F479192

General Info

Members Datasets Scaffolds Average Seq Length
753 323 744 134

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101092134|Ga0070668_1010921341
Length 155
Sequence MGVERMDLRKLKTLIELVETSGIAELEIQEGEERVRITRAPMSGTQTVMLPAAAPTAPPPTGGPHNMGSEPTAPAKPEGHVVKSPMVGTFYRAASPGAKSFVEVGDTVAQGDALCIIEAMKLMNEIEADAAGTVKAILAENGQAVEFGQPLFVIV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
4 2842733646 Variovorax sp. R-72446 Isolate Unclassified
5 2842747753 Variovorax sp. R-72060 Isolate Unclassified
6 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
7 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
8 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
9 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
223 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
224 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
237 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
238 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
239 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
243 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
310 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
311 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
314 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
319 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
323 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 0
Rhizoplane 4.65
Rhizosphere 85.52
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12253474 2162886012 Bacteria 818
2 JGI24746J21847_1016548 3300001977 Bacteria 1053
3 JGI24739J22299_10048713 3300001989 Bacteria 1376
4 JGI24743J22301_10008375 3300001991 Bacteria 1813
5 JGI24750J21931_1064877 3300002070 Bacteria 589
6 JGI24745J21846_1006246 3300002073 Bacteria 1317
7 JGI24749J21850_1003215 3300002076 Bacteria 2279
8 JGI24035J26624_1004552 3300002126 Bacteria 1317
9 JGI24034J26672_10016582 3300002239 Bacteria 1135
10 JGI24751J29686_10035823 3300002459 Bacteria 1029
11 Ga0065714_10193261 3300005288 Bacteria 920
12 Ga0065712_10223299 3300005290 Bacteria 1034
13 Ga0065715_10179257 3300005293 Bacteria 1488
14 Ga0070658_10021365 3300005327 Bacteria 5188
15 Ga0070658_10071691 3300005327 Bacteria 2838
16 Ga0070658_10307238 3300005327 Bacteria 1353
17 Ga0070676_10000960 3300005328 Bacteria 14331
18 Ga0070676_10033470 3300005328 Bacteria 2949
19 Ga0070676_10072032 3300005328 Bacteria 2077
20 Ga0070683_100265746 3300005329 Bacteria 1632
21 Ga0070683_100519812 3300005329 Bacteria 1137
22 Ga0070683_100527023 3300005329 Bacteria 1129
23 Ga0070683_100890111 3300005329 Bacteria 854
24 Ga0070683_101075073 3300005329 Bacteria 773
25 Ga0070690_100025876 3300005330 Bacteria 3616
26 Ga0070690_100099592 3300005330 Bacteria 1925
27 Ga0070670_100006913 3300005331 Bacteria 9618
28 Ga0070670_100065242 3300005331 Bacteria 3124
29 Ga0070670_100144933 3300005331 Bacteria 2054
30 Ga0070670_100164559 3300005331 Bacteria 1923
31 Ga0070670_100314225 3300005331 Bacteria 1372
32 Ga0070670_100725220 3300005331 Bacteria 895
33 Ga0070670_101179392 3300005331 Bacteria 699
34 Ga0070677_10002708 3300005333 Bacteria 5664
35 Ga0070677_10299167 3300005333 Bacteria 817
36 Ga0068869_100005133 3300005334 Bacteria 8210
37 Ga0068869_100027628 3300005334 Bacteria 3959
38 Ga0068869_100060461 3300005334 Bacteria 2777
39 Ga0068869_101181838 3300005334 Bacteria 672
40 Ga0070666_10043834 3300005335 Bacteria 2996
41 Ga0070666_10183324 3300005335 Bacteria 1469
42 Ga0070666_10200253 3300005335 Bacteria 1405
43 Ga0070666_10222514 3300005335 Bacteria 1331
44 Ga0070666_10237666 3300005335 Bacteria 1288
45 Ga0070666_10724877 3300005335 Bacteria 730
46 Ga0070680_100073905 3300005336 Bacteria 2804
47 Ga0070680_100615924 3300005336 Bacteria 932
48 Ga0068868_100022592 3300005338 Bacteria 4750
49 Ga0068868_100040730 3300005338 Bacteria 3616
50 Ga0068868_100350139 3300005338 Bacteria 1265
51 Ga0068868_100472683 3300005338 Bacteria 1094
52 Ga0068868_101676148 3300005338 Bacteria 599
53 Ga0070660_100007268 3300005339 Bacteria 7712
54 Ga0070660_100086675 3300005339 Bacteria 2464
55 Ga0070660_100139677 3300005339 Bacteria 1943
56 Ga0070660_100401362 3300005339 Bacteria 1134
57 Ga0070689_100242576 3300005340 Bacteria 1484
58 Ga0070689_100780834 3300005340 Bacteria 839
59 Ga0070687_100005303 3300005343 Bacteria 5208
60 Ga0070661_100000647 3300005344 Bacteria 25720
61 Ga0070661_100038455 3300005344 Bacteria 3483
62 Ga0070661_100043695 3300005344 Bacteria 3273
63 Ga0070661_100776962 3300005344 Bacteria 785
64 Ga0070692_10016920 3300005345 Bacteria 3476
65 Ga0070668_100002954 3300005347 Bacteria 12568
66 Ga0070668_100014646 3300005347 Bacteria 5861
67 Ga0070668_100049662 3300005347 Bacteria 3227
68 Ga0070668_100133822 3300005347 Bacteria 1992
69 Ga0070668_100312651 3300005347 Bacteria 1320
70 Ga0070668_100508264 3300005347 Bacteria 1044
71 Ga0070668_101092134 3300005347 Bacteria 720
72 Ga0070669_100039508 3300005353 Bacteria 3429
73 Ga0070669_100408028 3300005353 Bacteria 1113
74 Ga0070675_100194089 3300005354 Bacteria 1760
75 Ga0070675_100210830 3300005354 Bacteria 1688
76 Ga0070675_100252687 3300005354 Bacteria 1543
77 Ga0070671_100001559 3300005355 Bacteria 17239
78 Ga0070671_100004694 3300005355 Bacteria 10847
79 Ga0070671_100005899 3300005355 Bacteria 9760
80 Ga0070671_100010054 3300005355 Bacteria 7600
81 Ga0070671_100020026 3300005355 Bacteria 5451
82 Ga0070671_100101070 3300005355 Bacteria 2419
83 Ga0070671_100109552 3300005355 Bacteria 2319
84 Ga0070671_100298043 3300005355 Bacteria 1373
85 Ga0070674_100000204 3300005356 Bacteria 28346
86 Ga0070674_100013274 3300005356 Bacteria 5088
87 Ga0070674_100164076 3300005356 Bacteria 1688
88 Ga0070673_100002026 3300005364 Bacteria 12223
89 Ga0070673_100072245 3300005364 Bacteria 2774
90 Ga0070673_101095924 3300005364 Bacteria 744
91 Ga0070688_100000913 3300005365 Bacteria 14739
92 Ga0070659_100003383 3300005366 Bacteria 11356
93 Ga0070659_100110159 3300005366 Bacteria 2222
94 Ga0070659_100307523 3300005366 Bacteria 1323
95 Ga0070659_100403249 3300005366 Bacteria 1155
96 Ga0070659_100544700 3300005366 Bacteria 993
97 Ga0070659_100687545 3300005366 Bacteria 884
98 Ga0070659_101722105 3300005366 Bacteria 561
99 Ga0070667_100002207 3300005367 Bacteria 17131
100 Ga0070667_100010447 3300005367 Bacteria 7665
101 Ga0070667_100121649 3300005367 Bacteria 2270
102 Ga0070667_100441752 3300005367 Bacteria 1188
103 Ga0070667_101460580 3300005367 Bacteria 642
104 Ga0070709_10021902 3300005434 Bacteria 3730
105 Ga0070714_100012010 3300005435 Bacteria 6893
106 Ga0070714_100496667 3300005435 Bacteria 1163
107 Ga0070713_100550705 3300005436 Bacteria 1092
108 Ga0070710_10029598 3300005437 Bacteria 2940
109 Ga0070701_10040923 3300005438 Bacteria 2358
110 Ga0070711_100011567 3300005439 Bacteria 5487
111 Ga0070705_101104513 3300005440 Bacteria 649
112 Ga0070700_100008875 3300005441 Bacteria 5496
113 Ga0070700_100235235 3300005441 Bacteria 1306
114 Ga0070700_100259366 3300005441 Bacteria 1251
115 Ga0070700_100445496 3300005441 Bacteria 984
116 Ga0070694_100318116 3300005444 Bacteria 1197
117 Ga0070663_100009567 3300005455 Bacteria 6006
118 Ga0070663_100050386 3300005455 Bacteria 2961
119 Ga0070663_100121318 3300005455 Bacteria 1975
120 Ga0070663_100131355 3300005455 Bacteria 1902
121 Ga0070663_102005742 3300005455 Bacteria 521
122 Ga0070678_100003071 3300005456 Bacteria 9257
123 Ga0070678_100050601 3300005456 Bacteria 3007
124 Ga0070678_100314447 3300005456 Bacteria 1335
125 Ga0070662_100002390 3300005457 Bacteria 11527
126 Ga0070662_100027760 3300005457 Bacteria 3934
127 Ga0070662_100033344 3300005457 Bacteria 3625
128 Ga0070662_100231707 3300005457 Bacteria 1478
129 Ga0070662_100280264 3300005457 Bacteria 1349
130 Ga0070662_100564625 3300005457 Bacteria 955
131 Ga0070681_10335357 3300005458 Bacteria 1422
132 Ga0070681_10441529 3300005458 Bacteria 1213
133 Ga0068867_100001405 3300005459 Bacteria 16635
134 Ga0068867_100139217 3300005459 Bacteria 1895
135 Ga0068867_100164038 3300005459 Bacteria 1754
136 Ga0068867_100693266 3300005459 Bacteria 898
137 Ga0070685_10128595 3300005466 Bacteria 1581
138 Ga0070699_100016121 3300005518 Bacteria 6415
139 Ga0070679_100016850 3300005530 Bacteria 7063
140 Ga0070679_100379215 3300005530 Bacteria 1361
141 Ga0070679_101062564 3300005530 Bacteria 754
142 Ga0070684_100039111 3300005535 Bacteria 4079
143 Ga0070684_100078517 3300005535 Bacteria 2917
144 Ga0068853_100000497 3300005539 Bacteria 26925
145 Ga0068853_100001509 3300005539 Bacteria 16913
146 Ga0068853_100298889 3300005539 Bacteria 1487
147 Ga0068853_101167865 3300005539 Bacteria 743
148 Ga0070672_100001609 3300005543 Bacteria 14033
149 Ga0070672_100012934 3300005543 Bacteria 5882
150 Ga0070672_100040879 3300005543 Bacteria 3561
151 Ga0070672_100053025 3300005543 Bacteria 3169
152 Ga0070672_100091772 3300005543 Bacteria 2451
153 Ga0070672_100553560 3300005543 Bacteria 999
154 Ga0070672_100620866 3300005543 Bacteria 942
155 Ga0070686_100006318 3300005544 Bacteria 6579
156 Ga0070696_100002259 3300005546 Bacteria 12698
157 Ga0070696_100543194 3300005546 Bacteria 930
158 Ga0070696_101882501 3300005546 Bacteria 518
159 Ga0070693_100059945 3300005547 Bacteria 2208
160 Ga0070693_100132356 3300005547 Bacteria 1561
161 Ga0070693_100234524 3300005547 Bacteria 1209
162 Ga0070665_100003522 3300005548 Bacteria 16646
163 Ga0070665_100420928 3300005548 Bacteria 1344
164 Ga0070665_100559771 3300005548 Bacteria 1156
165 Ga0070665_101135543 3300005548 Bacteria 793
166 Ga0068855_100000863 3300005563 Bacteria 37650
167 Ga0068855_100019281 3300005563 Bacteria 8199
168 Ga0068855_100028328 3300005563 Bacteria 6700
169 Ga0068855_100265487 3300005563 Bacteria 1911
170 Ga0068855_100272281 3300005563 Bacteria 1883
171 Ga0070664_100009745 3300005564 Bacteria 7785
172 Ga0070664_100023353 3300005564 Bacteria 5107
173 Ga0070664_100087464 3300005564 Bacteria 2694
174 Ga0070664_100155015 3300005564 Bacteria 2024
175 Ga0070664_100203255 3300005564 Bacteria 1768
176 Ga0070664_100413405 3300005564 Bacteria 1235
177 Ga0070664_100805473 3300005564 Bacteria 878
178 Ga0068857_100017820 3300005577 Bacteria 6227
179 Ga0068857_100552661 3300005577 Bacteria 1085
180 Ga0068854_100011019 3300005578 Bacteria 5869
181 Ga0068854_100029326 3300005578 Bacteria 3809
182 Ga0068856_100000517 3300005614 Bacteria 42558
183 Ga0068856_100006194 3300005614 Bacteria 11737
184 Ga0068856_100593609 3300005614 Bacteria 1129
185 Ga0068856_101791642 3300005614 Bacteria 626
186 Ga0070702_100044523 3300005615 Bacteria 2506
187 Ga0070702_100087906 3300005615 Bacteria 1878
188 Ga0068852_100003761 3300005616 Bacteria 10642
189 Ga0068852_100007263 3300005616 Bacteria 8077
190 Ga0068852_100175973 3300005616 Bacteria 2009
191 Ga0068852_100444949 3300005616 Bacteria 1282
192 Ga0068852_100452759 3300005616 Bacteria 1271
193 Ga0068852_100510344 3300005616 Bacteria 1198
194 Ga0068852_100616032 3300005616 Bacteria 1091
195 Ga0068859_100029685 3300005617 Bacteria 5487
196 Ga0068859_100047138 3300005617 Bacteria 4329
197 Ga0068864_100007512 3300005618 Bacteria 8980
198 Ga0068864_100072581 3300005618 Bacteria 3000
199 Ga0068864_100353945 3300005618 Bacteria 1386
200 Ga0068864_100380204 3300005618 Bacteria 1338
201 Ga0068861_100035853 3300005719 Bacteria 3677
202 Ga0068861_100105613 3300005719 Bacteria 2249
203 Ga0068861_100801566 3300005719 Bacteria 884
204 Ga0068861_100975864 3300005719 Bacteria 807
205 Ga0068851_10000352 3300005834 Bacteria 20740
206 Ga0068851_10011745 3300005834 Bacteria 4112
207 Ga0068851_10018402 3300005834 Bacteria 3364
208 Ga0068851_10040994 3300005834 Bacteria 2328
209 Ga0068870_10009194 3300005840 Bacteria 4482
210 Ga0068870_10028835 3300005840 Bacteria 2791
211 Ga0068870_10083129 3300005840 Bacteria 1774
212 Ga0068863_100041440 3300005841 Bacteria 4379
213 Ga0068863_100128979 3300005841 Bacteria 2414
214 Ga0068863_100152703 3300005841 Bacteria 2210
215 Ga0068863_100477094 3300005841 Bacteria 1226
216 Ga0068858_100001192 3300005842 Bacteria 26912
217 Ga0068858_100074043 3300005842 Bacteria 3162
218 Ga0068858_100141183 3300005842 Bacteria 2261
219 Ga0068858_102249861 3300005842 Bacteria 539
220 Ga0068860_100035947 3300005843 Bacteria 4750
221 Ga0068860_100266280 3300005843 Bacteria 1671
222 Ga0068860_100293724 3300005843 Bacteria 1591
223 Ga0068860_100295570 3300005843 Bacteria 1586
224 Ga0068862_100017424 3300005844 Bacteria 5983
225 Ga0068862_101258900 3300005844 Bacteria 740
226 Ga0075365_10003706 3300006038 Bacteria 7943
227 Ga0075365_10250582 3300006038 Bacteria 1244
228 Ga0075368_10027148 3300006042 Bacteria 2206
229 Ga0075363_100064664 3300006048 Bacteria 1976
230 Ga0075363_100154028 3300006048 Bacteria 1298
231 Ga0075363_100571815 3300006048 Bacteria 675
232 Ga0075364_10012996 3300006051 Bacteria 5109
233 Ga0075432_10100361 3300006058 Bacteria 1069
234 Ga0075362_10003105 3300006177 Bacteria 5728
235 Ga0075362_10046064 3300006177 Bacteria 1938
236 Ga0075367_10005132 3300006178 Bacteria 6467
237 Ga0075367_10010956 3300006178 Bacteria 4778
238 Ga0075367_10043488 3300006178 Bacteria 2631
239 Ga0075369_10070905 3300006186 Bacteria 1533
240 Ga0075369_10503377 3300006186 Bacteria 576
241 Ga0075366_10005214 3300006195 Bacteria 7032
242 Ga0097621_100011274 3300006237 Bacteria 6581
243 Ga0097621_100036310 3300006237 Bacteria 3942
244 Ga0097621_100168703 3300006237 Bacteria 1885
245 Ga0097621_100728342 3300006237 Bacteria 915
246 Ga0075370_10018855 3300006353 Bacteria 3746
247 Ga0075370_10025431 3300006353 Bacteria 3275
248 Ga0075370_10076855 3300006353 Bacteria 1915
249 Ga0075370_10108700 3300006353 Bacteria 1609
250 Ga0068871_100023453 3300006358 Bacteria 4774
251 Ga0068871_100025961 3300006358 Bacteria 4565
252 Ga0075428_100164264 3300006844 Bacteria 2409
253 Ga0075430_100392330 3300006846 Bacteria 1145
254 Ga0075434_100702292 3300006871 Bacteria 1029
255 Ga0068865_100004033 3300006881 Bacteria 8818
256 Ga0068865_100074333 3300006881 Bacteria 2420
257 Ga0075436_100267954 3300006914 Bacteria 1219
258 Ga0097620_100029687 3300006931 Bacteria 5487
259 Ga0097620_100047142 3300006931 Bacteria 4329
260 Ga0097620_101257159 3300006931 Bacteria 816
261 Ga0105240_10005257 3300009093 Bacteria 19332
262 Ga0105240_10088641 3300009093 Bacteria 3785
263 Ga0111539_10036798 3300009094 Bacteria 5914
264 Ga0105245_10050653 3300009098 Bacteria 3722
265 Ga0105245_10752605 3300009098 Bacteria 1010
266 Ga0105245_11109313 3300009098 Bacteria 838
267 Ga0105245_11375244 3300009098 Bacteria 756
268 Ga0105245_11399483 3300009098 Bacteria 749
269 Ga0105247_10040897 3300009101 Bacteria 2835
270 Ga0105247_10141463 3300009101 Bacteria 1577
271 Ga0114129_10728414 3300009147 Bacteria 1272
272 Ga0105243_10000717 3300009148 Bacteria 31849
273 Ga0105243_10100809 3300009148 Bacteria 2397
274 Ga0105242_10179651 3300009176 Bacteria 1866
275 Ga0105242_10459619 3300009176 Bacteria 1202
276 Ga0105248_10008736 3300009177 Bacteria 11130
277 Ga0105248_10017366 3300009177 Bacteria 7932
278 Ga0105248_10124188 3300009177 Bacteria 2911
279 Ga0105248_10314314 3300009177 Bacteria 1764
280 Ga0105237_10400735 3300009545 Bacteria 1377
281 Ga0105237_10527052 3300009545 Bacteria 1188
282 Ga0105237_10866371 3300009545 Bacteria 910
283 Ga0105238_10007543 3300009551 Bacteria 10893
284 Ga0105249_10075013 3300009553 Bacteria 3132
285 Ga0105239_10100855 3300010375 Bacteria 3194
286 Ga0105239_10316310 3300010375 Bacteria 1760
287 Ga0105239_10383179 3300010375 Bacteria 1590
288 Ga0105246_10125023 3300011119 Bacteria 1912
289 Ga0105246_10463951 3300011119 Bacteria 1067
290 Ga0157316_1018409 3300012510 Bacteria 738
291 Ga0157373_10018753 3300013100 Bacteria 5034
292 Ga0157373_10021443 3300013100 Bacteria 4693
293 Ga0157373_10174425 3300013100 Bacteria 1513
294 Ga0157373_10552640 3300013100 Bacteria 835
295 Ga0157371_10000228 3300013102 Bacteria 81797
296 Ga0157371_10437407 3300013102 Bacteria 960
297 Ga0157370_10004497 3300013104 Bacteria 15981
298 Ga0157370_10009919 3300013104 Bacteria 10088
299 Ga0157370_10025967 3300013104 Bacteria 5790
300 Ga0157370_10026752 3300013104 Bacteria 5692
301 Ga0157370_10064964 3300013104 Bacteria 3453
302 Ga0157369_10001339 3300013105 Bacteria 30420
303 Ga0157369_10069250 3300013105 Bacteria 3791
304 Ga0157374_10040499 3300013296 Bacteria 4291
305 Ga0157374_10082171 3300013296 Bacteria 3059
306 Ga0157374_10432791 3300013296 Bacteria 1315
307 Ga0157374_10529900 3300013296 Bacteria 1184
308 Ga0157374_10969223 3300013296 Bacteria 869
309 Ga0157378_10058168 3300013297 Bacteria 3447
310 Ga0157378_10098654 3300013297 Bacteria 2664
311 Ga0157378_12056440 3300013297 Bacteria 621
312 Ga0163162_10027363 3300013306 Bacteria 5639
313 Ga0163162_10420494 3300013306 Bacteria 1469
314 Ga0163162_10704553 3300013306 Bacteria 1131
315 Ga0163162_12754149 3300013306 Bacteria 566
316 Ga0157372_10003161 3300013307 Bacteria 17754
317 Ga0157372_10012931 3300013307 Bacteria 8898
318 Ga0157372_10048886 3300013307 Bacteria 4701
319 Ga0157372_10134589 3300013307 Bacteria 2845
320 Ga0157372_10322599 3300013307 Bacteria 1798
321 Ga0157372_10345199 3300013307 Bacteria 1734
322 Ga0157372_10556880 3300013307 Bacteria 1336
323 Ga0157372_10849500 3300013307 Bacteria 1060
324 Ga0157375_10001806 3300013308 Bacteria 18332
325 Ga0157375_10057807 3300013308 Bacteria 3835
326 Ga0157375_10177219 3300013308 Bacteria 2282
327 Ga0157375_10266678 3300013308 Bacteria 1874
328 Ga0157375_10461970 3300013308 Bacteria 1435
329 Ga0157375_11033190 3300013308 Bacteria 960
330 Ga0163163_10170434 3300014325 Bacteria 2223
331 Ga0163163_10535438 3300014325 Bacteria 1234
332 Ga0163163_11420944 3300014325 Bacteria 755
333 Ga0157380_10019617 3300014326 Bacteria 5040
334 Ga0157380_10832430 3300014326 Bacteria 943
335 Ga0157377_10000032 3300014745 Bacteria 121003
336 Ga0157377_10048912 3300014745 Bacteria 2374
337 Ga0157379_10001262 3300014968 Bacteria 20560
338 Ga0157379_10003453 3300014968 Bacteria 13373
339 Ga0157379_10077414 3300014968 Bacteria 2978
340 Ga0157379_10125205 3300014968 Bacteria 2312
341 Ga0157376_10416592 3300014969 Bacteria 1302
342 Ga0157376_11978470 3300014969 Bacteria 620
343 Ga0157376_12370891 3300014969 Bacteria 570
344 Ga0183362_10003 3300015683 Bacteria 977584
345 Ga0163161_10030497 3300017792 Bacteria 3839
346 Ga0163161_10320921 3300017792 Bacteria 1224
347 Ga0207673_1017036 3300025290 Bacteria 968
348 Ga0209051_1003446 3300025303 Bacteria 10364
349 Ga0209257_1020496 3300025304 Bacteria 2441
350 Ga0207697_10000237 3300025315 Bacteria 30060
351 Ga0207656_10000916 3300025321 Bacteria 9617
352 Ga0207656_10142107 3300025321 Bacteria 1132
353 Ga0207682_10000059 3300025893 Bacteria 48172
354 Ga0207682_10000203 3300025893 Bacteria 26888
355 Ga0207692_10016249 3300025898 Bacteria 3291
356 Ga0207642_10466740 3300025899 Bacteria 767
357 Ga0207710_10044390 3300025900 Bacteria 1979
358 Ga0207688_10000362 3300025901 Bacteria 21159
359 Ga0207688_10515457 3300025901 Bacteria 750
360 Ga0207680_10077134 3300025903 Bacteria 2083
361 Ga0207680_10086904 3300025903 Bacteria 1978
362 Ga0207680_10234132 3300025903 Bacteria 1263
363 Ga0207680_10234417 3300025903 Bacteria 1262
364 Ga0207647_10091523 3300025904 Bacteria 1814
365 Ga0207699_10017799 3300025906 Bacteria 3751
366 Ga0207645_10000407 3300025907 Bacteria 35586
367 Ga0207645_10006246 3300025907 Bacteria 8560
368 Ga0207645_10121750 3300025907 Bacteria 1694
369 Ga0207645_10308135 3300025907 Bacteria 1055
370 Ga0207643_10003120 3300025908 Bacteria 8914
371 Ga0207643_10005194 3300025908 Bacteria 6965
372 Ga0207643_10009218 3300025908 Bacteria 5300
373 Ga0207705_10364539 3300025909 Bacteria 1115
374 Ga0207654_10140450 3300025911 Bacteria 1539
375 Ga0207654_10534414 3300025911 Bacteria 831
376 Ga0207707_10209460 3300025912 Bacteria 1699
377 Ga0207707_10228832 3300025912 Bacteria 1618
378 Ga0207695_10023026 3300025913 Bacteria 7052
379 Ga0207695_10049858 3300025913 Bacteria 4408
380 Ga0207695_10321865 3300025913 Bacteria 1436
381 Ga0207695_10355936 3300025913 Bacteria 1350
382 Ga0207671_10142411 3300025914 Bacteria 1848
383 Ga0207671_10414859 3300025914 Bacteria 1071
384 Ga0207660_10164370 3300025917 Bacteria 1714
385 Ga0207660_10538697 3300025917 Bacteria 949
386 Ga0207662_10007415 3300025918 Bacteria 5971
387 Ga0207662_11082769 3300025918 Bacteria 570
388 Ga0207657_10001657 3300025919 Bacteria 24031
389 Ga0207657_10012397 3300025919 Bacteria 8423
390 Ga0207657_10023410 3300025919 Bacteria 5751
391 Ga0207657_10027297 3300025919 Bacteria 5230
392 Ga0207649_10004347 3300025920 Bacteria 7691
393 Ga0207649_10017583 3300025920 Bacteria 4053
394 Ga0207649_10034478 3300025920 Bacteria 3033
395 Ga0207649_10232409 3300025920 Bacteria 1319
396 Ga0207649_10373875 3300025920 Bacteria 1060
397 Ga0207649_10665064 3300025920 Bacteria 806
398 Ga0207652_10067951 3300025921 Bacteria 3091
399 Ga0207652_10323300 3300025921 Bacteria 1393
400 Ga0207652_10850963 3300025921 Bacteria 808
401 Ga0207681_10019992 3300025923 Bacteria 4241
402 Ga0207681_10111611 3300025923 Bacteria 1989
403 Ga0207681_10539065 3300025923 Bacteria 959
404 Ga0207681_10874420 3300025923 Bacteria 752
405 Ga0207694_10007840 3300025924 Bacteria 8085
406 Ga0207650_10002859 3300025925 Bacteria 11921
407 Ga0207650_10004599 3300025925 Bacteria 9438
408 Ga0207650_10039595 3300025925 Bacteria 3444
409 Ga0207650_10152272 3300025925 Bacteria 1826
410 Ga0207650_10212532 3300025925 Bacteria 1554
411 Ga0207650_10217612 3300025925 Bacteria 1536
412 Ga0207650_10367924 3300025925 Bacteria 1185
413 Ga0207650_10463446 3300025925 Bacteria 1056
414 Ga0207659_10070771 3300025926 Bacteria 2545
415 Ga0207659_10300457 3300025926 Bacteria 1318
416 Ga0207659_10521429 3300025926 Bacteria 1008
417 Ga0207700_10078442 3300025928 Bacteria 2569
418 Ga0207664_10003381 3300025929 Bacteria 10612
419 Ga0207664_10062211 3300025929 Bacteria 2980
420 Ga0207644_10000991 3300025931 Bacteria 18125
421 Ga0207644_10003117 3300025931 Bacteria 10667
422 Ga0207644_10022346 3300025931 Bacteria 4321
423 Ga0207644_10044579 3300025931 Bacteria 3151
424 Ga0207644_10053037 3300025931 Bacteria 2917
425 Ga0207644_10058927 3300025931 Bacteria 2776
426 Ga0207644_10109903 3300025931 Bacteria 2083
427 Ga0207644_10283117 3300025931 Bacteria 1331
428 Ga0207644_10526752 3300025931 Bacteria 977
429 Ga0207690_10000837 3300025932 Bacteria 19691
430 Ga0207690_10074183 3300025932 Bacteria 2356
431 Ga0207690_10158828 3300025932 Bacteria 1683
432 Ga0207690_10167937 3300025932 Bacteria 1641
433 Ga0207690_10270068 3300025932 Bacteria 1321
434 Ga0207690_10293804 3300025932 Bacteria 1269
435 Ga0207690_10547410 3300025932 Bacteria 940
436 Ga0207690_10624045 3300025932 Bacteria 881
437 Ga0207706_10000014 3300025933 Bacteria 177082
438 Ga0207706_10000486 3300025933 Bacteria 42324
439 Ga0207706_10021040 3300025933 Bacteria 5860
440 Ga0207706_10032489 3300025933 Bacteria 4648
441 Ga0207706_10206669 3300025933 Bacteria 1722
442 Ga0207706_10457979 3300025933 Bacteria 1103
443 Ga0207709_10001051 3300025935 Bacteria 20412
444 Ga0207670_10196906 3300025936 Bacteria 1528
445 Ga0207670_10689843 3300025936 Bacteria 845
446 Ga0207669_10015701 3300025937 Bacteria 3826
447 Ga0207669_10036718 3300025937 Bacteria 2803
448 Ga0207669_10724602 3300025937 Bacteria 819
449 Ga0207704_10007005 3300025938 Bacteria 5296
450 Ga0207704_10040706 3300025938 Bacteria 2719
451 Ga0207704_10063437 3300025938 Bacteria 2303
452 Ga0207691_10001188 3300025940 Bacteria 25899
453 Ga0207691_10003887 3300025940 Bacteria 14504
454 Ga0207691_10004275 3300025940 Bacteria 13875
455 Ga0207691_10023447 3300025940 Bacteria 5810
456 Ga0207691_10026911 3300025940 Bacteria 5396
457 Ga0207691_10109650 3300025940 Bacteria 2456
458 Ga0207691_10315707 3300025940 Bacteria 1340
459 Ga0207711_10003826 3300025941 Bacteria 12946
460 Ga0207711_10013604 3300025941 Bacteria 6760
461 Ga0207711_10015597 3300025941 Bacteria 6306
462 Ga0207711_10106255 3300025941 Bacteria 2491
463 Ga0207711_10320982 3300025941 Bacteria 1431
464 Ga0207711_10464991 3300025941 Bacteria 1178
465 Ga0207711_10589185 3300025941 Bacteria 1037
466 Ga0207711_10821868 3300025941 Bacteria 865
467 Ga0207711_10825860 3300025941 Bacteria 863
468 Ga0207711_11207785 3300025941 Bacteria 698
469 Ga0207711_11503213 3300025941 Bacteria 616
470 Ga0207689_10000468 3300025942 Bacteria 37877
471 Ga0207689_10021262 3300025942 Bacteria 5455
472 Ga0207689_10037438 3300025942 Bacteria 4023
473 Ga0207689_10665793 3300025942 Bacteria 877
474 Ga0207661_10035912 3300025944 Bacteria 3865
475 Ga0207661_10056016 3300025944 Bacteria 3164
476 Ga0207661_10422422 3300025944 Bacteria 1211
477 Ga0207661_11431346 3300025944 Bacteria 634
478 Ga0207679_10003858 3300025945 Bacteria 9298
479 Ga0207679_10175984 3300025945 Bacteria 1766
480 Ga0207679_10235097 3300025945 Bacteria 1549
481 Ga0207679_10266911 3300025945 Bacteria 1462
482 Ga0207679_10347343 3300025945 Bacteria 1292
483 Ga0207679_10523135 3300025945 Bacteria 1061
484 Ga0207679_11068954 3300025945 Bacteria 740
485 Ga0207667_10001506 3300025949 Bacteria 29228
486 Ga0207667_10009870 3300025949 Bacteria 11204
487 Ga0207651_10012010 3300025960 Bacteria 4877
488 Ga0207651_10028559 3300025960 Bacteria 3521
489 Ga0207651_10033373 3300025960 Bacteria 3320
490 Ga0207651_10057300 3300025960 Bacteria 2686
491 Ga0207651_10791119 3300025960 Bacteria 840
492 Ga0207651_10798769 3300025960 Bacteria 836
493 Ga0207712_10199969 3300025961 Bacteria 1584
494 Ga0207668_10017135 3300025972 Bacteria 4533
495 Ga0207668_10259469 3300025972 Bacteria 1415
496 Ga0207668_10436415 3300025972 Bacteria 1114
497 Ga0207668_10889730 3300025972 Bacteria 792
498 Ga0207668_10970657 3300025972 Bacteria 758
499 Ga0207640_10026816 3300025981 Bacteria 3503
500 Ga0207640_10118133 3300025981 Bacteria 1894
501 Ga0207640_11494608 3300025981 Bacteria 607
502 Ga0207658_10009698 3300025986 Bacteria 6536
503 Ga0207658_10024430 3300025986 Bacteria 4228
504 Ga0207658_10091867 3300025986 Bacteria 2356
505 Ga0207658_10219113 3300025986 Bacteria 1600
506 Ga0207658_10490356 3300025986 Bacteria 1093
507 Ga0207658_10815514 3300025986 Bacteria 847
508 Ga0207658_11357196 3300025986 Bacteria 650
509 Ga0207677_10088754 3300026023 Bacteria 2243
510 Ga0207677_10123367 3300026023 Bacteria 1953
511 Ga0207677_10280257 3300026023 Bacteria 1368
512 Ga0207677_10459309 3300026023 Bacteria 1093
513 Ga0207677_11069650 3300026023 Bacteria 734
514 Ga0207703_10024981 3300026035 Bacteria 4699
515 Ga0207703_10049969 3300026035 Bacteria 3382
516 Ga0207703_10059509 3300026035 Bacteria 3120
517 Ga0207703_10061814 3300026035 Bacteria 3067
518 Ga0207639_10061501 3300026041 Bacteria 2901
519 Ga0207639_10096743 3300026041 Bacteria 2376
520 Ga0207639_10214445 3300026041 Bacteria 1659
521 Ga0207639_10593689 3300026041 Bacteria 1021
522 Ga0207639_11107964 3300026041 Bacteria 742
523 Ga0207639_11252630 3300026041 Bacteria 696
524 Ga0207678_10001272 3300026067 Bacteria 23314
525 Ga0207678_10002753 3300026067 Bacteria 15920
526 Ga0207678_10035695 3300026067 Bacteria 4329
527 Ga0207678_10157206 3300026067 Bacteria 1941
528 Ga0207678_10591625 3300026067 Bacteria 972
529 Ga0207708_10000650 3300026075 Bacteria 26677
530 Ga0207708_10185694 3300026075 Bacteria 1652
531 Ga0207708_10820976 3300026075 Bacteria 801
532 Ga0207702_10006552 3300026078 Bacteria 10017
533 Ga0207702_10016238 3300026078 Bacteria 6161
534 Ga0207702_11076942 3300026078 Bacteria 798
535 Ga0207641_10044803 3300026088 Bacteria 3721
536 Ga0207641_10059200 3300026088 Bacteria 3261
537 Ga0207641_10178458 3300026088 Bacteria 1943
538 Ga0207641_10355973 3300026088 Bacteria 1396
539 Ga0207641_10805647 3300026088 Bacteria 929
540 Ga0207641_10925608 3300026088 Bacteria 866
541 Ga0207648_10000790 3300026089 Bacteria 35657
542 Ga0207648_10001780 3300026089 Bacteria 23603
543 Ga0207648_10001903 3300026089 Bacteria 22822
544 Ga0207648_10208927 3300026089 Bacteria 1732
545 Ga0207648_10226970 3300026089 Bacteria 1661
546 Ga0207648_10609498 3300026089 Bacteria 1007
547 Ga0207676_10040308 3300026095 Bacteria 3579
548 Ga0207676_10042494 3300026095 Bacteria 3497
549 Ga0207676_10089512 3300026095 Bacteria 2522
550 Ga0207676_10151579 3300026095 Bacteria 1997
551 Ga0207674_10000020 3300026116 Bacteria 162474
552 Ga0207674_10000769 3300026116 Bacteria 41860
553 Ga0207674_10611643 3300026116 Bacteria 1052
554 Ga0207675_100003290 3300026118 Bacteria 15823
555 Ga0207675_100099444 3300026118 Bacteria 2739
556 Ga0207675_102258999 3300026118 Bacteria 558
557 Ga0207683_10000170 3300026121 Bacteria 56059
558 Ga0207683_10004396 3300026121 Bacteria 12182
559 Ga0207683_10050242 3300026121 Bacteria 3652
560 Ga0207683_10316434 3300026121 Bacteria 1429
561 Ga0207698_10003199 3300026142 Bacteria 9829
562 Ga0207698_10068931 3300026142 Bacteria 2795
563 Ga0207698_10201862 3300026142 Bacteria 1781
564 Ga0207698_10432361 3300026142 Bacteria 1266
565 Ga0207698_10448922 3300026142 Bacteria 1244
566 Ga0207698_11398871 3300026142 Bacteria 715
567 Ga0207698_12184961 3300026142 Bacteria 566
568 Ga0209982_1023903 3300027552 Bacteria 946
569 Ga0209970_1002539 3300027614 Bacteria 3093
570 Ga0209971_1032422 3300027682 Bacteria 1254
571 Ga0209813_10002074 3300027866 Bacteria 4555
572 Ga0209974_10008587 3300027876 Bacteria 3488
573 Ga0209974_10035220 3300027876 Bacteria 1662
574 Ga0207428_10275602 3300027907 Bacteria 1250
575 Ga0268266_10003715 3300028379 Bacteria 15019
576 Ga0268266_10249989 3300028379 Bacteria 1639
577 Ga0268266_10414528 3300028379 Bacteria 1276
578 Ga0268266_10505674 3300028379 Bacteria 1154
579 Ga0268265_10520221 3300028380 Bacteria 1124
580 Ga0268264_10103364 3300028381 Bacteria 2481
581 Ga0268264_10371939 3300028381 Bacteria 1366
582 Ga0268264_10614334 3300028381 Bacteria 1073
583 Ga0268264_10697939 3300028381 Bacteria 1008
584 Ga0307517_10221513 3300028786 Bacteria 1149
585 Ga0307515_10070717 3300028794 Bacteria 4744
586 Ga0307513_10071439 3300031456 Bacteria 3622
587 Ga0307408_100434930 3300031548 Bacteria 1135
588 Ga0265314_10052900 3300031711 Bacteria 2820
589 Ga0307516_10001407 3300031730 Bacteria 33232
590 Ga0307405_10296149 3300031731 Bacteria 1225
591 Ga0307405_11399538 3300031731 Bacteria 611
592 Ga0316577_10010632 3300031733 Bacteria 4973
593 Ga0307413_10251883 3300031824 Bacteria 1310
594 Ga0307410_10006187 3300031852 Bacteria 6431
595 Ga0307410_10795009 3300031852 Bacteria 804
596 Ga0307407_10011388 3300031903 Bacteria 4232
597 Ga0307412_11235791 3300031911 Bacteria 670
598 Ga0307409_100167196 3300031995 Bacteria 1931
599 Ga0307409_101239130 3300031995 Bacteria 770
600 Ga0307416_100555362 3300032002 Bacteria 1222
601 Ga0307416_101225842 3300032002 Bacteria 856
602 Ga0307416_101963368 3300032002 Bacteria 688
603 Ga0307414_10066774 3300032004 Bacteria 2573
604 Ga0307411_10003633 3300032005 Bacteria 7210
605 Ga0307415_100337589 3300032126 Bacteria 1263
606 Ga0373930_0084915 3300034816 Bacteria 736
607 Ga0373940_0380984 3300035088 Bacteria 500
608 Ga0373949_0108164 3300035090 Bacteria 769
609 Ga0373954_0333030 3300035118 Bacteria 749
610 Ga0373943_0281323 3300035170 Bacteria 941
611 Ga0373955_0301755 3300035172 Bacteria 966
612 Ga0373935_0526039 3300035692 Bacteria 860
613 Ga0373933_0142857 3300035724 Bacteria 1512
614 Ga0373933_0464782 3300035724 Bacteria 828
615 Ga0373937_0361569 3300036401 Bacteria 1375
616 Ga0373937_0609217 3300036401 Bacteria 1037
617 Ga0395899_0291734 3300037312 Bacteria 1106
618 Ga0395900_0045365 3300037418 Bacteria 4528
619 Ga0395898_0283198 3300037466 Bacteria 1581
620 Ga0395905_0170223 3300037471 Bacteria 2046
621 Ga0395901_0175307 3300038443 Bacteria 2249
622 Ga0395901_1380088 3300038443 Bacteria 664
623 Ga0400487_24476 3300039110 Bacteria 32520
624 Ga0451847_0032384 3300041503 Bacteria 764
625 Ga0439433_0128000 3300041999 Bacteria 644
626 Ga0439432_095221 3300042006 Bacteria 894
627 Ga0439446_0086139 3300042156 Bacteria 978
628 Ga0439434_0027955 3300042435 Bacteria 1707
629 Ga0439435_0177806 3300042436 Bacteria 694
630 Ga0450893_0039994 3300042532 Bacteria 857
631 Ga0451577_0199148 3300042876 Bacteria 1808
632 Ga0453683_1167688 3300044673 Bacteria 515
633 Ga0466963_0440725 3300044694 Bacteria 919
634 Ga0466964_0038869 3300044706 Bacteria 1915
635 Ga0453684_1787323 3300044712 Bacteria 625
636 Ga0466960_0057022 3300044901 Bacteria 1903
637 Ga0466967_1348845 3300045976 Bacteria 710
638 Ga0495629_0653271 3300046459 Bacteria 701
639 Ga0495638_0185393 3300046460 Bacteria 1184
640 Ga0495651_0210621 3300046462 Bacteria 1353
641 Ga0495580_0099435 3300046472 Bacteria 2024
642 Ga0495639_0027818 3300046475 Bacteria 2503
643 Ga0495618_0304135 3300046514 Bacteria 991
644 Ga0495628_0162644 3300046516 Bacteria 1696
645 Ga0495632_0149053 3300046519 Bacteria 1082
646 Ga0495586_0267458 3300046535 Bacteria 977
647 Ga0495625_0605781 3300046660 Bacteria 657
648 Ga0495600_0646228 3300046809 Bacteria 640
649 Ga0496100_0071661 3300048903 Bacteria 2314
650 Ga0496100_0283197 3300048903 Bacteria 1236
651 Ga0496101_0005661 3300048904 Bacteria 7971
652 Ga0496101_1106689 3300048904 Bacteria 622
653 Ga0496102_0001837 3300048905 Bacteria 18347
654 Ga0496102_0670851 3300048905 Bacteria 960
655 Ga0496103_0189967 3300048906 Bacteria 1321
656 Ga0496104_0421698 3300048907 Bacteria 1246
657 Ga0496105_0004196 3300048908 Bacteria 10822
658 Ga0496105_0193083 3300048908 Bacteria 1664
659 Ga0496106_0001298 3300048909 Bacteria 18768
660 Ga0496106_0061077 3300048909 Bacteria 2858
661 Ga0496107_0039852 3300048910 Bacteria 3370
662 Ga0496107_0547220 3300048910 Bacteria 857
663 Ga0496108_0045525 3300048911 Bacteria 3665
664 Ga0496108_0156924 3300048911 Bacteria 1965
665 Ga0496108_0165028 3300048911 Bacteria 1915
666 Ga0496108_0485409 3300048911 Bacteria 1079
667 Ga0496109_0137535 3300048912 Bacteria 2283
668 Ga0496109_0416688 3300048912 Bacteria 1269
669 Ga0496109_1602704 3300048912 Bacteria 585
670 Ga0496110_0028281 3300048913 Bacteria 4814
671 Ga0496110_0386624 3300048913 Bacteria 1275
672 Ga0496110_0882286 3300048913 Bacteria 800
673 Ga0496110_1060855 3300048913 Bacteria 718
674 Ga0496110_1281321 3300048913 Bacteria 642
675 Ga0496111_0499287 3300048914 Bacteria 896
676 Ga0496112_0004682 3300048915 Bacteria 11639
677 Ga0496112_0013189 3300048915 Bacteria 7625
678 Ga0496112_0920539 3300048915 Bacteria 796
679 Ga0496113_0178682 3300048916 Bacteria 1682
680 Ga0496113_0259091 3300048916 Bacteria 1389
681 Ga0496114_0252923 3300048917 Bacteria 1550
682 Ga0496114_0567162 3300048917 Bacteria 1002
683 Ga0496115_0445171 3300048918 Bacteria 1047
684 Ga0496122_0031207 3300048925 Bacteria 4441
685 Ga0496123_0101350 3300048926 Bacteria 1674
686 Ga0496124_0038111 3300048927 Bacteria 4175
687 Ga0496126_0118975 3300048929 Bacteria 2293
688 Ga0501034_0103580 3300049571 Bacteria 2839
689 Ga0501038_0442894 3300049574 Bacteria 1000
690 Ga0501043_0281422 3300049579 Bacteria 1275
691 Ga0501046_0159879 3300049580 Bacteria 1695
692 Ga0501047_0384104 3300049581 Bacteria 1238
693 Ga0501068_0253599 3300049584 Bacteria 1122
694 Ga0501072_0511435 3300049588 Bacteria 950
695 Ga0501073_0516134 3300049589 Bacteria 826
696 Ga0501241_055227 3300049758 Bacteria 790
697 Ga0501035_0320439 3300049822 Bacteria 1302
698 Ga0501044_0452432 3300049823 Bacteria 1190
699 nmdc:mga03683_3317_c1 3300050489 Bacteria 5170
700 nmdc:mga03683_89830_c1 3300050489 Bacteria 1338
701 nmdc:mga03n38_186883_c1 3300050490 Bacteria 1065
702 nmdc:mga03n38_854280_c1 3300050490 Bacteria 532
703 nmdc:mga03n38_94418_c1 3300050490 Bacteria 1431
704 nmdc:mga00v17_20264_c1 3300050491 Bacteria 3807
705 nmdc:mga0yw44_54687_c1 3300050492 Bacteria 2427
706 nmdc:mga0k408_15682_c1 3300050493 Bacteria 4194
707 nmdc:mga0k408_180_c1 3300050493 Bacteria 33189
708 nmdc:mga0k408_1901_c1 3300050493 Bacteria 11173
709 nmdc:mga0k408_2769_c1 3300050493 Bacteria 9320
710 nmdc:mga06z11_207697_c1 3300050494 Bacteria 1140
711 nmdc:mga06z11_30142_c1 3300050494 Bacteria 2622
712 nmdc:mga04h51_16959_c1 3300050495 Bacteria 2122
713 nmdc:mga04h51_93716_c1 3300050495 Bacteria 1084
714 nmdc:mga07m45_225995_c1 3300050496 Bacteria 1089
715 nmdc:mga07m45_260_c1 3300050496 Bacteria 21450
716 nmdc:mga07m45_293840_c1 3300050496 Bacteria 945
717 nmdc:mga07m45_452398_c1 3300050496 Bacteria 745
718 nmdc:mga07m45_4942_c1 3300050496 Bacteria 6572
719 nmdc:mga05p37_1073528_c1 3300050507 Bacteria 846
720 nmdc:mga09592_714568_c1 3300050508 Bacteria 852
721 nmdc:mga06r32_935035_c1 3300050510 Bacteria 822
722 nmdc:mga08y16_72716_c1 3300050511 Bacteria 3583
723 nmdc:mga0n895_1140852_c1 3300050512 Bacteria 755
724 nmdc:mga0n895_725427_c1 3300050512 Bacteria 988
725 nmdc:mga08x19_97942_c1 3300050514 Bacteria 1942
726 nmdc:mga0sz30_186555_c1 3300050516 Bacteria 921
727 nmdc:mga0sz30_70874_c1 3300050516 Bacteria 1500
728 Ga0495619_0139960 3300053085 Bacteria 1666
729 Ga0500644_0069331 3300053088 Bacteria 1266
730 Ga0500646_0023215 3300053090 Bacteria 1662
731 Ga0500583_0058484 3300053092 Bacteria 1813
732 Ga0500583_0149219 3300053092 Bacteria 1163
733 Ga0500641_0354935 3300053096 Bacteria 588
734 Ga0500650_0149800 3300053098 Bacteria 1079
735 Ga0500650_0212710 3300053098 Bacteria 877
736 Ga0500594_0004456 3300053118 Bacteria 3087
737 Ga0500642_0030478 3300053130 Bacteria 2245
738 Ga0500655_011334 3300053133 Bacteria 1614
739 Ga0500568_0023510 3300053139 Bacteria 2621
740 Ga0500577_0020647 3300053142 Bacteria 2159
741 Ga0500586_080182 3300053145 Bacteria 1145
742 Ga0500604_0003317 3300053151 Bacteria 4332
743 Ga0500616_0123281 3300053153 Bacteria 1234
744 Ga0500645_017536 3300053730 Bacteria 2242

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042435 Ga0439434_0027955 Ga0439434_0027955_389_847 92
2 3300005546 Ga0070696_101882501 Ga0070696_1018825011 94
3 3300005355 Ga0070671_100005899 Ga0070671_1000058993 97
4 3300005618 Ga0068864_100380204 Ga0068864_1003802041 97
5 3300005841 Ga0068863_100128979 Ga0068863_1001289791 97
6 3300009101 Ga0105247_10141463 Ga0105247_101414631 97
7 3300009177 Ga0105248_10017366 Ga0105248_100173664 97
8 3300025931 Ga0207644_10053037 Ga0207644_100530373 98
9 3300025941 Ga0207711_10013604 Ga0207711_100136047 98
10 3300026088 Ga0207641_10355973 Ga0207641_103559732 98
11 3300026095 Ga0207676_10151579 Ga0207676_101515792 98
12 3300048907 Ga0496104_0421698 Ga0496104_0421698_73_540 98
13 3300048908 Ga0496105_0193083 Ga0496105_0193083_971_1438 98
14 3300048911 Ga0496108_0045525 Ga0496108_0045525_387_854 98
15 3300048915 Ga0496112_0004682 Ga0496112_0004682_7408_7875 98
16 3300048916 Ga0496113_0178682 Ga0496113_0178682_150_617 98
17 3300028794 Ga0307515_10070717 Ga0307515_100707174 102
18 3300046460 Ga0495638_0185393 Ga0495638_0185393_267_713 102
19 3300046519 Ga0495632_0149053 Ga0495632_0149053_362_811 102
20 3300053092 Ga0500583_0058484 Ga0500583_0058484_617_1063 102
21 3300053098 Ga0500650_0149800 Ga0500650_0149800_352_798 102
22 3300006931 Ga0097620_101257159 Ga0097620_1012571592 106
23 3300006038 Ga0075365_10003706 Ga0075365_100037067 111
24 3300006042 Ga0075368_10027148 Ga0075368_100271482 111
25 3300006048 Ga0075363_100571815 Ga0075363_1005718151 111
26 3300006178 Ga0075367_10010956 Ga0075367_100109565 111
27 3300006353 Ga0075370_10025431 Ga0075370_100254312 111
28 3300053096 Ga0500641_0354935 Ga0500641_0354935_21_452 112
29 3300025303 Ga0209051_1003446 Ga0209051_100344610 113
30 3300025304 Ga0209257_1020496 Ga0209257_10204962 113
31 3300005841 Ga0068863_100477094 Ga0068863_1004770942 114
32 3300009148 Ga0105243_10000717 Ga0105243_100007179 114
33 3300014745 Ga0157377_10000032 Ga0157377_1000003277 114
34 3300025935 Ga0207709_10001051 Ga0207709_100010515 114
35 3300026088 Ga0207641_10805647 Ga0207641_108056471 114
36 3300026089 Ga0207648_10000790 Ga0207648_100007908 114
37 3300032002 Ga0307416_101225842 Ga0307416_1012258422 114
38 3300005335 Ga0070666_10724877 Ga0070666_107248771 115
39 3300031711 Ga0265314_10052900 Ga0265314_100529004 115
40 3300053090 Ga0500646_0023215 Ga0500646_0023215_829_1287 115
41 3300053092 Ga0500583_0149219 Ga0500583_0149219_143_601 115
42 3300053098 Ga0500650_0212710 Ga0500650_0212710_327_785 115
43 3300053130 Ga0500642_0030478 Ga0500642_0030478_269_727 115
44 3300053133 Ga0500655_011334 Ga0500655_011334_333_791 115
45 3300053139 Ga0500568_0023510 Ga0500568_0023510_1862_2320 115
46 3300053142 Ga0500577_0020647 Ga0500577_0020647_1627_2091 115
47 3300053151 Ga0500604_0003317 Ga0500604_0003317_2723_3181 115
48 3300053730 Ga0500645_017536 Ga0500645_017536_98_556 115
49 3300005329 Ga0070683_100265746 Ga0070683_1002657462 116
50 3300005330 Ga0070690_100025876 Ga0070690_1000258762 116
51 3300005331 Ga0070670_100144933 Ga0070670_1001449333 116
52 3300005334 Ga0068869_100060461 Ga0068869_1000604614 116
53 3300005355 Ga0070671_100004694 Ga0070671_1000046947 116
54 3300005364 Ga0070673_100072245 Ga0070673_1000722453 116
55 3300005367 Ga0070667_101460580 Ga0070667_1014605801 116
56 3300005456 Ga0070678_100314447 Ga0070678_1003144472 116
57 3300005457 Ga0070662_100027760 Ga0070662_1000277605 116
58 3300005457 Ga0070662_100564625 Ga0070662_1005646252 116
59 3300005543 Ga0070672_100053025 Ga0070672_1000530254 116
60 3300005548 Ga0070665_101135543 Ga0070665_1011355431 116
61 3300005616 Ga0068852_100444949 Ga0068852_1004449493 116
62 3300005719 Ga0068861_100105613 Ga0068861_1001056134 116
63 3300005843 Ga0068860_100295570 Ga0068860_1002955702 116
64 3300005844 Ga0068862_101258900 Ga0068862_1012589001 116
65 3300006237 Ga0097621_100036310 Ga0097621_1000363102 116
66 3300006358 Ga0068871_100023453 Ga0068871_1000234535 116
67 3300009098 Ga0105245_10752605 Ga0105245_107526052 116
68 3300009177 Ga0105248_10008736 Ga0105248_100087368 116
69 3300011119 Ga0105246_10125023 Ga0105246_101250232 116
70 3300013296 Ga0157374_10529900 Ga0157374_105299002 116
71 3300013297 Ga0157378_10058168 Ga0157378_100581682 116
72 3300013297 Ga0157378_12056440 Ga0157378_120564401 116
73 3300013308 Ga0157375_10461970 Ga0157375_104619701 116
74 3300025901 Ga0207688_10515457 Ga0207688_105154572 116
75 3300025925 Ga0207650_10039595 Ga0207650_100395953 116
76 3300025925 Ga0207650_10463446 Ga0207650_104634462 116
77 3300025931 Ga0207644_10000991 Ga0207644_100009915 116
78 3300025933 Ga0207706_10457979 Ga0207706_104579792 116
79 3300025941 Ga0207711_10003826 Ga0207711_100038268 116
80 3300025941 Ga0207711_10320982 Ga0207711_103209822 116
81 3300025942 Ga0207689_10037438 Ga0207689_100374382 116
82 3300025944 Ga0207661_10422422 Ga0207661_104224221 116
83 3300025945 Ga0207679_10235097 Ga0207679_102350972 116
84 3300025960 Ga0207651_10033373 Ga0207651_100333734 116
85 3300026023 Ga0207677_10459309 Ga0207677_104593092 116
86 3300026088 Ga0207641_10925608 Ga0207641_109256081 116
87 3300026118 Ga0207675_100099444 Ga0207675_1000994444 116
88 3300026121 Ga0207683_10050242 Ga0207683_100502422 116
89 3300026121 Ga0207683_10316434 Ga0207683_103164342 116
90 3300026142 Ga0207698_11398871 Ga0207698_113988711 116
91 3300028379 Ga0268266_10414528 Ga0268266_104145282 116
92 3300028381 Ga0268264_10103364 Ga0268264_101033643 116
93 3300031730 Ga0307516_10001407 Ga0307516_1000140726 116
94 3300035118 Ga0373954_0333030 Ga0373954_0333030_13_462 116
95 3300042436 Ga0439435_0177806 Ga0439435_0177806_21_527 116
96 3300046462 Ga0495651_0210621 Ga0495651_0210621_584_1057 116
97 3300046475 Ga0495639_0027818 Ga0495639_0027818_724_1197 116
98 3300046514 Ga0495618_0304135 Ga0495618_0304135_283_732 116
99 3300046516 Ga0495628_0162644 Ga0495628_0162644_1148_1597 116
100 3300046535 Ga0495586_0267458 Ga0495586_0267458_39_488 116
101 3300046809 Ga0495600_0646228 Ga0495600_0646228_116_565 116
102 3300048911 Ga0496108_0485409 Ga0496108_0485409_508_960 116
103 3300050496 nmdc:mga07m45_225995_c1 nmdc:mga07m45_225995_c1_171_641 116
104 3300005331 Ga0070670_100314225 Ga0070670_1003142251 117
105 3300005459 Ga0068867_100693266 Ga0068867_1006932662 117
106 3300025925 Ga0207650_10217612 Ga0207650_102176122 117
107 3300041999 Ga0439433_0128000 Ga0439433_0128000_145_600 117
108 3300006177 Ga0075362_10046064 Ga0075362_100460643 118
109 3300012510 Ga0157316_1018409 Ga0157316_10184091 118
110 3300042006 Ga0439432_095221 Ga0439432_095221_311_781 118
111 3300042156 Ga0439446_0086139 Ga0439446_0086139_365_835 118
112 3300042532 Ga0450893_0039994 Ga0450893_0039994_351_821 118
113 3300046459 Ga0495629_0653271 Ga0495629_0653271_68_520 118
114 3300050489 nmdc:mga03683_3317_c1 nmdc:mga03683_3317_c1_3682_4152 118
115 3300050490 nmdc:mga03n38_186883_c1 nmdc:mga03n38_186883_c1_441_911 118
116 iso_pu_bacteria 2932422444 2932425454 118
117 3300006186 Ga0075369_10503377 Ga0075369_105033771 119
118 3300026075 Ga0207708_10820976 Ga0207708_108209761 119
119 3300035724 Ga0373933_0142857 Ga0373933_0142857_930_1391 119
120 3300036401 Ga0373937_0609217 Ga0373937_0609217_353_814 119
121 3300053145 Ga0500586_080182 Ga0500586_080182_437_889 119
122 3300053153 Ga0500616_0123281 Ga0500616_0123281_627_1082 119
123 iso_pu_bacteria 2831265667 2831269799 119
124 iso_pu_bacteria 2842733646 2842734024 119
125 iso_pu_bacteria 2842747753 2842749696 119
126 iso_pu_bacteria 2928115317 2928117226 119
127 3300005331 Ga0070670_100065242 Ga0070670_1000652424 120
128 3300005543 Ga0070672_100553560 Ga0070672_1005535601 120
129 3300005618 Ga0068864_100353945 Ga0068864_1003539452 120
130 3300005719 Ga0068861_100975864 Ga0068861_1009758642 120
131 3300005841 Ga0068863_100152703 Ga0068863_1001527032 120
132 3300025925 Ga0207650_10152272 Ga0207650_101522722 120
133 3300025940 Ga0207691_10109650 Ga0207691_101096502 120
134 3300025941 Ga0207711_11503213 Ga0207711_115032131 120
135 3300025986 Ga0207658_11357196 Ga0207658_113571962 120
136 3300026041 Ga0207639_10096743 Ga0207639_100967434 120
137 3300026088 Ga0207641_10044803 Ga0207641_100448032 120
138 3300026095 Ga0207676_10042494 Ga0207676_100424942 120
139 3300026118 Ga0207675_102258999 Ga0207675_1022589991 120
140 3300053088 Ga0500644_0069331 Ga0500644_0069331_586_1041 120
141 3300053118 Ga0500594_0004456 Ga0500594_0004456_598_1053 120
142 iso_pu_bacteria 2643221654 2644301338 120
143 iso_pu_bacteria 2904479285 2904479686 120
144 3300005334 Ga0068869_101181838 Ga0068869_1011818381 121
145 3300005347 Ga0070668_100133822 Ga0070668_1001338222 121
146 3300005367 Ga0070667_100010447 Ga0070667_1000104478 121
147 3300005548 Ga0070665_100559771 Ga0070665_1005597713 121
148 3300005843 Ga0068860_100293724 Ga0068860_1002937244 121
149 3300006237 Ga0097621_100728342 Ga0097621_1007283421 121
150 3300009098 Ga0105245_11399483 Ga0105245_113994831 121
151 3300013308 Ga0157375_10177219 Ga0157375_101772192 121
152 3300014968 Ga0157379_10077414 Ga0157379_100774144 121
153 3300025918 Ga0207662_11082769 Ga0207662_110827691 121
154 3300025972 Ga0207668_10259469 Ga0207668_102594692 121
155 3300025986 Ga0207658_10009698 Ga0207658_100096987 121
156 3300028379 Ga0268266_10505674 Ga0268266_105056742 121
157 3300044712 Ga0453684_1787323 Ga0453684_1787323_50_502 121
158 3300049571 Ga0501034_0103580 Ga0501034_0103580_315_791 121
159 3300049574 Ga0501038_0442894 Ga0501038_0442894_389_865 121
160 3300049579 Ga0501043_0281422 Ga0501043_0281422_408_884 121
161 3300049580 Ga0501046_0159879 Ga0501046_0159879_1055_1531 121
162 3300049581 Ga0501047_0384104 Ga0501047_0384104_430_906 121
163 3300049588 Ga0501072_0511435 Ga0501072_0511435_64_540 121
164 3300049589 Ga0501073_0516134 Ga0501073_0516134_253_729 121
165 3300049822 Ga0501035_0320439 Ga0501035_0320439_312_788 121
166 3300049823 Ga0501044_0452432 Ga0501044_0452432_432_908 121
167 3300050508 nmdc:mga09592_714568_c1 nmdc:mga09592_714568_c1_81_605 121
168 3300005327 Ga0070658_10021365 Ga0070658_100213652 122
169 3300005329 Ga0070683_100527023 Ga0070683_1005270232 122
170 3300005338 Ga0068868_100472683 Ga0068868_1004726831 122
171 3300005339 Ga0070660_100086675 Ga0070660_1000866755 122
172 3300005344 Ga0070661_100000647 Ga0070661_1000006472 122
173 3300005366 Ga0070659_101722105 Ga0070659_1017221051 122
174 3300005435 Ga0070714_100012010 Ga0070714_1000120109 122
175 3300005436 Ga0070713_100550705 Ga0070713_1005507051 122
176 3300005530 Ga0070679_100016850 Ga0070679_1000168502 122
177 3300005535 Ga0070684_100039111 Ga0070684_1000391114 122
178 3300005563 Ga0068855_100019281 Ga0068855_1000192813 122
179 3300005564 Ga0070664_100023353 Ga0070664_1000233535 122
180 3300005564 Ga0070664_100413405 Ga0070664_1004134052 122
181 3300005578 Ga0068854_100011019 Ga0068854_1000110195 122
182 3300005614 Ga0068856_100006194 Ga0068856_1000061943 122
183 3300005616 Ga0068852_100003761 Ga0068852_10000376113 122
184 3300006038 Ga0075365_10250582 Ga0075365_102505822 122
185 3300006048 Ga0075363_100064664 Ga0075363_1000646642 122
186 3300006051 Ga0075364_10012996 Ga0075364_100129963 122
187 3300006177 Ga0075362_10003105 Ga0075362_100031056 122
188 3300006178 Ga0075367_10005132 Ga0075367_100051325 122
189 3300006186 Ga0075369_10070905 Ga0075369_100709052 122
190 3300006353 Ga0075370_10018855 Ga0075370_100188552 122
191 3300006353 Ga0075370_10076855 Ga0075370_100768553 122
192 3300009093 Ga0105240_10005257 Ga0105240_1000525720 122
193 3300009098 Ga0105245_11375244 Ga0105245_113752441 122
194 3300009545 Ga0105237_10527052 Ga0105237_105270522 122
195 3300009551 Ga0105238_10007543 Ga0105238_100075434 122
196 3300010375 Ga0105239_10383179 Ga0105239_103831792 122
197 3300013100 Ga0157373_10018753 Ga0157373_100187532 122
198 3300013104 Ga0157370_10064964 Ga0157370_100649642 122
199 3300013105 Ga0157369_10001339 Ga0157369_100013398 122
200 3300013296 Ga0157374_10432791 Ga0157374_104327913 122
201 3300013306 Ga0163162_12754149 Ga0163162_127541491 122
202 3300013307 Ga0157372_10012931 Ga0157372_100129319 122
203 3300025907 Ga0207645_10308135 Ga0207645_103081351 122
204 3300025911 Ga0207654_10140450 Ga0207654_101404502 122
205 3300025913 Ga0207695_10023026 Ga0207695_100230268 122
206 3300025913 Ga0207695_10355936 Ga0207695_103559362 122
207 3300025919 Ga0207657_10023410 Ga0207657_100234104 122
208 3300025920 Ga0207649_10017583 Ga0207649_100175834 122
209 3300025924 Ga0207694_10007840 Ga0207694_100078403 122
210 3300025929 Ga0207664_10003381 Ga0207664_100033814 122
211 3300025932 Ga0207690_10293804 Ga0207690_102938041 122
212 3300025933 Ga0207706_10032489 Ga0207706_100324892 122
213 3300025942 Ga0207689_10665793 Ga0207689_106657932 122
214 3300025944 Ga0207661_10056016 Ga0207661_100560162 122
215 3300025945 Ga0207679_10266911 Ga0207679_102669112 122
216 3300025945 Ga0207679_10347343 Ga0207679_103473432 122
217 3300025949 Ga0207667_10009870 Ga0207667_100098705 122
218 3300025960 Ga0207651_10798769 Ga0207651_107987691 122
219 3300025981 Ga0207640_10026816 Ga0207640_100268162 122
220 3300026078 Ga0207702_10006552 Ga0207702_100065525 122
221 3300026089 Ga0207648_10226970 Ga0207648_102269702 122
222 3300026116 Ga0207674_10000020 Ga0207674_10000020112 122
223 3300026142 Ga0207698_10003199 Ga0207698_100031999 122
224 3300027866 Ga0209813_10002074 Ga0209813_100020743 122
225 3300028786 Ga0307517_10221513 Ga0307517_102215132 122
226 3300031456 Ga0307513_10071439 Ga0307513_100714395 122
227 3300031548 Ga0307408_100434930 Ga0307408_1004349301 122
228 3300031731 Ga0307405_10296149 Ga0307405_102961492 122
229 3300031852 Ga0307410_10795009 Ga0307410_107950091 122
230 3300031911 Ga0307412_11235791 Ga0307412_112357911 122
231 3300031995 Ga0307409_101239130 Ga0307409_1012391301 122
232 3300032002 Ga0307416_101963368 Ga0307416_1019633681 122
233 3300038443 Ga0395901_1380088 Ga0395901_1380088_97_555 122
234 3300039110 Ga0400487_24476 Ga0400487_24476_28276_28737 122
235 3300050490 nmdc:mga03n38_854280_c1 nmdc:mga03n38_854280_c1_22_477 122
236 3300050490 nmdc:mga03n38_94418_c1 nmdc:mga03n38_94418_c1_515_976 122
237 3300050491 nmdc:mga00v17_20264_c1 nmdc:mga00v17_20264_c1_2384_2836 122
238 3300050492 nmdc:mga0yw44_54687_c1 nmdc:mga0yw44_54687_c1_692_1153 122
239 3300050493 nmdc:mga0k408_180_c1 nmdc:mga0k408_180_c1_26430_26891 122
240 3300050493 nmdc:mga0k408_1901_c1 nmdc:mga0k408_1901_c1_4661_5125 122
241 3300050493 nmdc:mga0k408_2769_c1 nmdc:mga0k408_2769_c1_4850_5302 122
242 3300050494 nmdc:mga06z11_30142_c1 nmdc:mga06z11_30142_c1_1708_2160 122
243 3300050495 nmdc:mga04h51_16959_c1 nmdc:mga04h51_16959_c1_1420_1881 122
244 3300050496 nmdc:mga07m45_260_c1 nmdc:mga07m45_260_c1_638_1102 122
245 3300050496 nmdc:mga07m45_293840_c1 nmdc:mga07m45_293840_c1_119_565 122
246 3300050496 nmdc:mga07m45_452398_c1 nmdc:mga07m45_452398_c1_130_582 122
247 3300050516 nmdc:mga0sz30_186555_c1 nmdc:mga0sz30_186555_c1_265_726 122
248 3300050516 nmdc:mga0sz30_70874_c1 nmdc:mga0sz30_70874_c1_369_821 122
249 iso_pu_bacteria 2891633521 2891635515 122
250 iso_pu_bacteria 639633007 639785982 122
251 3300005329 Ga0070683_101075073 Ga0070683_1010750732 123
252 3300005331 Ga0070670_101179392 Ga0070670_1011793921 123
253 3300005339 Ga0070660_100401362 Ga0070660_1004013622 123
254 3300005347 Ga0070668_100014646 Ga0070668_1000146462 123
255 3300005367 Ga0070667_100121649 Ga0070667_1001216492 123
256 3300005616 Ga0068852_100175973 Ga0068852_1001759731 123
257 3300005616 Ga0068852_100616032 Ga0068852_1006160321 123
258 3300005842 Ga0068858_100001192 Ga0068858_1000011925 123
259 3300005843 Ga0068860_100266280 Ga0068860_1002662802 123
260 3300006048 Ga0075363_100154028 Ga0075363_1001540282 123
261 3300006178 Ga0075367_10043488 Ga0075367_100434883 123
262 3300006195 Ga0075366_10005214 Ga0075366_100052143 123
263 3300006353 Ga0075370_10108700 Ga0075370_101087002 123
264 3300009101 Ga0105247_10040897 Ga0105247_100408975 123
265 3300013104 Ga0157370_10025967 Ga0157370_100259676 123
266 3300014968 Ga0157379_10003453 Ga0157379_100034532 123
267 3300015683 Ga0183362_10003 Ga0183362_10003856 123
268 3300025899 Ga0207642_10466740 Ga0207642_104667401 123
269 3300025900 Ga0207710_10044390 Ga0207710_100443903 123
270 3300025919 Ga0207657_10012397 Ga0207657_100123972 123
271 3300025926 Ga0207659_10521429 Ga0207659_105214292 123
272 3300025986 Ga0207658_10490356 Ga0207658_104903562 123
273 3300026035 Ga0207703_10024981 Ga0207703_100249815 123
274 3300026041 Ga0207639_11252630 Ga0207639_112526301 123
275 3300026142 Ga0207698_10448922 Ga0207698_104489222 123
276 3300028381 Ga0268264_10614334 Ga0268264_106143342 123
277 3300031731 Ga0307405_11399538 Ga0307405_113995381 123
278 3300044901 Ga0466960_0057022 Ga0466960_0057022_1075_1548 123
279 3300045976 Ga0466967_1348845 Ga0466967_1348845_244_696 123
280 3300046660 Ga0495625_0605781 Ga0495625_0605781_81_545 123
281 3300048912 Ga0496109_1602704 Ga0496109_1602704_43_504 123
282 3300048913 Ga0496110_0882286 Ga0496110_0882286_17_478 123
283 3300048925 Ga0496122_0031207 Ga0496122_0031207_3889_4338 123
284 3300048926 Ga0496123_0101350 Ga0496123_0101350_1069_1524 123
285 3300048927 Ga0496124_0038111 Ga0496124_0038111_3414_3863 123
286 3300048929 Ga0496126_0118975 Ga0496126_0118975_319_768 123
287 3300049758 Ga0501241_055227 Ga0501241_055227_257_706 123
288 3300050489 nmdc:mga03683_89830_c1 nmdc:mga03683_89830_c1_321_776 123
289 3300050493 nmdc:mga0k408_15682_c1 nmdc:mga0k408_15682_c1_3213_3668 123
290 3300050494 nmdc:mga06z11_207697_c1 nmdc:mga06z11_207697_c1_170_625 123
291 3300050495 nmdc:mga04h51_93716_c1 nmdc:mga04h51_93716_c1_529_984 123
292 3300050496 nmdc:mga07m45_4942_c1 nmdc:mga07m45_4942_c1_4769_5224 123
293 3300005366 Ga0070659_100307523 Ga0070659_1003075232 124
294 3300005441 Ga0070700_100235235 Ga0070700_1002352352 124
295 3300005444 Ga0070694_100318116 Ga0070694_1003181161 124
296 3300005459 Ga0068867_100164038 Ga0068867_1001640382 124
297 3300005530 Ga0070679_101062564 Ga0070679_1010625641 124
298 3300005543 Ga0070672_100040879 Ga0070672_1000408793 124
299 3300005840 Ga0068870_10009194 Ga0068870_100091946 124
300 3300013307 Ga0157372_10556880 Ga0157372_105568802 124
301 3300013308 Ga0157375_10266678 Ga0157375_102666782 124
302 3300025908 Ga0207643_10003120 Ga0207643_100031207 124
303 3300025920 Ga0207649_10665064 Ga0207649_106650641 124
304 3300025921 Ga0207652_10850963 Ga0207652_108509632 124
305 3300025923 Ga0207681_10019992 Ga0207681_100199925 124
306 3300025932 Ga0207690_10167937 Ga0207690_101679372 124
307 3300025938 Ga0207704_10040706 Ga0207704_100407062 124
308 3300025940 Ga0207691_10003887 Ga0207691_1000388712 124
309 3300026089 Ga0207648_10208927 Ga0207648_102089272 124
310 3300031733 Ga0316577_10010632 Ga0316577_100106322 124
311 3300044706 Ga0466964_0038869 Ga0466964_0038869_662_1114 124
312 3300001977 JGI24746J21847_1016548 JGI24746J21847_10165482 125
313 3300001991 JGI24743J22301_10008375 JGI24743J22301_100083752 125
314 3300002070 JGI24750J21931_1064877 JGI24750J21931_10648771 125
315 3300002073 JGI24745J21846_1006246 JGI24745J21846_10062462 125
316 3300002076 JGI24749J21850_1003215 JGI24749J21850_10032152 125
317 3300002126 JGI24035J26624_1004552 JGI24035J26624_10045521 125
318 3300002239 JGI24034J26672_10016582 JGI24034J26672_100165822 125
319 3300002459 JGI24751J29686_10035823 JGI24751J29686_100358232 125
320 3300005288 Ga0065714_10193261 Ga0065714_101932611 125
321 3300005290 Ga0065712_10223299 Ga0065712_102232991 125
322 3300005327 Ga0070658_10307238 Ga0070658_103072382 125
323 3300005328 Ga0070676_10033470 Ga0070676_100334703 125
324 3300005329 Ga0070683_100519812 Ga0070683_1005198122 125
325 3300005330 Ga0070690_100099592 Ga0070690_1000995922 125
326 3300005331 Ga0070670_100006913 Ga0070670_1000069138 125
327 3300005331 Ga0070670_100725220 Ga0070670_1007252201 125
328 3300005334 Ga0068869_100005133 Ga0068869_1000051332 125
329 3300005335 Ga0070666_10222514 Ga0070666_102225142 125
330 3300005338 Ga0068868_100022592 Ga0068868_1000225922 125
331 3300005339 Ga0070660_100139677 Ga0070660_1001396772 125
332 3300005340 Ga0070689_100242576 Ga0070689_1002425762 125
333 3300005343 Ga0070687_100005303 Ga0070687_1000053032 125
334 3300005344 Ga0070661_100038455 Ga0070661_1000384556 125
335 3300005345 Ga0070692_10016920 Ga0070692_100169201 125
336 3300005347 Ga0070668_100049662 Ga0070668_1000496622 125
337 3300005353 Ga0070669_100039508 Ga0070669_1000395085 125
338 3300005354 Ga0070675_100194089 Ga0070675_1001940892 125
339 3300005355 Ga0070671_100109552 Ga0070671_1001095522 125
340 3300005356 Ga0070674_100013274 Ga0070674_1000132744 125
341 3300005365 Ga0070688_100000913 Ga0070688_1000009134 125
342 3300005366 Ga0070659_100403249 Ga0070659_1004032491 125
343 3300005438 Ga0070701_10040923 Ga0070701_100409232 125
344 3300005440 Ga0070705_101104513 Ga0070705_1011045131 125
345 3300005441 Ga0070700_100008875 Ga0070700_1000088752 125
346 3300005455 Ga0070663_100009567 Ga0070663_1000095675 125
347 3300005456 Ga0070678_100050601 Ga0070678_1000506015 125
348 3300005457 Ga0070662_100033344 Ga0070662_1000333442 125
349 3300005459 Ga0068867_100139217 Ga0068867_1001392172 125
350 3300005466 Ga0070685_10128595 Ga0070685_101285952 125
351 3300005535 Ga0070684_100078517 Ga0070684_1000785175 125
352 3300005539 Ga0068853_100298889 Ga0068853_1002988892 125
353 3300005544 Ga0070686_100006318 Ga0070686_1000063182 125
354 3300005547 Ga0070693_100059945 Ga0070693_1000599452 125
355 3300005547 Ga0070693_100132356 Ga0070693_1001323563 125
356 3300005548 Ga0070665_100420928 Ga0070665_1004209282 125
357 3300005563 Ga0068855_100272281 Ga0068855_1002722811 125
358 3300005564 Ga0070664_100203255 Ga0070664_1002032552 125
359 3300005577 Ga0068857_100017820 Ga0068857_1000178203 125
360 3300005578 Ga0068854_100029326 Ga0068854_1000293262 125
361 3300005614 Ga0068856_101791642 Ga0068856_1017916421 125
362 3300005615 Ga0070702_100044523 Ga0070702_1000445232 125
363 3300005616 Ga0068852_100510344 Ga0068852_1005103442 125
364 3300005617 Ga0068859_100029685 Ga0068859_1000296853 125
365 3300005618 Ga0068864_100072581 Ga0068864_1000725812 125
366 3300005719 Ga0068861_100035853 Ga0068861_1000358531 125
367 3300005834 Ga0068851_10011745 Ga0068851_100117453 125
368 3300005840 Ga0068870_10083129 Ga0068870_100831292 125
369 3300005842 Ga0068858_100141183 Ga0068858_1001411833 125
370 3300005844 Ga0068862_100017424 Ga0068862_1000174246 125
371 3300006237 Ga0097621_100168703 Ga0097621_1001687032 125
372 3300006881 Ga0068865_100004033 Ga0068865_1000040332 125
373 3300006931 Ga0097620_100029687 Ga0097620_1000296873 125
374 3300009094 Ga0111539_10036798 Ga0111539_100367985 125
375 3300009098 Ga0105245_10050653 Ga0105245_100506532 125
376 3300009148 Ga0105243_10100809 Ga0105243_101008093 125
377 3300009176 Ga0105242_10179651 Ga0105242_101796512 125
378 3300009545 Ga0105237_10866371 Ga0105237_108663712 125
379 3300009553 Ga0105249_10075013 Ga0105249_100750133 125
380 3300010375 Ga0105239_10316310 Ga0105239_103163101 125
381 3300011119 Ga0105246_10463951 Ga0105246_104639512 125
382 3300013100 Ga0157373_10552640 Ga0157373_105526401 125
383 3300013102 Ga0157371_10437407 Ga0157371_104374072 125
384 3300013296 Ga0157374_10040499 Ga0157374_100404993 125
385 3300013297 Ga0157378_10098654 Ga0157378_100986543 125
386 3300013307 Ga0157372_10322599 Ga0157372_103225992 125
387 3300014325 Ga0163163_10170434 Ga0163163_101704342 125
388 3300014326 Ga0157380_10019617 Ga0157380_100196173 125
389 3300014745 Ga0157377_10048912 Ga0157377_100489122 125
390 3300014968 Ga0157379_10001262 Ga0157379_1000126219 125
391 3300014969 Ga0157376_11978470 Ga0157376_119784701 125
392 3300017792 Ga0163161_10320921 Ga0163161_103209212 125
393 3300025290 Ga0207673_1017036 Ga0207673_10170362 125
394 3300025315 Ga0207697_10000237 Ga0207697_1000023717 125
395 3300025321 Ga0207656_10000916 Ga0207656_100009163 125
396 3300025893 Ga0207682_10000203 Ga0207682_1000020310 125
397 3300025901 Ga0207688_10000362 Ga0207688_1000036214 125
398 3300025903 Ga0207680_10077134 Ga0207680_100771343 125
399 3300025907 Ga0207645_10006246 Ga0207645_100062469 125
400 3300025908 Ga0207643_10009218 Ga0207643_100092184 125
401 3300025909 Ga0207705_10364539 Ga0207705_103645392 125
402 3300025918 Ga0207662_10007415 Ga0207662_100074158 125
403 3300025919 Ga0207657_10027297 Ga0207657_100272972 125
404 3300025920 Ga0207649_10232409 Ga0207649_102324092 125
405 3300025923 Ga0207681_10111611 Ga0207681_101116113 125
406 3300025925 Ga0207650_10002859 Ga0207650_100028599 125
407 3300025925 Ga0207650_10004599 Ga0207650_100045998 125
408 3300025925 Ga0207650_10367924 Ga0207650_103679241 125
409 3300025926 Ga0207659_10300457 Ga0207659_103004571 125
410 3300025931 Ga0207644_10283117 Ga0207644_102831171 125
411 3300025932 Ga0207690_10158828 Ga0207690_101588282 125
412 3300025933 Ga0207706_10000486 Ga0207706_1000048614 125
413 3300025936 Ga0207670_10196906 Ga0207670_101969062 125
414 3300025937 Ga0207669_10036718 Ga0207669_100367182 125
415 3300025938 Ga0207704_10007005 Ga0207704_100070053 125
416 3300025940 Ga0207691_10004275 Ga0207691_1000427515 125
417 3300025941 Ga0207711_10821868 Ga0207711_108218682 125
418 3300025942 Ga0207689_10000468 Ga0207689_1000046820 125
419 3300025944 Ga0207661_10035912 Ga0207661_100359122 125
420 3300025945 Ga0207679_10175984 Ga0207679_101759842 125
421 3300025960 Ga0207651_10057300 Ga0207651_100573003 125
422 3300025961 Ga0207712_10199969 Ga0207712_101999692 125
423 3300025972 Ga0207668_10436415 Ga0207668_104364152 125
424 3300025986 Ga0207658_10091867 Ga0207658_100918672 125
425 3300026023 Ga0207677_10123367 Ga0207677_101233672 125
426 3300026035 Ga0207703_10049969 Ga0207703_100499691 125
427 3300026067 Ga0207678_10001272 Ga0207678_100012725 125
428 3300026075 Ga0207708_10000650 Ga0207708_100006507 125
429 3300026088 Ga0207641_10178458 Ga0207641_101784582 125
430 3300026089 Ga0207648_10001903 Ga0207648_1000190312 125
431 3300026095 Ga0207676_10089512 Ga0207676_100895125 125
432 3300026116 Ga0207674_10000769 Ga0207674_1000076922 125
433 3300026118 Ga0207675_100003290 Ga0207675_10000329012 125
434 3300026121 Ga0207683_10004396 Ga0207683_1000439612 125
435 3300026142 Ga0207698_10432361 Ga0207698_104323612 125
436 3300027907 Ga0207428_10275602 Ga0207428_102756022 125
437 3300028379 Ga0268266_10249989 Ga0268266_102499892 125
438 3300028380 Ga0268265_10520221 Ga0268265_105202211 125
439 3300028381 Ga0268264_10371939 Ga0268264_103719391 125
440 3300032002 Ga0307416_100555362 Ga0307416_1005553622 125
441 3300035170 Ga0373943_0281323 Ga0373943_0281323_232_693 125
442 3300044694 Ga0466963_0440725 Ga0466963_0440725_140_589 125
443 3300048903 Ga0496100_0071661 Ga0496100_0071661_898_1359 125
444 3300048904 Ga0496101_0005661 Ga0496101_0005661_5893_6354 125
445 3300048905 Ga0496102_0670851 Ga0496102_0670851_400_861 125
446 3300048908 Ga0496105_0004196 Ga0496105_0004196_8337_8798 125
447 3300048909 Ga0496106_0061077 Ga0496106_0061077_38_499 125
448 3300048910 Ga0496107_0547220 Ga0496107_0547220_193_654 125
449 3300048911 Ga0496108_0156924 Ga0496108_0156924_651_1112 125
450 3300048912 Ga0496109_0137535 Ga0496109_0137535_425_886 125
451 3300048913 Ga0496110_0028281 Ga0496110_0028281_1609_2070 125
452 3300048914 Ga0496111_0499287 Ga0496111_0499287_190_651 125
453 3300048915 Ga0496112_0920539 Ga0496112_0920539_71_532 125
454 3300048917 Ga0496114_0252923 Ga0496114_0252923_649_1110 125
455 3300048918 Ga0496115_0445171 Ga0496115_0445171_475_936 125
456 3300049584 Ga0501068_0253599 Ga0501068_0253599_476_925 125
457 3300050511 nmdc:mga08y16_72716_c1 nmdc:mga08y16_72716_c1_100_561 125
458 2162886012 MBSR1b_contig_12253474 MBSR1b_0335.00003510 126
459 3300001989 JGI24739J22299_10048713 JGI24739J22299_100487132 126
460 3300005293 Ga0065715_10179257 Ga0065715_101792572 126
461 3300005327 Ga0070658_10071691 Ga0070658_100716912 126
462 3300005328 Ga0070676_10000960 Ga0070676_100009604 126
463 3300005328 Ga0070676_10072032 Ga0070676_100720322 126
464 3300005329 Ga0070683_100890111 Ga0070683_1008901112 126
465 3300005331 Ga0070670_100164559 Ga0070670_1001645592 126
466 3300005333 Ga0070677_10002708 Ga0070677_100027087 126
467 3300005333 Ga0070677_10299167 Ga0070677_102991671 126
468 3300005334 Ga0068869_100027628 Ga0068869_1000276282 126
469 3300005335 Ga0070666_10043834 Ga0070666_100438343 126
470 3300005335 Ga0070666_10183324 Ga0070666_101833241 126
471 3300005335 Ga0070666_10200253 Ga0070666_102002532 126
472 3300005335 Ga0070666_10237666 Ga0070666_102376662 126
473 3300005336 Ga0070680_100073905 Ga0070680_1000739052 126
474 3300005336 Ga0070680_100615924 Ga0070680_1006159241 126
475 3300005338 Ga0068868_100040730 Ga0068868_1000407302 126
476 3300005338 Ga0068868_100350139 Ga0068868_1003501392 126
477 3300005338 Ga0068868_101676148 Ga0068868_1016761481 126
478 3300005339 Ga0070660_100007268 Ga0070660_1000072685 126
479 3300005340 Ga0070689_100780834 Ga0070689_1007808342 126
480 3300005344 Ga0070661_100043695 Ga0070661_1000436953 126
481 3300005344 Ga0070661_100776962 Ga0070661_1007769622 126
482 3300005347 Ga0070668_100002954 Ga0070668_1000029545 126
483 3300005347 Ga0070668_100312651 Ga0070668_1003126511 126
484 3300005347 Ga0070668_100508264 Ga0070668_1005082642 126
485 3300005347 Ga0070668_101092134 Ga0070668_1010921341 126
486 3300005353 Ga0070669_100408028 Ga0070669_1004080282 126
487 3300005354 Ga0070675_100210830 Ga0070675_1002108302 126
488 3300005354 Ga0070675_100252687 Ga0070675_1002526872 126
489 3300005355 Ga0070671_100001559 Ga0070671_1000015598 126
490 3300005355 Ga0070671_100010054 Ga0070671_1000100547 126
491 3300005355 Ga0070671_100020026 Ga0070671_1000200264 126
492 3300005355 Ga0070671_100101070 Ga0070671_1001010702 126
493 3300005355 Ga0070671_100298043 Ga0070671_1002980432 126
494 3300005356 Ga0070674_100000204 Ga0070674_10000020415 126
495 3300005356 Ga0070674_100164076 Ga0070674_1001640761 126
496 3300005364 Ga0070673_100002026 Ga0070673_1000020269 126
497 3300005364 Ga0070673_101095924 Ga0070673_1010959241 126
498 3300005366 Ga0070659_100003383 Ga0070659_10000338312 126
499 3300005366 Ga0070659_100110159 Ga0070659_1001101592 126
500 3300005366 Ga0070659_100544700 Ga0070659_1005447002 126
501 3300005366 Ga0070659_100687545 Ga0070659_1006875451 126
502 3300005367 Ga0070667_100002207 Ga0070667_1000022078 126
503 3300005367 Ga0070667_100441752 Ga0070667_1004417522 126
504 3300005434 Ga0070709_10021902 Ga0070709_100219026 126
505 3300005435 Ga0070714_100496667 Ga0070714_1004966671 126
506 3300005437 Ga0070710_10029598 Ga0070710_100295983 126
507 3300005439 Ga0070711_100011567 Ga0070711_1000115673 126
508 3300005441 Ga0070700_100259366 Ga0070700_1002593661 126
509 3300005441 Ga0070700_100445496 Ga0070700_1004454961 126
510 3300005455 Ga0070663_100050386 Ga0070663_1000503865 126
511 3300005455 Ga0070663_100121318 Ga0070663_1001213182 126
512 3300005455 Ga0070663_100131355 Ga0070663_1001313552 126
513 3300005455 Ga0070663_102005742 Ga0070663_1020057421 126
514 3300005456 Ga0070678_100003071 Ga0070678_1000030715 126
515 3300005457 Ga0070662_100002390 Ga0070662_1000023905 126
516 3300005457 Ga0070662_100231707 Ga0070662_1002317072 126
517 3300005457 Ga0070662_100280264 Ga0070662_1002802642 126
518 3300005458 Ga0070681_10335357 Ga0070681_103353572 126
519 3300005458 Ga0070681_10441529 Ga0070681_104415291 126
520 3300005459 Ga0068867_100001405 Ga0068867_1000014055 126
521 3300005518 Ga0070699_100016121 Ga0070699_1000161213 126
522 3300005530 Ga0070679_100379215 Ga0070679_1003792152 126
523 3300005539 Ga0068853_100000497 Ga0068853_10000049711 126
524 3300005539 Ga0068853_100001509 Ga0068853_1000015092 126
525 3300005539 Ga0068853_101167865 Ga0068853_1011678652 126
526 3300005543 Ga0070672_100001609 Ga0070672_1000016092 126
527 3300005543 Ga0070672_100012934 Ga0070672_1000129343 126
528 3300005543 Ga0070672_100091772 Ga0070672_1000917722 126
529 3300005543 Ga0070672_100620866 Ga0070672_1006208662 126
530 3300005546 Ga0070696_100002259 Ga0070696_1000022593 126
531 3300005546 Ga0070696_100543194 Ga0070696_1005431942 126
532 3300005547 Ga0070693_100234524 Ga0070693_1002345241 126
533 3300005548 Ga0070665_100003522 Ga0070665_10000352211 126
534 3300005563 Ga0068855_100000863 Ga0068855_1000008635 126
535 3300005563 Ga0068855_100028328 Ga0068855_1000283287 126
536 3300005563 Ga0068855_100265487 Ga0068855_1002654874 126
537 3300005564 Ga0070664_100009745 Ga0070664_10000974510 126
538 3300005564 Ga0070664_100087464 Ga0070664_1000874642 126
539 3300005564 Ga0070664_100155015 Ga0070664_1001550152 126
540 3300005564 Ga0070664_100805473 Ga0070664_1008054732 126
541 3300005577 Ga0068857_100552661 Ga0068857_1005526612 126
542 3300005614 Ga0068856_100000517 Ga0068856_10000051736 126
543 3300005614 Ga0068856_100593609 Ga0068856_1005936092 126
544 3300005615 Ga0070702_100087906 Ga0070702_1000879062 126
545 3300005616 Ga0068852_100007263 Ga0068852_10000726310 126
546 3300005616 Ga0068852_100452759 Ga0068852_1004527591 126
547 3300005617 Ga0068859_100047138 Ga0068859_1000471384 126
548 3300005618 Ga0068864_100007512 Ga0068864_1000075124 126
549 3300005719 Ga0068861_100801566 Ga0068861_1008015661 126
550 3300005834 Ga0068851_10000352 Ga0068851_100003526 126
551 3300005834 Ga0068851_10018402 Ga0068851_100184026 126
552 3300005834 Ga0068851_10040994 Ga0068851_100409942 126
553 3300005840 Ga0068870_10028835 Ga0068870_100288352 126
554 3300005841 Ga0068863_100041440 Ga0068863_1000414405 126
555 3300005842 Ga0068858_100074043 Ga0068858_1000740432 126
556 3300005842 Ga0068858_102249861 Ga0068858_1022498611 126
557 3300005843 Ga0068860_100035947 Ga0068860_1000359472 126
558 3300006058 Ga0075432_10100361 Ga0075432_101003612 126
559 3300006237 Ga0097621_100011274 Ga0097621_1000112742 126
560 3300006358 Ga0068871_100025961 Ga0068871_1000259617 126
561 3300006844 Ga0075428_100164264 Ga0075428_1001642642 126
562 3300006846 Ga0075430_100392330 Ga0075430_1003923301 126
563 3300006871 Ga0075434_100702292 Ga0075434_1007022922 126
564 3300006881 Ga0068865_100074333 Ga0068865_1000743332 126
565 3300006914 Ga0075436_100267954 Ga0075436_1002679542 126
566 3300006931 Ga0097620_100047142 Ga0097620_1000471424 126
567 3300009093 Ga0105240_10088641 Ga0105240_100886417 126
568 3300009098 Ga0105245_11109313 Ga0105245_111093132 126
569 3300009147 Ga0114129_10728414 Ga0114129_107284142 126
570 3300009176 Ga0105242_10459619 Ga0105242_104596192 126
571 3300009177 Ga0105248_10124188 Ga0105248_101241885 126
572 3300009177 Ga0105248_10314314 Ga0105248_103143142 126
573 3300009545 Ga0105237_10400735 Ga0105237_104007352 126
574 3300010375 Ga0105239_10100855 Ga0105239_101008552 126
575 3300013100 Ga0157373_10021443 Ga0157373_100214437 126
576 3300013100 Ga0157373_10174425 Ga0157373_101744252 126
577 3300013102 Ga0157371_10000228 Ga0157371_1000022848 126
578 3300013104 Ga0157370_10004497 Ga0157370_100044975 126
579 3300013104 Ga0157370_10009919 Ga0157370_100099199 126
580 3300013104 Ga0157370_10026752 Ga0157370_100267522 126
581 3300013105 Ga0157369_10069250 Ga0157369_100692502 126
582 3300013296 Ga0157374_10082171 Ga0157374_100821716 126
583 3300013296 Ga0157374_10969223 Ga0157374_109692232 126
584 3300013306 Ga0163162_10027363 Ga0163162_100273638 126
585 3300013306 Ga0163162_10420494 Ga0163162_104204942 126
586 3300013306 Ga0163162_10704553 Ga0163162_107045532 126
587 3300013307 Ga0157372_10003161 Ga0157372_1000316120 126
588 3300013307 Ga0157372_10048886 Ga0157372_100488862 126
589 3300013307 Ga0157372_10134589 Ga0157372_101345893 126
590 3300013307 Ga0157372_10345199 Ga0157372_103451993 126
591 3300013307 Ga0157372_10849500 Ga0157372_108495002 126
592 3300013308 Ga0157375_10001806 Ga0157375_1000180616 126
593 3300013308 Ga0157375_10057807 Ga0157375_100578076 126
594 3300013308 Ga0157375_11033190 Ga0157375_110331902 126
595 3300014325 Ga0163163_10535438 Ga0163163_105354382 126
596 3300014325 Ga0163163_11420944 Ga0163163_114209442 126
597 3300014326 Ga0157380_10832430 Ga0157380_108324301 126
598 3300014968 Ga0157379_10125205 Ga0157379_101252055 126
599 3300014969 Ga0157376_10416592 Ga0157376_104165922 126
600 3300014969 Ga0157376_12370891 Ga0157376_123708911 126
601 3300017792 Ga0163161_10030497 Ga0163161_100304974 126
602 3300025321 Ga0207656_10142107 Ga0207656_101421072 126
603 3300025893 Ga0207682_10000059 Ga0207682_1000005918 126
604 3300025898 Ga0207692_10016249 Ga0207692_100162492 126
605 3300025903 Ga0207680_10086904 Ga0207680_100869042 126
606 3300025903 Ga0207680_10234132 Ga0207680_102341322 126
607 3300025903 Ga0207680_10234417 Ga0207680_102344172 126
608 3300025904 Ga0207647_10091523 Ga0207647_100915232 126
609 3300025906 Ga0207699_10017799 Ga0207699_100177996 126
610 3300025907 Ga0207645_10000407 Ga0207645_1000040722 126
611 3300025907 Ga0207645_10121750 Ga0207645_101217502 126
612 3300025908 Ga0207643_10005194 Ga0207643_100051947 126
613 3300025911 Ga0207654_10534414 Ga0207654_105344142 126
614 3300025912 Ga0207707_10209460 Ga0207707_102094601 126
615 3300025912 Ga0207707_10228832 Ga0207707_102288322 126
616 3300025913 Ga0207695_10049858 Ga0207695_100498586 126
617 3300025913 Ga0207695_10321865 Ga0207695_103218653 126
618 3300025914 Ga0207671_10142411 Ga0207671_101424112 126
619 3300025914 Ga0207671_10414859 Ga0207671_104148591 126
620 3300025917 Ga0207660_10164370 Ga0207660_101643701 126
621 3300025917 Ga0207660_10538697 Ga0207660_105386972 126
622 3300025919 Ga0207657_10001657 Ga0207657_1000165724 126
623 3300025920 Ga0207649_10004347 Ga0207649_100043477 126
624 3300025920 Ga0207649_10034478 Ga0207649_100344782 126
625 3300025920 Ga0207649_10373875 Ga0207649_103738752 126
626 3300025921 Ga0207652_10067951 Ga0207652_100679513 126
627 3300025921 Ga0207652_10323300 Ga0207652_103233002 126
628 3300025923 Ga0207681_10539065 Ga0207681_105390652 126
629 3300025923 Ga0207681_10874420 Ga0207681_108744202 126
630 3300025925 Ga0207650_10212532 Ga0207650_102125322 126
631 3300025926 Ga0207659_10070771 Ga0207659_100707715 126
632 3300025928 Ga0207700_10078442 Ga0207700_100784422 126
633 3300025929 Ga0207664_10062211 Ga0207664_100622112 126
634 3300025931 Ga0207644_10003117 Ga0207644_100031172 126
635 3300025931 Ga0207644_10022346 Ga0207644_100223464 126
636 3300025931 Ga0207644_10044579 Ga0207644_100445792 126
637 3300025931 Ga0207644_10058927 Ga0207644_100589273 126
638 3300025931 Ga0207644_10109903 Ga0207644_101099032 126
639 3300025931 Ga0207644_10526752 Ga0207644_105267522 126
640 3300025932 Ga0207690_10000837 Ga0207690_1000083711 126
641 3300025932 Ga0207690_10074183 Ga0207690_100741834 126
642 3300025932 Ga0207690_10270068 Ga0207690_102700682 126
643 3300025932 Ga0207690_10547410 Ga0207690_105474102 126
644 3300025932 Ga0207690_10624045 Ga0207690_106240452 126
645 3300025933 Ga0207706_10000014 Ga0207706_1000001498 126
646 3300025933 Ga0207706_10021040 Ga0207706_100210402 126
647 3300025933 Ga0207706_10206669 Ga0207706_102066693 126
648 3300025936 Ga0207670_10689843 Ga0207670_106898432 126
649 3300025937 Ga0207669_10015701 Ga0207669_100157013 126
650 3300025937 Ga0207669_10724602 Ga0207669_107246021 126
651 3300025938 Ga0207704_10063437 Ga0207704_100634372 126
652 3300025940 Ga0207691_10001188 Ga0207691_100011889 126
653 3300025940 Ga0207691_10023447 Ga0207691_100234475 126
654 3300025940 Ga0207691_10026911 Ga0207691_100269116 126
655 3300025940 Ga0207691_10315707 Ga0207691_103157072 126
656 3300025941 Ga0207711_10015597 Ga0207711_100155972 126
657 3300025941 Ga0207711_10106255 Ga0207711_101062554 126
658 3300025941 Ga0207711_10464991 Ga0207711_104649912 126
659 3300025941 Ga0207711_10589185 Ga0207711_105891852 126
660 3300025941 Ga0207711_10825860 Ga0207711_108258602 126
661 3300025941 Ga0207711_11207785 Ga0207711_112077851 126
662 3300025942 Ga0207689_10021262 Ga0207689_100212621 126
663 3300025944 Ga0207661_11431346 Ga0207661_114313461 126
664 3300025945 Ga0207679_10003858 Ga0207679_100038582 126
665 3300025945 Ga0207679_10523135 Ga0207679_105231352 126
666 3300025945 Ga0207679_11068954 Ga0207679_110689541 126
667 3300025949 Ga0207667_10001506 Ga0207667_1000150624 126
668 3300025960 Ga0207651_10012010 Ga0207651_100120103 126
669 3300025960 Ga0207651_10028559 Ga0207651_100285594 126
670 3300025960 Ga0207651_10791119 Ga0207651_107911192 126
671 3300025972 Ga0207668_10017135 Ga0207668_100171354 126
672 3300025972 Ga0207668_10889730 Ga0207668_108897302 126
673 3300025972 Ga0207668_10970657 Ga0207668_109706572 126
674 3300025981 Ga0207640_10118133 Ga0207640_101181332 126
675 3300025981 Ga0207640_11494608 Ga0207640_114946081 126
676 3300025986 Ga0207658_10024430 Ga0207658_100244304 126
677 3300025986 Ga0207658_10219113 Ga0207658_102191132 126
678 3300025986 Ga0207658_10815514 Ga0207658_108155142 126
679 3300026023 Ga0207677_10088754 Ga0207677_100887542 126
680 3300026023 Ga0207677_10280257 Ga0207677_102802572 126
681 3300026023 Ga0207677_11069650 Ga0207677_110696501 126
682 3300026035 Ga0207703_10059509 Ga0207703_100595095 126
683 3300026035 Ga0207703_10061814 Ga0207703_100618143 126
684 3300026041 Ga0207639_10061501 Ga0207639_100615012 126
685 3300026041 Ga0207639_10214445 Ga0207639_102144452 126
686 3300026041 Ga0207639_10593689 Ga0207639_105936892 126
687 3300026041 Ga0207639_11107964 Ga0207639_111079642 126
688 3300026067 Ga0207678_10002753 Ga0207678_100027532 126
689 3300026067 Ga0207678_10035695 Ga0207678_100356953 126
690 3300026067 Ga0207678_10157206 Ga0207678_101572062 126
691 3300026067 Ga0207678_10591625 Ga0207678_105916252 126
692 3300026075 Ga0207708_10185694 Ga0207708_101856942 126
693 3300026078 Ga0207702_10016238 Ga0207702_100162386 126
694 3300026078 Ga0207702_11076942 Ga0207702_110769422 126
695 3300026088 Ga0207641_10059200 Ga0207641_100592004 126
696 3300026089 Ga0207648_10001780 Ga0207648_1000178010 126
697 3300026089 Ga0207648_10609498 Ga0207648_106094981 126
698 3300026095 Ga0207676_10040308 Ga0207676_100403084 126
699 3300026116 Ga0207674_10611643 Ga0207674_106116431 126
700 3300026121 Ga0207683_10000170 Ga0207683_1000017042 126
701 3300026142 Ga0207698_10068931 Ga0207698_100689313 126
702 3300026142 Ga0207698_10201862 Ga0207698_102018622 126
703 3300026142 Ga0207698_12184961 Ga0207698_121849611 126
704 3300027552 Ga0209982_1023903 Ga0209982_10239032 126
705 3300027614 Ga0209970_1002539 Ga0209970_10025393 126
706 3300027682 Ga0209971_1032422 Ga0209971_10324221 126
707 3300027876 Ga0209974_10008587 Ga0209974_100085872 126
708 3300027876 Ga0209974_10035220 Ga0209974_100352202 126
709 3300028379 Ga0268266_10003715 Ga0268266_100037154 126
710 3300028381 Ga0268264_10697939 Ga0268264_106979392 126
711 3300031824 Ga0307413_10251883 Ga0307413_102518832 126
712 3300031852 Ga0307410_10006187 Ga0307410_100061879 126
713 3300031903 Ga0307407_10011388 Ga0307407_100113886 126
714 3300031995 Ga0307409_100167196 Ga0307409_1001671962 126
715 3300032004 Ga0307414_10066774 Ga0307414_100667744 126
716 3300032005 Ga0307411_10003633 Ga0307411_100036337 126
717 3300032126 Ga0307415_100337589 Ga0307415_1003375892 126
718 3300034816 Ga0373930_0084915 Ga0373930_0084915_225_674 126
719 3300035088 Ga0373940_0380984 Ga0373940_0380984_38_481 126
720 3300035090 Ga0373949_0108164 Ga0373949_0108164_288_737 126
721 3300035172 Ga0373955_0301755 Ga0373955_0301755_47_496 126
722 3300035692 Ga0373935_0526039 Ga0373935_0526039_399_848 126
723 3300035724 Ga0373933_0464782 Ga0373933_0464782_223_672 126
724 3300036401 Ga0373937_0361569 Ga0373937_0361569_477_926 126
725 3300037312 Ga0395899_0291734 Ga0395899_0291734_73_528 126
726 3300037418 Ga0395900_0045365 Ga0395900_0045365_3936_4391 126
727 3300037466 Ga0395898_0283198 Ga0395898_0283198_882_1337 126
728 3300037471 Ga0395905_0170223 Ga0395905_0170223_1014_1469 126
729 3300038443 Ga0395901_0175307 Ga0395901_0175307_237_692 126
730 3300041503 Ga0451847_0032384 Ga0451847_0032384_268_717 126
731 3300042876 Ga0451577_0199148 Ga0451577_0199148_1093_1551 126
732 3300044673 Ga0453683_1167688 Ga0453683_1167688_40_495 126
733 3300046472 Ga0495580_0099435 Ga0495580_0099435_1045_1494 126
734 3300048903 Ga0496100_0283197 Ga0496100_0283197_690_1136 126
735 3300048904 Ga0496101_1106689 Ga0496101_1106689_134_586 126
736 3300048905 Ga0496102_0001837 Ga0496102_0001837_5998_6444 126
737 3300048906 Ga0496103_0189967 Ga0496103_0189967_130_573 126
738 3300048909 Ga0496106_0001298 Ga0496106_0001298_12789_13235 126
739 3300048910 Ga0496107_0039852 Ga0496107_0039852_888_1334 126
740 3300048911 Ga0496108_0165028 Ga0496108_0165028_1088_1537 126
741 3300048912 Ga0496109_0416688 Ga0496109_0416688_749_1198 126
742 3300048913 Ga0496110_0386624 Ga0496110_0386624_246_692 126
743 3300048913 Ga0496110_1060855 Ga0496110_1060855_157_615 126
744 3300048913 Ga0496110_1281321 Ga0496110_1281321_165_614 126
745 3300048915 Ga0496112_0013189 Ga0496112_0013189_6541_6990 126
746 3300048916 Ga0496113_0259091 Ga0496113_0259091_729_1178 126
747 3300048917 Ga0496114_0567162 Ga0496114_0567162_413_859 126
748 3300050507 nmdc:mga05p37_1073528_c1 nmdc:mga05p37_1073528_c1_298_750 126
749 3300050510 nmdc:mga06r32_935035_c1 nmdc:mga06r32_935035_c1_152_604 126
750 3300050512 nmdc:mga0n895_1140852_c1 nmdc:mga0n895_1140852_c1_151_609 126
751 3300050512 nmdc:mga0n895_725427_c1 nmdc:mga0n895_725427_c1_452_907 126
752 3300050514 nmdc:mga08x19_97942_c1 nmdc:mga08x19_97942_c1_1136_1579 126
753 3300053085 Ga0495619_0139960 Ga0495619_0139960_234_683 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

80

154

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9895 48 126
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9717 52 126
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9652 48 126
5csa-assembly1.cif.gz_B crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.9597 52 126
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9581 51 126
ID Description Score Start End Superfamily
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9951 50 125 2.40.50.100
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9697 50 125 2.40.50.100
af_Q93W03_192_271_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9676 51 125 2.40.50.100
af_Q2FXX0_70_148_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9588 51 123 2.40.50.100
2d5dB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9559 52 126 2.40.50.100
ID Description Score Start End GO Terms
AF-D0W8C8-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1.004 52 126 GO:0003989
GO:0006633
GO:0009317
AF-A0A6J4LLE9-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1.002 51 126 GO:0003989
GO:0006633
GO:0009317
AF-A0A530BNW1-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1 52 126 GO:0003989
GO:0006633
GO:0009317
AF-A0A833NR05-F1-model_v4 deleted 0.9997 50 126
AF-A0A2S6SVY7-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9956 52 126 GO:0003989
GO:0006633
GO:0009317
GO:0016020

Feature Viewer

pLDDT pTM Quality
82.38 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map