F479221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 753 | 422 | 661 | 445 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0098778|Ga0466959_0098778_187_1614 |
| Length | 475 |
| Sequence | MSDQTTDPKTAEPVDVPPAASVPGSTDDADPYDLPQNLATDEIEEGRVFTSSGGDWDEIAEEATHLGEERIVVNMGPQHPSTHGVLRLILELDGETVTEARCGIGYLHTGIEKTMEYRTWVQGVTLCTRMDYLSPLYQEAAYCLGIERLLGIEDQIPERVHVIRVLLMELNRVGSHIVALATGGMEIGALTVMTVGFRLRERVLKLLELITGLRMNHAFIRPGGLAQDIPPGTLDAIMDEMPGMLQDVSDVEKLSDENPLVRSRLVDVGYLDLTGCMALGLTGPVLRSTGLPHDLRRVQPYCGYEDYEFDVVTWDTCDAYGRWRIREEEMRQSLRIVEQCVRRLRDMPPTPVMIPDRKIAWPAQLAIGGDGMGNSLEHIREIMGSSMEALIHHFKLVTEGFRVPAGQVYFPVESPRGELGAHLVSDGGTRPYRAHFRDPSFVNLQAVAAMCEGGQVADVIAAVASLDPVMGGVDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 5 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 6 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 7 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 8 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 9 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 10 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 11 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 12 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 13 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 14 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 15 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 16 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 17 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 18 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 19 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 20 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 21 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 22 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 23 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 24 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 25 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 26 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 27 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 28 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 29 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 30 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 31 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 32 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 33 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 34 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 35 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 36 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 37 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 38 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 39 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 40 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 41 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 42 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 43 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 44 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 45 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 46 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 47 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 48 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 49 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 50 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 51 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 52 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 53 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 54 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 55 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 56 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 57 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 58 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 59 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 60 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 61 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 62 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 63 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 64 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 65 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 66 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 67 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 68 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 69 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 70 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 71 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 72 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 73 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 74 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 75 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 76 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 77 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 78 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 79 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 80 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 81 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 82 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 83 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 84 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 85 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 86 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 87 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 88 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 89 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 90 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 91 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 95 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 97 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 109 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 117 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 119 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 120 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 121 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 122 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 123 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 124 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 125 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 126 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 128 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 129 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 130 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 136 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 137 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 140 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 141 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 143 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 218 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 239 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 240 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 241 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 242 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 243 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 244 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 245 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 246 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 247 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 248 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 249 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 250 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 251 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 254 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 255 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 339 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 340 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 341 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 342 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 343 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 344 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 397 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 400 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 402 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 403 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 408 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 414 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 415 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 416 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 417 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 418 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 419 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 420 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 421 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 422 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.65 |
| Metatranscriptomes | 0.13 |
| Isolates | 12.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 6.91 |
| Nodule | 0.27 |
| Rhizoplane | 5.84 |
| Rhizosphere | 76.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005365 | 3300001979 | Bacteria | 5430 |
| 2 | JGI24740J21852_10018753 | 3300001979 | Bacteria | 2447 |
| 3 | JGI24739J22299_10005499 | 3300001989 | Bacteria | 4807 |
| 4 | JGI24739J22299_10006893 | 3300001989 | Bacteria | 4281 |
| 5 | JGI24737J22298_10005250 | 3300001990 | Bacteria | 4485 |
| 6 | JGI24735J21928_10008371 | 3300002067 | Bacteria | 3347 |
| 7 | JGI24738J21930_10007021 | 3300002075 | Bacteria | 2616 |
| 8 | JGI24744J21845_10012947 | 3300002077 | Bacteria | 1685 |
| 9 | Ga0007427J51700_109281 | 3300003559 | Bacteria | 3569 |
| 10 | Ga0055540_1000539 | 3300003792 | Bacteria | 28425 |
| 11 | Ga0070658_10011481 | 3300005327 | Bacteria | 7103 |
| 12 | Ga0070683_100056266 | 3300005329 | Bacteria | 3652 |
| 13 | Ga0068869_100023468 | 3300005334 | Bacteria | 4261 |
| 14 | Ga0070682_100013171 | 3300005337 | Bacteria | 4751 |
| 15 | Ga0068868_100031203 | 3300005338 | Bacteria | 4091 |
| 16 | Ga0070661_100076191 | 3300005344 | Bacteria | 2472 |
| 17 | Ga0070692_10075932 | 3300005345 | Bacteria | 1800 |
| 18 | Ga0070674_100021380 | 3300005356 | Bacteria | 4152 |
| 19 | Ga0070673_100038351 | 3300005364 | Bacteria | 3658 |
| 20 | Ga0070659_100152696 | 3300005366 | Bacteria | 1885 |
| 21 | Ga0070667_100084572 | 3300005367 | Bacteria | 2719 |
| 22 | Ga0070709_10083867 | 3300005434 | Bacteria | 2086 |
| 23 | Ga0070711_100002215 | 3300005439 | Bacteria | 11032 |
| 24 | Ga0070705_100090063 | 3300005440 | Bacteria | 1909 |
| 25 | Ga0070708_100062048 | 3300005445 | Bacteria | 3341 |
| 26 | Ga0070663_100071824 | 3300005455 | Bacteria | 2520 |
| 27 | Ga0068867_100164392 | 3300005459 | Bacteria | 1753 |
| 28 | Ga0070685_10033602 | 3300005466 | Bacteria | 2883 |
| 29 | Ga0070698_100000408 | 3300005471 | Bacteria | 45628 |
| 30 | Ga0070679_100051890 | 3300005530 | Bacteria | 4085 |
| 31 | Ga0070684_100154578 | 3300005535 | Bacteria | 2080 |
| 32 | Ga0070684_100200514 | 3300005535 | Bacteria | 1817 |
| 33 | Ga0070696_100066758 | 3300005546 | Bacteria | 2523 |
| 34 | Ga0070665_100000516 | 3300005548 | Bacteria | 55112 |
| 35 | Ga0070665_100007014 | 3300005548 | Bacteria | 11450 |
| 36 | Ga0070665_100095388 | 3300005548 | Bacteria | 2980 |
| 37 | Ga0070665_100131433 | 3300005548 | Bacteria | 2505 |
| 38 | Ga0070704_100017559 | 3300005549 | Bacteria | 4553 |
| 39 | Ga0068855_100007296 | 3300005563 | Bacteria | 13388 |
| 40 | Ga0068855_100206484 | 3300005563 | Bacteria | 2210 |
| 41 | Ga0070664_100064323 | 3300005564 | Bacteria | 3128 |
| 42 | Ga0068857_100007139 | 3300005577 | Bacteria | 9621 |
| 43 | Ga0068857_100038888 | 3300005577 | Bacteria | 4212 |
| 44 | Ga0068854_100009946 | 3300005578 | Bacteria | 6155 |
| 45 | Ga0068854_100219211 | 3300005578 | Bacteria | 1504 |
| 46 | Ga0068856_100204808 | 3300005614 | Bacteria | 1987 |
| 47 | Ga0068852_100292311 | 3300005616 | Bacteria | 1574 |
| 48 | Ga0068859_100265156 | 3300005617 | Bacteria | 1810 |
| 49 | Ga0081455_10009867 | 3300005937 | Bacteria | 9770 |
| 50 | Ga0081455_10009960 | 3300005937 | Bacteria | 9717 |
| 51 | Ga0081455_10019330 | 3300005937 | Bacteria | 6447 |
| 52 | Ga0081540_1003156 | 3300005983 | Bacteria | 13157 |
| 53 | Ga0081540_1033264 | 3300005983 | Bacteria | 2802 |
| 54 | Ga0081539_10000381 | 3300005985 | Bacteria | 96399 |
| 55 | Ga0081539_10008707 | 3300005985 | Bacteria | 8723 |
| 56 | Ga0081539_10015008 | 3300005985 | Bacteria | 5676 |
| 57 | Ga0081539_10019912 | 3300005985 | Bacteria | 4568 |
| 58 | Ga0081539_10060074 | 3300005985 | Bacteria | 2089 |
| 59 | Ga0070717_10210444 | 3300006028 | Bacteria | 1706 |
| 60 | Ga0075368_10005635 | 3300006042 | Bacteria | 4321 |
| 61 | Ga0075363_100005675 | 3300006048 | Bacteria | 5585 |
| 62 | Ga0075363_100027448 | 3300006048 | Bacteria | 2919 |
| 63 | Ga0075363_100078333 | 3300006048 | Bacteria | 1804 |
| 64 | Ga0075363_100091167 | 3300006048 | Bacteria | 1678 |
| 65 | Ga0075364_10031721 | 3300006051 | Bacteria | 3395 |
| 66 | Ga0070715_10012620 | 3300006163 | Bacteria | 3081 |
| 67 | Ga0070716_100004805 | 3300006173 | Bacteria | 6488 |
| 68 | Ga0070712_100004010 | 3300006175 | Bacteria | 9047 |
| 69 | Ga0075367_10027504 | 3300006178 | Bacteria | 3236 |
| 70 | Ga0075367_10040955 | 3300006178 | Bacteria | 2706 |
| 71 | Ga0075370_10027371 | 3300006353 | Bacteria | 3162 |
| 72 | Ga0075370_10069235 | 3300006353 | Bacteria | 2016 |
| 73 | Ga0075428_100007250 | 3300006844 | Bacteria | 12285 |
| 74 | Ga0075428_100011991 | 3300006844 | Bacteria | 9642 |
| 75 | Ga0075431_100009125 | 3300006847 | Bacteria | 9945 |
| 76 | Ga0075431_100028072 | 3300006847 | Bacteria | 5778 |
| 77 | Ga0075433_10003678 | 3300006852 | Bacteria | 11863 |
| 78 | Ga0075434_100001261 | 3300006871 | Bacteria | 21103 |
| 79 | Ga0075434_100014570 | 3300006871 | Bacteria | 7519 |
| 80 | Ga0075429_100007247 | 3300006880 | Bacteria | 9621 |
| 81 | Ga0075429_100020235 | 3300006880 | Bacteria | 5770 |
| 82 | Ga0075436_100001077 | 3300006914 | Bacteria | 18366 |
| 83 | Ga0097620_100265168 | 3300006931 | Bacteria | 1810 |
| 84 | Ga0099826_10055940 | 3300006948 | Bacteria | 2608 |
| 85 | Ga0105244_10053032 | 3300009036 | Bacteria | 2062 |
| 86 | Ga0105240_10015715 | 3300009093 | Bacteria | 10272 |
| 87 | Ga0105240_10097021 | 3300009093 | Bacteria | 3591 |
| 88 | Ga0111539_10000537 | 3300009094 | Bacteria | 48227 |
| 89 | Ga0111539_10099912 | 3300009094 | Bacteria | 3407 |
| 90 | Ga0105245_10157298 | 3300009098 | Bacteria | 2153 |
| 91 | Ga0114129_10008460 | 3300009147 | Bacteria | 14661 |
| 92 | Ga0105243_10052523 | 3300009148 | Bacteria | 3229 |
| 93 | Ga0105243_10056185 | 3300009148 | Bacteria | 3129 |
| 94 | Ga0105241_10003698 | 3300009174 | Bacteria | 11365 |
| 95 | Ga0105241_10006208 | 3300009174 | Bacteria | 8814 |
| 96 | Ga0105242_10037132 | 3300009176 | Bacteria | 3912 |
| 97 | Ga0105237_10004407 | 3300009545 | Bacteria | 16312 |
| 98 | Ga0105237_10176531 | 3300009545 | Bacteria | 2136 |
| 99 | Ga0105237_10228148 | 3300009545 | Bacteria | 1863 |
| 100 | Ga0105238_10000200 | 3300009551 | Bacteria | 66219 |
| 101 | Ga0105238_10041156 | 3300009551 | Bacteria | 4681 |
| 102 | Ga0105238_10119804 | 3300009551 | Bacteria | 2612 |
| 103 | Ga0105238_10149694 | 3300009551 | Bacteria | 2309 |
| 104 | Ga0105249_10167924 | 3300009553 | Bacteria | 2125 |
| 105 | Ga0105249_10190960 | 3300009553 | Bacteria | 1999 |
| 106 | Ga0105239_10016948 | 3300010375 | Bacteria | 8054 |
| 107 | Ga0105239_10048362 | 3300010375 | Bacteria | 4664 |
| 108 | Ga0105239_10076437 | 3300010375 | Bacteria | 3683 |
| 109 | Ga0105246_10017871 | 3300011119 | Bacteria | 4512 |
| 110 | Ga0105246_10029411 | 3300011119 | Bacteria | 3618 |
| 111 | Ga0157369_10075585 | 3300013105 | Bacteria | 3611 |
| 112 | Ga0157369_10189324 | 3300013105 | Bacteria | 2162 |
| 113 | Ga0157374_10133760 | 3300013296 | Bacteria | 2402 |
| 114 | Ga0157378_10045454 | 3300013297 | Bacteria | 3902 |
| 115 | Ga0163162_10054215 | 3300013306 | Bacteria | 4033 |
| 116 | Ga0157372_10084428 | 3300013307 | Bacteria | 3599 |
| 117 | Ga0157372_10145291 | 3300013307 | Bacteria | 2735 |
| 118 | Ga0163163_10210225 | 3300014325 | Bacteria | 1995 |
| 119 | Ga0157377_10017835 | 3300014745 | Bacteria | 3680 |
| 120 | Ga0157376_10150420 | 3300014969 | Bacteria | 2099 |
| 121 | Ga0163161_10093855 | 3300017792 | Bacteria | 2224 |
| 122 | Ga0207656_10036994 | 3300025321 | Bacteria | 2051 |
| 123 | Ga0207656_10044570 | 3300025321 | Bacteria | 1895 |
| 124 | Ga0207692_10001290 | 3300025898 | Bacteria | 9312 |
| 125 | Ga0207692_10024393 | 3300025898 | Bacteria | 2811 |
| 126 | Ga0207688_10000841 | 3300025901 | Bacteria | 15432 |
| 127 | Ga0207688_10011866 | 3300025901 | Bacteria | 4742 |
| 128 | Ga0207688_10044896 | 3300025901 | Bacteria | 2463 |
| 129 | Ga0207688_10047386 | 3300025901 | Bacteria | 2400 |
| 130 | Ga0207680_10108739 | 3300025903 | Bacteria | 1794 |
| 131 | Ga0207647_10000384 | 3300025904 | Bacteria | 35996 |
| 132 | Ga0207647_10009432 | 3300025904 | Bacteria | 6934 |
| 133 | Ga0207647_10019932 | 3300025904 | Bacteria | 4503 |
| 134 | Ga0207647_10023053 | 3300025904 | Bacteria | 4123 |
| 135 | Ga0207647_10029337 | 3300025904 | Bacteria | 3562 |
| 136 | Ga0207647_10043871 | 3300025904 | Bacteria | 2796 |
| 137 | Ga0207647_10065118 | 3300025904 | Bacteria | 2213 |
| 138 | Ga0207685_10011398 | 3300025905 | Bacteria | 2671 |
| 139 | Ga0207699_10001300 | 3300025906 | Bacteria | 11868 |
| 140 | Ga0207705_10011129 | 3300025909 | Bacteria | 6522 |
| 141 | Ga0207654_10002418 | 3300025911 | Bacteria | 9533 |
| 142 | Ga0207654_10013103 | 3300025911 | Bacteria | 4261 |
| 143 | Ga0207707_10034940 | 3300025912 | Bacteria | 4397 |
| 144 | Ga0207695_10000449 | 3300025913 | Bacteria | 89856 |
| 145 | Ga0207695_10013520 | 3300025913 | Bacteria | 9729 |
| 146 | Ga0207671_10000052 | 3300025914 | Bacteria | 188462 |
| 147 | Ga0207671_10000580 | 3300025914 | Bacteria | 48907 |
| 148 | Ga0207693_10000602 | 3300025915 | Bacteria | 32212 |
| 149 | Ga0207663_10119603 | 3300025916 | Bacteria | 1801 |
| 150 | Ga0207657_10013589 | 3300025919 | Bacteria | 7985 |
| 151 | Ga0207694_10000079 | 3300025924 | Bacteria | 111767 |
| 152 | Ga0207694_10037053 | 3300025924 | Bacteria | 3743 |
| 153 | Ga0207694_10067059 | 3300025924 | Bacteria | 2801 |
| 154 | Ga0207687_10018220 | 3300025927 | Bacteria | 4631 |
| 155 | Ga0207664_10006688 | 3300025929 | Bacteria | 7953 |
| 156 | Ga0207664_10024716 | 3300025929 | Bacteria | 4517 |
| 157 | Ga0207644_10036679 | 3300025931 | Bacteria | 3444 |
| 158 | Ga0207686_10036736 | 3300025934 | Bacteria | 2952 |
| 159 | Ga0207686_10126933 | 3300025934 | Bacteria | 1745 |
| 160 | Ga0207709_10029384 | 3300025935 | Bacteria | 3188 |
| 161 | Ga0207669_10044145 | 3300025937 | Bacteria | 2617 |
| 162 | Ga0207665_10003722 | 3300025939 | Bacteria | 10187 |
| 163 | Ga0207689_10004009 | 3300025942 | Bacteria | 13393 |
| 164 | Ga0207661_10148198 | 3300025944 | Bacteria | 2026 |
| 165 | Ga0207679_10006682 | 3300025945 | Bacteria | 7303 |
| 166 | Ga0207667_10008068 | 3300025949 | Bacteria | 12548 |
| 167 | Ga0207667_10258671 | 3300025949 | Bacteria | 1780 |
| 168 | Ga0207651_10015401 | 3300025960 | Bacteria | 4443 |
| 169 | Ga0207640_10007132 | 3300025981 | Bacteria | 6158 |
| 170 | Ga0207703_10051971 | 3300026035 | Bacteria | 3325 |
| 171 | Ga0207703_10184631 | 3300026035 | Bacteria | 1842 |
| 172 | Ga0207639_10081722 | 3300026041 | Bacteria | 2560 |
| 173 | Ga0207678_10007867 | 3300026067 | Bacteria | 9405 |
| 174 | Ga0207708_10159261 | 3300026075 | Bacteria | 1782 |
| 175 | Ga0207708_10242311 | 3300026075 | Bacteria | 1450 |
| 176 | Ga0207648_10007779 | 3300026089 | Bacteria | 10465 |
| 177 | Ga0207676_10057652 | 3300026095 | Bacteria | 3060 |
| 178 | Ga0207674_10017090 | 3300026116 | Bacteria | 7919 |
| 179 | Ga0207674_10063468 | 3300026116 | Bacteria | 3729 |
| 180 | Ga0207675_100008679 | 3300026118 | Bacteria | 9554 |
| 181 | Ga0207675_100115019 | 3300026118 | Bacteria | 2541 |
| 182 | Ga0207698_10017352 | 3300026142 | Bacteria | 4880 |
| 183 | Ga0207698_10254149 | 3300026142 | Bacteria | 1610 |
| 184 | Ga0209813_10001795 | 3300027866 | Bacteria | 4835 |
| 185 | Ga0209813_10005253 | 3300027866 | Bacteria | 3134 |
| 186 | Ga0207428_10005928 | 3300027907 | Bacteria | 11312 |
| 187 | Ga0207428_10080214 | 3300027907 | Bacteria | 2550 |
| 188 | Ga0268266_10007187 | 3300028379 | Bacteria | 10083 |
| 189 | Ga0268266_10015277 | 3300028379 | Bacteria | 6591 |
| 190 | Ga0268266_10020552 | 3300028379 | Bacteria | 5626 |
| 191 | Ga0268266_10148357 | 3300028379 | Bacteria | 2111 |
| 192 | Ga0268264_10000374 | 3300028381 | Bacteria | 65781 |
| 193 | Ga0265337_1016808 | 3300028556 | Bacteria | 2358 |
| 194 | Ga0265326_10000388 | 3300028558 | Bacteria | 17873 |
| 195 | Ga0307517_10002400 | 3300028786 | Bacteria | 30069 |
| 196 | Ga0307517_10006298 | 3300028786 | Bacteria | 17623 |
| 197 | Ga0307517_10119485 | 3300028786 | Bacteria | 1956 |
| 198 | Ga0307515_10001177 | 3300028794 | Bacteria | 59836 |
| 199 | Ga0307511_10029836 | 3300030521 | Bacteria | 4913 |
| 200 | Ga0307512_10005436 | 3300030522 | Bacteria | 13305 |
| 201 | Ga0265327_10000630 | 3300031251 | Bacteria | 57536 |
| 202 | Ga0307513_10016493 | 3300031456 | Bacteria | 8902 |
| 203 | Ga0307513_10023232 | 3300031456 | Bacteria | 7249 |
| 204 | Ga0307513_10077152 | 3300031456 | Bacteria | 3452 |
| 205 | Ga0307513_10102899 | 3300031456 | Bacteria | 2874 |
| 206 | Ga0307408_100008922 | 3300031548 | Bacteria | 6625 |
| 207 | Ga0307408_100010849 | 3300031548 | Bacteria | 6012 |
| 208 | Ga0307408_100112552 | 3300031548 | Bacteria | 2093 |
| 209 | Ga0307508_10005680 | 3300031616 | Bacteria | 11819 |
| 210 | Ga0307508_10014629 | 3300031616 | Bacteria | 7158 |
| 211 | Ga0307508_10064626 | 3300031616 | Bacteria | 3226 |
| 212 | Ga0307514_10037111 | 3300031649 | Bacteria | 3868 |
| 213 | Ga0316579_10015603 | 3300031691 | Bacteria | 3304 |
| 214 | Ga0307516_10010111 | 3300031730 | Bacteria | 10429 |
| 215 | Ga0307405_10000511 | 3300031731 | Bacteria | 14619 |
| 216 | Ga0316577_10011424 | 3300031733 | Bacteria | 4808 |
| 217 | Ga0307413_10000901 | 3300031824 | Bacteria | 10505 |
| 218 | Ga0307413_10015857 | 3300031824 | Bacteria | 3874 |
| 219 | Ga0307413_10027245 | 3300031824 | Bacteria | 3163 |
| 220 | Ga0307410_10043450 | 3300031852 | Bacteria | 2978 |
| 221 | Ga0307410_10182567 | 3300031852 | Bacteria | 1589 |
| 222 | Ga0307406_10000019 | 3300031901 | Bacteria | 98555 |
| 223 | Ga0307407_10004007 | 3300031903 | Bacteria | 6162 |
| 224 | Ga0307412_10018856 | 3300031911 | Bacteria | 4163 |
| 225 | Ga0307409_100078970 | 3300031995 | Bacteria | 2650 |
| 226 | Ga0307409_100094875 | 3300031995 | Bacteria | 2456 |
| 227 | Ga0307409_100310526 | 3300031995 | Bacteria | 1471 |
| 228 | Ga0307416_100000040 | 3300032002 | Bacteria | 132572 |
| 229 | Ga0307416_100015467 | 3300032002 | Bacteria | 5274 |
| 230 | Ga0307416_100033810 | 3300032002 | Bacteria | 3882 |
| 231 | Ga0307414_10002067 | 3300032004 | Bacteria | 10425 |
| 232 | Ga0307414_10009244 | 3300032004 | Bacteria | 5651 |
| 233 | Ga0307411_10000062 | 3300032005 | Bacteria | 32207 |
| 234 | Ga0307411_10012877 | 3300032005 | Bacteria | 4586 |
| 235 | Ga0307411_10047651 | 3300032005 | Bacteria | 2772 |
| 236 | Ga0307415_100002141 | 3300032126 | Bacteria | 9778 |
| 237 | Ga0307415_100005448 | 3300032126 | Bacteria | 6761 |
| 238 | Ga0307415_100047103 | 3300032126 | Bacteria | 2901 |
| 239 | Ga0307415_100069236 | 3300032126 | Bacteria | 2473 |
| 240 | Ga0316574_0003441 | 3300035398 | Bacteria | 8157 |
| 241 | Ga0316574_0058133 | 3300035398 | Bacteria | 2422 |
| 242 | Ga0316584_0055895 | 3300036712 | Bacteria | 2955 |
| 243 | Ga0395899_0065927 | 3300037312 | Bacteria | 2660 |
| 244 | Ga0395900_0128670 | 3300037418 | Bacteria | 2596 |
| 245 | Ga0395898_0053416 | 3300037466 | Bacteria | 3946 |
| 246 | Ga0395898_0114731 | 3300037466 | Bacteria | 2581 |
| 247 | Ga0395901_0008656 | 3300038443 | Bacteria | 10283 |
| 248 | Ga0395901_0029700 | 3300038443 | Bacteria | 5629 |
| 249 | Ga0395901_0099361 | 3300038443 | Bacteria | 3051 |
| 250 | Ga0395901_0160644 | 3300038443 | Bacteria | 2360 |
| 251 | Ga0395901_0256540 | 3300038443 | Bacteria | 1821 |
| 252 | Ga0400485_14323 | 3300038735 | Bacteria | 58881 |
| 253 | Ga0400488_07225 | 3300038741 | Bacteria | 3313 |
| 254 | Ga0400486_16675 | 3300038742 | Bacteria | 25458 |
| 255 | Ga0439461_0000895 | 3300041410 | Bacteria | 4424 |
| 256 | Ga0439466_0026182 | 3300041411 | Bacteria | 2030 |
| 257 | Ga0439431_0004227 | 3300041997 | Bacteria | 3151 |
| 258 | Ga0439442_016345 | 3300042002 | Bacteria | 1530 |
| 259 | Ga0439448_0030378 | 3300042005 | Bacteria | 1714 |
| 260 | Ga0439448_0030485 | 3300042005 | Bacteria | 1711 |
| 261 | Ga0439457_005570 | 3300042014 | Bacteria | 3152 |
| 262 | Ga0439463_017598 | 3300042016 | Bacteria | 1773 |
| 263 | Ga0450902_005362 | 3300042137 | Bacteria | 1933 |
| 264 | Ga0450903_000042 | 3300042138 | Bacteria | 24733 |
| 265 | Ga0439446_0013258 | 3300042156 | Bacteria | 2260 |
| 266 | Ga0439458_0001348 | 3300042157 | Bacteria | 6191 |
| 267 | Ga0439434_0003877 | 3300042435 | Bacteria | 4368 |
| 268 | Ga0439459_0012755 | 3300042438 | Bacteria | 1501 |
| 269 | Ga0439440_0001853 | 3300042993 | Bacteria | 3922 |
| 270 | Ga0439440_0002277 | 3300042993 | Bacteria | 3604 |
| 271 | Ga0466969_0001418 | 3300044656 | Bacteria | 12922 |
| 272 | Ga0466969_0003205 | 3300044656 | Bacteria | 8713 |
| 273 | Ga0466969_0004397 | 3300044656 | Bacteria | 7494 |
| 274 | Ga0466972_0056342 | 3300044658 | Bacteria | 1890 |
| 275 | Ga0466965_0003169 | 3300044683 | Bacteria | 7181 |
| 276 | Ga0466965_0005755 | 3300044683 | Bacteria | 5594 |
| 277 | Ga0466965_0056712 | 3300044683 | Bacteria | 1951 |
| 278 | Ga0466966_0002097 | 3300044684 | Bacteria | 12945 |
| 279 | Ga0466966_0002225 | 3300044684 | Bacteria | 12619 |
| 280 | Ga0466966_0002490 | 3300044684 | Bacteria | 12063 |
| 281 | Ga0466966_0005466 | 3300044684 | Bacteria | 8354 |
| 282 | Ga0466966_0006467 | 3300044684 | Bacteria | 7754 |
| 283 | Ga0466966_0025916 | 3300044684 | Bacteria | 3830 |
| 284 | Ga0466966_0105399 | 3300044684 | Bacteria | 1741 |
| 285 | Ga0466961_0006972 | 3300044693 | Bacteria | 7188 |
| 286 | Ga0466961_0010029 | 3300044693 | Bacteria | 6034 |
| 287 | Ga0466961_0021195 | 3300044693 | Bacteria | 4183 |
| 288 | Ga0466961_0030018 | 3300044693 | Bacteria | 3493 |
| 289 | Ga0466961_0045720 | 3300044693 | Bacteria | 2800 |
| 290 | Ga0466961_0057787 | 3300044693 | Bacteria | 2469 |
| 291 | Ga0466961_0057919 | 3300044693 | Bacteria | 2465 |
| 292 | Ga0466963_0006392 | 3300044694 | Bacteria | 6969 |
| 293 | Ga0466963_0029351 | 3300044694 | Bacteria | 3540 |
| 294 | Ga0466964_0026522 | 3300044706 | Bacteria | 2268 |
| 295 | Ga0466971_0006943 | 3300044719 | Bacteria | 4924 |
| 296 | Ga0466968_0010428 | 3300044735 | Bacteria | 3603 |
| 297 | Ga0466970_0000821 | 3300044765 | Bacteria | 14916 |
| 298 | Ga0466970_0005211 | 3300044765 | Bacteria | 6433 |
| 299 | Ga0466970_0006446 | 3300044765 | Bacteria | 5869 |
| 300 | Ga0466970_0008060 | 3300044765 | Bacteria | 5291 |
| 301 | Ga0466970_0009711 | 3300044765 | Bacteria | 4868 |
| 302 | Ga0466970_0034286 | 3300044765 | Bacteria | 2686 |
| 303 | Ga0466957_0001983 | 3300044842 | Bacteria | 10901 |
| 304 | Ga0466957_0016357 | 3300044842 | Bacteria | 4338 |
| 305 | Ga0466960_0005774 | 3300044901 | Bacteria | 4926 |
| 306 | Ga0466960_0010227 | 3300044901 | Bacteria | 3894 |
| 307 | Ga0466959_0012867 | 3300045049 | Bacteria | 6056 |
| 308 | Ga0466959_0026000 | 3300045049 | Bacteria | 4340 |
| 309 | Ga0466959_0032027 | 3300045049 | Bacteria | 3890 |
| 310 | Ga0466959_0042996 | 3300045049 | Bacteria | 3332 |
| 311 | Ga0466959_0043923 | 3300045049 | Bacteria | 3293 |
| 312 | Ga0466959_0098778 | 3300045049 | Bacteria | 2091 |
| 313 | Ga0451576_0078962 | 3300045051 | Bacteria | 3424 |
| 314 | Ga0466958_0002731 | 3300045836 | Bacteria | 8951 |
| 315 | Ga0466958_0009827 | 3300045836 | Bacteria | 5338 |
| 316 | Ga0466967_0017591 | 3300045976 | Bacteria | 5682 |
| 317 | Ga0466967_0036385 | 3300045976 | Bacteria | 4202 |
| 318 | Ga0466967_0042514 | 3300045976 | Bacteria | 3928 |
| 319 | Ga0466967_0046247 | 3300045976 | Bacteria | 3788 |
| 320 | Ga0466967_0151430 | 3300045976 | Bacteria | 2168 |
| 321 | Ga0495592_0007921 | 3300046454 | Bacteria | 7967 |
| 322 | Ga0495592_0008939 | 3300046454 | Bacteria | 7521 |
| 323 | Ga0495603_0084999 | 3300046455 | Bacteria | 1852 |
| 324 | Ga0495603_0085586 | 3300046455 | Bacteria | 1845 |
| 325 | Ga0495629_0004039 | 3300046459 | Bacteria | 11030 |
| 326 | Ga0495629_0004832 | 3300046459 | Bacteria | 10102 |
| 327 | Ga0495629_0018751 | 3300046459 | Bacteria | 4946 |
| 328 | Ga0495629_0062864 | 3300046459 | Bacteria | 2592 |
| 329 | Ga0495638_0026034 | 3300046460 | Bacteria | 3797 |
| 330 | Ga0495638_0070088 | 3300046460 | Bacteria | 2147 |
| 331 | Ga0495651_0000129 | 3300046462 | Bacteria | 56034 |
| 332 | Ga0495651_0000877 | 3300046462 | Bacteria | 23370 |
| 333 | Ga0495651_0002270 | 3300046462 | Bacteria | 14836 |
| 334 | Ga0495651_0002743 | 3300046462 | Bacteria | 13659 |
| 335 | Ga0495651_0020641 | 3300046462 | Bacteria | 5114 |
| 336 | Ga0495651_0035079 | 3300046462 | Bacteria | 3907 |
| 337 | Ga0495651_0064795 | 3300046462 | Bacteria | 2792 |
| 338 | Ga0495653_0003805 | 3300046463 | Bacteria | 12215 |
| 339 | Ga0495653_0052219 | 3300046463 | Bacteria | 3134 |
| 340 | Ga0495580_0070581 | 3300046472 | Bacteria | 2440 |
| 341 | Ga0495662_0002591 | 3300046476 | Bacteria | 9136 |
| 342 | Ga0495664_0011037 | 3300046477 | Bacteria | 5082 |
| 343 | Ga0495585_0007060 | 3300046492 | Bacteria | 6907 |
| 344 | Ga0495585_0065273 | 3300046492 | Bacteria | 1995 |
| 345 | Ga0495594_0000534 | 3300046499 | Bacteria | 19485 |
| 346 | Ga0495608_0014307 | 3300046511 | Bacteria | 5505 |
| 347 | Ga0495616_0033346 | 3300046513 | Bacteria | 2684 |
| 348 | Ga0495620_0023194 | 3300046515 | Bacteria | 2973 |
| 349 | Ga0495628_0013131 | 3300046516 | Bacteria | 6972 |
| 350 | Ga0495628_0017507 | 3300046516 | Bacteria | 5963 |
| 351 | Ga0495628_0043231 | 3300046516 | Bacteria | 3590 |
| 352 | Ga0495628_0048477 | 3300046516 | Bacteria | 3367 |
| 353 | Ga0495632_0013008 | 3300046519 | Bacteria | 4770 |
| 354 | Ga0495643_0003319 | 3300046522 | Bacteria | 11874 |
| 355 | Ga0495643_0011979 | 3300046522 | Bacteria | 5248 |
| 356 | Ga0495643_0079387 | 3300046522 | Bacteria | 1711 |
| 357 | Ga0495666_0013332 | 3300046526 | Bacteria | 4098 |
| 358 | Ga0495652_0000654 | 3300046529 | Bacteria | 40137 |
| 359 | Ga0495652_0002119 | 3300046529 | Bacteria | 20914 |
| 360 | Ga0495652_0002317 | 3300046529 | Bacteria | 19797 |
| 361 | Ga0495652_0006834 | 3300046529 | Bacteria | 10573 |
| 362 | Ga0495652_0013171 | 3300046529 | Bacteria | 7446 |
| 363 | Ga0495652_0038084 | 3300046529 | Bacteria | 4168 |
| 364 | Ga0495652_0040281 | 3300046529 | Bacteria | 4037 |
| 365 | Ga0495652_0084400 | 3300046529 | Bacteria | 2612 |
| 366 | Ga0495640_0012881 | 3300046533 | Bacteria | 6377 |
| 367 | Ga0495640_0017126 | 3300046533 | Bacteria | 5407 |
| 368 | Ga0495640_0018021 | 3300046533 | Bacteria | 5249 |
| 369 | Ga0495640_0018600 | 3300046533 | Bacteria | 5146 |
| 370 | Ga0495587_0003288 | 3300046536 | Bacteria | 10788 |
| 371 | Ga0495587_0022087 | 3300046536 | Bacteria | 3919 |
| 372 | Ga0495645_0004398 | 3300046543 | Bacteria | 9628 |
| 373 | Ga0495645_0023172 | 3300046543 | Bacteria | 4495 |
| 374 | Ga0495622_0011920 | 3300046557 | Bacteria | 4021 |
| 375 | Ga0495633_0048814 | 3300046558 | Bacteria | 1998 |
| 376 | Ga0495667_0020606 | 3300046559 | Bacteria | 4447 |
| 377 | Ga0495667_0028673 | 3300046559 | Bacteria | 3749 |
| 378 | Ga0495634_0012335 | 3300046642 | Bacteria | 6192 |
| 379 | Ga0495634_0017379 | 3300046642 | Bacteria | 5133 |
| 380 | Ga0495634_0052248 | 3300046642 | Bacteria | 2739 |
| 381 | Ga0495611_0028558 | 3300046648 | Bacteria | 2443 |
| 382 | Ga0495625_0005807 | 3300046660 | Bacteria | 11145 |
| 383 | Ga0495635_0004355 | 3300046663 | Bacteria | 9800 |
| 384 | Ga0495635_0005875 | 3300046663 | Bacteria | 8556 |
| 385 | Ga0495635_0016061 | 3300046663 | Bacteria | 5228 |
| 386 | Ga0495588_0002549 | 3300046674 | Bacteria | 7786 |
| 387 | Ga0495588_0130716 | 3300046674 | Bacteria | 1324 |
| 388 | Ga0495657_0003629 | 3300046675 | Bacteria | 12539 |
| 389 | Ga0495657_0016996 | 3300046675 | Bacteria | 5288 |
| 390 | Ga0495657_0019934 | 3300046675 | Bacteria | 4831 |
| 391 | Ga0495599_0012610 | 3300046678 | Bacteria | 5212 |
| 392 | Ga0495623_0058203 | 3300046679 | Bacteria | 2430 |
| 393 | Ga0495623_0066863 | 3300046679 | Bacteria | 2244 |
| 394 | Ga0495646_0000855 | 3300046680 | Bacteria | 17256 |
| 395 | Ga0495646_0107181 | 3300046680 | Bacteria | 1594 |
| 396 | Ga0495613_0023073 | 3300046689 | Bacteria | 4637 |
| 397 | Ga0495624_0007422 | 3300046690 | Bacteria | 7692 |
| 398 | Ga0495670_0006366 | 3300046691 | Bacteria | 5797 |
| 399 | Ga0495671_0027068 | 3300046692 | Bacteria | 2964 |
| 400 | Ga0495589_0029739 | 3300046794 | Bacteria | 2754 |
| 401 | Ga0495600_0001072 | 3300046809 | Bacteria | 14861 |
| 402 | Ga0495600_0035679 | 3300046809 | Bacteria | 3231 |
| 403 | Ga0495600_0075430 | 3300046809 | Bacteria | 2202 |
| 404 | Ga0495660_0007437 | 3300046810 | Bacteria | 6431 |
| 405 | Ga0495581_0008614 | 3300047315 | Bacteria | 5909 |
| 406 | Ga0495581_0042500 | 3300047315 | Bacteria | 2631 |
| 407 | Ga0495604_0010118 | 3300047317 | Bacteria | 7472 |
| 408 | Ga0495604_0011789 | 3300047317 | Bacteria | 6950 |
| 409 | Ga0495604_0116883 | 3300047317 | Bacteria | 1935 |
| 410 | Ga0495636_0034595 | 3300047318 | Bacteria | 2080 |
| 411 | Ga0495676_0008079 | 3300047321 | Bacteria | 9654 |
| 412 | Ga0495676_0026725 | 3300047321 | Bacteria | 4962 |
| 413 | Ga0495676_0096093 | 3300047321 | Bacteria | 2203 |
| 414 | Ga0495675_0015922 | 3300047444 | Bacteria | 4755 |
| 415 | Ga0495675_0025100 | 3300047444 | Bacteria | 3801 |
| 416 | Ga0495675_0060804 | 3300047444 | Bacteria | 2394 |
| 417 | Ga0495685_000486 | 3300047447 | Bacteria | 12295 |
| 418 | Ga0495681_0000590 | 3300047470 | Bacteria | 27737 |
| 419 | Ga0495681_0004760 | 3300047470 | Bacteria | 9198 |
| 420 | Ga0495684_0055850 | 3300047471 | Bacteria | 3011 |
| 421 | Ga0495686_0050971 | 3300047472 | Bacteria | 2599 |
| 422 | Ga0495602_0060791 | 3300048088 | Bacteria | 3290 |
| 423 | Ga0495614_0002125 | 3300048089 | Bacteria | 8769 |
| 424 | Ga0496100_0001299 | 3300048903 | Bacteria | 12190 |
| 425 | Ga0496100_0034974 | 3300048903 | Bacteria | 3157 |
| 426 | Ga0496100_0058356 | 3300048903 | Bacteria | 2532 |
| 427 | Ga0496101_0000108 | 3300048904 | Bacteria | 86290 |
| 428 | Ga0496101_0043038 | 3300048904 | Bacteria | 3225 |
| 429 | Ga0496101_0066956 | 3300048904 | Bacteria | 2621 |
| 430 | Ga0496102_0000005 | 3300048905 | Bacteria | 481937 |
| 431 | Ga0496102_0030302 | 3300048905 | Bacteria | 4842 |
| 432 | Ga0496102_0041912 | 3300048905 | Bacteria | 4147 |
| 433 | Ga0496102_0210018 | 3300048905 | Bacteria | 1835 |
| 434 | Ga0496103_0000002 | 3300048906 | Bacteria | 605387 |
| 435 | Ga0496103_0056359 | 3300048906 | Bacteria | 2439 |
| 436 | Ga0496104_0007962 | 3300048907 | Bacteria | 9397 |
| 437 | Ga0496104_0145031 | 3300048907 | Bacteria | 2280 |
| 438 | Ga0496105_0002357 | 3300048908 | Bacteria | 13685 |
| 439 | Ga0496105_0022117 | 3300048908 | Bacteria | 5151 |
| 440 | Ga0496105_0035803 | 3300048908 | Bacteria | 4087 |
| 441 | Ga0496105_0187628 | 3300048908 | Bacteria | 1692 |
| 442 | Ga0496106_0001149 | 3300048909 | Bacteria | 19609 |
| 443 | Ga0496106_0015048 | 3300048909 | Bacteria | 5725 |
| 444 | Ga0496106_0021137 | 3300048909 | Bacteria | 4832 |
| 445 | Ga0496106_0087147 | 3300048909 | Bacteria | 2405 |
| 446 | Ga0496107_0012322 | 3300048910 | Bacteria | 5969 |
| 447 | Ga0496107_0038012 | 3300048910 | Bacteria | 3455 |
| 448 | Ga0496107_0073522 | 3300048910 | Bacteria | 2486 |
| 449 | Ga0496108_0001760 | 3300048911 | Bacteria | 17219 |
| 450 | Ga0496108_0021929 | 3300048911 | Bacteria | 5250 |
| 451 | Ga0496108_0090417 | 3300048911 | Bacteria | 2602 |
| 452 | Ga0496109_0014852 | 3300048912 | Bacteria | 6775 |
| 453 | Ga0496109_0026161 | 3300048912 | Bacteria | 5202 |
| 454 | Ga0496109_0034523 | 3300048912 | Bacteria | 4556 |
| 455 | Ga0496109_0080158 | 3300048912 | Bacteria | 3008 |
| 456 | Ga0496109_0241200 | 3300048912 | Bacteria | 1701 |
| 457 | Ga0496110_0004424 | 3300048913 | Bacteria | 10886 |
| 458 | Ga0496110_0040490 | 3300048913 | Bacteria | 4060 |
| 459 | Ga0496111_0065120 | 3300048914 | Bacteria | 2645 |
| 460 | Ga0496112_0008515 | 3300048915 | Bacteria | 9188 |
| 461 | Ga0496113_0045946 | 3300048916 | Bacteria | 3241 |
| 462 | Ga0496113_0111951 | 3300048916 | Bacteria | 2126 |
| 463 | Ga0496114_0000890 | 3300048917 | Bacteria | 22328 |
| 464 | Ga0496114_0010650 | 3300048917 | Bacteria | 7319 |
| 465 | Ga0496115_0015781 | 3300048918 | Bacteria | 5736 |
| 466 | Ga0496115_0026477 | 3300048918 | Bacteria | 4526 |
| 467 | Ga0496116_0000034 | 3300048919 | Bacteria | 409567 |
| 468 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 469 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 470 | Ga0496119_0000669 | 3300048922 | Bacteria | 45985 |
| 471 | Ga0496119_0102432 | 3300048922 | Bacteria | 1605 |
| 472 | Ga0496120_0000594 | 3300048923 | Bacteria | 54781 |
| 473 | Ga0496121_0003113 | 3300048924 | Bacteria | 23968 |
| 474 | Ga0496124_0031963 | 3300048927 | Bacteria | 4655 |
| 475 | Ga0496126_0000178 | 3300048929 | Bacteria | 145079 |
| 476 | Ga0496126_0046522 | 3300048929 | Bacteria | 3979 |
| 477 | Ga0501031_0003124 | 3300049568 | Bacteria | 10615 |
| 478 | Ga0501031_0012776 | 3300049568 | Bacteria | 5486 |
| 479 | Ga0501031_0013104 | 3300049568 | Bacteria | 5408 |
| 480 | Ga0501031_0063185 | 3300049568 | Bacteria | 2412 |
| 481 | Ga0501031_0080746 | 3300049568 | Bacteria | 2119 |
| 482 | Ga0501032_0000686 | 3300049569 | Bacteria | 27531 |
| 483 | Ga0501032_0007044 | 3300049569 | Bacteria | 8247 |
| 484 | Ga0501032_0009613 | 3300049569 | Bacteria | 7008 |
| 485 | Ga0501032_0025746 | 3300049569 | Bacteria | 4055 |
| 486 | Ga0501032_0067229 | 3300049569 | Bacteria | 2394 |
| 487 | Ga0501032_0082971 | 3300049569 | Bacteria | 2132 |
| 488 | Ga0501032_0088277 | 3300049569 | Bacteria | 2059 |
| 489 | Ga0501033_0003959 | 3300049570 | Bacteria | 12010 |
| 490 | Ga0501033_0009007 | 3300049570 | Bacteria | 7700 |
| 491 | Ga0501033_0011728 | 3300049570 | Bacteria | 6702 |
| 492 | Ga0501033_0028770 | 3300049570 | Bacteria | 4175 |
| 493 | Ga0501033_0037585 | 3300049570 | Bacteria | 3623 |
| 494 | Ga0501034_0000700 | 3300049571 | Bacteria | 50894 |
| 495 | Ga0501034_0000987 | 3300049571 | Bacteria | 40823 |
| 496 | Ga0501034_0008931 | 3300049571 | Bacteria | 10535 |
| 497 | Ga0501034_0020937 | 3300049571 | Bacteria | 6676 |
| 498 | Ga0501034_0037777 | 3300049571 | Bacteria | 4890 |
| 499 | Ga0501034_0041324 | 3300049571 | Bacteria | 4665 |
| 500 | Ga0501034_0044577 | 3300049571 | Bacteria | 4484 |
| 501 | Ga0501034_0052775 | 3300049571 | Bacteria | 4095 |
| 502 | Ga0501034_0168769 | 3300049571 | Bacteria | 2156 |
| 503 | Ga0501036_0001560 | 3300049572 | Bacteria | 17694 |
| 504 | Ga0501036_0010572 | 3300049572 | Bacteria | 7625 |
| 505 | Ga0501036_0011932 | 3300049572 | Bacteria | 7203 |
| 506 | Ga0501036_0014281 | 3300049572 | Bacteria | 6608 |
| 507 | Ga0501036_0018022 | 3300049572 | Bacteria | 5912 |
| 508 | Ga0501036_0018754 | 3300049572 | Bacteria | 5803 |
| 509 | Ga0501036_0030414 | 3300049572 | Bacteria | 4561 |
| 510 | Ga0501036_0034631 | 3300049572 | Bacteria | 4272 |
| 511 | Ga0501036_0045495 | 3300049572 | Bacteria | 3718 |
| 512 | Ga0501037_0001087 | 3300049573 | Bacteria | 20162 |
| 513 | Ga0501037_0023459 | 3300049573 | Bacteria | 4562 |
| 514 | Ga0501037_0025618 | 3300049573 | Bacteria | 4357 |
| 515 | Ga0501038_0001242 | 3300049574 | Bacteria | 23113 |
| 516 | Ga0501038_0002500 | 3300049574 | Bacteria | 17111 |
| 517 | Ga0501038_0025955 | 3300049574 | Bacteria | 5218 |
| 518 | Ga0501038_0073141 | 3300049574 | Bacteria | 2903 |
| 519 | Ga0501039_0004281 | 3300049575 | Bacteria | 10759 |
| 520 | Ga0501039_0014667 | 3300049575 | Bacteria | 5995 |
| 521 | Ga0501039_0021995 | 3300049575 | Bacteria | 4893 |
| 522 | Ga0501039_0023058 | 3300049575 | Bacteria | 4775 |
| 523 | Ga0501039_0025256 | 3300049575 | Bacteria | 4564 |
| 524 | Ga0501039_0097693 | 3300049575 | Bacteria | 2290 |
| 525 | Ga0501040_0001045 | 3300049576 | Bacteria | 17510 |
| 526 | Ga0501041_0000883 | 3300049577 | Bacteria | 16205 |
| 527 | Ga0501042_0002602 | 3300049578 | Bacteria | 11093 |
| 528 | Ga0501042_0007307 | 3300049578 | Bacteria | 7228 |
| 529 | Ga0501042_0037201 | 3300049578 | Bacteria | 3454 |
| 530 | Ga0501043_0000867 | 3300049579 | Bacteria | 26805 |
| 531 | Ga0501043_0005179 | 3300049579 | Bacteria | 10551 |
| 532 | Ga0501043_0035627 | 3300049579 | Bacteria | 3914 |
| 533 | Ga0501043_0035665 | 3300049579 | Bacteria | 3912 |
| 534 | Ga0501043_0050090 | 3300049579 | Bacteria | 3283 |
| 535 | Ga0501043_0060168 | 3300049579 | Bacteria | 2981 |
| 536 | Ga0501043_0189793 | 3300049579 | Bacteria | 1598 |
| 537 | Ga0501046_0000707 | 3300049580 | Bacteria | 32240 |
| 538 | Ga0501046_0006561 | 3300049580 | Bacteria | 10288 |
| 539 | Ga0501046_0038654 | 3300049580 | Bacteria | 3827 |
| 540 | Ga0501047_0000112 | 3300049581 | Bacteria | 98939 |
| 541 | Ga0501047_0000216 | 3300049581 | Bacteria | 69275 |
| 542 | Ga0501047_0000544 | 3300049581 | Bacteria | 40681 |
| 543 | Ga0501047_0003079 | 3300049581 | Bacteria | 15814 |
| 544 | Ga0501047_0011943 | 3300049581 | Bacteria | 8220 |
| 545 | Ga0501047_0023263 | 3300049581 | Bacteria | 5950 |
| 546 | Ga0501047_0060538 | 3300049581 | Bacteria | 3653 |
| 547 | Ga0501047_0063225 | 3300049581 | Bacteria | 3570 |
| 548 | Ga0501047_0065503 | 3300049581 | Bacteria | 3502 |
| 549 | Ga0501047_0145819 | 3300049581 | Bacteria | 2244 |
| 550 | Ga0501048_0002418 | 3300049582 | Bacteria | 14247 |
| 551 | Ga0501048_0003490 | 3300049582 | Bacteria | 11951 |
| 552 | Ga0501048_0005883 | 3300049582 | Bacteria | 9335 |
| 553 | Ga0501048_0010821 | 3300049582 | Bacteria | 6802 |
| 554 | Ga0501067_0002973 | 3300049583 | Bacteria | 9353 |
| 555 | Ga0501068_0000652 | 3300049584 | Bacteria | 17789 |
| 556 | Ga0501068_0030095 | 3300049584 | Bacteria | 3218 |
| 557 | Ga0501069_0001987 | 3300049585 | Bacteria | 10227 |
| 558 | Ga0501070_0005364 | 3300049586 | Bacteria | 10933 |
| 559 | Ga0501070_0008447 | 3300049586 | Bacteria | 8696 |
| 560 | Ga0501070_0024422 | 3300049586 | Bacteria | 5071 |
| 561 | Ga0501070_0057881 | 3300049586 | Bacteria | 3213 |
| 562 | Ga0501071_0003645 | 3300049587 | Bacteria | 9658 |
| 563 | Ga0501071_0008460 | 3300049587 | Bacteria | 6805 |
| 564 | Ga0501072_0008562 | 3300049588 | Bacteria | 7758 |
| 565 | Ga0501072_0013685 | 3300049588 | Bacteria | 6212 |
| 566 | Ga0501073_0003012 | 3300049589 | Bacteria | 12622 |
| 567 | Ga0501073_0014251 | 3300049589 | Bacteria | 5772 |
| 568 | Ga0501073_0095406 | 3300049589 | Bacteria | 2065 |
| 569 | Ga0501074_0002273 | 3300049590 | Bacteria | 13362 |
| 570 | Ga0501074_0016485 | 3300049590 | Bacteria | 5363 |
| 571 | Ga0501074_0029004 | 3300049590 | Bacteria | 4009 |
| 572 | Ga0501074_0052805 | 3300049590 | Bacteria | 2933 |
| 573 | Ga0501076_0207672 | 3300049592 | Bacteria | 1600 |
| 574 | Ga0501077_0017485 | 3300049593 | Bacteria | 4527 |
| 575 | Ga0501079_0002562 | 3300049741 | Bacteria | 13200 |
| 576 | Ga0501079_0056015 | 3300049741 | Bacteria | 3042 |
| 577 | Ga0501080_0023738 | 3300049742 | Bacteria | 5682 |
| 578 | Ga0501080_0027729 | 3300049742 | Bacteria | 5266 |
| 579 | Ga0501080_0073993 | 3300049742 | Bacteria | 3169 |
| 580 | Ga0501081_0077702 | 3300049743 | Bacteria | 2320 |
| 581 | Ga0501083_0010392 | 3300049744 | Bacteria | 6553 |
| 582 | Ga0501083_0012707 | 3300049744 | Bacteria | 5890 |
| 583 | Ga0501035_0000870 | 3300049822 | Bacteria | 32141 |
| 584 | Ga0501035_0004451 | 3300049822 | Bacteria | 13296 |
| 585 | Ga0501035_0004984 | 3300049822 | Bacteria | 12582 |
| 586 | Ga0501035_0007027 | 3300049822 | Bacteria | 10518 |
| 587 | Ga0501035_0120484 | 3300049822 | Bacteria | 2294 |
| 588 | Ga0501044_0002317 | 3300049823 | Bacteria | 21701 |
| 589 | Ga0501044_0006618 | 3300049823 | Bacteria | 12782 |
| 590 | Ga0501044_0010095 | 3300049823 | Bacteria | 10259 |
| 591 | Ga0501044_0010614 | 3300049823 | Bacteria | 9992 |
| 592 | Ga0501044_0020341 | 3300049823 | Bacteria | 7085 |
| 593 | Ga0501044_0056404 | 3300049823 | Bacteria | 4033 |
| 594 | Ga0501045_0007837 | 3300049824 | Bacteria | 7430 |
| 595 | Ga0501045_0014319 | 3300049824 | Bacteria | 5619 |
| 596 | Ga0501045_0024013 | 3300049824 | Bacteria | 4376 |
| 597 | nmdc:mga03683_13553_c1 | 3300050489 | Bacteria | 3003 |
| 598 | nmdc:mga03n38_3148_c1 | 3300050490 | Bacteria | 5253 |
| 599 | nmdc:mga03n38_48181_c1 | 3300050490 | Bacteria | 1890 |
| 600 | nmdc:mga00v17_25768_c1 | 3300050491 | Bacteria | 3421 |
| 601 | nmdc:mga00v17_31601_c1 | 3300050491 | Bacteria | 3124 |
| 602 | nmdc:mga00v17_37665_c1 | 3300050491 | Bacteria | 2889 |
| 603 | nmdc:mga00v17_64405_c1 | 3300050491 | Bacteria | 2259 |
| 604 | nmdc:mga0yw44_40379_c1 | 3300050492 | Bacteria | 2772 |
| 605 | nmdc:mga0yw44_4245_c1 | 3300050492 | Bacteria | 6531 |
| 606 | nmdc:mga0yw44_4616_c1 | 3300050492 | Bacteria | 6355 |
| 607 | nmdc:mga0yw44_72200_c1 | 3300050492 | Bacteria | 2145 |
| 608 | nmdc:mga06z11_3386_c1 | 3300050494 | Bacteria | 6166 |
| 609 | nmdc:mga06z11_41662_c1 | 3300050494 | Bacteria | 2299 |
| 610 | nmdc:mga06z11_7320_c1 | 3300050494 | Bacteria | 4535 |
| 611 | nmdc:mga06z11_7458_c1 | 3300050494 | Bacteria | 4501 |
| 612 | nmdc:mga06z11_9099_c1 | 3300050494 | Bacteria | 4173 |
| 613 | nmdc:mga04h51_22456_c1 | 3300050495 | Bacteria | 1909 |
| 614 | nmdc:mga04h51_2262_c1 | 3300050495 | Bacteria | 4538 |
| 615 | nmdc:mga04h51_24566_c1 | 3300050495 | Bacteria | 1847 |
| 616 | nmdc:mga07m45_43203_c1 | 3300050496 | Bacteria | 2199 |
| 617 | nmdc:mga07m45_43272_c1 | 3300050496 | Bacteria | 2525 |
| 618 | nmdc:mga05p37_36587_c1 | 3300050507 | Bacteria | 6021 |
| 619 | nmdc:mga05p37_41527_c1 | 3300050507 | Bacteria | 5647 |
| 620 | nmdc:mga09592_279267_c1 | 3300050508 | Bacteria | 1449 |
| 621 | nmdc:mga0qj67_7306_c1 | 3300050509 | Bacteria | 8167 |
| 622 | nmdc:mga06r32_35629_c1 | 3300050510 | Bacteria | 4696 |
| 623 | nmdc:mga06r32_43895_c1 | 3300050510 | Bacteria | 4255 |
| 624 | nmdc:mga08y16_13478_c1 | 3300050511 | Bacteria | 8012 |
| 625 | nmdc:mga08y16_26727_c1 | 3300050511 | Bacteria | 6082 |
| 626 | nmdc:mga0n895_1812_c1 | 3300050512 | Bacteria | 16262 |
| 627 | nmdc:mga0n895_24204_c1 | 3300050512 | Bacteria | 5721 |
| 628 | nmdc:mga0a205_120_c1 | 3300050515 | Bacteria | 47367 |
| 629 | nmdc:mga0a205_5052_c1 | 3300050515 | Bacteria | 11878 |
| 630 | Ga0495601_0007351 | 3300053077 | Bacteria | 6458 |
| 631 | Ga0495601_0019263 | 3300053077 | Bacteria | 4161 |
| 632 | Ga0495612_0000768 | 3300053078 | Bacteria | 13075 |
| 633 | Ga0495619_0031757 | 3300053085 | Bacteria | 3423 |
| 634 | Ga0495619_0062140 | 3300053085 | Bacteria | 2486 |
| 635 | Ga0500578_0008090 | 3300053086 | Bacteria | 6887 |
| 636 | Ga0500644_0000148 | 3300053088 | Bacteria | 43939 |
| 637 | Ga0500640_000199 | 3300053095 | Bacteria | 12879 |
| 638 | Ga0500650_0081793 | 3300053098 | Bacteria | 1511 |
| 639 | Ga0500556_0000485 | 3300053104 | Bacteria | 27724 |
| 640 | Ga0500556_0009470 | 3300053104 | Bacteria | 2832 |
| 641 | Ga0500558_026568 | 3300053106 | Bacteria | 2460 |
| 642 | Ga0500569_007352 | 3300053109 | Bacteria | 2466 |
| 643 | Ga0500652_000612 | 3300053131 | Bacteria | 12304 |
| 644 | Ga0500652_001049 | 3300053131 | Bacteria | 8969 |
| 645 | Ga0500658_0003635 | 3300053134 | Bacteria | 5819 |
| 646 | Ga0500600_0003949 | 3300053149 | Bacteria | 8643 |
| 647 | Ga0500616_0000466 | 3300053153 | Bacteria | 52609 |
| 648 | Ga0500616_0001931 | 3300053153 | Bacteria | 18503 |
| 649 | Ga0500616_0014693 | 3300053153 | Bacteria | 4491 |
| 650 | Ga0500633_0016697 | 3300053160 | Bacteria | 2136 |
| 651 | Ga0500634_0027336 | 3300053161 | Bacteria | 3108 |
| 652 | Ga0500656_000440 | 3300053732 | Bacteria | 3038 |
| 653 | Ga0501084_0001814 | 3300054114 | Bacteria | 17044 |
| 654 | Ga0501084_0037634 | 3300054114 | Bacteria | 4043 |
| 655 | Ga0501084_0159640 | 3300054114 | Bacteria | 1902 |
| 656 | Ga0501082_0009754 | 3300060353 | Bacteria | 8272 |
| 657 | Ga0501082_0062671 | 3300060353 | Bacteria | 3201 |
| 658 | Ga0466962_0000729 | 3300061719 | Bacteria | 14725 |
| 659 | Ga0466962_0005792 | 3300061719 | Bacteria | 5936 |
| 660 | Ga0466962_0024363 | 3300061719 | Bacteria | 2907 |
| 661 | Ga0530510_0095798 | 3300061734 | Bacteria | 2168 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2738543028 | 2739335203 | 380 |
| 2 | 3300042438 | Ga0439459_0012755 | Ga0439459_0012755_301_1461 | 386 |
| 3 | 3300046459 | Ga0495629_0018751 | Ga0495629_0018751_16_1182 | 388 |
| 4 | 3300046674 | Ga0495588_0130716 | Ga0495588_0130716_28_1194 | 388 |
| 5 | 3300047444 | Ga0495675_0015922 | Ga0495675_0015922_10_1176 | 388 |
| 6 | 3300028556 | Ga0265337_1016808 | Ga0265337_10168082 | 390 |
| 7 | 3300044706 | Ga0466964_0026522 | Ga0466964_0026522_1068_2252 | 391 |
| 8 | 3300048907 | Ga0496104_0145031 | Ga0496104_0145031_1080_2255 | 391 |
| 9 | 3300048912 | Ga0496109_0241200 | Ga0496109_0241200_25_1200 | 391 |
| 10 | 3300049586 | Ga0501070_0057881 | Ga0501070_0057881_2017_3192 | 391 |
| 11 | 3300035398 | Ga0316574_0058133 | Ga0316574_0058133_167_1405 | 394 |
| 12 | 3300031691 | Ga0316579_10015603 | Ga0316579_100156032 | 396 |
| 13 | 3300031733 | Ga0316577_10011424 | Ga0316577_100114243 | 396 |
| 14 | 3300036712 | Ga0316584_0055895 | Ga0316584_0055895_1458_2732 | 396 |
| 15 | 3300028558 | Ga0265326_10000388 | Ga0265326_100003888 | 397 |
| 16 | 3300002075 | JGI24738J21930_10007021 | JGI24738J21930_100070213 | 398 |
| 17 | 3300048905 | Ga0496102_0041912 | Ga0496102_0041912_2919_4124 | 401 |
| 18 | 3300044683 | Ga0466965_0003169 | Ga0466965_0003169_5214_6542 | 408 |
| 19 | 3300053085 | Ga0495619_0062140 | Ga0495619_0062140_824_2137 | 408 |
| 20 | 3300050508 | nmdc:mga09592_279267_c1 | nmdc:mga09592_279267_c1_24_1274 | 416 |
| 21 | 3300042005 | Ga0439448_0030378 | Ga0439448_0030378_53_1447 | 418 |
| 22 | 3300005548 | Ga0070665_100131433 | Ga0070665_1001314333 | 419 |
| 23 | 3300005563 | Ga0068855_100007296 | Ga0068855_1000072967 | 419 |
| 24 | 3300009093 | Ga0105240_10097021 | Ga0105240_100970213 | 419 |
| 25 | 3300009174 | Ga0105241_10003698 | Ga0105241_100036989 | 419 |
| 26 | 3300009545 | Ga0105237_10228148 | Ga0105237_102281483 | 419 |
| 27 | 3300009551 | Ga0105238_10041156 | Ga0105238_100411563 | 419 |
| 28 | 3300025904 | Ga0207647_10029337 | Ga0207647_100293373 | 419 |
| 29 | 3300025911 | Ga0207654_10013103 | Ga0207654_100131033 | 419 |
| 30 | 3300025913 | Ga0207695_10013520 | Ga0207695_100135205 | 419 |
| 31 | 3300025914 | Ga0207671_10000580 | Ga0207671_1000058027 | 419 |
| 32 | 3300025924 | Ga0207694_10037053 | Ga0207694_100370532 | 419 |
| 33 | 3300025949 | Ga0207667_10258671 | Ga0207667_102586713 | 419 |
| 34 | 3300028379 | Ga0268266_10148357 | Ga0268266_101483571 | 419 |
| 35 | 3300046529 | Ga0495652_0084400 | Ga0495652_0084400_179_1447 | 420 |
| 36 | 3300053077 | Ga0495601_0007351 | Ga0495601_0007351_471_1739 | 420 |
| 37 | 3300046462 | Ga0495651_0000129 | Ga0495651_0000129_28627_29916 | 422 |
| 38 | 3300046516 | Ga0495628_0043231 | Ga0495628_0043231_2244_3533 | 422 |
| 39 | 3300046529 | Ga0495652_0002317 | Ga0495652_0002317_313_1602 | 422 |
| 40 | iso_pu_bacteria | 2902792274 | 2902798017 | 425 |
| 41 | 3300044693 | Ga0466961_0057787 | Ga0466961_0057787_772_2100 | 427 |
| 42 | iso_pu_bacteria | 2902810491 | 2902815763 | 427 |
| 43 | 3300048922 | Ga0496119_0102432 | Ga0496119_0102432_89_1405 | 428 |
| 44 | 3300044683 | Ga0466965_0005755 | Ga0466965_0005755_952_2280 | 429 |
| 45 | 3300044684 | Ga0466966_0002225 | Ga0466966_0002225_9489_10817 | 429 |
| 46 | 3300044693 | Ga0466961_0045720 | Ga0466961_0045720_239_1567 | 429 |
| 47 | 3300044694 | Ga0466963_0006392 | Ga0466963_0006392_1529_2857 | 429 |
| 48 | 3300044765 | Ga0466970_0009711 | Ga0466970_0009711_36_1364 | 429 |
| 49 | 3300045049 | Ga0466959_0032027 | Ga0466959_0032027_34_1362 | 429 |
| 50 | 3300061719 | Ga0466962_0000729 | Ga0466962_0000729_223_1551 | 429 |
| 51 | 3300003792 | Ga0055540_1000539 | Ga0055540_10005397 | 430 |
| 52 | 3300006051 | Ga0075364_10031721 | Ga0075364_100317213 | 430 |
| 53 | 3300041410 | Ga0439461_0000895 | Ga0439461_0000895_2039_3340 | 430 |
| 54 | 3300041411 | Ga0439466_0026182 | Ga0439466_0026182_475_1776 | 430 |
| 55 | 3300048903 | Ga0496100_0001299 | Ga0496100_0001299_9026_10336 | 430 |
| 56 | 3300048904 | Ga0496101_0000108 | Ga0496101_0000108_27102_28412 | 430 |
| 57 | 3300048905 | Ga0496102_0000005 | Ga0496102_0000005_100140_101450 | 430 |
| 58 | 3300048906 | Ga0496103_0000002 | Ga0496103_0000002_380518_381828 | 430 |
| 59 | 3300048909 | Ga0496106_0001149 | Ga0496106_0001149_17867_19177 | 430 |
| 60 | 3300048919 | Ga0496116_0000034 | Ga0496116_0000034_28006_29316 | 430 |
| 61 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_972654_973964 | 430 |
| 62 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_972657_973967 | 430 |
| 63 | 3300048922 | Ga0496119_0000669 | Ga0496119_0000669_17579_18889 | 430 |
| 64 | 3300048923 | Ga0496120_0000594 | Ga0496120_0000594_26375_27685 | 430 |
| 65 | 3300048924 | Ga0496121_0003113 | Ga0496121_0003113_16011_17321 | 430 |
| 66 | 3300048929 | Ga0496126_0000178 | Ga0496126_0000178_57801_59111 | 430 |
| 67 | 3300053104 | Ga0500556_0009470 | Ga0500556_0009470_450_1763 | 430 |
| 68 | 3300005985 | Ga0081539_10008707 | Ga0081539_100087074 | 431 |
| 69 | 3300003559 | Ga0007427J51700_109281 | Ga0007427J51700_1092811 | 432 |
| 70 | 3300005337 | Ga0070682_100013171 | Ga0070682_1000131713 | 432 |
| 71 | 3300044684 | Ga0466966_0002097 | Ga0466966_0002097_5515_6816 | 432 |
| 72 | 3300044693 | Ga0466961_0006972 | Ga0466961_0006972_2639_3940 | 432 |
| 73 | 3300044694 | Ga0466963_0029351 | Ga0466963_0029351_1692_2993 | 432 |
| 74 | 3300044842 | Ga0466957_0001983 | Ga0466957_0001983_4234_5535 | 432 |
| 75 | 3300045049 | Ga0466959_0043923 | Ga0466959_0043923_1709_3010 | 432 |
| 76 | 3300045836 | Ga0466958_0009827 | Ga0466958_0009827_2316_3617 | 432 |
| 77 | 3300046515 | Ga0495620_0023194 | Ga0495620_0023194_1285_2619 | 432 |
| 78 | 3300046794 | Ga0495589_0029739 | Ga0495589_0029739_803_2137 | 432 |
| 79 | 3300049581 | Ga0501047_0011943 | Ga0501047_0011943_5670_6983 | 432 |
| 80 | 3300053131 | Ga0500652_001049 | Ga0500652_001049_4041_5348 | 432 |
| 81 | iso_pu_bacteria | 2799112218 | 2799186696 | 432 |
| 82 | 3300049569 | Ga0501032_0007044 | Ga0501032_0007044_6708_8018 | 433 |
| 83 | 3300049570 | Ga0501033_0037585 | Ga0501033_0037585_1551_2861 | 433 |
| 84 | 3300049571 | Ga0501034_0037777 | Ga0501034_0037777_2040_3350 | 433 |
| 85 | 3300049578 | Ga0501042_0037201 | Ga0501042_0037201_1159_2469 | 433 |
| 86 | 3300049579 | Ga0501043_0035665 | Ga0501043_0035665_1756_3066 | 433 |
| 87 | 3300049580 | Ga0501046_0038654 | Ga0501046_0038654_1708_3018 | 433 |
| 88 | 3300049581 | Ga0501047_0060538 | Ga0501047_0060538_102_1412 | 433 |
| 89 | 3300049581 | Ga0501047_0063225 | Ga0501047_0063225_2159_3469 | 433 |
| 90 | 3300049582 | Ga0501048_0003490 | Ga0501048_0003490_10220_11530 | 433 |
| 91 | 3300049822 | Ga0501035_0120484 | Ga0501035_0120484_65_1375 | 433 |
| 92 | 3300050489 | nmdc:mga03683_13553_c1 | nmdc:mga03683_13553_c1_111_1424 | 433 |
| 93 | iso_pu_bacteria | 2547132111 | 2547410071 | 433 |
| 94 | iso_pu_bacteria | 2582581313 | 2585308203 | 433 |
| 95 | iso_pu_bacteria | 2616644941 | 2616902033 | 433 |
| 96 | iso_pu_bacteria | 2643221587 | 2643942083 | 433 |
| 97 | iso_pu_bacteria | 2643221647 | 2644261708 | 433 |
| 98 | iso_pu_bacteria | 2643221670 | 2644389742 | 433 |
| 99 | iso_pu_bacteria | 2643221677 | 2644429166 | 433 |
| 100 | iso_pu_bacteria | 2731639228 | 2731908873 | 433 |
| 101 | iso_pu_bacteria | 2784132148 | 2784589622 | 433 |
| 102 | iso_pu_bacteria | 2786546132 | 2786671849 | 433 |
| 103 | iso_pu_bacteria | 2808606448 | 2809233302 | 433 |
| 104 | iso_pu_bacteria | 2811994917 | 2812479541 | 433 |
| 105 | iso_pu_bacteria | 2852635781 | 2852640440 | 433 |
| 106 | iso_pu_bacteria | 2862574272 | 2862578285 | 433 |
| 107 | iso_pu_bacteria | 2867428634 | 2867434718 | 433 |
| 108 | iso_pu_bacteria | 2877676314 | 2877679922 | 433 |
| 109 | iso_pu_bacteria | 2912757875 | 2912762035 | 433 |
| 110 | iso_pu_bacteria | 2918501144 | 2918505716 | 433 |
| 111 | iso_pu_bacteria | 2919468124 | 2919475437 | 433 |
| 112 | iso_pu_bacteria | 2954002825 | 2954003025 | 433 |
| 113 | iso_pu_bacteria | 2954380949 | 2954384877 | 433 |
| 114 | iso_pu_bacteria | 2954673503 | 2954678126 | 433 |
| 115 | iso_pu_bacteria | 2954682443 | 2954686032 | 433 |
| 116 | iso_pu_bacteria | 2954691527 | 2954695690 | 433 |
| 117 | iso_pu_bacteria | 2954701450 | 2954710884 | 433 |
| 118 | iso_pu_bacteria | 2954711539 | 2954715106 | 433 |
| 119 | iso_pu_bacteria | 2954721474 | 2954725048 | 433 |
| 120 | iso_pu_bacteria | 2954731030 | 2954736770 | 433 |
| 121 | iso_pu_bacteria | 2954740390 | 2954743981 | 433 |
| 122 | iso_pu_bacteria | 2954749733 | 2954755617 | 433 |
| 123 | iso_pu_bacteria | 2954759201 | 2954762921 | 433 |
| 124 | iso_pu_bacteria | 2990059506 | 2990062198 | 433 |
| 125 | iso_pu_bacteria | 2997451912 | 2997458149 | 433 |
| 126 | iso_pu_bacteria | 3006393351 | 3006397705 | 433 |
| 127 | iso_pu_bacteria | 8023623736 | 8023626417 | 433 |
| 128 | iso_pu_bacteria | 8025530807 | 8025534838 | 433 |
| 129 | 3300028786 | Ga0307517_10006298 | Ga0307517_1000629814 | 434 |
| 130 | 3300028794 | Ga0307515_10001177 | Ga0307515_1000117734 | 434 |
| 131 | 3300031649 | Ga0307514_10037111 | Ga0307514_100371113 | 434 |
| 132 | 3300044765 | Ga0466970_0034286 | Ga0466970_0034286_896_2206 | 434 |
| 133 | 3300046660 | Ga0495625_0005807 | Ga0495625_0005807_8390_9727 | 434 |
| 134 | 3300046674 | Ga0495588_0002549 | Ga0495588_0002549_3081_4418 | 434 |
| 135 | 3300046679 | Ga0495623_0066863 | Ga0495623_0066863_500_1822 | 434 |
| 136 | 3300046692 | Ga0495671_0027068 | Ga0495671_0027068_209_1546 | 434 |
| 137 | 3300047470 | Ga0495681_0000590 | Ga0495681_0000590_4541_5878 | 434 |
| 138 | 3300048089 | Ga0495614_0002125 | Ga0495614_0002125_1419_2756 | 434 |
| 139 | 3300049569 | Ga0501032_0082971 | Ga0501032_0082971_273_1613 | 434 |
| 140 | 3300049571 | Ga0501034_0008931 | Ga0501034_0008931_573_1913 | 434 |
| 141 | 3300049574 | Ga0501038_0002500 | Ga0501038_0002500_11547_12887 | 434 |
| 142 | 3300049581 | Ga0501047_0003079 | Ga0501047_0003079_11608_12948 | 434 |
| 143 | 3300049822 | Ga0501035_0004984 | Ga0501035_0004984_10742_12082 | 434 |
| 144 | 3300053098 | Ga0500650_0081793 | Ga0500650_0081793_106_1443 | 434 |
| 145 | iso_pu_bacteria | 2784746768 | 2785370666 | 434 |
| 146 | iso_pu_bacteria | 2947224130 | 2947227892 | 434 |
| 147 | 3300005937 | Ga0081455_10019330 | Ga0081455_100193303 | 435 |
| 148 | 3300005985 | Ga0081539_10015008 | Ga0081539_100150081 | 435 |
| 149 | 3300031456 | Ga0307513_10016493 | Ga0307513_100164938 | 435 |
| 150 | 3300044684 | Ga0466966_0105399 | Ga0466966_0105399_251_1594 | 435 |
| 151 | 3300046460 | Ga0495638_0070088 | Ga0495638_0070088_658_2013 | 435 |
| 152 | 3300046462 | Ga0495651_0002743 | Ga0495651_0002743_10987_12357 | 435 |
| 153 | 3300046663 | Ga0495635_0004355 | Ga0495635_0004355_248_1618 | 435 |
| 154 | 3300049571 | Ga0501034_0000700 | Ga0501034_0000700_8055_9386 | 435 |
| 155 | 3300049572 | Ga0501036_0001560 | Ga0501036_0001560_3193_4524 | 435 |
| 156 | 3300049572 | Ga0501036_0011932 | Ga0501036_0011932_4920_6248 | 435 |
| 157 | 3300049575 | Ga0501039_0004281 | Ga0501039_0004281_5583_6914 | 435 |
| 158 | 3300049586 | Ga0501070_0005364 | Ga0501070_0005364_1785_3116 | 435 |
| 159 | 3300049822 | Ga0501035_0004451 | Ga0501035_0004451_9066_10397 | 435 |
| 160 | 3300049823 | Ga0501044_0006618 | Ga0501044_0006618_8582_9910 | 435 |
| 161 | 3300053153 | Ga0500616_0000466 | Ga0500616_0000466_25902_27257 | 435 |
| 162 | 3300053153 | Ga0500616_0001931 | Ga0500616_0001931_2695_4050 | 435 |
| 163 | iso_pu_bacteria | 2643221548 | 2643764865 | 435 |
| 164 | iso_pu_bacteria | 2643221682 | 2644461295 | 435 |
| 165 | iso_pu_bacteria | 2738541264 | 2738667082 | 435 |
| 166 | iso_pu_bacteria | 2738541356 | 2739145926 | 435 |
| 167 | iso_pu_bacteria | 2818991463 | 2819695316 | 435 |
| 168 | iso_pu_bacteria | 2966598605 | 2966601550 | 435 |
| 169 | iso_pu_bacteria | 3006486233 | 3006492625 | 435 |
| 170 | 3300001989 | JGI24739J22299_10006893 | JGI24739J22299_100068934 | 436 |
| 171 | 3300005563 | Ga0068855_100206484 | Ga0068855_1002064842 | 436 |
| 172 | 3300005937 | Ga0081455_10009867 | Ga0081455_100098674 | 436 |
| 173 | 3300006042 | Ga0075368_10005635 | Ga0075368_100056354 | 436 |
| 174 | 3300006178 | Ga0075367_10027504 | Ga0075367_100275042 | 436 |
| 175 | 3300006948 | Ga0099826_10055940 | Ga0099826_100559402 | 436 |
| 176 | 3300009036 | Ga0105244_10053032 | Ga0105244_100530322 | 436 |
| 177 | 3300011119 | Ga0105246_10029411 | Ga0105246_100294112 | 436 |
| 178 | 3300013105 | Ga0157369_10189324 | Ga0157369_101893242 | 436 |
| 179 | 3300013307 | Ga0157372_10145291 | Ga0157372_101452913 | 436 |
| 180 | 3300025904 | Ga0207647_10009432 | Ga0207647_100094325 | 436 |
| 181 | 3300030522 | Ga0307512_10005436 | Ga0307512_100054366 | 436 |
| 182 | 3300031456 | Ga0307513_10023232 | Ga0307513_100232324 | 436 |
| 183 | 3300031616 | Ga0307508_10014629 | Ga0307508_100146295 | 436 |
| 184 | 3300031616 | Ga0307508_10064626 | Ga0307508_100646262 | 436 |
| 185 | 3300031730 | Ga0307516_10010111 | Ga0307516_100101112 | 436 |
| 186 | 3300042005 | Ga0439448_0030485 | Ga0439448_0030485_200_1522 | 436 |
| 187 | 3300042014 | Ga0439457_005570 | Ga0439457_005570_914_2236 | 436 |
| 188 | 3300042137 | Ga0450902_005362 | Ga0450902_005362_399_1739 | 436 |
| 189 | 3300042138 | Ga0450903_000042 | Ga0450903_000042_21396_22718 | 436 |
| 190 | 3300042157 | Ga0439458_0001348 | Ga0439458_0001348_110_1432 | 436 |
| 191 | 3300044656 | Ga0466969_0004397 | Ga0466969_0004397_3173_4504 | 436 |
| 192 | 3300044684 | Ga0466966_0005466 | Ga0466966_0005466_3526_4857 | 436 |
| 193 | 3300044684 | Ga0466966_0006467 | Ga0466966_0006467_5545_6870 | 436 |
| 194 | 3300044693 | Ga0466961_0010029 | Ga0466961_0010029_3225_4556 | 436 |
| 195 | 3300044719 | Ga0466971_0006943 | Ga0466971_0006943_2696_4027 | 436 |
| 196 | 3300045049 | Ga0466959_0026000 | Ga0466959_0026000_442_1773 | 436 |
| 197 | 3300045049 | Ga0466959_0042996 | Ga0466959_0042996_878_2203 | 436 |
| 198 | 3300046455 | Ga0495603_0084999 | Ga0495603_0084999_31_1353 | 436 |
| 199 | 3300046455 | Ga0495603_0085586 | Ga0495603_0085586_31_1353 | 436 |
| 200 | 3300046459 | Ga0495629_0004039 | Ga0495629_0004039_4796_6118 | 436 |
| 201 | 3300046459 | Ga0495629_0062864 | Ga0495629_0062864_929_2251 | 436 |
| 202 | 3300046462 | Ga0495651_0002270 | Ga0495651_0002270_4984_6306 | 436 |
| 203 | 3300046476 | Ga0495662_0002591 | Ga0495662_0002591_6430_7752 | 436 |
| 204 | 3300046477 | Ga0495664_0011037 | Ga0495664_0011037_2352_3674 | 436 |
| 205 | 3300046499 | Ga0495594_0000534 | Ga0495594_0000534_7700_9022 | 436 |
| 206 | 3300046516 | Ga0495628_0048477 | Ga0495628_0048477_1631_2953 | 436 |
| 207 | 3300046522 | Ga0495643_0079387 | Ga0495643_0079387_376_1698 | 436 |
| 208 | 3300046529 | Ga0495652_0038084 | Ga0495652_0038084_863_2185 | 436 |
| 209 | 3300046536 | Ga0495587_0003288 | Ga0495587_0003288_2753_4075 | 436 |
| 210 | 3300046642 | Ga0495634_0012335 | Ga0495634_0012335_2075_3397 | 436 |
| 211 | 3300046648 | Ga0495611_0028558 | Ga0495611_0028558_324_1646 | 436 |
| 212 | 3300046663 | Ga0495635_0016061 | Ga0495635_0016061_1407_2729 | 436 |
| 213 | 3300046675 | Ga0495657_0003629 | Ga0495657_0003629_9805_11127 | 436 |
| 214 | 3300046680 | Ga0495646_0000855 | Ga0495646_0000855_6062_7384 | 436 |
| 215 | 3300047315 | Ga0495581_0008614 | Ga0495581_0008614_1285_2607 | 436 |
| 216 | 3300047317 | Ga0495604_0010118 | Ga0495604_0010118_3938_5260 | 436 |
| 217 | 3300047318 | Ga0495636_0034595 | Ga0495636_0034595_745_2067 | 436 |
| 218 | 3300047321 | Ga0495676_0026725 | Ga0495676_0026725_1353_2675 | 436 |
| 219 | 3300047321 | Ga0495676_0096093 | Ga0495676_0096093_554_1876 | 436 |
| 220 | 3300047471 | Ga0495684_0055850 | Ga0495684_0055850_1498_2820 | 436 |
| 221 | 3300048088 | Ga0495602_0060791 | Ga0495602_0060791_1838_3160 | 436 |
| 222 | 3300048929 | Ga0496126_0046522 | Ga0496126_0046522_774_2180 | 436 |
| 223 | 3300049568 | Ga0501031_0080746 | Ga0501031_0080746_104_1417 | 436 |
| 224 | 3300049570 | Ga0501033_0003959 | Ga0501033_0003959_2665_3978 | 436 |
| 225 | 3300049571 | Ga0501034_0168769 | Ga0501034_0168769_134_1447 | 436 |
| 226 | 3300049572 | Ga0501036_0014281 | Ga0501036_0014281_1462_2775 | 436 |
| 227 | 3300049573 | Ga0501037_0025618 | Ga0501037_0025618_1904_3217 | 436 |
| 228 | 3300049574 | Ga0501038_0073141 | Ga0501038_0073141_1449_2762 | 436 |
| 229 | 3300049575 | Ga0501039_0014667 | Ga0501039_0014667_1350_2663 | 436 |
| 230 | 3300049579 | Ga0501043_0005179 | Ga0501043_0005179_476_1789 | 436 |
| 231 | 3300049579 | Ga0501043_0060168 | Ga0501043_0060168_1404_2717 | 436 |
| 232 | 3300049580 | Ga0501046_0000707 | Ga0501046_0000707_4993_6306 | 436 |
| 233 | 3300049582 | Ga0501048_0005883 | Ga0501048_0005883_6906_8219 | 436 |
| 234 | 3300049586 | Ga0501070_0008447 | Ga0501070_0008447_6603_7916 | 436 |
| 235 | 3300049590 | Ga0501074_0052805 | Ga0501074_0052805_948_2261 | 436 |
| 236 | 3300049742 | Ga0501080_0073993 | Ga0501080_0073993_1127_2440 | 436 |
| 237 | 3300050494 | nmdc:mga06z11_9099_c1 | nmdc:mga06z11_9099_c1_2268_3599 | 436 |
| 238 | 3300053095 | Ga0500640_000199 | Ga0500640_000199_8691_10013 | 436 |
| 239 | 3300054114 | Ga0501084_0159640 | Ga0501084_0159640_282_1595 | 436 |
| 240 | 3300061719 | Ga0466962_0005792 | Ga0466962_0005792_3395_4726 | 436 |
| 241 | iso_pu_bacteria | 2784746763 | 2785341981 | 436 |
| 242 | iso_pu_bacteria | 2791355406 | 2793980314 | 436 |
| 243 | iso_pu_bacteria | 2862178590 | 2862181678 | 436 |
| 244 | iso_pu_bacteria | 2862507626 | 2862515587 | 436 |
| 245 | iso_pu_bacteria | 2935390628 | 2935394861 | 436 |
| 246 | iso_pu_bacteria | 2946072368 | 2946076993 | 436 |
| 247 | iso_pu_bacteria | 2990044586 | 2990045355 | 436 |
| 248 | iso_pu_bacteria | 2997600082 | 2997606371 | 436 |
| 249 | iso_pu_bacteria | 3006321560 | 3006326293 | 436 |
| 250 | iso_pu_bacteria | 8047893842 | 8047897068 | 436 |
| 251 | iso_pu_bacteria | 8048127548 | 8048134688 | 436 |
| 252 | iso_pu_bacteria | 8048356638 | 8048361884 | 436 |
| 253 | iso_pu_bacteria | 8048369669 | 8048374052 | 436 |
| 254 | iso_pu_bacteria | 8048379754 | 8048384174 | 436 |
| 255 | iso_pu_bacteria | 8048406513 | 8048410727 | 436 |
| 256 | 3300009553 | Ga0105249_10190960 | Ga0105249_101909602 | 437 |
| 257 | 3300028786 | Ga0307517_10002400 | Ga0307517_100024004 | 437 |
| 258 | 3300031616 | Ga0307508_10005680 | Ga0307508_100056809 | 437 |
| 259 | 3300038443 | Ga0395901_0008656 | Ga0395901_0008656_2724_4043 | 437 |
| 260 | 3300044683 | Ga0466965_0056712 | Ga0466965_0056712_286_1611 | 437 |
| 261 | 3300046460 | Ga0495638_0026034 | Ga0495638_0026034_1955_3289 | 437 |
| 262 | 3300046462 | Ga0495651_0064795 | Ga0495651_0064795_31_1374 | 437 |
| 263 | 3300046463 | Ga0495653_0052219 | Ga0495653_0052219_1186_2529 | 437 |
| 264 | 3300046472 | Ga0495580_0070581 | Ga0495580_0070581_553_1896 | 437 |
| 265 | 3300046492 | Ga0495585_0007060 | Ga0495585_0007060_4506_5840 | 437 |
| 266 | 3300046513 | Ga0495616_0033346 | Ga0495616_0033346_342_1730 | 437 |
| 267 | 3300046519 | Ga0495632_0013008 | Ga0495632_0013008_3324_4658 | 437 |
| 268 | 3300046522 | Ga0495643_0003319 | Ga0495643_0003319_2647_3981 | 437 |
| 269 | 3300046522 | Ga0495643_0011979 | Ga0495643_0011979_3765_5108 | 437 |
| 270 | 3300046529 | Ga0495652_0006834 | Ga0495652_0006834_7833_9176 | 437 |
| 271 | 3300046533 | Ga0495640_0017126 | Ga0495640_0017126_2857_4200 | 437 |
| 272 | 3300046533 | Ga0495640_0018021 | Ga0495640_0018021_2351_3682 | 437 |
| 273 | 3300046558 | Ga0495633_0048814 | Ga0495633_0048814_85_1419 | 437 |
| 274 | 3300046663 | Ga0495635_0005875 | Ga0495635_0005875_1313_2656 | 437 |
| 275 | 3300046680 | Ga0495646_0107181 | Ga0495646_0107181_86_1429 | 437 |
| 276 | 3300046689 | Ga0495613_0023073 | Ga0495613_0023073_324_1667 | 437 |
| 277 | 3300046691 | Ga0495670_0006366 | Ga0495670_0006366_3920_5254 | 437 |
| 278 | 3300046809 | Ga0495600_0075430 | Ga0495600_0075430_363_1706 | 437 |
| 279 | 3300046810 | Ga0495660_0007437 | Ga0495660_0007437_5024_6358 | 437 |
| 280 | 3300047315 | Ga0495581_0042500 | Ga0495581_0042500_695_2038 | 437 |
| 281 | 3300047317 | Ga0495604_0116883 | Ga0495604_0116883_158_1489 | 437 |
| 282 | 3300047447 | Ga0495685_000486 | Ga0495685_000486_7195_8529 | 437 |
| 283 | 3300047470 | Ga0495681_0004760 | Ga0495681_0004760_4564_5898 | 437 |
| 284 | 3300047472 | Ga0495686_0050971 | Ga0495686_0050971_266_1600 | 437 |
| 285 | 3300049823 | Ga0501044_0010614 | Ga0501044_0010614_5788_7173 | 437 |
| 286 | 3300053086 | Ga0500578_0008090 | Ga0500578_0008090_4927_6261 | 437 |
| 287 | 3300053106 | Ga0500558_026568 | Ga0500558_026568_645_1979 | 437 |
| 288 | 3300053109 | Ga0500569_007352 | Ga0500569_007352_535_1869 | 437 |
| 289 | 3300053131 | Ga0500652_000612 | Ga0500652_000612_3270_4604 | 437 |
| 290 | 3300053134 | Ga0500658_0003635 | Ga0500658_0003635_2000_3334 | 437 |
| 291 | 3300053149 | Ga0500600_0003949 | Ga0500600_0003949_5361_6695 | 437 |
| 292 | 3300053153 | Ga0500616_0014693 | Ga0500616_0014693_1900_3234 | 437 |
| 293 | 3300053160 | Ga0500633_0016697 | Ga0500633_0016697_661_1995 | 437 |
| 294 | 3300053161 | Ga0500634_0027336 | Ga0500634_0027336_411_1745 | 437 |
| 295 | 3300053732 | Ga0500656_000440 | Ga0500656_000440_372_1706 | 437 |
| 296 | iso_pu_bacteria | 2554235005 | 2554256889 | 437 |
| 297 | iso_pu_bacteria | 2616644814 | 2616696894 | 437 |
| 298 | iso_pu_bacteria | 2884994152 | 2884996516 | 437 |
| 299 | 3300002077 | JGI24744J21845_10012947 | JGI24744J21845_100129471 | 438 |
| 300 | 3300005334 | Ga0068869_100023468 | Ga0068869_1000234683 | 438 |
| 301 | 3300005338 | Ga0068868_100031203 | Ga0068868_1000312033 | 438 |
| 302 | 3300005356 | Ga0070674_100021380 | Ga0070674_1000213803 | 438 |
| 303 | 3300005364 | Ga0070673_100038351 | Ga0070673_1000383513 | 438 |
| 304 | 3300005434 | Ga0070709_10083867 | Ga0070709_100838672 | 438 |
| 305 | 3300005439 | Ga0070711_100002215 | Ga0070711_10000221511 | 438 |
| 306 | 3300005440 | Ga0070705_100090063 | Ga0070705_1000900632 | 438 |
| 307 | 3300005459 | Ga0068867_100164392 | Ga0068867_1001643922 | 438 |
| 308 | 3300005466 | Ga0070685_10033602 | Ga0070685_100336023 | 438 |
| 309 | 3300005546 | Ga0070696_100066758 | Ga0070696_1000667582 | 438 |
| 310 | 3300005548 | Ga0070665_100095388 | Ga0070665_1000953882 | 438 |
| 311 | 3300005549 | Ga0070704_100017559 | Ga0070704_1000175594 | 438 |
| 312 | 3300005578 | Ga0068854_100219211 | Ga0068854_1002192111 | 438 |
| 313 | 3300005617 | Ga0068859_100265156 | Ga0068859_1002651561 | 438 |
| 314 | 3300006173 | Ga0070716_100004805 | Ga0070716_1000048053 | 438 |
| 315 | 3300006175 | Ga0070712_100004010 | Ga0070712_1000040109 | 438 |
| 316 | 3300006931 | Ga0097620_100265168 | Ga0097620_1002651682 | 438 |
| 317 | 3300009551 | Ga0105238_10149694 | Ga0105238_101496942 | 438 |
| 318 | 3300011119 | Ga0105246_10017871 | Ga0105246_100178716 | 438 |
| 319 | 3300013296 | Ga0157374_10133760 | Ga0157374_101337602 | 438 |
| 320 | 3300013297 | Ga0157378_10045454 | Ga0157378_100454543 | 438 |
| 321 | 3300014745 | Ga0157377_10017835 | Ga0157377_100178352 | 438 |
| 322 | 3300014969 | Ga0157376_10150420 | Ga0157376_101504202 | 438 |
| 323 | 3300025321 | Ga0207656_10044570 | Ga0207656_100445702 | 438 |
| 324 | 3300025898 | Ga0207692_10024393 | Ga0207692_100243934 | 438 |
| 325 | 3300025901 | Ga0207688_10000841 | Ga0207688_1000084110 | 438 |
| 326 | 3300025903 | Ga0207680_10108739 | Ga0207680_101087392 | 438 |
| 327 | 3300025915 | Ga0207693_10000602 | Ga0207693_1000060210 | 438 |
| 328 | 3300025931 | Ga0207644_10036679 | Ga0207644_100366793 | 438 |
| 329 | 3300025939 | Ga0207665_10003722 | Ga0207665_100037224 | 438 |
| 330 | 3300025942 | Ga0207689_10004009 | Ga0207689_100040093 | 438 |
| 331 | 3300025960 | Ga0207651_10015401 | Ga0207651_100154013 | 438 |
| 332 | 3300026035 | Ga0207703_10184631 | Ga0207703_101846312 | 438 |
| 333 | 3300026067 | Ga0207678_10007867 | Ga0207678_100078674 | 438 |
| 334 | 3300026089 | Ga0207648_10007779 | Ga0207648_100077794 | 438 |
| 335 | 3300026095 | Ga0207676_10057652 | Ga0207676_100576522 | 438 |
| 336 | 3300028379 | Ga0268266_10020552 | Ga0268266_100205529 | 438 |
| 337 | 3300031251 | Ga0265327_10000630 | Ga0265327_1000063024 | 438 |
| 338 | 3300046516 | Ga0495628_0017507 | Ga0495628_0017507_3970_5367 | 438 |
| 339 | 3300046529 | Ga0495652_0002119 | Ga0495652_0002119_16803_18197 | 438 |
| 340 | 3300048904 | Ga0496101_0066956 | Ga0496101_0066956_1105_2454 | 438 |
| 341 | 3300048906 | Ga0496103_0056359 | Ga0496103_0056359_1038_2387 | 438 |
| 342 | 3300048909 | Ga0496106_0015048 | Ga0496106_0015048_403_1752 | 438 |
| 343 | 3300048911 | Ga0496108_0001760 | Ga0496108_0001760_3938_5287 | 438 |
| 344 | 3300048916 | Ga0496113_0111951 | Ga0496113_0111951_165_1514 | 438 |
| 345 | 3300048917 | Ga0496114_0010650 | Ga0496114_0010650_3824_5173 | 438 |
| 346 | 3300005983 | Ga0081540_1003156 | Ga0081540_100315612 | 439 |
| 347 | 3300025912 | Ga0207707_10034940 | Ga0207707_100349403 | 439 |
| 348 | 3300028786 | Ga0307517_10119485 | Ga0307517_101194852 | 439 |
| 349 | 3300030521 | Ga0307511_10029836 | Ga0307511_100298364 | 439 |
| 350 | 3300046678 | Ga0495599_0012610 | Ga0495599_0012610_1161_2570 | 439 |
| 351 | 3300047444 | Ga0495675_0060804 | Ga0495675_0060804_152_1495 | 439 |
| 352 | 3300049568 | Ga0501031_0003124 | Ga0501031_0003124_8553_9890 | 439 |
| 353 | 3300049568 | Ga0501031_0012776 | Ga0501031_0012776_180_1517 | 439 |
| 354 | 3300049569 | Ga0501032_0000686 | Ga0501032_0000686_14414_15751 | 439 |
| 355 | 3300049569 | Ga0501032_0025746 | Ga0501032_0025746_1779_3116 | 439 |
| 356 | 3300049569 | Ga0501032_0067229 | Ga0501032_0067229_301_1638 | 439 |
| 357 | 3300049570 | Ga0501033_0009007 | Ga0501033_0009007_3173_4510 | 439 |
| 358 | 3300049570 | Ga0501033_0011728 | Ga0501033_0011728_3057_4394 | 439 |
| 359 | 3300049571 | Ga0501034_0000987 | Ga0501034_0000987_36296_37633 | 439 |
| 360 | 3300049571 | Ga0501034_0041324 | Ga0501034_0041324_2865_4202 | 439 |
| 361 | 3300049571 | Ga0501034_0044577 | Ga0501034_0044577_1922_3259 | 439 |
| 362 | 3300049572 | Ga0501036_0018754 | Ga0501036_0018754_3252_4589 | 439 |
| 363 | 3300049572 | Ga0501036_0030414 | Ga0501036_0030414_2474_3811 | 439 |
| 364 | 3300049572 | Ga0501036_0045495 | Ga0501036_0045495_2068_3405 | 439 |
| 365 | 3300049573 | Ga0501037_0001087 | Ga0501037_0001087_8438_9775 | 439 |
| 366 | 3300049573 | Ga0501037_0023459 | Ga0501037_0023459_2120_3457 | 439 |
| 367 | 3300049574 | Ga0501038_0001242 | Ga0501038_0001242_13224_14561 | 439 |
| 368 | 3300049574 | Ga0501038_0025955 | Ga0501038_0025955_2843_4180 | 439 |
| 369 | 3300049575 | Ga0501039_0021995 | Ga0501039_0021995_598_1935 | 439 |
| 370 | 3300049576 | Ga0501040_0001045 | Ga0501040_0001045_6564_7901 | 439 |
| 371 | 3300049577 | Ga0501041_0000883 | Ga0501041_0000883_14475_15812 | 439 |
| 372 | 3300049578 | Ga0501042_0002602 | Ga0501042_0002602_9114_10451 | 439 |
| 373 | 3300049579 | Ga0501043_0000867 | Ga0501043_0000867_8234_9571 | 439 |
| 374 | 3300049579 | Ga0501043_0035627 | Ga0501043_0035627_2203_3540 | 439 |
| 375 | 3300049579 | Ga0501043_0050090 | Ga0501043_0050090_889_2226 | 439 |
| 376 | 3300049580 | Ga0501046_0006561 | Ga0501046_0006561_8234_9571 | 439 |
| 377 | 3300049581 | Ga0501047_0000216 | Ga0501047_0000216_32442_33779 | 439 |
| 378 | 3300049581 | Ga0501047_0000544 | Ga0501047_0000544_29248_30585 | 439 |
| 379 | 3300049581 | Ga0501047_0023263 | Ga0501047_0023263_2732_4069 | 439 |
| 380 | 3300049581 | Ga0501047_0145819 | Ga0501047_0145819_497_1834 | 439 |
| 381 | 3300049582 | Ga0501048_0002418 | Ga0501048_0002418_2627_3964 | 439 |
| 382 | 3300049584 | Ga0501068_0000652 | Ga0501068_0000652_3983_5320 | 439 |
| 383 | 3300049585 | Ga0501069_0001987 | Ga0501069_0001987_338_1675 | 439 |
| 384 | 3300049587 | Ga0501071_0003645 | Ga0501071_0003645_3984_5321 | 439 |
| 385 | 3300049588 | Ga0501072_0008562 | Ga0501072_0008562_3915_5252 | 439 |
| 386 | 3300049589 | Ga0501073_0014251 | Ga0501073_0014251_2627_3964 | 439 |
| 387 | 3300049590 | Ga0501074_0002273 | Ga0501074_0002273_9647_10984 | 439 |
| 388 | 3300049593 | Ga0501077_0017485 | Ga0501077_0017485_2964_4301 | 439 |
| 389 | 3300049741 | Ga0501079_0002562 | Ga0501079_0002562_8552_9889 | 439 |
| 390 | 3300049742 | Ga0501080_0023738 | Ga0501080_0023738_2474_3811 | 439 |
| 391 | 3300049744 | Ga0501083_0010392 | Ga0501083_0010392_3408_4745 | 439 |
| 392 | 3300049822 | Ga0501035_0000870 | Ga0501035_0000870_16034_17371 | 439 |
| 393 | 3300049822 | Ga0501035_0007027 | Ga0501035_0007027_4045_5382 | 439 |
| 394 | 3300049823 | Ga0501044_0002317 | Ga0501044_0002317_17186_18523 | 439 |
| 395 | 3300049823 | Ga0501044_0010095 | Ga0501044_0010095_5461_6798 | 439 |
| 396 | 3300049823 | Ga0501044_0020341 | Ga0501044_0020341_2308_3645 | 439 |
| 397 | 3300049824 | Ga0501045_0014319 | Ga0501045_0014319_2474_3811 | 439 |
| 398 | 3300054114 | Ga0501084_0001814 | Ga0501084_0001814_2474_3811 | 439 |
| 399 | 3300060353 | Ga0501082_0009754 | Ga0501082_0009754_4544_5881 | 439 |
| 400 | 3300061734 | Ga0530510_0095798 | Ga0530510_0095798_208_1545 | 439 |
| 401 | iso_pu_bacteria | 2643221604 | 2644032045 | 439 |
| 402 | iso_pu_bacteria | 2738541305 | 2738871203 | 439 |
| 403 | iso_pu_bacteria | 2995463766 | 2995468643 | 439 |
| 404 | 3300035398 | Ga0316574_0003441 | Ga0316574_0003441_5071_6459 | 440 |
| 405 | 3300037418 | Ga0395900_0128670 | Ga0395900_0128670_1060_2397 | 440 |
| 406 | 3300044735 | Ga0466968_0010428 | Ga0466968_0010428_922_2247 | 440 |
| 407 | 3300046454 | Ga0495592_0008939 | Ga0495592_0008939_4770_6116 | 440 |
| 408 | 3300046459 | Ga0495629_0004832 | Ga0495629_0004832_6742_8088 | 440 |
| 409 | 3300046462 | Ga0495651_0035079 | Ga0495651_0035079_2455_3801 | 440 |
| 410 | 3300046529 | Ga0495652_0013171 | Ga0495652_0013171_3607_4953 | 440 |
| 411 | 3300046533 | Ga0495640_0012881 | Ga0495640_0012881_2134_3480 | 440 |
| 412 | 3300046557 | Ga0495622_0011920 | Ga0495622_0011920_1348_2685 | 440 |
| 413 | 3300046559 | Ga0495667_0028673 | Ga0495667_0028673_438_1784 | 440 |
| 414 | 3300046642 | Ga0495634_0017379 | Ga0495634_0017379_2441_3787 | 440 |
| 415 | 3300046675 | Ga0495657_0016996 | Ga0495657_0016996_543_1889 | 440 |
| 416 | 3300046679 | Ga0495623_0058203 | Ga0495623_0058203_834_2180 | 440 |
| 417 | 3300046690 | Ga0495624_0007422 | Ga0495624_0007422_3223_4569 | 440 |
| 418 | 3300046809 | Ga0495600_0035679 | Ga0495600_0035679_607_1953 | 440 |
| 419 | 3300047321 | Ga0495676_0008079 | Ga0495676_0008079_2578_3924 | 440 |
| 420 | 3300049569 | Ga0501032_0009613 | Ga0501032_0009613_5518_6870 | 440 |
| 421 | 3300049570 | Ga0501033_0028770 | Ga0501033_0028770_2430_3782 | 440 |
| 422 | 3300049572 | Ga0501036_0034631 | Ga0501036_0034631_491_1843 | 440 |
| 423 | 3300049575 | Ga0501039_0023058 | Ga0501039_0023058_51_1403 | 440 |
| 424 | 3300049579 | Ga0501043_0189793 | Ga0501043_0189793_161_1513 | 440 |
| 425 | 3300049581 | Ga0501047_0065503 | Ga0501047_0065503_2017_3369 | 440 |
| 426 | 3300049823 | Ga0501044_0056404 | Ga0501044_0056404_891_2243 | 440 |
| 427 | 3300053078 | Ga0495612_0000768 | Ga0495612_0000768_5018_6364 | 440 |
| 428 | 3300053088 | Ga0500644_0000148 | Ga0500644_0000148_18771_20093 | 440 |
| 429 | iso_pu_bacteria | 2643221613 | 2644082759 | 440 |
| 430 | iso_pu_bacteria | 2643221617 | 2644100454 | 440 |
| 431 | iso_pu_bacteria | 2643221620 | 2644116862 | 440 |
| 432 | iso_pu_bacteria | 2643221721 | 2644665621 | 440 |
| 433 | iso_pu_bacteria | 2811994874 | 2812334845 | 440 |
| 434 | iso_pu_bacteria | 2868088558 | 2868090615 | 440 |
| 435 | iso_pu_bacteria | 2935890801 | 2935892198 | 440 |
| 436 | iso_pu_bacteria | 2990256926 | 2990260614 | 440 |
| 437 | 3300005445 | Ga0070708_100062048 | Ga0070708_1000620482 | 441 |
| 438 | 3300006028 | Ga0070717_10210444 | Ga0070717_102104441 | 441 |
| 439 | 3300006163 | Ga0070715_10012620 | Ga0070715_100126203 | 441 |
| 440 | 3300025898 | Ga0207692_10001290 | Ga0207692_100012908 | 441 |
| 441 | 3300025905 | Ga0207685_10011398 | Ga0207685_100113983 | 441 |
| 442 | 3300025906 | Ga0207699_10001300 | Ga0207699_100013002 | 441 |
| 443 | 3300025916 | Ga0207663_10119603 | Ga0207663_101196032 | 441 |
| 444 | 3300025929 | Ga0207664_10006688 | Ga0207664_100066882 | 441 |
| 445 | 3300038735 | Ga0400485_14323 | Ga0400485_14323_26013_27383 | 441 |
| 446 | 3300038741 | Ga0400488_07225 | Ga0400488_07225_1483_2877 | 441 |
| 447 | 3300038742 | Ga0400486_16675 | Ga0400486_16675_14724_16094 | 441 |
| 448 | 3300044656 | Ga0466969_0001418 | Ga0466969_0001418_3071_4417 | 441 |
| 449 | 3300044684 | Ga0466966_0025916 | Ga0466966_0025916_507_1853 | 441 |
| 450 | 3300044693 | Ga0466961_0030018 | Ga0466961_0030018_666_2012 | 441 |
| 451 | 3300045049 | Ga0466959_0012867 | Ga0466959_0012867_4226_5572 | 441 |
| 452 | 3300045049 | Ga0466959_0098778 | Ga0466959_0098778_187_1614 | 441 |
| 453 | 3300046454 | Ga0495592_0007921 | Ga0495592_0007921_4768_6129 | 441 |
| 454 | 3300046462 | Ga0495651_0020641 | Ga0495651_0020641_1928_3289 | 441 |
| 455 | 3300046511 | Ga0495608_0014307 | Ga0495608_0014307_2443_3804 | 441 |
| 456 | 3300046516 | Ga0495628_0013131 | Ga0495628_0013131_2255_3616 | 441 |
| 457 | 3300046526 | Ga0495666_0013332 | Ga0495666_0013332_2330_3691 | 441 |
| 458 | 3300046529 | Ga0495652_0040281 | Ga0495652_0040281_2357_3718 | 441 |
| 459 | 3300046533 | Ga0495640_0018600 | Ga0495640_0018600_2454_3815 | 441 |
| 460 | 3300046536 | Ga0495587_0022087 | Ga0495587_0022087_1346_2707 | 441 |
| 461 | 3300046543 | Ga0495645_0004398 | Ga0495645_0004398_306_1658 | 441 |
| 462 | 3300046543 | Ga0495645_0023172 | Ga0495645_0023172_1170_2531 | 441 |
| 463 | 3300046559 | Ga0495667_0020606 | Ga0495667_0020606_854_2215 | 441 |
| 464 | 3300046642 | Ga0495634_0052248 | Ga0495634_0052248_213_1574 | 441 |
| 465 | 3300046675 | Ga0495657_0019934 | Ga0495657_0019934_294_1655 | 441 |
| 466 | 3300047317 | Ga0495604_0011789 | Ga0495604_0011789_3357_4718 | 441 |
| 467 | 3300047444 | Ga0495675_0025100 | Ga0495675_0025100_1993_3345 | 441 |
| 468 | 3300048905 | Ga0496102_0030302 | Ga0496102_0030302_2251_3627 | 441 |
| 469 | 3300048907 | Ga0496104_0007962 | Ga0496104_0007962_435_1811 | 441 |
| 470 | 3300048908 | Ga0496105_0002357 | Ga0496105_0002357_2985_4361 | 441 |
| 471 | 3300048911 | Ga0496108_0090417 | Ga0496108_0090417_134_1510 | 441 |
| 472 | 3300048912 | Ga0496109_0026161 | Ga0496109_0026161_811_2187 | 441 |
| 473 | 3300048915 | Ga0496112_0008515 | Ga0496112_0008515_7378_8754 | 441 |
| 474 | 3300048916 | Ga0496113_0045946 | Ga0496113_0045946_797_2173 | 441 |
| 475 | 3300048918 | Ga0496115_0015781 | Ga0496115_0015781_1016_2392 | 441 |
| 476 | iso_pu_bacteria | 2643221561 | 2643827310 | 441 |
| 477 | iso_pu_bacteria | 2643221615 | 2644093098 | 441 |
| 478 | iso_pu_bacteria | 2643221657 | 2644322709 | 441 |
| 479 | iso_pu_bacteria | 2643221696 | 2644533863 | 441 |
| 480 | iso_pu_bacteria | 2802429296 | 2804845665 | 441 |
| 481 | iso_pu_bacteria | 2816332119 | 2816421347 | 441 |
| 482 | iso_pu_bacteria | 2855386786 | 2855388124 | 441 |
| 483 | iso_pu_bacteria | 2857481737 | 2857485696 | 441 |
| 484 | iso_pu_bacteria | 8025413630 | 8025419666 | 441 |
| 485 | 3300001990 | JGI24737J22298_10005250 | JGI24737J22298_100052504 | 442 |
| 486 | 3300005327 | Ga0070658_10011481 | Ga0070658_100114814 | 442 |
| 487 | 3300005329 | Ga0070683_100056266 | Ga0070683_1000562664 | 442 |
| 488 | 3300005535 | Ga0070684_100200514 | Ga0070684_1002005142 | 442 |
| 489 | 3300005577 | Ga0068857_100007139 | Ga0068857_1000071393 | 442 |
| 490 | 3300005985 | Ga0081539_10000381 | Ga0081539_1000038152 | 442 |
| 491 | 3300006048 | Ga0075363_100005675 | Ga0075363_1000056754 | 442 |
| 492 | 3300006048 | Ga0075363_100027448 | Ga0075363_1000274482 | 442 |
| 493 | 3300006048 | Ga0075363_100078333 | Ga0075363_1000783332 | 442 |
| 494 | 3300006353 | Ga0075370_10069235 | Ga0075370_100692352 | 442 |
| 495 | 3300025901 | Ga0207688_10047386 | Ga0207688_100473862 | 442 |
| 496 | 3300025904 | Ga0207647_10023053 | Ga0207647_100230532 | 442 |
| 497 | 3300025909 | Ga0207705_10011129 | Ga0207705_100111294 | 442 |
| 498 | 3300025927 | Ga0207687_10018220 | Ga0207687_100182204 | 442 |
| 499 | 3300025934 | Ga0207686_10036736 | Ga0207686_100367363 | 442 |
| 500 | 3300025944 | Ga0207661_10148198 | Ga0207661_101481982 | 442 |
| 501 | 3300026035 | Ga0207703_10051971 | Ga0207703_100519714 | 442 |
| 502 | 3300026116 | Ga0207674_10063468 | Ga0207674_100634683 | 442 |
| 503 | 3300026142 | Ga0207698_10254149 | Ga0207698_102541492 | 442 |
| 504 | 3300027866 | Ga0209813_10001795 | Ga0209813_100017952 | 442 |
| 505 | 3300037466 | Ga0395898_0114731 | Ga0395898_0114731_158_1489 | 442 |
| 506 | 3300038443 | Ga0395901_0099361 | Ga0395901_0099361_1397_2728 | 442 |
| 507 | 3300045051 | Ga0451576_0078962 | Ga0451576_0078962_219_1550 | 442 |
| 508 | 3300048905 | Ga0496102_0210018 | Ga0496102_0210018_154_1485 | 442 |
| 509 | 3300048911 | Ga0496108_0021929 | Ga0496108_0021929_3641_5020 | 442 |
| 510 | 3300048912 | Ga0496109_0080158 | Ga0496109_0080158_1402_2781 | 442 |
| 511 | 3300048913 | Ga0496110_0004424 | Ga0496110_0004424_1127_2458 | 442 |
| 512 | 3300048917 | Ga0496114_0000890 | Ga0496114_0000890_12558_13889 | 442 |
| 513 | 3300049586 | Ga0501070_0024422 | Ga0501070_0024422_44_1378 | 442 |
| 514 | 3300050490 | nmdc:mga03n38_3148_c1 | nmdc:mga03n38_3148_c1_1973_3307 | 442 |
| 515 | 3300050490 | nmdc:mga03n38_48181_c1 | nmdc:mga03n38_48181_c1_23_1357 | 442 |
| 516 | 3300050491 | nmdc:mga00v17_31601_c1 | nmdc:mga00v17_31601_c1_1507_2841 | 442 |
| 517 | 3300050491 | nmdc:mga00v17_64405_c1 | nmdc:mga00v17_64405_c1_423_1757 | 442 |
| 518 | 3300050492 | nmdc:mga0yw44_72200_c1 | nmdc:mga0yw44_72200_c1_39_1373 | 442 |
| 519 | 3300050494 | nmdc:mga06z11_7320_c1 | nmdc:mga06z11_7320_c1_2918_4252 | 442 |
| 520 | 3300050495 | nmdc:mga04h51_24566_c1 | nmdc:mga04h51_24566_c1_19_1353 | 442 |
| 521 | 3300050496 | nmdc:mga07m45_43203_c1 | nmdc:mga07m45_43203_c1_268_1602 | 442 |
| 522 | iso_pu_bacteria | 2739367898 | 2740168276 | 442 |
| 523 | 3300001979 | JGI24740J21852_10018753 | JGI24740J21852_100187532 | 443 |
| 524 | 3300002067 | JGI24735J21928_10008371 | JGI24735J21928_100083713 | 443 |
| 525 | 3300005548 | Ga0070665_100000516 | Ga0070665_10000051621 | 443 |
| 526 | 3300005548 | Ga0070665_100007014 | Ga0070665_1000070143 | 443 |
| 527 | 3300005578 | Ga0068854_100009946 | Ga0068854_1000099464 | 443 |
| 528 | 3300005616 | Ga0068852_100292311 | Ga0068852_1002923112 | 443 |
| 529 | 3300005937 | Ga0081455_10009960 | Ga0081455_100099604 | 443 |
| 530 | 3300005985 | Ga0081539_10019912 | Ga0081539_100199123 | 443 |
| 531 | 3300006048 | Ga0075363_100091167 | Ga0075363_1000911672 | 443 |
| 532 | 3300009093 | Ga0105240_10015715 | Ga0105240_100157156 | 443 |
| 533 | 3300009174 | Ga0105241_10006208 | Ga0105241_100062083 | 443 |
| 534 | 3300009545 | Ga0105237_10004407 | Ga0105237_100044077 | 443 |
| 535 | 3300009551 | Ga0105238_10000200 | Ga0105238_1000020020 | 443 |
| 536 | 3300010375 | Ga0105239_10048362 | Ga0105239_100483623 | 443 |
| 537 | 3300013105 | Ga0157369_10075585 | Ga0157369_100755852 | 443 |
| 538 | 3300025904 | Ga0207647_10000384 | Ga0207647_100003846 | 443 |
| 539 | 3300025904 | Ga0207647_10065118 | Ga0207647_100651182 | 443 |
| 540 | 3300025911 | Ga0207654_10002418 | Ga0207654_100024184 | 443 |
| 541 | 3300025913 | Ga0207695_10000449 | Ga0207695_1000044961 | 443 |
| 542 | 3300025914 | Ga0207671_10000052 | Ga0207671_10000052116 | 443 |
| 543 | 3300025919 | Ga0207657_10013589 | Ga0207657_100135892 | 443 |
| 544 | 3300025924 | Ga0207694_10000079 | Ga0207694_1000007919 | 443 |
| 545 | 3300025937 | Ga0207669_10044145 | Ga0207669_100441452 | 443 |
| 546 | 3300025949 | Ga0207667_10008068 | Ga0207667_100080689 | 443 |
| 547 | 3300025981 | Ga0207640_10007132 | Ga0207640_100071322 | 443 |
| 548 | 3300026075 | Ga0207708_10159261 | Ga0207708_101592612 | 443 |
| 549 | 3300026118 | Ga0207675_100115019 | Ga0207675_1001150192 | 443 |
| 550 | 3300026142 | Ga0207698_10017352 | Ga0207698_100173524 | 443 |
| 551 | 3300028379 | Ga0268266_10007187 | Ga0268266_100071879 | 443 |
| 552 | 3300028379 | Ga0268266_10015277 | Ga0268266_100152774 | 443 |
| 553 | 3300031852 | Ga0307410_10182567 | Ga0307410_101825672 | 443 |
| 554 | 3300031995 | Ga0307409_100078970 | Ga0307409_1000789702 | 443 |
| 555 | 3300032005 | Ga0307411_10047651 | Ga0307411_100476512 | 443 |
| 556 | 3300032126 | Ga0307415_100069236 | Ga0307415_1000692363 | 443 |
| 557 | 3300037312 | Ga0395899_0065927 | Ga0395899_0065927_1279_2622 | 443 |
| 558 | 3300037466 | Ga0395898_0053416 | Ga0395898_0053416_621_1964 | 443 |
| 559 | 3300038443 | Ga0395901_0029700 | Ga0395901_0029700_3182_4525 | 443 |
| 560 | 3300044656 | Ga0466969_0003205 | Ga0466969_0003205_5018_6376 | 443 |
| 561 | 3300044684 | Ga0466966_0002490 | Ga0466966_0002490_9627_10970 | 443 |
| 562 | 3300044693 | Ga0466961_0021195 | Ga0466961_0021195_383_1726 | 443 |
| 563 | 3300044765 | Ga0466970_0005211 | Ga0466970_0005211_2213_3571 | 443 |
| 564 | 3300044901 | Ga0466960_0005774 | Ga0466960_0005774_2948_4282 | 443 |
| 565 | 3300045976 | Ga0466967_0042514 | Ga0466967_0042514_1818_3161 | 443 |
| 566 | 3300045976 | Ga0466967_0046247 | Ga0466967_0046247_1158_2492 | 443 |
| 567 | 3300045976 | Ga0466967_0151430 | Ga0466967_0151430_195_1553 | 443 |
| 568 | 3300046462 | Ga0495651_0000877 | Ga0495651_0000877_10274_11635 | 443 |
| 569 | 3300046463 | Ga0495653_0003805 | Ga0495653_0003805_7107_8468 | 443 |
| 570 | 3300046529 | Ga0495652_0000654 | Ga0495652_0000654_27541_28902 | 443 |
| 571 | 3300046809 | Ga0495600_0001072 | Ga0495600_0001072_8316_9677 | 443 |
| 572 | 3300048903 | Ga0496100_0058356 | Ga0496100_0058356_109_1443 | 443 |
| 573 | 3300048904 | Ga0496101_0043038 | Ga0496101_0043038_656_1990 | 443 |
| 574 | 3300048908 | Ga0496105_0022117 | Ga0496105_0022117_2779_4176 | 443 |
| 575 | 3300048908 | Ga0496105_0035803 | Ga0496105_0035803_447_1781 | 443 |
| 576 | 3300048910 | Ga0496107_0038012 | Ga0496107_0038012_1039_2373 | 443 |
| 577 | 3300048910 | Ga0496107_0073522 | Ga0496107_0073522_417_1751 | 443 |
| 578 | 3300048912 | Ga0496109_0034523 | Ga0496109_0034523_156_1553 | 443 |
| 579 | 3300048913 | Ga0496110_0040490 | Ga0496110_0040490_880_2277 | 443 |
| 580 | 3300048914 | Ga0496111_0065120 | Ga0496111_0065120_450_1847 | 443 |
| 581 | 3300048918 | Ga0496115_0026477 | Ga0496115_0026477_912_2246 | 443 |
| 582 | 3300049568 | Ga0501031_0063185 | Ga0501031_0063185_1034_2368 | 443 |
| 583 | 3300049571 | Ga0501034_0020937 | Ga0501034_0020937_1946_3280 | 443 |
| 584 | 3300049571 | Ga0501034_0052775 | Ga0501034_0052775_1828_3165 | 443 |
| 585 | 3300049572 | Ga0501036_0018022 | Ga0501036_0018022_1252_2586 | 443 |
| 586 | 3300049584 | Ga0501068_0030095 | Ga0501068_0030095_1787_3121 | 443 |
| 587 | 3300049589 | Ga0501073_0003012 | Ga0501073_0003012_5753_7090 | 443 |
| 588 | 3300049589 | Ga0501073_0095406 | Ga0501073_0095406_588_1922 | 443 |
| 589 | 3300049590 | Ga0501074_0016485 | Ga0501074_0016485_2854_4188 | 443 |
| 590 | 3300049741 | Ga0501079_0056015 | Ga0501079_0056015_895_2232 | 443 |
| 591 | 3300049742 | Ga0501080_0027729 | Ga0501080_0027729_811_2145 | 443 |
| 592 | 3300049744 | Ga0501083_0012707 | Ga0501083_0012707_2855_4192 | 443 |
| 593 | 3300049824 | Ga0501045_0007837 | Ga0501045_0007837_4677_6011 | 443 |
| 594 | 3300050492 | nmdc:mga0yw44_4616_c1 | nmdc:mga0yw44_4616_c1_4410_5747 | 443 |
| 595 | 3300053077 | Ga0495601_0019263 | Ga0495601_0019263_773_2119 | 443 |
| 596 | 3300053085 | Ga0495619_0031757 | Ga0495619_0031757_67_1401 | 443 |
| 597 | 3300060353 | Ga0501082_0062671 | Ga0501082_0062671_89_1423 | 443 |
| 598 | 3300061719 | Ga0466962_0024363 | Ga0466962_0024363_1548_2891 | 443 |
| 599 | iso_pu_bacteria | 2643221576 | 2643893681 | 443 |
| 600 | iso_pu_bacteria | 2643221590 | 2643957764 | 443 |
| 601 | iso_pu_bacteria | 2839986021 | 2839989606 | 443 |
| 602 | iso_pu_bacteria | 2932431166 | 2932432113 | 443 |
| 603 | 3300005345 | Ga0070692_10075932 | Ga0070692_100759321 | 444 |
| 604 | 3300005366 | Ga0070659_100152696 | Ga0070659_1001526962 | 444 |
| 605 | 3300005455 | Ga0070663_100071824 | Ga0070663_1000718242 | 444 |
| 606 | 3300005471 | Ga0070698_100000408 | Ga0070698_10000040840 | 444 |
| 607 | 3300005985 | Ga0081539_10060074 | Ga0081539_100600742 | 444 |
| 608 | 3300006844 | Ga0075428_100007250 | Ga0075428_1000072505 | 444 |
| 609 | 3300006847 | Ga0075431_100009125 | Ga0075431_1000091253 | 444 |
| 610 | 3300006852 | Ga0075433_10003678 | Ga0075433_100036788 | 444 |
| 611 | 3300006871 | Ga0075434_100001261 | Ga0075434_1000012615 | 444 |
| 612 | 3300006871 | Ga0075434_100014570 | Ga0075434_1000145706 | 444 |
| 613 | 3300006880 | Ga0075429_100007247 | Ga0075429_1000072476 | 444 |
| 614 | 3300006914 | Ga0075436_100001077 | Ga0075436_1000010772 | 444 |
| 615 | 3300009094 | Ga0111539_10000537 | Ga0111539_1000053739 | 444 |
| 616 | 3300009094 | Ga0111539_10099912 | Ga0111539_100999123 | 444 |
| 617 | 3300009098 | Ga0105245_10157298 | Ga0105245_101572981 | 444 |
| 618 | 3300009147 | Ga0114129_10008460 | Ga0114129_1000846011 | 444 |
| 619 | 3300009148 | Ga0105243_10052523 | Ga0105243_100525232 | 444 |
| 620 | 3300009148 | Ga0105243_10056185 | Ga0105243_100561852 | 444 |
| 621 | 3300009176 | Ga0105242_10037132 | Ga0105242_100371322 | 444 |
| 622 | 3300009545 | Ga0105237_10176531 | Ga0105237_101765312 | 444 |
| 623 | 3300009551 | Ga0105238_10119804 | Ga0105238_101198042 | 444 |
| 624 | 3300009553 | Ga0105249_10167924 | Ga0105249_101679242 | 444 |
| 625 | 3300010375 | Ga0105239_10016948 | Ga0105239_100169483 | 444 |
| 626 | 3300010375 | Ga0105239_10076437 | Ga0105239_100764375 | 444 |
| 627 | 3300013306 | Ga0163162_10054215 | Ga0163162_100542152 | 444 |
| 628 | 3300013307 | Ga0157372_10084428 | Ga0157372_100844283 | 444 |
| 629 | 3300014325 | Ga0163163_10210225 | Ga0163163_102102252 | 444 |
| 630 | 3300017792 | Ga0163161_10093855 | Ga0163161_100938552 | 444 |
| 631 | 3300025901 | Ga0207688_10011866 | Ga0207688_100118661 | 444 |
| 632 | 3300025901 | Ga0207688_10044896 | Ga0207688_100448962 | 444 |
| 633 | 3300025924 | Ga0207694_10067059 | Ga0207694_100670592 | 444 |
| 634 | 3300025934 | Ga0207686_10126933 | Ga0207686_101269331 | 444 |
| 635 | 3300025935 | Ga0207709_10029384 | Ga0207709_100293843 | 444 |
| 636 | 3300026118 | Ga0207675_100008679 | Ga0207675_1000086795 | 444 |
| 637 | 3300027866 | Ga0209813_10005253 | Ga0209813_100052533 | 444 |
| 638 | 3300027907 | Ga0207428_10005928 | Ga0207428_100059285 | 444 |
| 639 | 3300027907 | Ga0207428_10080214 | Ga0207428_100802142 | 444 |
| 640 | 3300031548 | Ga0307408_100008922 | Ga0307408_1000089225 | 444 |
| 641 | 3300031548 | Ga0307408_100010849 | Ga0307408_1000108491 | 444 |
| 642 | 3300031548 | Ga0307408_100112552 | Ga0307408_1001125522 | 444 |
| 643 | 3300031731 | Ga0307405_10000511 | Ga0307405_1000051112 | 444 |
| 644 | 3300031824 | Ga0307413_10000901 | Ga0307413_100009014 | 444 |
| 645 | 3300031824 | Ga0307413_10015857 | Ga0307413_100158573 | 444 |
| 646 | 3300031824 | Ga0307413_10027245 | Ga0307413_100272452 | 444 |
| 647 | 3300031852 | Ga0307410_10043450 | Ga0307410_100434504 | 444 |
| 648 | 3300031901 | Ga0307406_10000019 | Ga0307406_1000001941 | 444 |
| 649 | 3300031903 | Ga0307407_10004007 | Ga0307407_100040073 | 444 |
| 650 | 3300031911 | Ga0307412_10018856 | Ga0307412_100188564 | 444 |
| 651 | 3300031995 | Ga0307409_100310526 | Ga0307409_1003105262 | 444 |
| 652 | 3300032002 | Ga0307416_100000040 | Ga0307416_10000004067 | 444 |
| 653 | 3300032002 | Ga0307416_100015467 | Ga0307416_1000154674 | 444 |
| 654 | 3300032004 | Ga0307414_10002067 | Ga0307414_100020679 | 444 |
| 655 | 3300032004 | Ga0307414_10009244 | Ga0307414_100092446 | 444 |
| 656 | 3300032005 | Ga0307411_10000062 | Ga0307411_100000623 | 444 |
| 657 | 3300032005 | Ga0307411_10012877 | Ga0307411_100128773 | 444 |
| 658 | 3300032126 | Ga0307415_100002141 | Ga0307415_1000021415 | 444 |
| 659 | 3300032126 | Ga0307415_100005448 | Ga0307415_1000054483 | 444 |
| 660 | 3300041997 | Ga0439431_0004227 | Ga0439431_0004227_1184_2542 | 444 |
| 661 | 3300042016 | Ga0439463_017598 | Ga0439463_017598_16_1410 | 444 |
| 662 | 3300042156 | Ga0439446_0013258 | Ga0439446_0013258_135_1493 | 444 |
| 663 | 3300042435 | Ga0439434_0003877 | Ga0439434_0003877_456_1814 | 444 |
| 664 | 3300042993 | Ga0439440_0001853 | Ga0439440_0001853_2241_3629 | 444 |
| 665 | 3300042993 | Ga0439440_0002277 | Ga0439440_0002277_1895_3271 | 444 |
| 666 | 3300044693 | Ga0466961_0057919 | Ga0466961_0057919_728_2080 | 444 |
| 667 | 3300044901 | Ga0466960_0010227 | Ga0466960_0010227_1475_2827 | 444 |
| 668 | 3300048912 | Ga0496109_0014852 | Ga0496109_0014852_2603_3949 | 444 |
| 669 | 3300049568 | Ga0501031_0013104 | Ga0501031_0013104_277_1626 | 444 |
| 670 | 3300049569 | Ga0501032_0088277 | Ga0501032_0088277_537_1886 | 444 |
| 671 | 3300049572 | Ga0501036_0010572 | Ga0501036_0010572_2397_3746 | 444 |
| 672 | 3300049575 | Ga0501039_0097693 | Ga0501039_0097693_627_1976 | 444 |
| 673 | 3300049578 | Ga0501042_0007307 | Ga0501042_0007307_365_1714 | 444 |
| 674 | 3300049581 | Ga0501047_0000112 | Ga0501047_0000112_19902_21269 | 444 |
| 675 | 3300049582 | Ga0501048_0010821 | Ga0501048_0010821_2910_4259 | 444 |
| 676 | 3300049587 | Ga0501071_0008460 | Ga0501071_0008460_2241_3590 | 444 |
| 677 | 3300049588 | Ga0501072_0013685 | Ga0501072_0013685_2500_3849 | 444 |
| 678 | 3300049590 | Ga0501074_0029004 | Ga0501074_0029004_384_1733 | 444 |
| 679 | 3300049592 | Ga0501076_0207672 | Ga0501076_0207672_203_1543 | 444 |
| 680 | 3300049743 | Ga0501081_0077702 | Ga0501081_0077702_883_2232 | 444 |
| 681 | 3300049824 | Ga0501045_0024013 | Ga0501045_0024013_825_2174 | 444 |
| 682 | 3300050492 | nmdc:mga0yw44_4245_c1 | nmdc:mga0yw44_4245_c1_1943_3283 | 444 |
| 683 | 3300050494 | nmdc:mga06z11_7458_c1 | nmdc:mga06z11_7458_c1_414_1754 | 444 |
| 684 | 3300050495 | nmdc:mga04h51_2262_c1 | nmdc:mga04h51_2262_c1_1312_2652 | 444 |
| 685 | 3300050507 | nmdc:mga05p37_36587_c1 | nmdc:mga05p37_36587_c1_1891_3285 | 444 |
| 686 | 3300050510 | nmdc:mga06r32_43895_c1 | nmdc:mga06r32_43895_c1_1538_2932 | 444 |
| 687 | 3300050511 | nmdc:mga08y16_13478_c1 | nmdc:mga08y16_13478_c1_4456_5850 | 444 |
| 688 | 3300050511 | nmdc:mga08y16_26727_c1 | nmdc:mga08y16_26727_c1_4509_5906 | 444 |
| 689 | 3300050512 | nmdc:mga0n895_1812_c1 | nmdc:mga0n895_1812_c1_466_1863 | 444 |
| 690 | 3300050512 | nmdc:mga0n895_24204_c1 | nmdc:mga0n895_24204_c1_2463_3857 | 444 |
| 691 | 3300050515 | nmdc:mga0a205_120_c1 | nmdc:mga0a205_120_c1_18512_19909 | 444 |
| 692 | 3300050515 | nmdc:mga0a205_5052_c1 | nmdc:mga0a205_5052_c1_6924_8318 | 444 |
| 693 | 3300054114 | Ga0501084_0037634 | Ga0501084_0037634_1870_3219 | 444 |
| 694 | 3300001979 | JGI24740J21852_10005365 | JGI24740J21852_100053652 | 445 |
| 695 | 3300001989 | JGI24739J22299_10005499 | JGI24739J22299_100054994 | 445 |
| 696 | 3300005344 | Ga0070661_100076191 | Ga0070661_1000761912 | 445 |
| 697 | 3300005367 | Ga0070667_100084572 | Ga0070667_1000845723 | 445 |
| 698 | 3300005530 | Ga0070679_100051890 | Ga0070679_1000518905 | 445 |
| 699 | 3300005535 | Ga0070684_100154578 | Ga0070684_1001545782 | 445 |
| 700 | 3300005564 | Ga0070664_100064323 | Ga0070664_1000643232 | 445 |
| 701 | 3300005577 | Ga0068857_100038888 | Ga0068857_1000388882 | 445 |
| 702 | 3300005614 | Ga0068856_100204808 | Ga0068856_1002048081 | 445 |
| 703 | 3300005983 | Ga0081540_1033264 | Ga0081540_10332643 | 445 |
| 704 | 3300006178 | Ga0075367_10040955 | Ga0075367_100409552 | 445 |
| 705 | 3300006353 | Ga0075370_10027371 | Ga0075370_100273713 | 445 |
| 706 | 3300006844 | Ga0075428_100011991 | Ga0075428_1000119915 | 445 |
| 707 | 3300006847 | Ga0075431_100028072 | Ga0075431_1000280724 | 445 |
| 708 | 3300006880 | Ga0075429_100020235 | Ga0075429_1000202354 | 445 |
| 709 | 3300025321 | Ga0207656_10036994 | Ga0207656_100369942 | 445 |
| 710 | 3300025904 | Ga0207647_10019932 | Ga0207647_100199323 | 445 |
| 711 | 3300025904 | Ga0207647_10043871 | Ga0207647_100438711 | 445 |
| 712 | 3300025929 | Ga0207664_10024716 | Ga0207664_100247162 | 445 |
| 713 | 3300025945 | Ga0207679_10006682 | Ga0207679_100066823 | 445 |
| 714 | 3300026041 | Ga0207639_10081722 | Ga0207639_100817223 | 445 |
| 715 | 3300026075 | Ga0207708_10242311 | Ga0207708_102423111 | 445 |
| 716 | 3300026116 | Ga0207674_10017090 | Ga0207674_100170902 | 445 |
| 717 | 3300028381 | Ga0268264_10000374 | Ga0268264_1000037447 | 445 |
| 718 | 3300031456 | Ga0307513_10077152 | Ga0307513_100771523 | 445 |
| 719 | 3300031456 | Ga0307513_10102899 | Ga0307513_101028993 | 445 |
| 720 | 3300031995 | Ga0307409_100094875 | Ga0307409_1000948752 | 445 |
| 721 | 3300032002 | Ga0307416_100033810 | Ga0307416_1000338105 | 445 |
| 722 | 3300032126 | Ga0307415_100047103 | Ga0307415_1000471032 | 445 |
| 723 | 3300038443 | Ga0395901_0160644 | Ga0395901_0160644_43_1401 | 445 |
| 724 | 3300038443 | Ga0395901_0256540 | Ga0395901_0256540_149_1495 | 445 |
| 725 | 3300042002 | Ga0439442_016345 | Ga0439442_016345_121_1473 | 445 |
| 726 | 3300044658 | Ga0466972_0056342 | Ga0466972_0056342_301_1659 | 445 |
| 727 | 3300044765 | Ga0466970_0000821 | Ga0466970_0000821_8187_9545 | 445 |
| 728 | 3300044765 | Ga0466970_0006446 | Ga0466970_0006446_2262_3605 | 445 |
| 729 | 3300044765 | Ga0466970_0008060 | Ga0466970_0008060_3780_5120 | 445 |
| 730 | 3300044842 | Ga0466957_0016357 | Ga0466957_0016357_709_2067 | 445 |
| 731 | 3300045836 | Ga0466958_0002731 | Ga0466958_0002731_3172_4530 | 445 |
| 732 | 3300045976 | Ga0466967_0017591 | Ga0466967_0017591_188_1561 | 445 |
| 733 | 3300045976 | Ga0466967_0036385 | Ga0466967_0036385_1899_3257 | 445 |
| 734 | 3300046492 | Ga0495585_0065273 | Ga0495585_0065273_628_1965 | 445 |
| 735 | 3300048903 | Ga0496100_0034974 | Ga0496100_0034974_1267_2619 | 445 |
| 736 | 3300048908 | Ga0496105_0187628 | Ga0496105_0187628_282_1634 | 445 |
| 737 | 3300048909 | Ga0496106_0021137 | Ga0496106_0021137_2109_3461 | 445 |
| 738 | 3300048909 | Ga0496106_0087147 | Ga0496106_0087147_128_1474 | 445 |
| 739 | 3300048910 | Ga0496107_0012322 | Ga0496107_0012322_4598_5950 | 445 |
| 740 | 3300048927 | Ga0496124_0031963 | Ga0496124_0031963_2278_3630 | 445 |
| 741 | 3300049575 | Ga0501039_0025256 | Ga0501039_0025256_1283_2632 | 445 |
| 742 | 3300049583 | Ga0501067_0002973 | Ga0501067_0002973_351_1691 | 445 |
| 743 | 3300050491 | nmdc:mga00v17_25768_c1 | nmdc:mga00v17_25768_c1_1971_3323 | 445 |
| 744 | 3300050491 | nmdc:mga00v17_37665_c1 | nmdc:mga00v17_37665_c1_501_1853 | 445 |
| 745 | 3300050492 | nmdc:mga0yw44_40379_c1 | nmdc:mga0yw44_40379_c1_470_1822 | 445 |
| 746 | 3300050494 | nmdc:mga06z11_3386_c1 | nmdc:mga06z11_3386_c1_259_1611 | 445 |
| 747 | 3300050494 | nmdc:mga06z11_41662_c1 | nmdc:mga06z11_41662_c1_265_1611 | 445 |
| 748 | 3300050495 | nmdc:mga04h51_22456_c1 | nmdc:mga04h51_22456_c1_299_1645 | 445 |
| 749 | 3300050496 | nmdc:mga07m45_43272_c1 | nmdc:mga07m45_43272_c1_986_2338 | 445 |
| 750 | 3300050507 | nmdc:mga05p37_41527_c1 | nmdc:mga05p37_41527_c1_901_2250 | 445 |
| 751 | 3300050509 | nmdc:mga0qj67_7306_c1 | nmdc:mga0qj67_7306_c1_6187_7536 | 445 |
| 752 | 3300050510 | nmdc:mga06r32_35629_c1 | nmdc:mga06r32_35629_c1_1424_2773 | 445 |
| 753 | 3300053104 | Ga0500556_0000485 | Ga0500556_0000485_9192_10544 | 445 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zk9-assembly1.cif.gz_4 | peripheral domain of open complex i during turnover | 0.9332 | 40 | 445 |
| 5gpn-assembly1.cif.gz_Z | architecture of mammalian respirasome | 0.9309 | 50 | 445 |
| 7a24-assembly1.cif.gz_G | assembly intermediate of the plant mitochondrial complex i | 0.9307 | 41 | 442 |
| 8e9h-assembly1.cif.gz_D | mycobacterial respiratory complex i, fully-inserted quinone | 0.9303 | 39 | 445 |
| 5gpn-assembly1.cif.gz_Z | architecture of mammalian respirasome | 0.9285 | 50 | 445 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9353 | 41 | 445 | 1.10.645.10 |
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9308 | 41 | 445 | 1.10.645.10 |
| af_P16431_180_537_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.923 | 41 | 436 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9169 | 41 | 445 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9123 | 41 | 445 | 1.10.645.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9G032-F1-model_v4 | NADH dehydrogenase subunit D | 0.9894 | 222 | 303 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A6B3I5G8-F1-model_v4 | NADH dehydrogenase subunit D | 0.987 | 106 | 247 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A6G3WKU9-F1-model_v4 | NADH dehydrogenase subunit D | 0.9818 | 159 | 330 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-T1BX24-F1-model_v4 | NADH dehydrogenase I, D subunit | 0.9729 | 137 | 326 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A533XNX7-F1-model_v4 | NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) | 0.9724 | 177 | 305 |
GO:0016651
GO:0048038 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar