672_100091772 | Ga0070672_1000917722 | 126 |
| 529 | 3300005543 | Ga0070672_100620866 | Ga0070672_1006208662 | 126 |
| 530 | 3300005546 | Ga0070696_100002259 | Ga0070696_1000022593 | 126 |
| 531 | 3300005546 | Ga0070696_100543194 | Ga0070696_1005431942 | 126 |
| 532 | 3300005547 | Ga0070693_100234524 | Ga0070693_1002345241 | 126 |
| 533 | 3300005548 | Ga0070665_100003522 | Ga0070665_10000352211 | 126 |
| 534 | 3300005563 | Ga0068855_100000863 | Ga0068855_1000008635 | 126 |
| 535 | 3300005563 | Ga0068855_100028328 | Ga0068855_1000283287 | 126 |
| 536 | 3300005563 | Ga0068855_100265487 | Ga0068855_1002654874 | 126 |
| 537 | 3300005564 | Ga0070664_100009745 | Ga0070664_10000974510 | 126 |
| 538 | 3300005564 | Ga0070664_100087464 | Ga0070664_1000874642 | 126 |
| 539 | 3300005564 | Ga0070664_100155015 | Ga0070664_1001550152 | 126 |
| 540 | 3300005564 | Ga0070664_100805473 | Ga0070664_1008054732 | 126 |
| 541 | 3300005577 | Ga0068857_100552661 | Ga0068857_1005526612 | 126 |
| 542 | 3300005614 | Ga0068856_100000517 | Ga0068856_10000051736 | 126 |
| 543 | 3300005614 | Ga0068856_100593609 | Ga0068856_1005936092 | 126 |
| 544 | 3300005615 | Ga0070702_100087906 | Ga0070702_1000879062 | 126 |
| 545 | 3300005616 | Ga0068852_100007263 | Ga0068852_10000726310 | 126 |
| 546 | 3300005616 | Ga0068852_100452759 | Ga0068852_1004527591 | 126 |
| 547 | 3300005617 | Ga0068859_100047138 | Ga0068859_1000471384 | 126 |
| 548 | 3300005618 | Ga0068864_100007512 | Ga0068864_1000075124 | 126 |
| 549 | 3300005719 | Ga0068861_100801566 | Ga0068861_1008015661 | 126 |
| 550 | 3300005834 | Ga0068851_10000352 | Ga0068851_100003526 | 126 |
| 551 | 3300005834 | Ga0068851_10018402 | Ga0068851_100184026 | 126 |
| 552 | 3300005834 | Ga0068851_10040994 | Ga0068851_100409942 | 126 |
| 553 | 3300005840 | Ga0068870_10028835 | Ga0068870_100288352 | 126 |
| 554 | 3300005841 | Ga0068863_100041440 | Ga0068863_1000414405 | 126 |
| 555 | 3300005842 | Ga0068858_100074043 | Ga0068858_1000740432 | 126 |
| 556 | 3300005842 | Ga0068858_102249861 | Ga0068858_1022498611 | 126 |
| 557 | 3300005843 | Ga0068860_100035947 | Ga0068860_1000359472 | 126 |
| 558 | 3300006058 | Ga0075432_10100361 | Ga0075432_101003612 | 126 |
| 559 | 3300006237 | Ga0097621_100011274 | Ga0097621_1000112742 | 126 |
| 560 | 3300006358 | Ga0068871_100025961 | Ga0068871_1000259617 | 126 |
| 561 | 3300006844 | Ga0075428_100164264 | Ga0075428_1001642642 | 126 |
| 562 | 3300006846 | Ga0075430_100392330 | Ga0075430_1003923301 | 126 |
| 563 | 3300006871 | Ga0075434_100702292 | Ga0075434_1007022922 | 126 |
| 564 | 3300006881 | Ga0068865_100074333 | Ga0068865_1000743332 | 126 |
| 565 | 3300006914 | Ga0075436_100267954 | Ga0075436_1002679542 | 126 |
| 566 | 3300006931 | Ga0097620_100047142 | Ga0097620_1000471424 | 126 |
| 567 | 3300009093 | Ga0105240_10088641 | Ga0105240_100886417 | 126 |
| 568 | 3300009098 | Ga0105245_11109313 | Ga0105245_111093132 | 126 |
| 569 | 3300009147 | Ga0114129_10728414 | Ga0114129_107284142 | 126 |
| 570 | 3300009176 | Ga0105242_10459619 | Ga0105242_104596192 | 126 |
| 571 | 3300009177 | Ga0105248_10124188 | Ga0105248_101241885 | 126 |
| 572 | 3300009177 | Ga0105248_10314314 | Ga0105248_103143142 | 126 |
| 573 | 3300009545 | Ga0105237_10400735 | Ga0105237_104007352 | 126 |
| 574 | 3300010375 | Ga0105239_10100855 | Ga0105239_101008552 | 126 |
| 575 | 3300013100 | Ga0157373_10021443 | Ga0157373_100214437 | 126 |
| 576 | 3300013100 | Ga0157373_10174425 | Ga0157373_101744252 | 126 |
| 577 | 3300013102 | Ga0157371_10000228 | Ga0157371_1000022848 | 126 |
| 578 | 3300013104 | Ga0157370_10004497 | Ga0157370_100044975 | 126 |
| 579 | 3300013104 | Ga0157370_10009919 | Ga0157370_100099199 | 126 |
| 580 | 3300013104 | Ga0157370_10026752 | Ga0157370_100267522 | 126 |
| 581 | 3300013105 | Ga0157369_10069250 | Ga0157369_100692502 | 126 |
| 582 | 3300013296 | Ga0157374_10082171 | Ga0157374_100821716 | 126 |
| 583 | 3300013296 | Ga0157374_10969223 | Ga0157374_109692232 | 126 |
| 584 | 3300013306 | Ga0163162_10027363 | Ga0163162_100273638 | 126 |
| 585 | 3300013306 | Ga0163162_10420494 | Ga0163162_104204942 | 126 |
| 586 | 3300013306 | Ga0163162_10704553 | Ga0163162_107045532 | 126 |
| 587 | 3300013307 | Ga0157372_10003161 | Ga0157372_1000316120 | 126 |
| 588 | 3300013307 | Ga0157372_10048886 | Ga0157372_100488862 | 126 |
| 589 | 3300013307 | Ga0157372_10134589 | Ga0157372_101345893 | 126 |
| 590 | 3300013307 | Ga0157372_10345199 | Ga0157372_103451993 | 126 |
| 591 | 3300013307 | Ga0157372_10849500 | Ga0157372_108495002 | 126 |
| 592 | 3300013308 | Ga0157375_10001806 | Ga0157375_1000180616 | 126 |
| 593 | 3300013308 | Ga0157375_10057807 | Ga0157375_100578076 | 126 |
| 594 | 3300013308 | Ga0157375_11033190 | Ga0157375_110331902 | 126 |
| 595 | 3300014325 | Ga0163163_10535438 | Ga0163163_105354382 | 126 |
| 596 | 3300014325 | Ga0163163_11420944 | Ga0163163_114209442 | 126 |
| 597 | 3300014326 | Ga0157380_10832430 | Ga0157380_108324301 | 126 |
| 598 | 3300014968 | Ga0157379_10125205 | Ga0157379_101252055 | 126 |
| 599 | 3300014969 | Ga0157376_10416592 | Ga0157376_104165922 | 126 |
| 600 | 3300014969 | Ga0157376_12370891 | Ga0157376_123708911 | 126 |
| 601 | 3300017792 | Ga0163161_10030497 | Ga0163161_100304974 | 126 |
| 602 | 3300025321 | Ga0207656_10142107 | Ga0207656_101421072 | 126 |
| 603 | 3300025893 | Ga0207682_10000059 | Ga0207682_1000005918 | 126 |
| 604 | 3300025898 | Ga0207692_10016249 | Ga0207692_100162492 | 126 |
| 605 | 3300025903 | Ga0207680_10086904 | Ga0207680_100869042 | 126 |
| 606 | 3300025903 | Ga0207680_10234132 | Ga0207680_102341322 | 126 |
| 607 | 3300025903 | Ga0207680_10234417 | Ga0207680_102344172 | 126 |
| 608 | 3300025904 | Ga0207647_10091523 | Ga0207647_100915232 | 126 |
| 609 | 3300025906 | Ga0207699_10017799 | Ga0207699_100177996 | 126 |
| 610 | 3300025907 | Ga0207645_10000407 | Ga0207645_1000040722 | 126 |
| 611 | 3300025907 | Ga0207645_10121750 | Ga0207645_101217502 | 126 |
| 612 | 3300025908 | Ga0207643_10005194 | Ga0207643_100051947 | 126 |
| 613 | 3300025911 | Ga0207654_10534414 | Ga0207654_105344142 | 126 |
| 614 | 3300025912 | Ga0207707_10209460 | Ga0207707_102094601 | 126 |
| 615 | 3300025912 | Ga0207707_10228832 | Ga0207707_102288322 | 126 |
| 616 | 3300025913 | Ga0207695_10049858 | Ga0207695_100498586 | 126 |
| 617 | 3300025913 | Ga0207695_10321865 | Ga0207695_103218653 | 126 |
| 618 | 3300025914 | Ga0207671_10142411 | Ga0207671_101424112 | 126 |
| 619 | 3300025914 | Ga0207671_10414859 | Ga0207671_104148591 | 126 |
| 620 | 3300025917 | Ga0207660_10164370 | Ga0207660_101643701 | 126 |
| 621 | 3300025917 | Ga0207660_10538697 | Ga0207660_105386972 | 126 |
| 622 | 3300025919 | Ga0207657_10001657 | Ga0207657_1000165724 | 126 |
| 623 | 3300025920 | Ga0207649_10004347 | Ga0207649_100043477 | 126 |
| 624 | 3300025920 | Ga0207649_10034478 | Ga0207649_100344782 | 126 |
| 625 | 3300025920 | Ga0207649_10373875 | Ga0207649_103738752 | 126 |
| 626 | 3300025921 | Ga0207652_10067951 | Ga0207652_100679513 | 126 |
| 627 | 3300025921 | Ga0207652_10323300 | Ga0207652_103233002 | 126 |
| 628 | 3300025923 | Ga0207681_10539065 | Ga0207681_105390652 | 126 |
| 629 | 3300025923 | Ga0207681_10874420 | Ga0207681_108744202 | 126 |
| 630 | 3300025925 | Ga0207650_10212532 | Ga0207650_102125322 | 126 |
| 631 | 3300025926 | Ga0207659_10070771 | Ga0207659_100707715 | 126 |
| 632 | 3300025928 | Ga0207700_10078442 | Ga0207700_100784422 | 126 |
| 633 | 3300025929 | Ga0207664_10062211 | Ga0207664_100622112 | 126 |
| 634 | 3300025931 | Ga0207644_10003117 | Ga0207644_100031172 | 126 |
| 635 | 3300025931 | Ga0207644_10022346 | Ga0207644_100223464 | 126 |
| 636 | 3300025931 | Ga0207644_10044579 | Ga0207644_100445792 | 126 |
| 637 | 3300025931 | Ga0207644_10058927 | Ga0207644_100589273 | 126 |
| 638 | 3300025931 | Ga0207644_10109903 | Ga0207644_101099032 | 126 |
| 639 | 3300025931 | Ga0207644_10526752 | Ga0207644_105267522 | 126 |
| 640 | 3300025932 | Ga0207690_10000837 | Ga0207690_1000083711 | 126 |
| 641 | 3300025932 | Ga0207690_10074183 | Ga0207690_100741834 | 126 |
| 642 | 3300025932 | Ga0207690_10270068 | Ga0207690_102700682 | 126 |
| 643 | 3300025932 | Ga0207690_10547410 | Ga0207690_105474102 | 126 |
| 644 | 3300025932 | Ga0207690_10624045 | Ga0207690_106240452 | 126 |
| 645 | 3300025933 | Ga0207706_10000014 | Ga0207706_1000001498 | 126 |
| 646 | 3300025933 | Ga0207706_10021040 | Ga0207706_100210402 | 126 |
| 647 | 3300025933 | Ga0207706_10206669 | Ga0207706_102066693 | 126 |
| 648 | 3300025936 | Ga0207670_10689843 | Ga0207670_106898432 | 126 |
| 649 | 3300025937 | Ga0207669_10015701 | Ga0207669_100157013 | 126 |
| 650 | 3300025937 | Ga0207669_10724602 | Ga0207669_107246021 | 126 |
| 651 | 3300025938 | Ga0207704_10063437 | Ga0207704_100634372 | 126 |
| 652 | 3300025940 | Ga0207691_10001188 | Ga0207691_100011889 | 126 |
| 653 | 3300025940 | Ga0207691_10023447 | Ga0207691_100234475 | 126 |
| 654 | 3300025940 | Ga0207691_10026911 | Ga0207691_100269116 | 126 |
| 655 | 3300025940 | Ga0207691_10315707 | Ga0207691_103157072 | 126 |
| 656 | 3300025941 | Ga0207711_10015597 | Ga0207711_100155972 | 126 |
| 657 | 3300025941 | Ga0207711_10106255 | Ga0207711_101062554 | 126 |
| 658 | 3300025941 | Ga0207711_10464991 | Ga0207711_104649912 | 126 |
| 659 | 3300025941 | Ga0207711_10589185 | Ga0207711_105891852 | 126 |
| 660 | 3300025941 | Ga0207711_10825860 | Ga0207711_108258602 | 126 |
| 661 | 3300025941 | Ga0207711_11207785 | Ga0207711_112077851 | 126 |
| 662 | 3300025942 | Ga0207689_10021262 | Ga0207689_100212621 | 126 |
| 663 | 3300025944 | Ga0207661_11431346 | Ga0207661_114313461 | 126 |
| 664 | 3300025945 | Ga0207679_10003858 | Ga0207679_100038582 | 126 |
| 665 | 3300025945 | Ga0207679_10523135 | Ga0207679_105231352 | 126 |
| 666 | 3300025945 | Ga0207679_11068954 | Ga0207679_110689541 | 126 |
| 667 | 3300025949 | Ga0207667_10001506 | Ga0207667_1000150624 | 126 |
| 668 | 3300025960 | Ga0207651_10012010 | Ga0207651_100120103 | 126 |
| 669 | 3300025960 | Ga0207651_10028559 | Ga0207651_100285594 | 126 |
| 670 | 3300025960 | Ga0207651_10791119 | Ga0207651_107911192 | 126 |
| 671 | 3300025972 | Ga0207668_10017135 | Ga0207668_100171354 | 126 |
| 672 | 3300025972 | Ga0207668_10889730 | Ga0207668_108897302 | 126 |
| 673 | 3300025972 | Ga0207668_10970657 | Ga0207668_109706572 | 126 |
| 674 | 3300025981 | Ga0207640_10118133 | Ga0207640_101181332 | 126 |
| 675 | 3300025981 | Ga0207640_11494608 | Ga0207640_114946081 | 126 |
| 676 | 3300025986 | Ga0207658_10024430 | Ga0207658_100244304 | 126 |
| 677 | 3300025986 | Ga0207658_10219113 | Ga0207658_102191132 | 126 |
| 678 | 3300025986 | Ga0207658_10815514 | Ga0207658_108155142 | 126 |
| 679 | 3300026023 | Ga0207677_10088754 | Ga0207677_100887542 | 126 |
| 680 | 3300026023 | Ga0207677_10280257 | Ga0207677_102802572 | 126 |
| 681 | 3300026023 | Ga0207677_11069650 | Ga0207677_110696501 | 126 |
| 682 | 3300026035 | Ga0207703_10059509 | Ga0207703_100595095 | 126 |
| 683 | 3300026035 | Ga0207703_10061814 | Ga0207703_100618143 | 126 |
| 684 | 3300026041 | Ga0207639_10061501 | Ga0207639_100615012 | 126 |
| 685 | 3300026041 | Ga0207639_10214445 | Ga0207639_102144452 | 126 |
| 686 | 3300026041 | Ga0207639_10593689 | Ga0207639_105936892 | 126 |
| 687 | 3300026041 | Ga0207639_11107964 | Ga0207639_111079642 | 126 |
| 688 | 3300026067 | Ga0207678_10002753 | Ga0207678_100027532 | 126 |
| 689 | 3300026067 | Ga0207678_10035695 | Ga0207678_100356953 | 126 |
| 690 | 3300026067 | Ga0207678_10157206 | Ga0207678_101572062 | 126 |
| 691 | 3300026067 | Ga0207678_10591625 | Ga0207678_105916252 | 126 |
| 692 | 3300026075 | Ga0207708_10185694 | Ga0207708_101856942 | 126 |
| 693 | 3300026078 | Ga0207702_10016238 | Ga0207702_100162386 | 126 |
| 694 | 3300026078 | Ga0207702_11076942 | Ga0207702_110769422 | 126 |
| 695 | 3300026088 | Ga0207641_10059200 | Ga0207641_100592004 | 126 |
| 696 | 3300026089 | Ga0207648_10001780 | Ga0207648_1000178010 | 126 |
| 697 | 3300026089 | Ga0207648_10609498 | Ga0207648_106094981 | 126 |
| 698 | 3300026095 | Ga0207676_10040308 | Ga0207676_100403084 | 126 |
| 699 | 3300026116 | Ga0207674_10611643 | Ga0207674_106116431 | 126 |
| 700 | 3300026121 | Ga0207683_10000170 | Ga0207683_1000017042 | 126 |
| 701 | 3300026142 | Ga0207698_10068931 | Ga0207698_100689313 | 126 |
| 702 | 3300026142 | Ga0207698_10201862 | Ga0207698_102018622 | 126 |
| 703 | 3300026142 | Ga0207698_12184961 | Ga0207698_121849611 | 126 |
| 704 | 3300027552 | Ga0209982_1023903 | Ga0209982_10239032 | 126 |
| 705 | 3300027614 | Ga0209970_1002539 | Ga0209970_10025393 | 126 |
| 706 | 3300027682 | Ga0209971_1032422 | Ga0209971_10324221 | 126 |
| 707 | 3300027876 | Ga0209974_10008587 | Ga0209974_100085872 | 126 |
| 708 | 3300027876 | Ga0209974_10035220 | Ga0209974_100352202 | 126 |
| 709 | 3300028379 | Ga0268266_10003715 | Ga0268266_100037154 | 126 |
| 710 | 3300028381 | Ga0268264_10697939 | Ga0268264_106979392 | 126 |
| 711 | 3300031824 | Ga0307413_10251883 | Ga0307413_102518832 | 126 |
| 712 | 3300031852 | Ga0307410_10006187 | Ga0307410_100061879 | 126 |
| 713 | 3300031903 | Ga0307407_10011388 | Ga0307407_100113886 | 126 |
| 714 | 3300031995 | Ga0307409_100167196 | Ga0307409_1001671962 | 126 |
| 715 | 3300032004 | Ga0307414_10066774 | Ga0307414_100667744 | 126 |
| 716 | 3300032005 | Ga0307411_10003633 | Ga0307411_100036337 | 126 |
| 717 | 3300032126 | Ga0307415_100337589 | Ga0307415_1003375892 | 126 |
| 718 | 3300034816 | Ga0373930_0084915 | Ga0373930_0084915_225_674 | 126 |
| 719 | 3300035088 | Ga0373940_0380984 | Ga0373940_0380984_38_481 | 126 |
| 720 | 3300035090 | Ga0373949_0108164 | Ga0373949_0108164_288_737 | 126 |
| 721 | 3300035172 | Ga0373955_0301755 | Ga0373955_0301755_47_496 | 126 |
| 722 | 3300035692 | Ga0373935_0526039 | Ga0373935_0526039_399_848 | 126 |
| 723 | 3300035724 | Ga0373933_0464782 | Ga0373933_0464782_223_672 | 126 |
| 724 | 3300036401 | Ga0373937_0361569 | Ga0373937_0361569_477_926 | 126 |
| 725 | 3300037312 | Ga0395899_0291734 | Ga0395899_0291734_73_528 | 126 |
| 726 | 3300037418 | Ga0395900_0045365 | Ga0395900_0045365_3936_4391 | 126 |
| 727 | 3300037466 | Ga0395898_0283198 | Ga0395898_0283198_882_1337 | 126 |
| 728 | 3300037471 | Ga0395905_0170223 | Ga0395905_0170223_1014_1469 | 126 |
| 729 | 3300038443 | Ga0395901_0175307 | Ga0395901_0175307_237_692 | 126 |
| 730 | 3300041503 | Ga0451847_0032384 | Ga0451847_0032384_268_717 | 126 |
| 731 | 3300042876 | Ga0451577_0199148 | Ga0451577_0199148_1093_1551 | 126 |
| 732 | 3300044673 | Ga0453683_1167688 | Ga0453683_1167688_40_495 | 126 |
| 733 | 3300046472 | Ga0495580_0099435 | Ga0495580_0099435_1045_1494 | 126 |
| 734 | 3300048903 | Ga0496100_0283197 | Ga0496100_0283197_690_1136 | 126 |
| 735 | 3300048904 | Ga0496101_1106689 | Ga0496101_1106689_134_586 | 126 |
| 736 | 3300048905 | Ga0496102_0001837 | Ga0496102_0001837_5998_6444 | 126 |
| 737 | 3300048906 | Ga0496103_0189967 | Ga0496103_0189967_130_573 | 126 |
| 738 | 3300048909 | Ga0496106_0001298 | Ga0496106_0001298_12789_13235 | 126 |
| 739 | 3300048910 | Ga0496107_0039852 | Ga0496107_0039852_888_1334 | 126 |
| 740 | 3300048911 | Ga0496108_0165028 | Ga0496108_0165028_1088_1537 | 126 |
| 741 | 3300048912 | Ga0496109_0416688 | Ga0496109_0416688_749_1198 | 126 |
| 742 | 3300048913 | Ga0496110_0386624 | Ga0496110_0386624_246_692 | 126 |
| 743 | 3300048913 | Ga0496110_1060855 | Ga0496110_1060855_157_615 | 126 |
| 744 | 3300048913 | Ga0496110_1281321 | Ga0496110_1281321_165_614 | 126 |
| 745 | 3300048915 | Ga0496112_0013189 | Ga0496112_0013189_6541_6990 | 126 |
| 746 | 3300048916 | Ga0496113_0259091 | Ga0496113_0259091_729_1178 | 126 |
| 747 | 3300048917 | Ga0496114_0567162 | Ga0496114_0567162_413_859 | 126 |
| 748 | 3300050507 | nmdc:mga05p37_1073528_c1 | nmdc:mga05p37_1073528_c1_298_750 | 126 |
| 749 | 3300050510 | nmdc:mga06r32_935035_c1 | nmdc:mga06r32_935035_c1_152_604 | 126 |
| 750 | 3300050512 | nmdc:mga0n895_1140852_c1 | nmdc:mga0n895_1140852_c1_151_609 | 126 |
| 751 | 3300050512 | nmdc:mga0n895_725427_c1 | nmdc:mga0n895_725427_c1_452_907 | 126 |
| 752 | 3300050514 | nmdc:mga08x19_97942_c1 | nmdc:mga08x19_97942_c1_1136_1579 | 126 |
| 753 | 3300053085 | Ga0495619_0139960 | Ga0495619_0139960_234_683 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hr7-assembly1.cif.gz_B | crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli | 0.9895 | 48 | 126 |
| 5gu9-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant | 0.9717 | 52 | 126 |
| 4hr7-assembly1.cif.gz_B | crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli | 0.9652 | 48 | 126 |
| 5csa-assembly1.cif.gz_B | crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase | 0.9597 | 52 | 126 |
| 2ejg-assembly1.cif.gz_C | crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.9581 | 51 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LWR8_198_274_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9951 | 50 | 125 | 2.40.50.100 |
| af_I1LWR8_198_274_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9697 | 50 | 125 | 2.40.50.100 |
| af_Q93W03_192_271_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9676 | 51 | 125 | 2.40.50.100 |
| af_Q2FXX0_70_148_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9588 | 51 | 123 | 2.40.50.100 |
| 2d5dB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9559 | 52 | 126 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D0W8C8-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 1.004 | 52 | 126 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A6J4LLE9-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 1.002 | 51 | 126 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A530BNW1-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 1 | 52 | 126 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A833NR05-F1-model_v4 | deleted | 0.9997 | 50 | 126 |
|
| AF-A0A2S6SVY7-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9956 | 52 | 126 |
GO:0003989
GO:0006633 GO:0009317 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar