F479221

General Info

Members Datasets Scaffolds Average Seq Length
753 422 661 445

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0098778|Ga0466959_0098778_187_1614
Length 475
Sequence MSDQTTDPKTAEPVDVPPAASVPGSTDDADPYDLPQNLATDEIEEGRVFTSSGGDWDEIAEEATHLGEERIVVNMGPQHPSTHGVLRLILELDGETVTEARCGIGYLHTGIEKTMEYRTWVQGVTLCTRMDYLSPLYQEAAYCLGIERLLGIEDQIPERVHVIRVLLMELNRVGSHIVALATGGMEIGALTVMTVGFRLRERVLKLLELITGLRMNHAFIRPGGLAQDIPPGTLDAIMDEMPGMLQDVSDVEKLSDENPLVRSRLVDVGYLDLTGCMALGLTGPVLRSTGLPHDLRRVQPYCGYEDYEFDVVTWDTCDAYGRWRIREEEMRQSLRIVEQCVRRLRDMPPTPVMIPDRKIAWPAQLAIGGDGMGNSLEHIREIMGSSMEALIHHFKLVTEGFRVPAGQVYFPVESPRGELGAHLVSDGGTRPYRAHFRDPSFVNLQAVAAMCEGGQVADVIAAVASLDPVMGGVDR

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221561 Nocardioides sp. Root151 Isolate Unclassified
8 2643221576 Nocardioides sp. Root614 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221590 Nocardioides sp. Root682 Isolate Unclassified
11 2643221604 Nocardioides sp. Root190 Isolate Unclassified
12 2643221613 Oerskovia sp. Root22 Isolate Unclassified
13 2643221615 Nocardioides sp. Root224 Isolate Unclassified
14 2643221617 Nocardioides sp. Root79 Isolate Unclassified
15 2643221620 Nocardioides sp. Root240 Isolate Unclassified
16 2643221647 Streptomyces sp. Root369 Isolate Unclassified
17 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
18 2643221670 Streptomyces sp. Root431 Isolate Unclassified
19 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
20 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
21 2643221696 Nocardioides sp. Root140 Isolate Unclassified
22 2643221721 Oerskovia sp. Root918 Isolate Unclassified
23 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
24 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
25 2738541305 Nocardioides sp. CF167 Isolate Unclassified
26 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
27 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
28 2739367898 Nocardioides sp. CF479 Isolate Unclassified
29 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
30 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
31 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
32 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
33 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
34 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
35 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
36 2808606448 Streptomyces sp. 193411 Isolate Unclassified
37 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
38 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
39 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
40 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
41 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
42 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
43 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
44 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
45 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
46 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
47 2862574272 Streptomyces sp. AcE210 Isolate Nodule
48 2867428634 Streptomyces sp. RP5T Isolate Unclassified
49 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
50 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
51 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
52 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
53 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
54 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
55 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
56 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
57 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
58 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
59 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
60 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
61 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
62 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
63 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
64 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
65 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
66 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
67 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
68 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
69 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
70 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
71 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
72 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
73 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
74 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
75 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
76 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
77 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
78 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
79 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
80 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
81 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
82 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
83 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
84 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
85 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
86 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
87 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
88 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
89 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
90 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
91 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
96 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
99 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
100 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
103 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
104 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
105 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
106 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
119 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
122 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
123 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
126 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
137 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
149 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
150 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
208 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
239 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
240 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
241 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
247 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
248 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
249 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
254 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
318 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
342 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
343 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
371 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
372 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
379 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
380 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
381 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
384 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
396 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
397 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
398 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
399 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
400 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
401 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
402 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
403 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
408 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
409 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
415 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
416 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
417 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
418 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
419 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
420 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
421 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
422 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.65
Metatranscriptomes 0.13
Isolates 12.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 6.91
Nodule 0.27
Rhizoplane 5.84
Rhizosphere 76.76
Stem 0
Stem Tuber 0
Unclassified 10.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005365 3300001979 Bacteria 5430
2 JGI24740J21852_10018753 3300001979 Bacteria 2447
3 JGI24739J22299_10005499 3300001989 Bacteria 4807
4 JGI24739J22299_10006893 3300001989 Bacteria 4281
5 JGI24737J22298_10005250 3300001990 Bacteria 4485
6 JGI24735J21928_10008371 3300002067 Bacteria 3347
7 JGI24738J21930_10007021 3300002075 Bacteria 2616
8 JGI24744J21845_10012947 3300002077 Bacteria 1685
9 Ga0007427J51700_109281 3300003559 Bacteria 3569
10 Ga0055540_1000539 3300003792 Bacteria 28425
11 Ga0070658_10011481 3300005327 Bacteria 7103
12 Ga0070683_100056266 3300005329 Bacteria 3652
13 Ga0068869_100023468 3300005334 Bacteria 4261
14 Ga0070682_100013171 3300005337 Bacteria 4751
15 Ga0068868_100031203 3300005338 Bacteria 4091
16 Ga0070661_100076191 3300005344 Bacteria 2472
17 Ga0070692_10075932 3300005345 Bacteria 1800
18 Ga0070674_100021380 3300005356 Bacteria 4152
19 Ga0070673_100038351 3300005364 Bacteria 3658
20 Ga0070659_100152696 3300005366 Bacteria 1885
21 Ga0070667_100084572 3300005367 Bacteria 2719
22 Ga0070709_10083867 3300005434 Bacteria 2086
23 Ga0070711_100002215 3300005439 Bacteria 11032
24 Ga0070705_100090063 3300005440 Bacteria 1909
25 Ga0070708_100062048 3300005445 Bacteria 3341
26 Ga0070663_100071824 3300005455 Bacteria 2520
27 Ga0068867_100164392 3300005459 Bacteria 1753
28 Ga0070685_10033602 3300005466 Bacteria 2883
29 Ga0070698_100000408 3300005471 Bacteria 45628
30 Ga0070679_100051890 3300005530 Bacteria 4085
31 Ga0070684_100154578 3300005535 Bacteria 2080
32 Ga0070684_100200514 3300005535 Bacteria 1817
33 Ga0070696_100066758 3300005546 Bacteria 2523
34 Ga0070665_100000516 3300005548 Bacteria 55112
35 Ga0070665_100007014 3300005548 Bacteria 11450
36 Ga0070665_100095388 3300005548 Bacteria 2980
37 Ga0070665_100131433 3300005548 Bacteria 2505
38 Ga0070704_100017559 3300005549 Bacteria 4553
39 Ga0068855_100007296 3300005563 Bacteria 13388
40 Ga0068855_100206484 3300005563 Bacteria 2210
41 Ga0070664_100064323 3300005564 Bacteria 3128
42 Ga0068857_100007139 3300005577 Bacteria 9621
43 Ga0068857_100038888 3300005577 Bacteria 4212
44 Ga0068854_100009946 3300005578 Bacteria 6155
45 Ga0068854_100219211 3300005578 Bacteria 1504
46 Ga0068856_100204808 3300005614 Bacteria 1987
47 Ga0068852_100292311 3300005616 Bacteria 1574
48 Ga0068859_100265156 3300005617 Bacteria 1810
49 Ga0081455_10009867 3300005937 Bacteria 9770
50 Ga0081455_10009960 3300005937 Bacteria 9717
51 Ga0081455_10019330 3300005937 Bacteria 6447
52 Ga0081540_1003156 3300005983 Bacteria 13157
53 Ga0081540_1033264 3300005983 Bacteria 2802
54 Ga0081539_10000381 3300005985 Bacteria 96399
55 Ga0081539_10008707 3300005985 Bacteria 8723
56 Ga0081539_10015008 3300005985 Bacteria 5676
57 Ga0081539_10019912 3300005985 Bacteria 4568
58 Ga0081539_10060074 3300005985 Bacteria 2089
59 Ga0070717_10210444 3300006028 Bacteria 1706
60 Ga0075368_10005635 3300006042 Bacteria 4321
61 Ga0075363_100005675 3300006048 Bacteria 5585
62 Ga0075363_100027448 3300006048 Bacteria 2919
63 Ga0075363_100078333 3300006048 Bacteria 1804
64 Ga0075363_100091167 3300006048 Bacteria 1678
65 Ga0075364_10031721 3300006051 Bacteria 3395
66 Ga0070715_10012620 3300006163 Bacteria 3081
67 Ga0070716_100004805 3300006173 Bacteria 6488
68 Ga0070712_100004010 3300006175 Bacteria 9047
69 Ga0075367_10027504 3300006178 Bacteria 3236
70 Ga0075367_10040955 3300006178 Bacteria 2706
71 Ga0075370_10027371 3300006353 Bacteria 3162
72 Ga0075370_10069235 3300006353 Bacteria 2016
73 Ga0075428_100007250 3300006844 Bacteria 12285
74 Ga0075428_100011991 3300006844 Bacteria 9642
75 Ga0075431_100009125 3300006847 Bacteria 9945
76 Ga0075431_100028072 3300006847 Bacteria 5778
77 Ga0075433_10003678 3300006852 Bacteria 11863
78 Ga0075434_100001261 3300006871 Bacteria 21103
79 Ga0075434_100014570 3300006871 Bacteria 7519
80 Ga0075429_100007247 3300006880 Bacteria 9621
81 Ga0075429_100020235 3300006880 Bacteria 5770
82 Ga0075436_100001077 3300006914 Bacteria 18366
83 Ga0097620_100265168 3300006931 Bacteria 1810
84 Ga0099826_10055940 3300006948 Bacteria 2608
85 Ga0105244_10053032 3300009036 Bacteria 2062
86 Ga0105240_10015715 3300009093 Bacteria 10272
87 Ga0105240_10097021 3300009093 Bacteria 3591
88 Ga0111539_10000537 3300009094 Bacteria 48227
89 Ga0111539_10099912 3300009094 Bacteria 3407
90 Ga0105245_10157298 3300009098 Bacteria 2153
91 Ga0114129_10008460 3300009147 Bacteria 14661
92 Ga0105243_10052523 3300009148 Bacteria 3229
93 Ga0105243_10056185 3300009148 Bacteria 3129
94 Ga0105241_10003698 3300009174 Bacteria 11365
95 Ga0105241_10006208 3300009174 Bacteria 8814
96 Ga0105242_10037132 3300009176 Bacteria 3912
97 Ga0105237_10004407 3300009545 Bacteria 16312
98 Ga0105237_10176531 3300009545 Bacteria 2136
99 Ga0105237_10228148 3300009545 Bacteria 1863
100 Ga0105238_10000200 3300009551 Bacteria 66219
101 Ga0105238_10041156 3300009551 Bacteria 4681
102 Ga0105238_10119804 3300009551 Bacteria 2612
103 Ga0105238_10149694 3300009551 Bacteria 2309
104 Ga0105249_10167924 3300009553 Bacteria 2125
105 Ga0105249_10190960 3300009553 Bacteria 1999
106 Ga0105239_10016948 3300010375 Bacteria 8054
107 Ga0105239_10048362 3300010375 Bacteria 4664
108 Ga0105239_10076437 3300010375 Bacteria 3683
109 Ga0105246_10017871 3300011119 Bacteria 4512
110 Ga0105246_10029411 3300011119 Bacteria 3618
111 Ga0157369_10075585 3300013105 Bacteria 3611
112 Ga0157369_10189324 3300013105 Bacteria 2162
113 Ga0157374_10133760 3300013296 Bacteria 2402
114 Ga0157378_10045454 3300013297 Bacteria 3902
115 Ga0163162_10054215 3300013306 Bacteria 4033
116 Ga0157372_10084428 3300013307 Bacteria 3599
117 Ga0157372_10145291 3300013307 Bacteria 2735
118 Ga0163163_10210225 3300014325 Bacteria 1995
119 Ga0157377_10017835 3300014745 Bacteria 3680
120 Ga0157376_10150420 3300014969 Bacteria 2099
121 Ga0163161_10093855 3300017792 Bacteria 2224
122 Ga0207656_10036994 3300025321 Bacteria 2051
123 Ga0207656_10044570 3300025321 Bacteria 1895
124 Ga0207692_10001290 3300025898 Bacteria 9312
125 Ga0207692_10024393 3300025898 Bacteria 2811
126 Ga0207688_10000841 3300025901 Bacteria 15432
127 Ga0207688_10011866 3300025901 Bacteria 4742
128 Ga0207688_10044896 3300025901 Bacteria 2463
129 Ga0207688_10047386 3300025901 Bacteria 2400
130 Ga0207680_10108739 3300025903 Bacteria 1794
131 Ga0207647_10000384 3300025904 Bacteria 35996
132 Ga0207647_10009432 3300025904 Bacteria 6934
133 Ga0207647_10019932 3300025904 Bacteria 4503
134 Ga0207647_10023053 3300025904 Bacteria 4123
135 Ga0207647_10029337 3300025904 Bacteria 3562
136 Ga0207647_10043871 3300025904 Bacteria 2796
137 Ga0207647_10065118 3300025904 Bacteria 2213
138 Ga0207685_10011398 3300025905 Bacteria 2671
139 Ga0207699_10001300 3300025906 Bacteria 11868
140 Ga0207705_10011129 3300025909 Bacteria 6522
141 Ga0207654_10002418 3300025911 Bacteria 9533
142 Ga0207654_10013103 3300025911 Bacteria 4261
143 Ga0207707_10034940 3300025912 Bacteria 4397
144 Ga0207695_10000449 3300025913 Bacteria 89856
145 Ga0207695_10013520 3300025913 Bacteria 9729
146 Ga0207671_10000052 3300025914 Bacteria 188462
147 Ga0207671_10000580 3300025914 Bacteria 48907
148 Ga0207693_10000602 3300025915 Bacteria 32212
149 Ga0207663_10119603 3300025916 Bacteria 1801
150 Ga0207657_10013589 3300025919 Bacteria 7985
151 Ga0207694_10000079 3300025924 Bacteria 111767
152 Ga0207694_10037053 3300025924 Bacteria 3743
153 Ga0207694_10067059 3300025924 Bacteria 2801
154 Ga0207687_10018220 3300025927 Bacteria 4631
155 Ga0207664_10006688 3300025929 Bacteria 7953
156 Ga0207664_10024716 3300025929 Bacteria 4517
157 Ga0207644_10036679 3300025931 Bacteria 3444
158 Ga0207686_10036736 3300025934 Bacteria 2952
159 Ga0207686_10126933 3300025934 Bacteria 1745
160 Ga0207709_10029384 3300025935 Bacteria 3188
161 Ga0207669_10044145 3300025937 Bacteria 2617
162 Ga0207665_10003722 3300025939 Bacteria 10187
163 Ga0207689_10004009 3300025942 Bacteria 13393
164 Ga0207661_10148198 3300025944 Bacteria 2026
165 Ga0207679_10006682 3300025945 Bacteria 7303
166 Ga0207667_10008068 3300025949 Bacteria 12548
167 Ga0207667_10258671 3300025949 Bacteria 1780
168 Ga0207651_10015401 3300025960 Bacteria 4443
169 Ga0207640_10007132 3300025981 Bacteria 6158
170 Ga0207703_10051971 3300026035 Bacteria 3325
171 Ga0207703_10184631 3300026035 Bacteria 1842
172 Ga0207639_10081722 3300026041 Bacteria 2560
173 Ga0207678_10007867 3300026067 Bacteria 9405
174 Ga0207708_10159261 3300026075 Bacteria 1782
175 Ga0207708_10242311 3300026075 Bacteria 1450
176 Ga0207648_10007779 3300026089 Bacteria 10465
177 Ga0207676_10057652 3300026095 Bacteria 3060
178 Ga0207674_10017090 3300026116 Bacteria 7919
179 Ga0207674_10063468 3300026116 Bacteria 3729
180 Ga0207675_100008679 3300026118 Bacteria 9554
181 Ga0207675_100115019 3300026118 Bacteria 2541
182 Ga0207698_10017352 3300026142 Bacteria 4880
183 Ga0207698_10254149 3300026142 Bacteria 1610
184 Ga0209813_10001795 3300027866 Bacteria 4835
185 Ga0209813_10005253 3300027866 Bacteria 3134
186 Ga0207428_10005928 3300027907 Bacteria 11312
187 Ga0207428_10080214 3300027907 Bacteria 2550
188 Ga0268266_10007187 3300028379 Bacteria 10083
189 Ga0268266_10015277 3300028379 Bacteria 6591
190 Ga0268266_10020552 3300028379 Bacteria 5626
191 Ga0268266_10148357 3300028379 Bacteria 2111
192 Ga0268264_10000374 3300028381 Bacteria 65781
193 Ga0265337_1016808 3300028556 Bacteria 2358
194 Ga0265326_10000388 3300028558 Bacteria 17873
195 Ga0307517_10002400 3300028786 Bacteria 30069
196 Ga0307517_10006298 3300028786 Bacteria 17623
197 Ga0307517_10119485 3300028786 Bacteria 1956
198 Ga0307515_10001177 3300028794 Bacteria 59836
199 Ga0307511_10029836 3300030521 Bacteria 4913
200 Ga0307512_10005436 3300030522 Bacteria 13305
201 Ga0265327_10000630 3300031251 Bacteria 57536
202 Ga0307513_10016493 3300031456 Bacteria 8902
203 Ga0307513_10023232 3300031456 Bacteria 7249
204 Ga0307513_10077152 3300031456 Bacteria 3452
205 Ga0307513_10102899 3300031456 Bacteria 2874
206 Ga0307408_100008922 3300031548 Bacteria 6625
207 Ga0307408_100010849 3300031548 Bacteria 6012
208 Ga0307408_100112552 3300031548 Bacteria 2093
209 Ga0307508_10005680 3300031616 Bacteria 11819
210 Ga0307508_10014629 3300031616 Bacteria 7158
211 Ga0307508_10064626 3300031616 Bacteria 3226
212 Ga0307514_10037111 3300031649 Bacteria 3868
213 Ga0316579_10015603 3300031691 Bacteria 3304
214 Ga0307516_10010111 3300031730 Bacteria 10429
215 Ga0307405_10000511 3300031731 Bacteria 14619
216 Ga0316577_10011424 3300031733 Bacteria 4808
217 Ga0307413_10000901 3300031824 Bacteria 10505
218 Ga0307413_10015857 3300031824 Bacteria 3874
219 Ga0307413_10027245 3300031824 Bacteria 3163
220 Ga0307410_10043450 3300031852 Bacteria 2978
221 Ga0307410_10182567 3300031852 Bacteria 1589
222 Ga0307406_10000019 3300031901 Bacteria 98555
223 Ga0307407_10004007 3300031903 Bacteria 6162
224 Ga0307412_10018856 3300031911 Bacteria 4163
225 Ga0307409_100078970 3300031995 Bacteria 2650
226 Ga0307409_100094875 3300031995 Bacteria 2456
227 Ga0307409_100310526 3300031995 Bacteria 1471
228 Ga0307416_100000040 3300032002 Bacteria 132572
229 Ga0307416_100015467 3300032002 Bacteria 5274
230 Ga0307416_100033810 3300032002 Bacteria 3882
231 Ga0307414_10002067 3300032004 Bacteria 10425
232 Ga0307414_10009244 3300032004 Bacteria 5651
233 Ga0307411_10000062 3300032005 Bacteria 32207
234 Ga0307411_10012877 3300032005 Bacteria 4586
235 Ga0307411_10047651 3300032005 Bacteria 2772
236 Ga0307415_100002141 3300032126 Bacteria 9778
237 Ga0307415_100005448 3300032126 Bacteria 6761
238 Ga0307415_100047103 3300032126 Bacteria 2901
239 Ga0307415_100069236 3300032126 Bacteria 2473
240 Ga0316574_0003441 3300035398 Bacteria 8157
241 Ga0316574_0058133 3300035398 Bacteria 2422
242 Ga0316584_0055895 3300036712 Bacteria 2955
243 Ga0395899_0065927 3300037312 Bacteria 2660
244 Ga0395900_0128670 3300037418 Bacteria 2596
245 Ga0395898_0053416 3300037466 Bacteria 3946
246 Ga0395898_0114731 3300037466 Bacteria 2581
247 Ga0395901_0008656 3300038443 Bacteria 10283
248 Ga0395901_0029700 3300038443 Bacteria 5629
249 Ga0395901_0099361 3300038443 Bacteria 3051
250 Ga0395901_0160644 3300038443 Bacteria 2360
251 Ga0395901_0256540 3300038443 Bacteria 1821
252 Ga0400485_14323 3300038735 Bacteria 58881
253 Ga0400488_07225 3300038741 Bacteria 3313
254 Ga0400486_16675 3300038742 Bacteria 25458
255 Ga0439461_0000895 3300041410 Bacteria 4424
256 Ga0439466_0026182 3300041411 Bacteria 2030
257 Ga0439431_0004227 3300041997 Bacteria 3151
258 Ga0439442_016345 3300042002 Bacteria 1530
259 Ga0439448_0030378 3300042005 Bacteria 1714
260 Ga0439448_0030485 3300042005 Bacteria 1711
261 Ga0439457_005570 3300042014 Bacteria 3152
262 Ga0439463_017598 3300042016 Bacteria 1773
263 Ga0450902_005362 3300042137 Bacteria 1933
264 Ga0450903_000042 3300042138 Bacteria 24733
265 Ga0439446_0013258 3300042156 Bacteria 2260
266 Ga0439458_0001348 3300042157 Bacteria 6191
267 Ga0439434_0003877 3300042435 Bacteria 4368
268 Ga0439459_0012755 3300042438 Bacteria 1501
269 Ga0439440_0001853 3300042993 Bacteria 3922
270 Ga0439440_0002277 3300042993 Bacteria 3604
271 Ga0466969_0001418 3300044656 Bacteria 12922
272 Ga0466969_0003205 3300044656 Bacteria 8713
273 Ga0466969_0004397 3300044656 Bacteria 7494
274 Ga0466972_0056342 3300044658 Bacteria 1890
275 Ga0466965_0003169 3300044683 Bacteria 7181
276 Ga0466965_0005755 3300044683 Bacteria 5594
277 Ga0466965_0056712 3300044683 Bacteria 1951
278 Ga0466966_0002097 3300044684 Bacteria 12945
279 Ga0466966_0002225 3300044684 Bacteria 12619
280 Ga0466966_0002490 3300044684 Bacteria 12063
281 Ga0466966_0005466 3300044684 Bacteria 8354
282 Ga0466966_0006467 3300044684 Bacteria 7754
283 Ga0466966_0025916 3300044684 Bacteria 3830
284 Ga0466966_0105399 3300044684 Bacteria 1741
285 Ga0466961_0006972 3300044693 Bacteria 7188
286 Ga0466961_0010029 3300044693 Bacteria 6034
287 Ga0466961_0021195 3300044693 Bacteria 4183
288 Ga0466961_0030018 3300044693 Bacteria 3493
289 Ga0466961_0045720 3300044693 Bacteria 2800
290 Ga0466961_0057787 3300044693 Bacteria 2469
291 Ga0466961_0057919 3300044693 Bacteria 2465
292 Ga0466963_0006392 3300044694 Bacteria 6969
293 Ga0466963_0029351 3300044694 Bacteria 3540
294 Ga0466964_0026522 3300044706 Bacteria 2268
295 Ga0466971_0006943 3300044719 Bacteria 4924
296 Ga0466968_0010428 3300044735 Bacteria 3603
297 Ga0466970_0000821 3300044765 Bacteria 14916
298 Ga0466970_0005211 3300044765 Bacteria 6433
299 Ga0466970_0006446 3300044765 Bacteria 5869
300 Ga0466970_0008060 3300044765 Bacteria 5291
301 Ga0466970_0009711 3300044765 Bacteria 4868
302 Ga0466970_0034286 3300044765 Bacteria 2686
303 Ga0466957_0001983 3300044842 Bacteria 10901
304 Ga0466957_0016357 3300044842 Bacteria 4338
305 Ga0466960_0005774 3300044901 Bacteria 4926
306 Ga0466960_0010227 3300044901 Bacteria 3894
307 Ga0466959_0012867 3300045049 Bacteria 6056
308 Ga0466959_0026000 3300045049 Bacteria 4340
309 Ga0466959_0032027 3300045049 Bacteria 3890
310 Ga0466959_0042996 3300045049 Bacteria 3332
311 Ga0466959_0043923 3300045049 Bacteria 3293
312 Ga0466959_0098778 3300045049 Bacteria 2091
313 Ga0451576_0078962 3300045051 Bacteria 3424
314 Ga0466958_0002731 3300045836 Bacteria 8951
315 Ga0466958_0009827 3300045836 Bacteria 5338
316 Ga0466967_0017591 3300045976 Bacteria 5682
317 Ga0466967_0036385 3300045976 Bacteria 4202
318 Ga0466967_0042514 3300045976 Bacteria 3928
319 Ga0466967_0046247 3300045976 Bacteria 3788
320 Ga0466967_0151430 3300045976 Bacteria 2168
321 Ga0495592_0007921 3300046454 Bacteria 7967
322 Ga0495592_0008939 3300046454 Bacteria 7521
323 Ga0495603_0084999 3300046455 Bacteria 1852
324 Ga0495603_0085586 3300046455 Bacteria 1845
325 Ga0495629_0004039 3300046459 Bacteria 11030
326 Ga0495629_0004832 3300046459 Bacteria 10102
327 Ga0495629_0018751 3300046459 Bacteria 4946
328 Ga0495629_0062864 3300046459 Bacteria 2592
329 Ga0495638_0026034 3300046460 Bacteria 3797
330 Ga0495638_0070088 3300046460 Bacteria 2147
331 Ga0495651_0000129 3300046462 Bacteria 56034
332 Ga0495651_0000877 3300046462 Bacteria 23370
333 Ga0495651_0002270 3300046462 Bacteria 14836
334 Ga0495651_0002743 3300046462 Bacteria 13659
335 Ga0495651_0020641 3300046462 Bacteria 5114
336 Ga0495651_0035079 3300046462 Bacteria 3907
337 Ga0495651_0064795 3300046462 Bacteria 2792
338 Ga0495653_0003805 3300046463 Bacteria 12215
339 Ga0495653_0052219 3300046463 Bacteria 3134
340 Ga0495580_0070581 3300046472 Bacteria 2440
341 Ga0495662_0002591 3300046476 Bacteria 9136
342 Ga0495664_0011037 3300046477 Bacteria 5082
343 Ga0495585_0007060 3300046492 Bacteria 6907
344 Ga0495585_0065273 3300046492 Bacteria 1995
345 Ga0495594_0000534 3300046499 Bacteria 19485
346 Ga0495608_0014307 3300046511 Bacteria 5505
347 Ga0495616_0033346 3300046513 Bacteria 2684
348 Ga0495620_0023194 3300046515 Bacteria 2973
349 Ga0495628_0013131 3300046516 Bacteria 6972
350 Ga0495628_0017507 3300046516 Bacteria 5963
351 Ga0495628_0043231 3300046516 Bacteria 3590
352 Ga0495628_0048477 3300046516 Bacteria 3367
353 Ga0495632_0013008 3300046519 Bacteria 4770
354 Ga0495643_0003319 3300046522 Bacteria 11874
355 Ga0495643_0011979 3300046522 Bacteria 5248
356 Ga0495643_0079387 3300046522 Bacteria 1711
357 Ga0495666_0013332 3300046526 Bacteria 4098
358 Ga0495652_0000654 3300046529 Bacteria 40137
359 Ga0495652_0002119 3300046529 Bacteria 20914
360 Ga0495652_0002317 3300046529 Bacteria 19797
361 Ga0495652_0006834 3300046529 Bacteria 10573
362 Ga0495652_0013171 3300046529 Bacteria 7446
363 Ga0495652_0038084 3300046529 Bacteria 4168
364 Ga0495652_0040281 3300046529 Bacteria 4037
365 Ga0495652_0084400 3300046529 Bacteria 2612
366 Ga0495640_0012881 3300046533 Bacteria 6377
367 Ga0495640_0017126 3300046533 Bacteria 5407
368 Ga0495640_0018021 3300046533 Bacteria 5249
369 Ga0495640_0018600 3300046533 Bacteria 5146
370 Ga0495587_0003288 3300046536 Bacteria 10788
371 Ga0495587_0022087 3300046536 Bacteria 3919
372 Ga0495645_0004398 3300046543 Bacteria 9628
373 Ga0495645_0023172 3300046543 Bacteria 4495
374 Ga0495622_0011920 3300046557 Bacteria 4021
375 Ga0495633_0048814 3300046558 Bacteria 1998
376 Ga0495667_0020606 3300046559 Bacteria 4447
377 Ga0495667_0028673 3300046559 Bacteria 3749
378 Ga0495634_0012335 3300046642 Bacteria 6192
379 Ga0495634_0017379 3300046642 Bacteria 5133
380 Ga0495634_0052248 3300046642 Bacteria 2739
381 Ga0495611_0028558 3300046648 Bacteria 2443
382 Ga0495625_0005807 3300046660 Bacteria 11145
383 Ga0495635_0004355 3300046663 Bacteria 9800
384 Ga0495635_0005875 3300046663 Bacteria 8556
385 Ga0495635_0016061 3300046663 Bacteria 5228
386 Ga0495588_0002549 3300046674 Bacteria 7786
387 Ga0495588_0130716 3300046674 Bacteria 1324
388 Ga0495657_0003629 3300046675 Bacteria 12539
389 Ga0495657_0016996 3300046675 Bacteria 5288
390 Ga0495657_0019934 3300046675 Bacteria 4831
391 Ga0495599_0012610 3300046678 Bacteria 5212
392 Ga0495623_0058203 3300046679 Bacteria 2430
393 Ga0495623_0066863 3300046679 Bacteria 2244
394 Ga0495646_0000855 3300046680 Bacteria 17256
395 Ga0495646_0107181 3300046680 Bacteria 1594
396 Ga0495613_0023073 3300046689 Bacteria 4637
397 Ga0495624_0007422 3300046690 Bacteria 7692
398 Ga0495670_0006366 3300046691 Bacteria 5797
399 Ga0495671_0027068 3300046692 Bacteria 2964
400 Ga0495589_0029739 3300046794 Bacteria 2754
401 Ga0495600_0001072 3300046809 Bacteria 14861
402 Ga0495600_0035679 3300046809 Bacteria 3231
403 Ga0495600_0075430 3300046809 Bacteria 2202
404 Ga0495660_0007437 3300046810 Bacteria 6431
405 Ga0495581_0008614 3300047315 Bacteria 5909
406 Ga0495581_0042500 3300047315 Bacteria 2631
407 Ga0495604_0010118 3300047317 Bacteria 7472
408 Ga0495604_0011789 3300047317 Bacteria 6950
409 Ga0495604_0116883 3300047317 Bacteria 1935
410 Ga0495636_0034595 3300047318 Bacteria 2080
411 Ga0495676_0008079 3300047321 Bacteria 9654
412 Ga0495676_0026725 3300047321 Bacteria 4962
413 Ga0495676_0096093 3300047321 Bacteria 2203
414 Ga0495675_0015922 3300047444 Bacteria 4755
415 Ga0495675_0025100 3300047444 Bacteria 3801
416 Ga0495675_0060804 3300047444 Bacteria 2394
417 Ga0495685_000486 3300047447 Bacteria 12295
418 Ga0495681_0000590 3300047470 Bacteria 27737
419 Ga0495681_0004760 3300047470 Bacteria 9198
420 Ga0495684_0055850 3300047471 Bacteria 3011
421 Ga0495686_0050971 3300047472 Bacteria 2599
422 Ga0495602_0060791 3300048088 Bacteria 3290
423 Ga0495614_0002125 3300048089 Bacteria 8769
424 Ga0496100_0001299 3300048903 Bacteria 12190
425 Ga0496100_0034974 3300048903 Bacteria 3157
426 Ga0496100_0058356 3300048903 Bacteria 2532
427 Ga0496101_0000108 3300048904 Bacteria 86290
428 Ga0496101_0043038 3300048904 Bacteria 3225
429 Ga0496101_0066956 3300048904 Bacteria 2621
430 Ga0496102_0000005 3300048905 Bacteria 481937
431 Ga0496102_0030302 3300048905 Bacteria 4842
432 Ga0496102_0041912 3300048905 Bacteria 4147
433 Ga0496102_0210018 3300048905 Bacteria 1835
434 Ga0496103_0000002 3300048906 Bacteria 605387
435 Ga0496103_0056359 3300048906 Bacteria 2439
436 Ga0496104_0007962 3300048907 Bacteria 9397
437 Ga0496104_0145031 3300048907 Bacteria 2280
438 Ga0496105_0002357 3300048908 Bacteria 13685
439 Ga0496105_0022117 3300048908 Bacteria 5151
440 Ga0496105_0035803 3300048908 Bacteria 4087
441 Ga0496105_0187628 3300048908 Bacteria 1692
442 Ga0496106_0001149 3300048909 Bacteria 19609
443 Ga0496106_0015048 3300048909 Bacteria 5725
444 Ga0496106_0021137 3300048909 Bacteria 4832
445 Ga0496106_0087147 3300048909 Bacteria 2405
446 Ga0496107_0012322 3300048910 Bacteria 5969
447 Ga0496107_0038012 3300048910 Bacteria 3455
448 Ga0496107_0073522 3300048910 Bacteria 2486
449 Ga0496108_0001760 3300048911 Bacteria 17219
450 Ga0496108_0021929 3300048911 Bacteria 5250
451 Ga0496108_0090417 3300048911 Bacteria 2602
452 Ga0496109_0014852 3300048912 Bacteria 6775
453 Ga0496109_0026161 3300048912 Bacteria 5202
454 Ga0496109_0034523 3300048912 Bacteria 4556
455 Ga0496109_0080158 3300048912 Bacteria 3008
456 Ga0496109_0241200 3300048912 Bacteria 1701
457 Ga0496110_0004424 3300048913 Bacteria 10886
458 Ga0496110_0040490 3300048913 Bacteria 4060
459 Ga0496111_0065120 3300048914 Bacteria 2645
460 Ga0496112_0008515 3300048915 Bacteria 9188
461 Ga0496113_0045946 3300048916 Bacteria 3241
462 Ga0496113_0111951 3300048916 Bacteria 2126
463 Ga0496114_0000890 3300048917 Bacteria 22328
464 Ga0496114_0010650 3300048917 Bacteria 7319
465 Ga0496115_0015781 3300048918 Bacteria 5736
466 Ga0496115_0026477 3300048918 Bacteria 4526
467 Ga0496116_0000034 3300048919 Bacteria 409567
468 Ga0496117_0000003 3300048920 Bacteria 1881097
469 Ga0496118_0000001 3300048921 Bacteria 1881100
470 Ga0496119_0000669 3300048922 Bacteria 45985
471 Ga0496119_0102432 3300048922 Bacteria 1605
472 Ga0496120_0000594 3300048923 Bacteria 54781
473 Ga0496121_0003113 3300048924 Bacteria 23968
474 Ga0496124_0031963 3300048927 Bacteria 4655
475 Ga0496126_0000178 3300048929 Bacteria 145079
476 Ga0496126_0046522 3300048929 Bacteria 3979
477 Ga0501031_0003124 3300049568 Bacteria 10615
478 Ga0501031_0012776 3300049568 Bacteria 5486
479 Ga0501031_0013104 3300049568 Bacteria 5408
480 Ga0501031_0063185 3300049568 Bacteria 2412
481 Ga0501031_0080746 3300049568 Bacteria 2119
482 Ga0501032_0000686 3300049569 Bacteria 27531
483 Ga0501032_0007044 3300049569 Bacteria 8247
484 Ga0501032_0009613 3300049569 Bacteria 7008
485 Ga0501032_0025746 3300049569 Bacteria 4055
486 Ga0501032_0067229 3300049569 Bacteria 2394
487 Ga0501032_0082971 3300049569 Bacteria 2132
488 Ga0501032_0088277 3300049569 Bacteria 2059
489 Ga0501033_0003959 3300049570 Bacteria 12010
490 Ga0501033_0009007 3300049570 Bacteria 7700
491 Ga0501033_0011728 3300049570 Bacteria 6702
492 Ga0501033_0028770 3300049570 Bacteria 4175
493 Ga0501033_0037585 3300049570 Bacteria 3623
494 Ga0501034_0000700 3300049571 Bacteria 50894
495 Ga0501034_0000987 3300049571 Bacteria 40823
496 Ga0501034_0008931 3300049571 Bacteria 10535
497 Ga0501034_0020937 3300049571 Bacteria 6676
498 Ga0501034_0037777 3300049571 Bacteria 4890
499 Ga0501034_0041324 3300049571 Bacteria 4665
500 Ga0501034_0044577 3300049571 Bacteria 4484
501 Ga0501034_0052775 3300049571 Bacteria 4095
502 Ga0501034_0168769 3300049571 Bacteria 2156
503 Ga0501036_0001560 3300049572 Bacteria 17694
504 Ga0501036_0010572 3300049572 Bacteria 7625
505 Ga0501036_0011932 3300049572 Bacteria 7203
506 Ga0501036_0014281 3300049572 Bacteria 6608
507 Ga0501036_0018022 3300049572 Bacteria 5912
508 Ga0501036_0018754 3300049572 Bacteria 5803
509 Ga0501036_0030414 3300049572 Bacteria 4561
510 Ga0501036_0034631 3300049572 Bacteria 4272
511 Ga0501036_0045495 3300049572 Bacteria 3718
512 Ga0501037_0001087 3300049573 Bacteria 20162
513 Ga0501037_0023459 3300049573 Bacteria 4562
514 Ga0501037_0025618 3300049573 Bacteria 4357
515 Ga0501038_0001242 3300049574 Bacteria 23113
516 Ga0501038_0002500 3300049574 Bacteria 17111
517 Ga0501038_0025955 3300049574 Bacteria 5218
518 Ga0501038_0073141 3300049574 Bacteria 2903
519 Ga0501039_0004281 3300049575 Bacteria 10759
520 Ga0501039_0014667 3300049575 Bacteria 5995
521 Ga0501039_0021995 3300049575 Bacteria 4893
522 Ga0501039_0023058 3300049575 Bacteria 4775
523 Ga0501039_0025256 3300049575 Bacteria 4564
524 Ga0501039_0097693 3300049575 Bacteria 2290
525 Ga0501040_0001045 3300049576 Bacteria 17510
526 Ga0501041_0000883 3300049577 Bacteria 16205
527 Ga0501042_0002602 3300049578 Bacteria 11093
528 Ga0501042_0007307 3300049578 Bacteria 7228
529 Ga0501042_0037201 3300049578 Bacteria 3454
530 Ga0501043_0000867 3300049579 Bacteria 26805
531 Ga0501043_0005179 3300049579 Bacteria 10551
532 Ga0501043_0035627 3300049579 Bacteria 3914
533 Ga0501043_0035665 3300049579 Bacteria 3912
534 Ga0501043_0050090 3300049579 Bacteria 3283
535 Ga0501043_0060168 3300049579 Bacteria 2981
536 Ga0501043_0189793 3300049579 Bacteria 1598
537 Ga0501046_0000707 3300049580 Bacteria 32240
538 Ga0501046_0006561 3300049580 Bacteria 10288
539 Ga0501046_0038654 3300049580 Bacteria 3827
540 Ga0501047_0000112 3300049581 Bacteria 98939
541 Ga0501047_0000216 3300049581 Bacteria 69275
542 Ga0501047_0000544 3300049581 Bacteria 40681
543 Ga0501047_0003079 3300049581 Bacteria 15814
544 Ga0501047_0011943 3300049581 Bacteria 8220
545 Ga0501047_0023263 3300049581 Bacteria 5950
546 Ga0501047_0060538 3300049581 Bacteria 3653
547 Ga0501047_0063225 3300049581 Bacteria 3570
548 Ga0501047_0065503 3300049581 Bacteria 3502
549 Ga0501047_0145819 3300049581 Bacteria 2244
550 Ga0501048_0002418 3300049582 Bacteria 14247
551 Ga0501048_0003490 3300049582 Bacteria 11951
552 Ga0501048_0005883 3300049582 Bacteria 9335
553 Ga0501048_0010821 3300049582 Bacteria 6802
554 Ga0501067_0002973 3300049583 Bacteria 9353
555 Ga0501068_0000652 3300049584 Bacteria 17789
556 Ga0501068_0030095 3300049584 Bacteria 3218
557 Ga0501069_0001987 3300049585 Bacteria 10227
558 Ga0501070_0005364 3300049586 Bacteria 10933
559 Ga0501070_0008447 3300049586 Bacteria 8696
560 Ga0501070_0024422 3300049586 Bacteria 5071
561 Ga0501070_0057881 3300049586 Bacteria 3213
562 Ga0501071_0003645 3300049587 Bacteria 9658
563 Ga0501071_0008460 3300049587 Bacteria 6805
564 Ga0501072_0008562 3300049588 Bacteria 7758
565 Ga0501072_0013685 3300049588 Bacteria 6212
566 Ga0501073_0003012 3300049589 Bacteria 12622
567 Ga0501073_0014251 3300049589 Bacteria 5772
568 Ga0501073_0095406 3300049589 Bacteria 2065
569 Ga0501074_0002273 3300049590 Bacteria 13362
570 Ga0501074_0016485 3300049590 Bacteria 5363
571 Ga0501074_0029004 3300049590 Bacteria 4009
572 Ga0501074_0052805 3300049590 Bacteria 2933
573 Ga0501076_0207672 3300049592 Bacteria 1600
574 Ga0501077_0017485 3300049593 Bacteria 4527
575 Ga0501079_0002562 3300049741 Bacteria 13200
576 Ga0501079_0056015 3300049741 Bacteria 3042
577 Ga0501080_0023738 3300049742 Bacteria 5682
578 Ga0501080_0027729 3300049742 Bacteria 5266
579 Ga0501080_0073993 3300049742 Bacteria 3169
580 Ga0501081_0077702 3300049743 Bacteria 2320
581 Ga0501083_0010392 3300049744 Bacteria 6553
582 Ga0501083_0012707 3300049744 Bacteria 5890
583 Ga0501035_0000870 3300049822 Bacteria 32141
584 Ga0501035_0004451 3300049822 Bacteria 13296
585 Ga0501035_0004984 3300049822 Bacteria 12582
586 Ga0501035_0007027 3300049822 Bacteria 10518
587 Ga0501035_0120484 3300049822 Bacteria 2294
588 Ga0501044_0002317 3300049823 Bacteria 21701
589 Ga0501044_0006618 3300049823 Bacteria 12782
590 Ga0501044_0010095 3300049823 Bacteria 10259
591 Ga0501044_0010614 3300049823 Bacteria 9992
592 Ga0501044_0020341 3300049823 Bacteria 7085
593 Ga0501044_0056404 3300049823 Bacteria 4033
594 Ga0501045_0007837 3300049824 Bacteria 7430
595 Ga0501045_0014319 3300049824 Bacteria 5619
596 Ga0501045_0024013 3300049824 Bacteria 4376
597 nmdc:mga03683_13553_c1 3300050489 Bacteria 3003
598 nmdc:mga03n38_3148_c1 3300050490 Bacteria 5253
599 nmdc:mga03n38_48181_c1 3300050490 Bacteria 1890
600 nmdc:mga00v17_25768_c1 3300050491 Bacteria 3421
601 nmdc:mga00v17_31601_c1 3300050491 Bacteria 3124
602 nmdc:mga00v17_37665_c1 3300050491 Bacteria 2889
603 nmdc:mga00v17_64405_c1 3300050491 Bacteria 2259
604 nmdc:mga0yw44_40379_c1 3300050492 Bacteria 2772
605 nmdc:mga0yw44_4245_c1 3300050492 Bacteria 6531
606 nmdc:mga0yw44_4616_c1 3300050492 Bacteria 6355
607 nmdc:mga0yw44_72200_c1 3300050492 Bacteria 2145
608 nmdc:mga06z11_3386_c1 3300050494 Bacteria 6166
609 nmdc:mga06z11_41662_c1 3300050494 Bacteria 2299
610 nmdc:mga06z11_7320_c1 3300050494 Bacteria 4535
611 nmdc:mga06z11_7458_c1 3300050494 Bacteria 4501
612 nmdc:mga06z11_9099_c1 3300050494 Bacteria 4173
613 nmdc:mga04h51_22456_c1 3300050495 Bacteria 1909
614 nmdc:mga04h51_2262_c1 3300050495 Bacteria 4538
615 nmdc:mga04h51_24566_c1 3300050495 Bacteria 1847
616 nmdc:mga07m45_43203_c1 3300050496 Bacteria 2199
617 nmdc:mga07m45_43272_c1 3300050496 Bacteria 2525
618 nmdc:mga05p37_36587_c1 3300050507 Bacteria 6021
619 nmdc:mga05p37_41527_c1 3300050507 Bacteria 5647
620 nmdc:mga09592_279267_c1 3300050508 Bacteria 1449
621 nmdc:mga0qj67_7306_c1 3300050509 Bacteria 8167
622 nmdc:mga06r32_35629_c1 3300050510 Bacteria 4696
623 nmdc:mga06r32_43895_c1 3300050510 Bacteria 4255
624 nmdc:mga08y16_13478_c1 3300050511 Bacteria 8012
625 nmdc:mga08y16_26727_c1 3300050511 Bacteria 6082
626 nmdc:mga0n895_1812_c1 3300050512 Bacteria 16262
627 nmdc:mga0n895_24204_c1 3300050512 Bacteria 5721
628 nmdc:mga0a205_120_c1 3300050515 Bacteria 47367
629 nmdc:mga0a205_5052_c1 3300050515 Bacteria 11878
630 Ga0495601_0007351 3300053077 Bacteria 6458
631 Ga0495601_0019263 3300053077 Bacteria 4161
632 Ga0495612_0000768 3300053078 Bacteria 13075
633 Ga0495619_0031757 3300053085 Bacteria 3423
634 Ga0495619_0062140 3300053085 Bacteria 2486
635 Ga0500578_0008090 3300053086 Bacteria 6887
636 Ga0500644_0000148 3300053088 Bacteria 43939
637 Ga0500640_000199 3300053095 Bacteria 12879
638 Ga0500650_0081793 3300053098 Bacteria 1511
639 Ga0500556_0000485 3300053104 Bacteria 27724
640 Ga0500556_0009470 3300053104 Bacteria 2832
641 Ga0500558_026568 3300053106 Bacteria 2460
642 Ga0500569_007352 3300053109 Bacteria 2466
643 Ga0500652_000612 3300053131 Bacteria 12304
644 Ga0500652_001049 3300053131 Bacteria 8969
645 Ga0500658_0003635 3300053134 Bacteria 5819
646 Ga0500600_0003949 3300053149 Bacteria 8643
647 Ga0500616_0000466 3300053153 Bacteria 52609
648 Ga0500616_0001931 3300053153 Bacteria 18503
649 Ga0500616_0014693 3300053153 Bacteria 4491
650 Ga0500633_0016697 3300053160 Bacteria 2136
651 Ga0500634_0027336 3300053161 Bacteria 3108
652 Ga0500656_000440 3300053732 Bacteria 3038
653 Ga0501084_0001814 3300054114 Bacteria 17044
654 Ga0501084_0037634 3300054114 Bacteria 4043
655 Ga0501084_0159640 3300054114 Bacteria 1902
656 Ga0501082_0009754 3300060353 Bacteria 8272
657 Ga0501082_0062671 3300060353 Bacteria 3201
658 Ga0466962_0000729 3300061719 Bacteria 14725
659 Ga0466962_0005792 3300061719 Bacteria 5936
660 Ga0466962_0024363 3300061719 Bacteria 2907
661 Ga0530510_0095798 3300061734 Bacteria 2168

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738543028 2739335203 380
2 3300042438 Ga0439459_0012755 Ga0439459_0012755_301_1461 386
3 3300046459 Ga0495629_0018751 Ga0495629_0018751_16_1182 388
4 3300046674 Ga0495588_0130716 Ga0495588_0130716_28_1194 388
5 3300047444 Ga0495675_0015922 Ga0495675_0015922_10_1176 388
6 3300028556 Ga0265337_1016808 Ga0265337_10168082 390
7 3300044706 Ga0466964_0026522 Ga0466964_0026522_1068_2252 391
8 3300048907 Ga0496104_0145031 Ga0496104_0145031_1080_2255 391
9 3300048912 Ga0496109_0241200 Ga0496109_0241200_25_1200 391
10 3300049586 Ga0501070_0057881 Ga0501070_0057881_2017_3192 391
11 3300035398 Ga0316574_0058133 Ga0316574_0058133_167_1405 394
12 3300031691 Ga0316579_10015603 Ga0316579_100156032 396
13 3300031733 Ga0316577_10011424 Ga0316577_100114243 396
14 3300036712 Ga0316584_0055895 Ga0316584_0055895_1458_2732 396
15 3300028558 Ga0265326_10000388 Ga0265326_100003888 397
16 3300002075 JGI24738J21930_10007021 JGI24738J21930_100070213 398
17 3300048905 Ga0496102_0041912 Ga0496102_0041912_2919_4124 401
18 3300044683 Ga0466965_0003169 Ga0466965_0003169_5214_6542 408
19 3300053085 Ga0495619_0062140 Ga0495619_0062140_824_2137 408
20 3300050508 nmdc:mga09592_279267_c1 nmdc:mga09592_279267_c1_24_1274 416
21 3300042005 Ga0439448_0030378 Ga0439448_0030378_53_1447 418
22 3300005548 Ga0070665_100131433 Ga0070665_1001314333 419
23 3300005563 Ga0068855_100007296 Ga0068855_1000072967 419
24 3300009093 Ga0105240_10097021 Ga0105240_100970213 419
25 3300009174 Ga0105241_10003698 Ga0105241_100036989 419
26 3300009545 Ga0105237_10228148 Ga0105237_102281483 419
27 3300009551 Ga0105238_10041156 Ga0105238_100411563 419
28 3300025904 Ga0207647_10029337 Ga0207647_100293373 419
29 3300025911 Ga0207654_10013103 Ga0207654_100131033 419
30 3300025913 Ga0207695_10013520 Ga0207695_100135205 419
31 3300025914 Ga0207671_10000580 Ga0207671_1000058027 419
32 3300025924 Ga0207694_10037053 Ga0207694_100370532 419
33 3300025949 Ga0207667_10258671 Ga0207667_102586713 419
34 3300028379 Ga0268266_10148357 Ga0268266_101483571 419
35 3300046529 Ga0495652_0084400 Ga0495652_0084400_179_1447 420
36 3300053077 Ga0495601_0007351 Ga0495601_0007351_471_1739 420
37 3300046462 Ga0495651_0000129 Ga0495651_0000129_28627_29916 422
38 3300046516 Ga0495628_0043231 Ga0495628_0043231_2244_3533 422
39 3300046529 Ga0495652_0002317 Ga0495652_0002317_313_1602 422
40 iso_pu_bacteria 2902792274 2902798017 425
41 3300044693 Ga0466961_0057787 Ga0466961_0057787_772_2100 427
42 iso_pu_bacteria 2902810491 2902815763 427
43 3300048922 Ga0496119_0102432 Ga0496119_0102432_89_1405 428
44 3300044683 Ga0466965_0005755 Ga0466965_0005755_952_2280 429
45 3300044684 Ga0466966_0002225 Ga0466966_0002225_9489_10817 429
46 3300044693 Ga0466961_0045720 Ga0466961_0045720_239_1567 429
47 3300044694 Ga0466963_0006392 Ga0466963_0006392_1529_2857 429
48 3300044765 Ga0466970_0009711 Ga0466970_0009711_36_1364 429
49 3300045049 Ga0466959_0032027 Ga0466959_0032027_34_1362 429
50 3300061719 Ga0466962_0000729 Ga0466962_0000729_223_1551 429
51 3300003792 Ga0055540_1000539 Ga0055540_10005397 430
52 3300006051 Ga0075364_10031721 Ga0075364_100317213 430
53 3300041410 Ga0439461_0000895 Ga0439461_0000895_2039_3340 430
54 3300041411 Ga0439466_0026182 Ga0439466_0026182_475_1776 430
55 3300048903 Ga0496100_0001299 Ga0496100_0001299_9026_10336 430
56 3300048904 Ga0496101_0000108 Ga0496101_0000108_27102_28412 430
57 3300048905 Ga0496102_0000005 Ga0496102_0000005_100140_101450 430
58 3300048906 Ga0496103_0000002 Ga0496103_0000002_380518_381828 430
59 3300048909 Ga0496106_0001149 Ga0496106_0001149_17867_19177 430
60 3300048919 Ga0496116_0000034 Ga0496116_0000034_28006_29316 430
61 3300048920 Ga0496117_0000003 Ga0496117_0000003_972654_973964 430
62 3300048921 Ga0496118_0000001 Ga0496118_0000001_972657_973967 430
63 3300048922 Ga0496119_0000669 Ga0496119_0000669_17579_18889 430
64 3300048923 Ga0496120_0000594 Ga0496120_0000594_26375_27685 430
65 3300048924 Ga0496121_0003113 Ga0496121_0003113_16011_17321 430
66 3300048929 Ga0496126_0000178 Ga0496126_0000178_57801_59111 430
67 3300053104 Ga0500556_0009470 Ga0500556_0009470_450_1763 430
68 3300005985 Ga0081539_10008707 Ga0081539_100087074 431
69 3300003559 Ga0007427J51700_109281 Ga0007427J51700_1092811 432
70 3300005337 Ga0070682_100013171 Ga0070682_1000131713 432
71 3300044684 Ga0466966_0002097 Ga0466966_0002097_5515_6816 432
72 3300044693 Ga0466961_0006972 Ga0466961_0006972_2639_3940 432
73 3300044694 Ga0466963_0029351 Ga0466963_0029351_1692_2993 432
74 3300044842 Ga0466957_0001983 Ga0466957_0001983_4234_5535 432
75 3300045049 Ga0466959_0043923 Ga0466959_0043923_1709_3010 432
76 3300045836 Ga0466958_0009827 Ga0466958_0009827_2316_3617 432
77 3300046515 Ga0495620_0023194 Ga0495620_0023194_1285_2619 432
78 3300046794 Ga0495589_0029739 Ga0495589_0029739_803_2137 432
79 3300049581 Ga0501047_0011943 Ga0501047_0011943_5670_6983 432
80 3300053131 Ga0500652_001049 Ga0500652_001049_4041_5348 432
81 iso_pu_bacteria 2799112218 2799186696 432
82 3300049569 Ga0501032_0007044 Ga0501032_0007044_6708_8018 433
83 3300049570 Ga0501033_0037585 Ga0501033_0037585_1551_2861 433
84 3300049571 Ga0501034_0037777 Ga0501034_0037777_2040_3350 433
85 3300049578 Ga0501042_0037201 Ga0501042_0037201_1159_2469 433
86 3300049579 Ga0501043_0035665 Ga0501043_0035665_1756_3066 433
87 3300049580 Ga0501046_0038654 Ga0501046_0038654_1708_3018 433
88 3300049581 Ga0501047_0060538 Ga0501047_0060538_102_1412 433
89 3300049581 Ga0501047_0063225 Ga0501047_0063225_2159_3469 433
90 3300049582 Ga0501048_0003490 Ga0501048_0003490_10220_11530 433
91 3300049822 Ga0501035_0120484 Ga0501035_0120484_65_1375 433
92 3300050489 nmdc:mga03683_13553_c1 nmdc:mga03683_13553_c1_111_1424 433
93 iso_pu_bacteria 2547132111 2547410071 433
94 iso_pu_bacteria 2582581313 2585308203 433
95 iso_pu_bacteria 2616644941 2616902033 433
96 iso_pu_bacteria 2643221587 2643942083 433
97 iso_pu_bacteria 2643221647 2644261708 433
98 iso_pu_bacteria 2643221670 2644389742 433
99 iso_pu_bacteria 2643221677 2644429166 433
100 iso_pu_bacteria 2731639228 2731908873 433
101 iso_pu_bacteria 2784132148 2784589622 433
102 iso_pu_bacteria 2786546132 2786671849 433
103 iso_pu_bacteria 2808606448 2809233302 433
104 iso_pu_bacteria 2811994917 2812479541 433
105 iso_pu_bacteria 2852635781 2852640440 433
106 iso_pu_bacteria 2862574272 2862578285 433
107 iso_pu_bacteria 2867428634 2867434718 433
108 iso_pu_bacteria 2877676314 2877679922 433
109 iso_pu_bacteria 2912757875 2912762035 433
110 iso_pu_bacteria 2918501144 2918505716 433
111 iso_pu_bacteria 2919468124 2919475437 433
112 iso_pu_bacteria 2954002825 2954003025 433
113 iso_pu_bacteria 2954380949 2954384877 433
114 iso_pu_bacteria 2954673503 2954678126 433
115 iso_pu_bacteria 2954682443 2954686032 433
116 iso_pu_bacteria 2954691527 2954695690 433
117 iso_pu_bacteria 2954701450 2954710884 433
118 iso_pu_bacteria 2954711539 2954715106 433
119 iso_pu_bacteria 2954721474 2954725048 433
120 iso_pu_bacteria 2954731030 2954736770 433
121 iso_pu_bacteria 2954740390 2954743981 433
122 iso_pu_bacteria 2954749733 2954755617 433
123 iso_pu_bacteria 2954759201 2954762921 433
124 iso_pu_bacteria 2990059506 2990062198 433
125 iso_pu_bacteria 2997451912 2997458149 433
126 iso_pu_bacteria 3006393351 3006397705 433
127 iso_pu_bacteria 8023623736 8023626417 433
128 iso_pu_bacteria 8025530807 8025534838 433
129 3300028786 Ga0307517_10006298 Ga0307517_1000629814 434
130 3300028794 Ga0307515_10001177 Ga0307515_1000117734 434
131 3300031649 Ga0307514_10037111 Ga0307514_100371113 434
132 3300044765 Ga0466970_0034286 Ga0466970_0034286_896_2206 434
133 3300046660 Ga0495625_0005807 Ga0495625_0005807_8390_9727 434
134 3300046674 Ga0495588_0002549 Ga0495588_0002549_3081_4418 434
135 3300046679 Ga0495623_0066863 Ga0495623_0066863_500_1822 434
136 3300046692 Ga0495671_0027068 Ga0495671_0027068_209_1546 434
137 3300047470 Ga0495681_0000590 Ga0495681_0000590_4541_5878 434
138 3300048089 Ga0495614_0002125 Ga0495614_0002125_1419_2756 434
139 3300049569 Ga0501032_0082971 Ga0501032_0082971_273_1613 434
140 3300049571 Ga0501034_0008931 Ga0501034_0008931_573_1913 434
141 3300049574 Ga0501038_0002500 Ga0501038_0002500_11547_12887 434
142 3300049581 Ga0501047_0003079 Ga0501047_0003079_11608_12948 434
143 3300049822 Ga0501035_0004984 Ga0501035_0004984_10742_12082 434
144 3300053098 Ga0500650_0081793 Ga0500650_0081793_106_1443 434
145 iso_pu_bacteria 2784746768 2785370666 434
146 iso_pu_bacteria 2947224130 2947227892 434
147 3300005937 Ga0081455_10019330 Ga0081455_100193303 435
148 3300005985 Ga0081539_10015008 Ga0081539_100150081 435
149 3300031456 Ga0307513_10016493 Ga0307513_100164938 435
150 3300044684 Ga0466966_0105399 Ga0466966_0105399_251_1594 435
151 3300046460 Ga0495638_0070088 Ga0495638_0070088_658_2013 435
152 3300046462 Ga0495651_0002743 Ga0495651_0002743_10987_12357 435
153 3300046663 Ga0495635_0004355 Ga0495635_0004355_248_1618 435
154 3300049571 Ga0501034_0000700 Ga0501034_0000700_8055_9386 435
155 3300049572 Ga0501036_0001560 Ga0501036_0001560_3193_4524 435
156 3300049572 Ga0501036_0011932 Ga0501036_0011932_4920_6248 435
157 3300049575 Ga0501039_0004281 Ga0501039_0004281_5583_6914 435
158 3300049586 Ga0501070_0005364 Ga0501070_0005364_1785_3116 435
159 3300049822 Ga0501035_0004451 Ga0501035_0004451_9066_10397 435
160 3300049823 Ga0501044_0006618 Ga0501044_0006618_8582_9910 435
161 3300053153 Ga0500616_0000466 Ga0500616_0000466_25902_27257 435
162 3300053153 Ga0500616_0001931 Ga0500616_0001931_2695_4050 435
163 iso_pu_bacteria 2643221548 2643764865 435
164 iso_pu_bacteria 2643221682 2644461295 435
165 iso_pu_bacteria 2738541264 2738667082 435
166 iso_pu_bacteria 2738541356 2739145926 435
167 iso_pu_bacteria 2818991463 2819695316 435
168 iso_pu_bacteria 2966598605 2966601550 435
169 iso_pu_bacteria 3006486233 3006492625 435
170 3300001989 JGI24739J22299_10006893 JGI24739J22299_100068934 436
171 3300005563 Ga0068855_100206484 Ga0068855_1002064842 436
172 3300005937 Ga0081455_10009867 Ga0081455_100098674 436
173 3300006042 Ga0075368_10005635 Ga0075368_100056354 436
174 3300006178 Ga0075367_10027504 Ga0075367_100275042 436
175 3300006948 Ga0099826_10055940 Ga0099826_100559402 436
176 3300009036 Ga0105244_10053032 Ga0105244_100530322 436
177 3300011119 Ga0105246_10029411 Ga0105246_100294112 436
178 3300013105 Ga0157369_10189324 Ga0157369_101893242 436
179 3300013307 Ga0157372_10145291 Ga0157372_101452913 436
180 3300025904 Ga0207647_10009432 Ga0207647_100094325 436
181 3300030522 Ga0307512_10005436 Ga0307512_100054366 436
182 3300031456 Ga0307513_10023232 Ga0307513_100232324 436
183 3300031616 Ga0307508_10014629 Ga0307508_100146295 436
184 3300031616 Ga0307508_10064626 Ga0307508_100646262 436
185 3300031730 Ga0307516_10010111 Ga0307516_100101112 436
186 3300042005 Ga0439448_0030485 Ga0439448_0030485_200_1522 436
187 3300042014 Ga0439457_005570 Ga0439457_005570_914_2236 436
188 3300042137 Ga0450902_005362 Ga0450902_005362_399_1739 436
189 3300042138 Ga0450903_000042 Ga0450903_000042_21396_22718 436
190 3300042157 Ga0439458_0001348 Ga0439458_0001348_110_1432 436
191 3300044656 Ga0466969_0004397 Ga0466969_0004397_3173_4504 436
192 3300044684 Ga0466966_0005466 Ga0466966_0005466_3526_4857 436
193 3300044684 Ga0466966_0006467 Ga0466966_0006467_5545_6870 436
194 3300044693 Ga0466961_0010029 Ga0466961_0010029_3225_4556 436
195 3300044719 Ga0466971_0006943 Ga0466971_0006943_2696_4027 436
196 3300045049 Ga0466959_0026000 Ga0466959_0026000_442_1773 436
197 3300045049 Ga0466959_0042996 Ga0466959_0042996_878_2203 436
198 3300046455 Ga0495603_0084999 Ga0495603_0084999_31_1353 436
199 3300046455 Ga0495603_0085586 Ga0495603_0085586_31_1353 436
200 3300046459 Ga0495629_0004039 Ga0495629_0004039_4796_6118 436
201 3300046459 Ga0495629_0062864 Ga0495629_0062864_929_2251 436
202 3300046462 Ga0495651_0002270 Ga0495651_0002270_4984_6306 436
203 3300046476 Ga0495662_0002591 Ga0495662_0002591_6430_7752 436
204 3300046477 Ga0495664_0011037 Ga0495664_0011037_2352_3674 436
205 3300046499 Ga0495594_0000534 Ga0495594_0000534_7700_9022 436
206 3300046516 Ga0495628_0048477 Ga0495628_0048477_1631_2953 436
207 3300046522 Ga0495643_0079387 Ga0495643_0079387_376_1698 436
208 3300046529 Ga0495652_0038084 Ga0495652_0038084_863_2185 436
209 3300046536 Ga0495587_0003288 Ga0495587_0003288_2753_4075 436
210 3300046642 Ga0495634_0012335 Ga0495634_0012335_2075_3397 436
211 3300046648 Ga0495611_0028558 Ga0495611_0028558_324_1646 436
212 3300046663 Ga0495635_0016061 Ga0495635_0016061_1407_2729 436
213 3300046675 Ga0495657_0003629 Ga0495657_0003629_9805_11127 436
214 3300046680 Ga0495646_0000855 Ga0495646_0000855_6062_7384 436
215 3300047315 Ga0495581_0008614 Ga0495581_0008614_1285_2607 436
216 3300047317 Ga0495604_0010118 Ga0495604_0010118_3938_5260 436
217 3300047318 Ga0495636_0034595 Ga0495636_0034595_745_2067 436
218 3300047321 Ga0495676_0026725 Ga0495676_0026725_1353_2675 436
219 3300047321 Ga0495676_0096093 Ga0495676_0096093_554_1876 436
220 3300047471 Ga0495684_0055850 Ga0495684_0055850_1498_2820 436
221 3300048088 Ga0495602_0060791 Ga0495602_0060791_1838_3160 436
222 3300048929 Ga0496126_0046522 Ga0496126_0046522_774_2180 436
223 3300049568 Ga0501031_0080746 Ga0501031_0080746_104_1417 436
224 3300049570 Ga0501033_0003959 Ga0501033_0003959_2665_3978 436
225 3300049571 Ga0501034_0168769 Ga0501034_0168769_134_1447 436
226 3300049572 Ga0501036_0014281 Ga0501036_0014281_1462_2775 436
227 3300049573 Ga0501037_0025618 Ga0501037_0025618_1904_3217 436
228 3300049574 Ga0501038_0073141 Ga0501038_0073141_1449_2762 436
229 3300049575 Ga0501039_0014667 Ga0501039_0014667_1350_2663 436
230 3300049579 Ga0501043_0005179 Ga0501043_0005179_476_1789 436
231 3300049579 Ga0501043_0060168 Ga0501043_0060168_1404_2717 436
232 3300049580 Ga0501046_0000707 Ga0501046_0000707_4993_6306 436
233 3300049582 Ga0501048_0005883 Ga0501048_0005883_6906_8219 436
234 3300049586 Ga0501070_0008447 Ga0501070_0008447_6603_7916 436
235 3300049590 Ga0501074_0052805 Ga0501074_0052805_948_2261 436
236 3300049742 Ga0501080_0073993 Ga0501080_0073993_1127_2440 436
237 3300050494 nmdc:mga06z11_9099_c1 nmdc:mga06z11_9099_c1_2268_3599 436
238 3300053095 Ga0500640_000199 Ga0500640_000199_8691_10013 436
239 3300054114 Ga0501084_0159640 Ga0501084_0159640_282_1595 436
240 3300061719 Ga0466962_0005792 Ga0466962_0005792_3395_4726 436
241 iso_pu_bacteria 2784746763 2785341981 436
242 iso_pu_bacteria 2791355406 2793980314 436
243 iso_pu_bacteria 2862178590 2862181678 436
244 iso_pu_bacteria 2862507626 2862515587 436
245 iso_pu_bacteria 2935390628 2935394861 436
246 iso_pu_bacteria 2946072368 2946076993 436
247 iso_pu_bacteria 2990044586 2990045355 436
248 iso_pu_bacteria 2997600082 2997606371 436
249 iso_pu_bacteria 3006321560 3006326293 436
250 iso_pu_bacteria 8047893842 8047897068 436
251 iso_pu_bacteria 8048127548 8048134688 436
252 iso_pu_bacteria 8048356638 8048361884 436
253 iso_pu_bacteria 8048369669 8048374052 436
254 iso_pu_bacteria 8048379754 8048384174 436
255 iso_pu_bacteria 8048406513 8048410727 436
256 3300009553 Ga0105249_10190960 Ga0105249_101909602 437
257 3300028786 Ga0307517_10002400 Ga0307517_100024004 437
258 3300031616 Ga0307508_10005680 Ga0307508_100056809 437
259 3300038443 Ga0395901_0008656 Ga0395901_0008656_2724_4043 437
260 3300044683 Ga0466965_0056712 Ga0466965_0056712_286_1611 437
261 3300046460 Ga0495638_0026034 Ga0495638_0026034_1955_3289 437
262 3300046462 Ga0495651_0064795 Ga0495651_0064795_31_1374 437
263 3300046463 Ga0495653_0052219 Ga0495653_0052219_1186_2529 437
264 3300046472 Ga0495580_0070581 Ga0495580_0070581_553_1896 437
265 3300046492 Ga0495585_0007060 Ga0495585_0007060_4506_5840 437
266 3300046513 Ga0495616_0033346 Ga0495616_0033346_342_1730 437
267 3300046519 Ga0495632_0013008 Ga0495632_0013008_3324_4658 437
268 3300046522 Ga0495643_0003319 Ga0495643_0003319_2647_3981 437
269 3300046522 Ga0495643_0011979 Ga0495643_0011979_3765_5108 437
270 3300046529 Ga0495652_0006834 Ga0495652_0006834_7833_9176 437
271 3300046533 Ga0495640_0017126 Ga0495640_0017126_2857_4200 437
272 3300046533 Ga0495640_0018021 Ga0495640_0018021_2351_3682 437
273 3300046558 Ga0495633_0048814 Ga0495633_0048814_85_1419 437
274 3300046663 Ga0495635_0005875 Ga0495635_0005875_1313_2656 437
275 3300046680 Ga0495646_0107181 Ga0495646_0107181_86_1429 437
276 3300046689 Ga0495613_0023073 Ga0495613_0023073_324_1667 437
277 3300046691 Ga0495670_0006366 Ga0495670_0006366_3920_5254 437
278 3300046809 Ga0495600_0075430 Ga0495600_0075430_363_1706 437
279 3300046810 Ga0495660_0007437 Ga0495660_0007437_5024_6358 437
280 3300047315 Ga0495581_0042500 Ga0495581_0042500_695_2038 437
281 3300047317 Ga0495604_0116883 Ga0495604_0116883_158_1489 437
282 3300047447 Ga0495685_000486 Ga0495685_000486_7195_8529 437
283 3300047470 Ga0495681_0004760 Ga0495681_0004760_4564_5898 437
284 3300047472 Ga0495686_0050971 Ga0495686_0050971_266_1600 437
285 3300049823 Ga0501044_0010614 Ga0501044_0010614_5788_7173 437
286 3300053086 Ga0500578_0008090 Ga0500578_0008090_4927_6261 437
287 3300053106 Ga0500558_026568 Ga0500558_026568_645_1979 437
288 3300053109 Ga0500569_007352 Ga0500569_007352_535_1869 437
289 3300053131 Ga0500652_000612 Ga0500652_000612_3270_4604 437
290 3300053134 Ga0500658_0003635 Ga0500658_0003635_2000_3334 437
291 3300053149 Ga0500600_0003949 Ga0500600_0003949_5361_6695 437
292 3300053153 Ga0500616_0014693 Ga0500616_0014693_1900_3234 437
293 3300053160 Ga0500633_0016697 Ga0500633_0016697_661_1995 437
294 3300053161 Ga0500634_0027336 Ga0500634_0027336_411_1745 437
295 3300053732 Ga0500656_000440 Ga0500656_000440_372_1706 437
296 iso_pu_bacteria 2554235005 2554256889 437
297 iso_pu_bacteria 2616644814 2616696894 437
298 iso_pu_bacteria 2884994152 2884996516 437
299 3300002077 JGI24744J21845_10012947 JGI24744J21845_100129471 438
300 3300005334 Ga0068869_100023468 Ga0068869_1000234683 438
301 3300005338 Ga0068868_100031203 Ga0068868_1000312033 438
302 3300005356 Ga0070674_100021380 Ga0070674_1000213803 438
303 3300005364 Ga0070673_100038351 Ga0070673_1000383513 438
304 3300005434 Ga0070709_10083867 Ga0070709_100838672 438
305 3300005439 Ga0070711_100002215 Ga0070711_10000221511 438
306 3300005440 Ga0070705_100090063 Ga0070705_1000900632 438
307 3300005459 Ga0068867_100164392 Ga0068867_1001643922 438
308 3300005466 Ga0070685_10033602 Ga0070685_100336023 438
309 3300005546 Ga0070696_100066758 Ga0070696_1000667582 438
310 3300005548 Ga0070665_100095388 Ga0070665_1000953882 438
311 3300005549 Ga0070704_100017559 Ga0070704_1000175594 438
312 3300005578 Ga0068854_100219211 Ga0068854_1002192111 438
313 3300005617 Ga0068859_100265156 Ga0068859_1002651561 438
314 3300006173 Ga0070716_100004805 Ga0070716_1000048053 438
315 3300006175 Ga0070712_100004010 Ga0070712_1000040109 438
316 3300006931 Ga0097620_100265168 Ga0097620_1002651682 438
317 3300009551 Ga0105238_10149694 Ga0105238_101496942 438
318 3300011119 Ga0105246_10017871 Ga0105246_100178716 438
319 3300013296 Ga0157374_10133760 Ga0157374_101337602 438
320 3300013297 Ga0157378_10045454 Ga0157378_100454543 438
321 3300014745 Ga0157377_10017835 Ga0157377_100178352 438
322 3300014969 Ga0157376_10150420 Ga0157376_101504202 438
323 3300025321 Ga0207656_10044570 Ga0207656_100445702 438
324 3300025898 Ga0207692_10024393 Ga0207692_100243934 438
325 3300025901 Ga0207688_10000841 Ga0207688_1000084110 438
326 3300025903 Ga0207680_10108739 Ga0207680_101087392 438
327 3300025915 Ga0207693_10000602 Ga0207693_1000060210 438
328 3300025931 Ga0207644_10036679 Ga0207644_100366793 438
329 3300025939 Ga0207665_10003722 Ga0207665_100037224 438
330 3300025942 Ga0207689_10004009 Ga0207689_100040093 438
331 3300025960 Ga0207651_10015401 Ga0207651_100154013 438
332 3300026035 Ga0207703_10184631 Ga0207703_101846312 438
333 3300026067 Ga0207678_10007867 Ga0207678_100078674 438
334 3300026089 Ga0207648_10007779 Ga0207648_100077794 438
335 3300026095 Ga0207676_10057652 Ga0207676_100576522 438
336 3300028379 Ga0268266_10020552 Ga0268266_100205529 438
337 3300031251 Ga0265327_10000630 Ga0265327_1000063024 438
338 3300046516 Ga0495628_0017507 Ga0495628_0017507_3970_5367 438
339 3300046529 Ga0495652_0002119 Ga0495652_0002119_16803_18197 438
340 3300048904 Ga0496101_0066956 Ga0496101_0066956_1105_2454 438
341 3300048906 Ga0496103_0056359 Ga0496103_0056359_1038_2387 438
342 3300048909 Ga0496106_0015048 Ga0496106_0015048_403_1752 438
343 3300048911 Ga0496108_0001760 Ga0496108_0001760_3938_5287 438
344 3300048916 Ga0496113_0111951 Ga0496113_0111951_165_1514 438
345 3300048917 Ga0496114_0010650 Ga0496114_0010650_3824_5173 438
346 3300005983 Ga0081540_1003156 Ga0081540_100315612 439
347 3300025912 Ga0207707_10034940 Ga0207707_100349403 439
348 3300028786 Ga0307517_10119485 Ga0307517_101194852 439
349 3300030521 Ga0307511_10029836 Ga0307511_100298364 439
350 3300046678 Ga0495599_0012610 Ga0495599_0012610_1161_2570 439
351 3300047444 Ga0495675_0060804 Ga0495675_0060804_152_1495 439
352 3300049568 Ga0501031_0003124 Ga0501031_0003124_8553_9890 439
353 3300049568 Ga0501031_0012776 Ga0501031_0012776_180_1517 439
354 3300049569 Ga0501032_0000686 Ga0501032_0000686_14414_15751 439
355 3300049569 Ga0501032_0025746 Ga0501032_0025746_1779_3116 439
356 3300049569 Ga0501032_0067229 Ga0501032_0067229_301_1638 439
357 3300049570 Ga0501033_0009007 Ga0501033_0009007_3173_4510 439
358 3300049570 Ga0501033_0011728 Ga0501033_0011728_3057_4394 439
359 3300049571 Ga0501034_0000987 Ga0501034_0000987_36296_37633 439
360 3300049571 Ga0501034_0041324 Ga0501034_0041324_2865_4202 439
361 3300049571 Ga0501034_0044577 Ga0501034_0044577_1922_3259 439
362 3300049572 Ga0501036_0018754 Ga0501036_0018754_3252_4589 439
363 3300049572 Ga0501036_0030414 Ga0501036_0030414_2474_3811 439
364 3300049572 Ga0501036_0045495 Ga0501036_0045495_2068_3405 439
365 3300049573 Ga0501037_0001087 Ga0501037_0001087_8438_9775 439
366 3300049573 Ga0501037_0023459 Ga0501037_0023459_2120_3457 439
367 3300049574 Ga0501038_0001242 Ga0501038_0001242_13224_14561 439
368 3300049574 Ga0501038_0025955 Ga0501038_0025955_2843_4180 439
369 3300049575 Ga0501039_0021995 Ga0501039_0021995_598_1935 439
370 3300049576 Ga0501040_0001045 Ga0501040_0001045_6564_7901 439
371 3300049577 Ga0501041_0000883 Ga0501041_0000883_14475_15812 439
372 3300049578 Ga0501042_0002602 Ga0501042_0002602_9114_10451 439
373 3300049579 Ga0501043_0000867 Ga0501043_0000867_8234_9571 439
374 3300049579 Ga0501043_0035627 Ga0501043_0035627_2203_3540 439
375 3300049579 Ga0501043_0050090 Ga0501043_0050090_889_2226 439
376 3300049580 Ga0501046_0006561 Ga0501046_0006561_8234_9571 439
377 3300049581 Ga0501047_0000216 Ga0501047_0000216_32442_33779 439
378 3300049581 Ga0501047_0000544 Ga0501047_0000544_29248_30585 439
379 3300049581 Ga0501047_0023263 Ga0501047_0023263_2732_4069 439
380 3300049581 Ga0501047_0145819 Ga0501047_0145819_497_1834 439
381 3300049582 Ga0501048_0002418 Ga0501048_0002418_2627_3964 439
382 3300049584 Ga0501068_0000652 Ga0501068_0000652_3983_5320 439
383 3300049585 Ga0501069_0001987 Ga0501069_0001987_338_1675 439
384 3300049587 Ga0501071_0003645 Ga0501071_0003645_3984_5321 439
385 3300049588 Ga0501072_0008562 Ga0501072_0008562_3915_5252 439
386 3300049589 Ga0501073_0014251 Ga0501073_0014251_2627_3964 439
387 3300049590 Ga0501074_0002273 Ga0501074_0002273_9647_10984 439
388 3300049593 Ga0501077_0017485 Ga0501077_0017485_2964_4301 439
389 3300049741 Ga0501079_0002562 Ga0501079_0002562_8552_9889 439
390 3300049742 Ga0501080_0023738 Ga0501080_0023738_2474_3811 439
391 3300049744 Ga0501083_0010392 Ga0501083_0010392_3408_4745 439
392 3300049822 Ga0501035_0000870 Ga0501035_0000870_16034_17371 439
393 3300049822 Ga0501035_0007027 Ga0501035_0007027_4045_5382 439
394 3300049823 Ga0501044_0002317 Ga0501044_0002317_17186_18523 439
395 3300049823 Ga0501044_0010095 Ga0501044_0010095_5461_6798 439
396 3300049823 Ga0501044_0020341 Ga0501044_0020341_2308_3645 439
397 3300049824 Ga0501045_0014319 Ga0501045_0014319_2474_3811 439
398 3300054114 Ga0501084_0001814 Ga0501084_0001814_2474_3811 439
399 3300060353 Ga0501082_0009754 Ga0501082_0009754_4544_5881 439
400 3300061734 Ga0530510_0095798 Ga0530510_0095798_208_1545 439
401 iso_pu_bacteria 2643221604 2644032045 439
402 iso_pu_bacteria 2738541305 2738871203 439
403 iso_pu_bacteria 2995463766 2995468643 439
404 3300035398 Ga0316574_0003441 Ga0316574_0003441_5071_6459 440
405 3300037418 Ga0395900_0128670 Ga0395900_0128670_1060_2397 440
406 3300044735 Ga0466968_0010428 Ga0466968_0010428_922_2247 440
407 3300046454 Ga0495592_0008939 Ga0495592_0008939_4770_6116 440
408 3300046459 Ga0495629_0004832 Ga0495629_0004832_6742_8088 440
409 3300046462 Ga0495651_0035079 Ga0495651_0035079_2455_3801 440
410 3300046529 Ga0495652_0013171 Ga0495652_0013171_3607_4953 440
411 3300046533 Ga0495640_0012881 Ga0495640_0012881_2134_3480 440
412 3300046557 Ga0495622_0011920 Ga0495622_0011920_1348_2685 440
413 3300046559 Ga0495667_0028673 Ga0495667_0028673_438_1784 440
414 3300046642 Ga0495634_0017379 Ga0495634_0017379_2441_3787 440
415 3300046675 Ga0495657_0016996 Ga0495657_0016996_543_1889 440
416 3300046679 Ga0495623_0058203 Ga0495623_0058203_834_2180 440
417 3300046690 Ga0495624_0007422 Ga0495624_0007422_3223_4569 440
418 3300046809 Ga0495600_0035679 Ga0495600_0035679_607_1953 440
419 3300047321 Ga0495676_0008079 Ga0495676_0008079_2578_3924 440
420 3300049569 Ga0501032_0009613 Ga0501032_0009613_5518_6870 440
421 3300049570 Ga0501033_0028770 Ga0501033_0028770_2430_3782 440
422 3300049572 Ga0501036_0034631 Ga0501036_0034631_491_1843 440
423 3300049575 Ga0501039_0023058 Ga0501039_0023058_51_1403 440
424 3300049579 Ga0501043_0189793 Ga0501043_0189793_161_1513 440
425 3300049581 Ga0501047_0065503 Ga0501047_0065503_2017_3369 440
426 3300049823 Ga0501044_0056404 Ga0501044_0056404_891_2243 440
427 3300053078 Ga0495612_0000768 Ga0495612_0000768_5018_6364 440
428 3300053088 Ga0500644_0000148 Ga0500644_0000148_18771_20093 440
429 iso_pu_bacteria 2643221613 2644082759 440
430 iso_pu_bacteria 2643221617 2644100454 440
431 iso_pu_bacteria 2643221620 2644116862 440
432 iso_pu_bacteria 2643221721 2644665621 440
433 iso_pu_bacteria 2811994874 2812334845 440
434 iso_pu_bacteria 2868088558 2868090615 440
435 iso_pu_bacteria 2935890801 2935892198 440
436 iso_pu_bacteria 2990256926 2990260614 440
437 3300005445 Ga0070708_100062048 Ga0070708_1000620482 441
438 3300006028 Ga0070717_10210444 Ga0070717_102104441 441
439 3300006163 Ga0070715_10012620 Ga0070715_100126203 441
440 3300025898 Ga0207692_10001290 Ga0207692_100012908 441
441 3300025905 Ga0207685_10011398 Ga0207685_100113983 441
442 3300025906 Ga0207699_10001300 Ga0207699_100013002 441
443 3300025916 Ga0207663_10119603 Ga0207663_101196032 441
444 3300025929 Ga0207664_10006688 Ga0207664_100066882 441
445 3300038735 Ga0400485_14323 Ga0400485_14323_26013_27383 441
446 3300038741 Ga0400488_07225 Ga0400488_07225_1483_2877 441
447 3300038742 Ga0400486_16675 Ga0400486_16675_14724_16094 441
448 3300044656 Ga0466969_0001418 Ga0466969_0001418_3071_4417 441
449 3300044684 Ga0466966_0025916 Ga0466966_0025916_507_1853 441
450 3300044693 Ga0466961_0030018 Ga0466961_0030018_666_2012 441
451 3300045049 Ga0466959_0012867 Ga0466959_0012867_4226_5572 441
452 3300045049 Ga0466959_0098778 Ga0466959_0098778_187_1614 441
453 3300046454 Ga0495592_0007921 Ga0495592_0007921_4768_6129 441
454 3300046462 Ga0495651_0020641 Ga0495651_0020641_1928_3289 441
455 3300046511 Ga0495608_0014307 Ga0495608_0014307_2443_3804 441
456 3300046516 Ga0495628_0013131 Ga0495628_0013131_2255_3616 441
457 3300046526 Ga0495666_0013332 Ga0495666_0013332_2330_3691 441
458 3300046529 Ga0495652_0040281 Ga0495652_0040281_2357_3718 441
459 3300046533 Ga0495640_0018600 Ga0495640_0018600_2454_3815 441
460 3300046536 Ga0495587_0022087 Ga0495587_0022087_1346_2707 441
461 3300046543 Ga0495645_0004398 Ga0495645_0004398_306_1658 441
462 3300046543 Ga0495645_0023172 Ga0495645_0023172_1170_2531 441
463 3300046559 Ga0495667_0020606 Ga0495667_0020606_854_2215 441
464 3300046642 Ga0495634_0052248 Ga0495634_0052248_213_1574 441
465 3300046675 Ga0495657_0019934 Ga0495657_0019934_294_1655 441
466 3300047317 Ga0495604_0011789 Ga0495604_0011789_3357_4718 441
467 3300047444 Ga0495675_0025100 Ga0495675_0025100_1993_3345 441
468 3300048905 Ga0496102_0030302 Ga0496102_0030302_2251_3627 441
469 3300048907 Ga0496104_0007962 Ga0496104_0007962_435_1811 441
470 3300048908 Ga0496105_0002357 Ga0496105_0002357_2985_4361 441
471 3300048911 Ga0496108_0090417 Ga0496108_0090417_134_1510 441
472 3300048912 Ga0496109_0026161 Ga0496109_0026161_811_2187 441
473 3300048915 Ga0496112_0008515 Ga0496112_0008515_7378_8754 441
474 3300048916 Ga0496113_0045946 Ga0496113_0045946_797_2173 441
475 3300048918 Ga0496115_0015781 Ga0496115_0015781_1016_2392 441
476 iso_pu_bacteria 2643221561 2643827310 441
477 iso_pu_bacteria 2643221615 2644093098 441
478 iso_pu_bacteria 2643221657 2644322709 441
479 iso_pu_bacteria 2643221696 2644533863 441
480 iso_pu_bacteria 2802429296 2804845665 441
481 iso_pu_bacteria 2816332119 2816421347 441
482 iso_pu_bacteria 2855386786 2855388124 441
483 iso_pu_bacteria 2857481737 2857485696 441
484 iso_pu_bacteria 8025413630 8025419666 441
485 3300001990 JGI24737J22298_10005250 JGI24737J22298_100052504 442
486 3300005327 Ga0070658_10011481 Ga0070658_100114814 442
487 3300005329 Ga0070683_100056266 Ga0070683_1000562664 442
488 3300005535 Ga0070684_100200514 Ga0070684_1002005142 442
489 3300005577 Ga0068857_100007139 Ga0068857_1000071393 442
490 3300005985 Ga0081539_10000381 Ga0081539_1000038152 442
491 3300006048 Ga0075363_100005675 Ga0075363_1000056754 442
492 3300006048 Ga0075363_100027448 Ga0075363_1000274482 442
493 3300006048 Ga0075363_100078333 Ga0075363_1000783332 442
494 3300006353 Ga0075370_10069235 Ga0075370_100692352 442
495 3300025901 Ga0207688_10047386 Ga0207688_100473862 442
496 3300025904 Ga0207647_10023053 Ga0207647_100230532 442
497 3300025909 Ga0207705_10011129 Ga0207705_100111294 442
498 3300025927 Ga0207687_10018220 Ga0207687_100182204 442
499 3300025934 Ga0207686_10036736 Ga0207686_100367363 442
500 3300025944 Ga0207661_10148198 Ga0207661_101481982 442
501 3300026035 Ga0207703_10051971 Ga0207703_100519714 442
502 3300026116 Ga0207674_10063468 Ga0207674_100634683 442
503 3300026142 Ga0207698_10254149 Ga0207698_102541492 442
504 3300027866 Ga0209813_10001795 Ga0209813_100017952 442
505 3300037466 Ga0395898_0114731 Ga0395898_0114731_158_1489 442
506 3300038443 Ga0395901_0099361 Ga0395901_0099361_1397_2728 442
507 3300045051 Ga0451576_0078962 Ga0451576_0078962_219_1550 442
508 3300048905 Ga0496102_0210018 Ga0496102_0210018_154_1485 442
509 3300048911 Ga0496108_0021929 Ga0496108_0021929_3641_5020 442
510 3300048912 Ga0496109_0080158 Ga0496109_0080158_1402_2781 442
511 3300048913 Ga0496110_0004424 Ga0496110_0004424_1127_2458 442
512 3300048917 Ga0496114_0000890 Ga0496114_0000890_12558_13889 442
513 3300049586 Ga0501070_0024422 Ga0501070_0024422_44_1378 442
514 3300050490 nmdc:mga03n38_3148_c1 nmdc:mga03n38_3148_c1_1973_3307 442
515 3300050490 nmdc:mga03n38_48181_c1 nmdc:mga03n38_48181_c1_23_1357 442
516 3300050491 nmdc:mga00v17_31601_c1 nmdc:mga00v17_31601_c1_1507_2841 442
517 3300050491 nmdc:mga00v17_64405_c1 nmdc:mga00v17_64405_c1_423_1757 442
518 3300050492 nmdc:mga0yw44_72200_c1 nmdc:mga0yw44_72200_c1_39_1373 442
519 3300050494 nmdc:mga06z11_7320_c1 nmdc:mga06z11_7320_c1_2918_4252 442
520 3300050495 nmdc:mga04h51_24566_c1 nmdc:mga04h51_24566_c1_19_1353 442
521 3300050496 nmdc:mga07m45_43203_c1 nmdc:mga07m45_43203_c1_268_1602 442
522 iso_pu_bacteria 2739367898 2740168276 442
523 3300001979 JGI24740J21852_10018753 JGI24740J21852_100187532 443
524 3300002067 JGI24735J21928_10008371 JGI24735J21928_100083713 443
525 3300005548 Ga0070665_100000516 Ga0070665_10000051621 443
526 3300005548 Ga0070665_100007014 Ga0070665_1000070143 443
527 3300005578 Ga0068854_100009946 Ga0068854_1000099464 443
528 3300005616 Ga0068852_100292311 Ga0068852_1002923112 443
529 3300005937 Ga0081455_10009960 Ga0081455_100099604 443
530 3300005985 Ga0081539_10019912 Ga0081539_100199123 443
531 3300006048 Ga0075363_100091167 Ga0075363_1000911672 443
532 3300009093 Ga0105240_10015715 Ga0105240_100157156 443
533 3300009174 Ga0105241_10006208 Ga0105241_100062083 443
534 3300009545 Ga0105237_10004407 Ga0105237_100044077 443
535 3300009551 Ga0105238_10000200 Ga0105238_1000020020 443
536 3300010375 Ga0105239_10048362 Ga0105239_100483623 443
537 3300013105 Ga0157369_10075585 Ga0157369_100755852 443
538 3300025904 Ga0207647_10000384 Ga0207647_100003846 443
539 3300025904 Ga0207647_10065118 Ga0207647_100651182 443
540 3300025911 Ga0207654_10002418 Ga0207654_100024184 443
541 3300025913 Ga0207695_10000449 Ga0207695_1000044961 443
542 3300025914 Ga0207671_10000052 Ga0207671_10000052116 443
543 3300025919 Ga0207657_10013589 Ga0207657_100135892 443
544 3300025924 Ga0207694_10000079 Ga0207694_1000007919 443
545 3300025937 Ga0207669_10044145 Ga0207669_100441452 443
546 3300025949 Ga0207667_10008068 Ga0207667_100080689 443
547 3300025981 Ga0207640_10007132 Ga0207640_100071322 443
548 3300026075 Ga0207708_10159261 Ga0207708_101592612 443
549 3300026118 Ga0207675_100115019 Ga0207675_1001150192 443
550 3300026142 Ga0207698_10017352 Ga0207698_100173524 443
551 3300028379 Ga0268266_10007187 Ga0268266_100071879 443
552 3300028379 Ga0268266_10015277 Ga0268266_100152774 443
553 3300031852 Ga0307410_10182567 Ga0307410_101825672 443
554 3300031995 Ga0307409_100078970 Ga0307409_1000789702 443
555 3300032005 Ga0307411_10047651 Ga0307411_100476512 443
556 3300032126 Ga0307415_100069236 Ga0307415_1000692363 443
557 3300037312 Ga0395899_0065927 Ga0395899_0065927_1279_2622 443
558 3300037466 Ga0395898_0053416 Ga0395898_0053416_621_1964 443
559 3300038443 Ga0395901_0029700 Ga0395901_0029700_3182_4525 443
560 3300044656 Ga0466969_0003205 Ga0466969_0003205_5018_6376 443
561 3300044684 Ga0466966_0002490 Ga0466966_0002490_9627_10970 443
562 3300044693 Ga0466961_0021195 Ga0466961_0021195_383_1726 443
563 3300044765 Ga0466970_0005211 Ga0466970_0005211_2213_3571 443
564 3300044901 Ga0466960_0005774 Ga0466960_0005774_2948_4282 443
565 3300045976 Ga0466967_0042514 Ga0466967_0042514_1818_3161 443
566 3300045976 Ga0466967_0046247 Ga0466967_0046247_1158_2492 443
567 3300045976 Ga0466967_0151430 Ga0466967_0151430_195_1553 443
568 3300046462 Ga0495651_0000877 Ga0495651_0000877_10274_11635 443
569 3300046463 Ga0495653_0003805 Ga0495653_0003805_7107_8468 443
570 3300046529 Ga0495652_0000654 Ga0495652_0000654_27541_28902 443
571 3300046809 Ga0495600_0001072 Ga0495600_0001072_8316_9677 443
572 3300048903 Ga0496100_0058356 Ga0496100_0058356_109_1443 443
573 3300048904 Ga0496101_0043038 Ga0496101_0043038_656_1990 443
574 3300048908 Ga0496105_0022117 Ga0496105_0022117_2779_4176 443
575 3300048908 Ga0496105_0035803 Ga0496105_0035803_447_1781 443
576 3300048910 Ga0496107_0038012 Ga0496107_0038012_1039_2373 443
577 3300048910 Ga0496107_0073522 Ga0496107_0073522_417_1751 443
578 3300048912 Ga0496109_0034523 Ga0496109_0034523_156_1553 443
579 3300048913 Ga0496110_0040490 Ga0496110_0040490_880_2277 443
580 3300048914 Ga0496111_0065120 Ga0496111_0065120_450_1847 443
581 3300048918 Ga0496115_0026477 Ga0496115_0026477_912_2246 443
582 3300049568 Ga0501031_0063185 Ga0501031_0063185_1034_2368 443
583 3300049571 Ga0501034_0020937 Ga0501034_0020937_1946_3280 443
584 3300049571 Ga0501034_0052775 Ga0501034_0052775_1828_3165 443
585 3300049572 Ga0501036_0018022 Ga0501036_0018022_1252_2586 443
586 3300049584 Ga0501068_0030095 Ga0501068_0030095_1787_3121 443
587 3300049589 Ga0501073_0003012 Ga0501073_0003012_5753_7090 443
588 3300049589 Ga0501073_0095406 Ga0501073_0095406_588_1922 443
589 3300049590 Ga0501074_0016485 Ga0501074_0016485_2854_4188 443
590 3300049741 Ga0501079_0056015 Ga0501079_0056015_895_2232 443
591 3300049742 Ga0501080_0027729 Ga0501080_0027729_811_2145 443
592 3300049744 Ga0501083_0012707 Ga0501083_0012707_2855_4192 443
593 3300049824 Ga0501045_0007837 Ga0501045_0007837_4677_6011 443
594 3300050492 nmdc:mga0yw44_4616_c1 nmdc:mga0yw44_4616_c1_4410_5747 443
595 3300053077 Ga0495601_0019263 Ga0495601_0019263_773_2119 443
596 3300053085 Ga0495619_0031757 Ga0495619_0031757_67_1401 443
597 3300060353 Ga0501082_0062671 Ga0501082_0062671_89_1423 443
598 3300061719 Ga0466962_0024363 Ga0466962_0024363_1548_2891 443
599 iso_pu_bacteria 2643221576 2643893681 443
600 iso_pu_bacteria 2643221590 2643957764 443
601 iso_pu_bacteria 2839986021 2839989606 443
602 iso_pu_bacteria 2932431166 2932432113 443
603 3300005345 Ga0070692_10075932 Ga0070692_100759321 444
604 3300005366 Ga0070659_100152696 Ga0070659_1001526962 444
605 3300005455 Ga0070663_100071824 Ga0070663_1000718242 444
606 3300005471 Ga0070698_100000408 Ga0070698_10000040840 444
607 3300005985 Ga0081539_10060074 Ga0081539_100600742 444
608 3300006844 Ga0075428_100007250 Ga0075428_1000072505 444
609 3300006847 Ga0075431_100009125 Ga0075431_1000091253 444
610 3300006852 Ga0075433_10003678 Ga0075433_100036788 444
611 3300006871 Ga0075434_100001261 Ga0075434_1000012615 444
612 3300006871 Ga0075434_100014570 Ga0075434_1000145706 444
613 3300006880 Ga0075429_100007247 Ga0075429_1000072476 444
614 3300006914 Ga0075436_100001077 Ga0075436_1000010772 444
615 3300009094 Ga0111539_10000537 Ga0111539_1000053739 444
616 3300009094 Ga0111539_10099912 Ga0111539_100999123 444
617 3300009098 Ga0105245_10157298 Ga0105245_101572981 444
618 3300009147 Ga0114129_10008460 Ga0114129_1000846011 444
619 3300009148 Ga0105243_10052523 Ga0105243_100525232 444
620 3300009148 Ga0105243_10056185 Ga0105243_100561852 444
621 3300009176 Ga0105242_10037132 Ga0105242_100371322 444
622 3300009545 Ga0105237_10176531 Ga0105237_101765312 444
623 3300009551 Ga0105238_10119804 Ga0105238_101198042 444
624 3300009553 Ga0105249_10167924 Ga0105249_101679242 444
625 3300010375 Ga0105239_10016948 Ga0105239_100169483 444
626 3300010375 Ga0105239_10076437 Ga0105239_100764375 444
627 3300013306 Ga0163162_10054215 Ga0163162_100542152 444
628 3300013307 Ga0157372_10084428 Ga0157372_100844283 444
629 3300014325 Ga0163163_10210225 Ga0163163_102102252 444
630 3300017792 Ga0163161_10093855 Ga0163161_100938552 444
631 3300025901 Ga0207688_10011866 Ga0207688_100118661 444
632 3300025901 Ga0207688_10044896 Ga0207688_100448962 444
633 3300025924 Ga0207694_10067059 Ga0207694_100670592 444
634 3300025934 Ga0207686_10126933 Ga0207686_101269331 444
635 3300025935 Ga0207709_10029384 Ga0207709_100293843 444
636 3300026118 Ga0207675_100008679 Ga0207675_1000086795 444
637 3300027866 Ga0209813_10005253 Ga0209813_100052533 444
638 3300027907 Ga0207428_10005928 Ga0207428_100059285 444
639 3300027907 Ga0207428_10080214 Ga0207428_100802142 444
640 3300031548 Ga0307408_100008922 Ga0307408_1000089225 444
641 3300031548 Ga0307408_100010849 Ga0307408_1000108491 444
642 3300031548 Ga0307408_100112552 Ga0307408_1001125522 444
643 3300031731 Ga0307405_10000511 Ga0307405_1000051112 444
644 3300031824 Ga0307413_10000901 Ga0307413_100009014 444
645 3300031824 Ga0307413_10015857 Ga0307413_100158573 444
646 3300031824 Ga0307413_10027245 Ga0307413_100272452 444
647 3300031852 Ga0307410_10043450 Ga0307410_100434504 444
648 3300031901 Ga0307406_10000019 Ga0307406_1000001941 444
649 3300031903 Ga0307407_10004007 Ga0307407_100040073 444
650 3300031911 Ga0307412_10018856 Ga0307412_100188564 444
651 3300031995 Ga0307409_100310526 Ga0307409_1003105262 444
652 3300032002 Ga0307416_100000040 Ga0307416_10000004067 444
653 3300032002 Ga0307416_100015467 Ga0307416_1000154674 444
654 3300032004 Ga0307414_10002067 Ga0307414_100020679 444
655 3300032004 Ga0307414_10009244 Ga0307414_100092446 444
656 3300032005 Ga0307411_10000062 Ga0307411_100000623 444
657 3300032005 Ga0307411_10012877 Ga0307411_100128773 444
658 3300032126 Ga0307415_100002141 Ga0307415_1000021415 444
659 3300032126 Ga0307415_100005448 Ga0307415_1000054483 444
660 3300041997 Ga0439431_0004227 Ga0439431_0004227_1184_2542 444
661 3300042016 Ga0439463_017598 Ga0439463_017598_16_1410 444
662 3300042156 Ga0439446_0013258 Ga0439446_0013258_135_1493 444
663 3300042435 Ga0439434_0003877 Ga0439434_0003877_456_1814 444
664 3300042993 Ga0439440_0001853 Ga0439440_0001853_2241_3629 444
665 3300042993 Ga0439440_0002277 Ga0439440_0002277_1895_3271 444
666 3300044693 Ga0466961_0057919 Ga0466961_0057919_728_2080 444
667 3300044901 Ga0466960_0010227 Ga0466960_0010227_1475_2827 444
668 3300048912 Ga0496109_0014852 Ga0496109_0014852_2603_3949 444
669 3300049568 Ga0501031_0013104 Ga0501031_0013104_277_1626 444
670 3300049569 Ga0501032_0088277 Ga0501032_0088277_537_1886 444
671 3300049572 Ga0501036_0010572 Ga0501036_0010572_2397_3746 444
672 3300049575 Ga0501039_0097693 Ga0501039_0097693_627_1976 444
673 3300049578 Ga0501042_0007307 Ga0501042_0007307_365_1714 444
674 3300049581 Ga0501047_0000112 Ga0501047_0000112_19902_21269 444
675 3300049582 Ga0501048_0010821 Ga0501048_0010821_2910_4259 444
676 3300049587 Ga0501071_0008460 Ga0501071_0008460_2241_3590 444
677 3300049588 Ga0501072_0013685 Ga0501072_0013685_2500_3849 444
678 3300049590 Ga0501074_0029004 Ga0501074_0029004_384_1733 444
679 3300049592 Ga0501076_0207672 Ga0501076_0207672_203_1543 444
680 3300049743 Ga0501081_0077702 Ga0501081_0077702_883_2232 444
681 3300049824 Ga0501045_0024013 Ga0501045_0024013_825_2174 444
682 3300050492 nmdc:mga0yw44_4245_c1 nmdc:mga0yw44_4245_c1_1943_3283 444
683 3300050494 nmdc:mga06z11_7458_c1 nmdc:mga06z11_7458_c1_414_1754 444
684 3300050495 nmdc:mga04h51_2262_c1 nmdc:mga04h51_2262_c1_1312_2652 444
685 3300050507 nmdc:mga05p37_36587_c1 nmdc:mga05p37_36587_c1_1891_3285 444
686 3300050510 nmdc:mga06r32_43895_c1 nmdc:mga06r32_43895_c1_1538_2932 444
687 3300050511 nmdc:mga08y16_13478_c1 nmdc:mga08y16_13478_c1_4456_5850 444
688 3300050511 nmdc:mga08y16_26727_c1 nmdc:mga08y16_26727_c1_4509_5906 444
689 3300050512 nmdc:mga0n895_1812_c1 nmdc:mga0n895_1812_c1_466_1863 444
690 3300050512 nmdc:mga0n895_24204_c1 nmdc:mga0n895_24204_c1_2463_3857 444
691 3300050515 nmdc:mga0a205_120_c1 nmdc:mga0a205_120_c1_18512_19909 444
692 3300050515 nmdc:mga0a205_5052_c1 nmdc:mga0a205_5052_c1_6924_8318 444
693 3300054114 Ga0501084_0037634 Ga0501084_0037634_1870_3219 444
694 3300001979 JGI24740J21852_10005365 JGI24740J21852_100053652 445
695 3300001989 JGI24739J22299_10005499 JGI24739J22299_100054994 445
696 3300005344 Ga0070661_100076191 Ga0070661_1000761912 445
697 3300005367 Ga0070667_100084572 Ga0070667_1000845723 445
698 3300005530 Ga0070679_100051890 Ga0070679_1000518905 445
699 3300005535 Ga0070684_100154578 Ga0070684_1001545782 445
700 3300005564 Ga0070664_100064323 Ga0070664_1000643232 445
701 3300005577 Ga0068857_100038888 Ga0068857_1000388882 445
702 3300005614 Ga0068856_100204808 Ga0068856_1002048081 445
703 3300005983 Ga0081540_1033264 Ga0081540_10332643 445
704 3300006178 Ga0075367_10040955 Ga0075367_100409552 445
705 3300006353 Ga0075370_10027371 Ga0075370_100273713 445
706 3300006844 Ga0075428_100011991 Ga0075428_1000119915 445
707 3300006847 Ga0075431_100028072 Ga0075431_1000280724 445
708 3300006880 Ga0075429_100020235 Ga0075429_1000202354 445
709 3300025321 Ga0207656_10036994 Ga0207656_100369942 445
710 3300025904 Ga0207647_10019932 Ga0207647_100199323 445
711 3300025904 Ga0207647_10043871 Ga0207647_100438711 445
712 3300025929 Ga0207664_10024716 Ga0207664_100247162 445
713 3300025945 Ga0207679_10006682 Ga0207679_100066823 445
714 3300026041 Ga0207639_10081722 Ga0207639_100817223 445
715 3300026075 Ga0207708_10242311 Ga0207708_102423111 445
716 3300026116 Ga0207674_10017090 Ga0207674_100170902 445
717 3300028381 Ga0268264_10000374 Ga0268264_1000037447 445
718 3300031456 Ga0307513_10077152 Ga0307513_100771523 445
719 3300031456 Ga0307513_10102899 Ga0307513_101028993 445
720 3300031995 Ga0307409_100094875 Ga0307409_1000948752 445
721 3300032002 Ga0307416_100033810 Ga0307416_1000338105 445
722 3300032126 Ga0307415_100047103 Ga0307415_1000471032 445
723 3300038443 Ga0395901_0160644 Ga0395901_0160644_43_1401 445
724 3300038443 Ga0395901_0256540 Ga0395901_0256540_149_1495 445
725 3300042002 Ga0439442_016345 Ga0439442_016345_121_1473 445
726 3300044658 Ga0466972_0056342 Ga0466972_0056342_301_1659 445
727 3300044765 Ga0466970_0000821 Ga0466970_0000821_8187_9545 445
728 3300044765 Ga0466970_0006446 Ga0466970_0006446_2262_3605 445
729 3300044765 Ga0466970_0008060 Ga0466970_0008060_3780_5120 445
730 3300044842 Ga0466957_0016357 Ga0466957_0016357_709_2067 445
731 3300045836 Ga0466958_0002731 Ga0466958_0002731_3172_4530 445
732 3300045976 Ga0466967_0017591 Ga0466967_0017591_188_1561 445
733 3300045976 Ga0466967_0036385 Ga0466967_0036385_1899_3257 445
734 3300046492 Ga0495585_0065273 Ga0495585_0065273_628_1965 445
735 3300048903 Ga0496100_0034974 Ga0496100_0034974_1267_2619 445
736 3300048908 Ga0496105_0187628 Ga0496105_0187628_282_1634 445
737 3300048909 Ga0496106_0021137 Ga0496106_0021137_2109_3461 445
738 3300048909 Ga0496106_0087147 Ga0496106_0087147_128_1474 445
739 3300048910 Ga0496107_0012322 Ga0496107_0012322_4598_5950 445
740 3300048927 Ga0496124_0031963 Ga0496124_0031963_2278_3630 445
741 3300049575 Ga0501039_0025256 Ga0501039_0025256_1283_2632 445
742 3300049583 Ga0501067_0002973 Ga0501067_0002973_351_1691 445
743 3300050491 nmdc:mga00v17_25768_c1 nmdc:mga00v17_25768_c1_1971_3323 445
744 3300050491 nmdc:mga00v17_37665_c1 nmdc:mga00v17_37665_c1_501_1853 445
745 3300050492 nmdc:mga0yw44_40379_c1 nmdc:mga0yw44_40379_c1_470_1822 445
746 3300050494 nmdc:mga06z11_3386_c1 nmdc:mga06z11_3386_c1_259_1611 445
747 3300050494 nmdc:mga06z11_41662_c1 nmdc:mga06z11_41662_c1_265_1611 445
748 3300050495 nmdc:mga04h51_22456_c1 nmdc:mga04h51_22456_c1_299_1645 445
749 3300050496 nmdc:mga07m45_43272_c1 nmdc:mga07m45_43272_c1_986_2338 445
750 3300050507 nmdc:mga05p37_41527_c1 nmdc:mga05p37_41527_c1_901_2250 445
751 3300050509 nmdc:mga0qj67_7306_c1 nmdc:mga0qj67_7306_c1_6187_7536 445
752 3300050510 nmdc:mga06r32_35629_c1 nmdc:mga06r32_35629_c1_1424_2773 445
753 3300053104 Ga0500556_0000485 Ga0500556_0000485_9192_10544 445

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00346

Complex1_49kDa

Respiratory-chain NADH dehydrogenase, 49 Kd subunit

186

475

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zk9-assembly1.cif.gz_4 peripheral domain of open complex i during turnover 0.9332 40 445
5gpn-assembly1.cif.gz_Z architecture of mammalian respirasome 0.9309 50 445
7a24-assembly1.cif.gz_G assembly intermediate of the plant mitochondrial complex i 0.9307 41 442
8e9h-assembly1.cif.gz_D mycobacterial respiratory complex i, fully-inserted quinone 0.9303 39 445
5gpn-assembly1.cif.gz_Z architecture of mammalian respirasome 0.9285 50 445
ID Description Score Start End Superfamily
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9353 41 445 1.10.645.10
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9308 41 445 1.10.645.10
af_P16431_180_537_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.923 41 436 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9169 41 445 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9123 41 445 1.10.645.10
ID Description Score Start End GO Terms
AF-A0A2S9G032-F1-model_v4 NADH dehydrogenase subunit D 0.9894 222 303 GO:0016651
GO:0048038
GO:0051287
AF-A0A6B3I5G8-F1-model_v4 NADH dehydrogenase subunit D 0.987 106 247 GO:0016651
GO:0048038
GO:0051287
AF-A0A6G3WKU9-F1-model_v4 NADH dehydrogenase subunit D 0.9818 159 330 GO:0016651
GO:0048038
GO:0051287
AF-T1BX24-F1-model_v4 NADH dehydrogenase I, D subunit 0.9729 137 326 GO:0016651
GO:0048038
GO:0051287
AF-A0A533XNX7-F1-model_v4 NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) 0.9724 177 305 GO:0016651
GO:0048038
GO:0051287

Feature Viewer

pLDDT pTM Quality
83.47 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map