F479232

General Info

Members Datasets Scaffolds Average Seq Length
753 304 1506 263

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0020426|Ga0500559_0020426_203_1243
Length 320
Sequence LRIAQKHPKGDIFHLNQWLVNHSSYQIKLPQFEGPFDLLLFFIERDELDIYNIPITRIIKDFMDYIHSLEKLNIELSSEFILFISTLMRIKAKMLLPRKELDAQGNEIDPRQELVDKILEYKRYKEAALRMAEMEAIRMLMVKRGNAVKEMSTIGEDSGEGTEIQSITLFKLMKTFEKVMKKLEQRNIKPVHTVVSYNYTMDGSRTYMLETVKTEKLMSFEKIFDICQDRIHAIFLFLSMLELVQMKYMSIMVGEGRNNFILEFNENREEDATFDIDALRESQFSDRKVVNEEVTEGLFAKAADDVVEAAHDELDKALRK

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
210 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
253 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
254 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
276 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
277 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
282 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
283 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
284 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
287 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
288 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 2738541278 Niastella sp. CF465 Isolate Unclassified
294 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
295 2818991444 Filimonas endophytica 3197 Isolate Unclassified
296 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
297 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
298 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
299 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
300 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
301 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
302 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
303 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
304 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.7
Nodule 0
Rhizoplane 0.8
Rhizosphere 86.59
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0020426 3300053136 Bacteria 2801
2 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
3 SwRhRL2b_contig_3813669 2162886007 Bacteria 2946
4 JGI24740J21852_10002134 3300001979 Bacteria 9036
5 JGI24740J21852_10018449 3300001979 Bacteria 2473
6 JGI24739J22299_10009728 3300001989 Bacteria 3577
7 JGI24737J22298_10054058 3300001990 Bacteria 1216
8 JGI24751J29686_10001433 3300002459 Bacteria 4992
9 JGI24751J29686_10028347 3300002459 Unclassified 1162
10 JGI25154J39366_1000006 3300002738 Bacteria 336396
11 JGI25157J39369_1004371 3300002741 Bacteria 2584
12 JGI25153J46596_10005500 3300003215 Bacteria 6632
13 JGI25153J46596_10014489 3300003215 Bacteria 3274
14 rootH1_10038598 3300003316 Bacteria 2239
15 rootH1_10066544 3300003316 Bacteria 1936
16 rootH2_10032113 3300003320 Bacteria 3959
17 rootH2_10094418 3300003320 Bacteria 2042
18 rootH2_10253391 3300003320 Bacteria 2929
19 rootL2_10014283 3300003322 Bacteria 15569
20 rootL2_10019832 3300003322 Bacteria 19078
21 rootL2_10119408 3300003322 Bacteria 1689
22 rootL2_10180565 3300003322 Bacteria 2060
23 rootL2_10319470 3300003322 Unclassified 3137
24 rootH1_10027463 3300003323 Bacteria 3175
25 rootH1_10137836 3300003323 Bacteria 5647
26 rootH1_10310403 3300003323 Bacteria 1057
27 JGI25160J50197_1005758 3300003354 Bacteria 5110
28 JGI25160J50197_1010184 3300003354 Bacteria 3419
29 JGI25160J50197_1012948 3300003354 Bacteria 2866
30 Ga0055542_1004003 3300003762 Bacteria 3741
31 Ga0055526_1010659 3300003771 Bacteria 4247
32 Ga0055528_1000077 3300003790 Bacteria 75704
33 Ga0055530_10002824 3300003791 Bacteria 10657
34 Ga0055531_10000005 3300003794 Bacteria 242179
35 Ga0055531_10024937 3300003794 Bacteria 2189
36 Ga0065165_1000042 3300005262 Bacteria 203874
37 Ga0065165_1011865 3300005262 Bacteria 3590
38 Ga0065714_10087840 3300005288 Unclassified 2042
39 Ga0065704_10070133 3300005289 Bacteria 1266035
40 Ga0065704_10077708 3300005289 Bacteria 4645
41 Ga0065712_10074422 3300005290 Bacteria 4098
42 Ga0065712_10175767 3300005290 Bacteria 1218
43 Ga0065712_10198684 3300005290 Bacteria 1117
44 Ga0065715_10006633 3300005293 Bacteria 4735
45 Ga0065707_10405757 3300005295 Unclassified 847
46 Ga0070658_10000515 3300005327 Bacteria 33566
47 Ga0070658_10005427 3300005327 Bacteria 10344
48 Ga0070658_10472927 3300005327 Bacteria 1081
49 Ga0070658_10648437 3300005327 Bacteria 916
50 Ga0070676_10000341 3300005328 Bacteria 21305
51 Ga0070676_10026193 3300005328 Bacteria 3301
52 Ga0070676_10185212 3300005328 Unclassified 1356
53 Ga0070683_100070766 3300005329 Bacteria 3254
54 Ga0070690_100230224 3300005330 Bacteria 1303
55 Ga0070670_100011332 3300005331 Bacteria 7619
56 Ga0070670_100015247 3300005331 Bacteria 6596
57 Ga0070670_100063043 3300005331 Bacteria 3181
58 Ga0070670_100166167 3300005331 Bacteria 1913
59 Ga0070670_100227187 3300005331 Bacteria 1624
60 Ga0070670_100257085 3300005331 Bacteria 1522
61 Ga0070670_100726849 3300005331 Bacteria 894
62 Ga0070677_10013665 3300005333 Bacteria 2844
63 Ga0068869_100006045 3300005334 Bacteria 7657
64 Ga0068869_100018070 3300005334 Unclassified 4793
65 Ga0068869_100088707 3300005334 Bacteria 2322
66 Ga0068869_100215495 3300005334 Bacteria 1520
67 Ga0068869_100326658 3300005334 Bacteria 1245
68 Ga0068869_100391470 3300005334 Bacteria 1141
69 Ga0070666_10000172 3300005335 Bacteria 44437
70 Ga0070666_10000185 3300005335 Bacteria 42683
71 Ga0070666_10163481 3300005335 Bacteria 1556
72 Ga0070666_10293408 3300005335 Bacteria 1157
73 Ga0070680_100001877 3300005336 Bacteria 15408
74 Ga0070682_100000259 3300005337 Bacteria 38232
75 Ga0070682_100002348 3300005337 Bacteria 10477
76 Ga0068868_100001522 3300005338 Bacteria 15890
77 Ga0068868_100330141 3300005338 Bacteria 1302
78 Ga0070660_100052435 3300005339 Bacteria 3145
79 Ga0070689_100013704 3300005340 Bacteria 5873
80 Ga0070689_100103172 3300005340 Unclassified 2260
81 Ga0070689_100215127 3300005340 Bacteria 1574
82 Ga0070691_10000875 3300005341 Bacteria 12204
83 Ga0070687_100081113 3300005343 Bacteria 1770
84 Ga0070661_100071198 3300005344 Bacteria 2558
85 Ga0070692_10019052 3300005345 Bacteria 3309
86 Ga0070668_100000169 3300005347 Bacteria 41705
87 Ga0070668_100035392 3300005347 Bacteria 3807
88 Ga0070668_100067980 3300005347 Unclassified 2769
89 Ga0070668_100299370 3300005347 Bacteria 1349
90 Ga0070669_100002549 3300005353 Bacteria 13166
91 Ga0070669_100329052 3300005353 Bacteria 1235
92 Ga0070675_100004810 3300005354 Bacteria 10303
93 Ga0070675_100019684 3300005354 Bacteria 5381
94 Ga0070675_100027677 3300005354 Bacteria 4557
95 Ga0070671_100007849 3300005355 Bacteria 8530
96 Ga0070671_100022580 3300005355 Bacteria 5139
97 Ga0070671_100037901 3300005355 Unclassified 4000
98 Ga0070671_100343410 3300005355 Bacteria 1274
99 Ga0070671_100350488 3300005355 Bacteria 1260
100 Ga0070671_100448603 3300005355 Bacteria 1107
101 Ga0070671_100621612 3300005355 Bacteria 934
102 Ga0070673_100000813 3300005364 Bacteria 17473
103 Ga0070673_100003572 3300005364 Bacteria 9712
104 Ga0070673_100029120 3300005364 Bacteria 4115
105 Ga0070673_100514598 3300005364 Bacteria 1084
106 Ga0070688_100007036 3300005365 Bacteria 6050
107 Ga0070688_100016843 3300005365 Bacteria 4185
108 Ga0070688_100027353 3300005365 Bacteria 3397
109 Ga0070688_100219473 3300005365 Unclassified 1339
110 Ga0070688_100224516 3300005365 Unclassified 1325
111 Ga0070659_100003003 3300005366 Bacteria 12009
112 Ga0070659_100299513 3300005366 Bacteria 1341
113 Ga0070667_100000553 3300005367 Bacteria 37217
114 Ga0070667_100002163 3300005367 Bacteria 17311
115 Ga0070667_100003932 3300005367 Bacteria 12623
116 Ga0070667_100011960 3300005367 Bacteria 7180
117 Ga0070667_100042562 3300005367 Unclassified 3811
118 Ga0070700_100037548 3300005441 Bacteria 2947
119 Ga0070663_100018961 3300005455 Bacteria 4523
120 Ga0070663_100465514 3300005455 Bacteria 1044
121 Ga0070663_100551384 3300005455 Bacteria 964
122 Ga0070678_100048144 3300005456 Bacteria 3068
123 Ga0070678_100057436 3300005456 Unclassified 2851
124 Ga0070678_100334582 3300005456 Bacteria 1297
125 Ga0070678_100404682 3300005456 Unclassified 1186
126 Ga0070662_100002884 3300005457 Bacteria 10668
127 Ga0070681_10014936 3300005458 Bacteria 7721
128 Ga0070681_10057796 3300005458 Unclassified 3859
129 Ga0070681_10356665 3300005458 Bacteria 1373
130 Ga0068867_100001171 3300005459 Bacteria 17945
131 Ga0068867_100016028 3300005459 Bacteria 5321
132 Ga0068867_100020227 3300005459 Unclassified 4743
133 Ga0068867_100031203 3300005459 Unclassified 3846
134 Ga0068867_100252856 3300005459 Unclassified 1433
135 Ga0068867_100522800 3300005459 Unclassified 1023
136 Ga0070685_10003193 3300005466 Bacteria 8344
137 Ga0070685_10012670 3300005466 Unclassified 4435
138 Ga0070685_10069633 3300005466 Bacteria 2081
139 Ga0070698_100001684 3300005471 Bacteria 24662
140 Ga0070698_100084673 3300005471 Bacteria 3158
141 Ga0070699_100206464 3300005518 Bacteria 1748
142 Ga0070679_100002688 3300005530 Bacteria 16195
143 Ga0070679_100220775 3300005530 Bacteria 1856
144 Ga0070679_100244734 3300005530 Bacteria 1750
145 Ga0068853_100000272 3300005539 Bacteria 36612
146 Ga0068853_100047923 3300005539 Unclassified 3668
147 Ga0068853_100372051 3300005539 Bacteria 1333
148 Ga0068853_100377660 3300005539 Bacteria 1323
149 Ga0070672_100000061 3300005543 Bacteria 49701
150 Ga0070672_100066056 3300005543 Unclassified 2863
151 Ga0070672_100134964 3300005543 Bacteria 2032
152 Ga0070672_100246378 3300005543 Unclassified 1504
153 Ga0070672_100289545 3300005543 Bacteria 1386
154 Ga0070665_100000612 3300005548 Bacteria 48973
155 Ga0070665_100008108 3300005548 Bacteria 10633
156 Ga0070665_100177167 3300005548 Bacteria 2133
157 Ga0070665_100396854 3300005548 Bacteria 1387
158 Ga0068855_100003883 3300005563 Bacteria 18266
159 Ga0068855_100016351 3300005563 Bacteria 8921
160 Ga0068855_100110959 3300005563 Bacteria 3148
161 Ga0068855_100137468 3300005563 Bacteria 2787
162 Ga0068855_100277230 3300005563 Unclassified 1863
163 Ga0070664_100009965 3300005564 Bacteria 7703
164 Ga0070664_100042674 3300005564 Bacteria 3828
165 Ga0070664_100139449 3300005564 Unclassified 2134
166 Ga0068857_100007129 3300005577 Bacteria 9627
167 Ga0068857_100104068 3300005577 Unclassified 2549
168 Ga0068857_100494269 3300005577 Bacteria 1147
169 Ga0068857_100661929 3300005577 Bacteria 990
170 Ga0068854_100013145 3300005578 Bacteria 5426
171 Ga0068854_100071501 3300005578 Unclassified 2538
172 Ga0068856_100034665 3300005614 Bacteria 4943
173 Ga0068856_100068876 3300005614 Bacteria 3498
174 Ga0070702_100019944 3300005615 Unclassified 3505
175 Ga0068852_100000787 3300005616 Bacteria 20834
176 Ga0068852_100008187 3300005616 Bacteria 7681
177 Ga0068852_100047286 3300005616 Bacteria 3670
178 Ga0068852_100086895 3300005616 Bacteria 2789
179 Ga0068852_100457813 3300005616 Bacteria 1264
180 Ga0068852_100612956 3300005616 Unclassified 1094
181 Ga0068859_100000013 3300005617 Bacteria 291126
182 Ga0068859_100028460 3300005617 Bacteria 5602
183 Ga0068859_100041010 3300005617 Bacteria 4650
184 Ga0068859_100047799 3300005617 Unclassified 4299
185 Ga0068859_100052217 3300005617 Unclassified 4109
186 Ga0068859_100090425 3300005617 Bacteria 3112
187 Ga0068859_100095284 3300005617 Bacteria 3029
188 Ga0068859_100185090 3300005617 Bacteria 2166
189 Ga0068864_100004846 3300005618 Bacteria 11021
190 Ga0068864_100014384 3300005618 Bacteria 6572
191 Ga0068864_100029845 3300005618 Bacteria 4621
192 Ga0068864_100062003 3300005618 Bacteria 3239
193 Ga0068864_100079933 3300005618 Bacteria 2864
194 Ga0068864_100082789 3300005618 Bacteria 2816
195 Ga0068866_10053858 3300005718 Bacteria 2059
196 Ga0068861_100076877 3300005719 Unclassified 2602
197 Ga0068861_100091750 3300005719 Bacteria 2399
198 Ga0068851_10001728 3300005834 Bacteria 9542
199 Ga0068851_10036515 3300005834 Unclassified 2460
200 Ga0068851_10051254 3300005834 Bacteria 2097
201 Ga0068851_10138654 3300005834 Unclassified 1321
202 Ga0068870_10004264 3300005840 Bacteria 6146
203 Ga0068870_10038156 3300005840 Unclassified 2479
204 Ga0068870_10207759 3300005840 Bacteria 1191
205 Ga0068863_100001273 3300005841 Bacteria 25131
206 Ga0068863_100015573 3300005841 Bacteria 7306
207 Ga0068863_100021719 3300005841 Bacteria 6123
208 Ga0068863_100021933 3300005841 Bacteria 6094
209 Ga0068863_100027233 3300005841 Bacteria 5451
210 Ga0068863_100296048 3300005841 Bacteria 1569
211 Ga0068863_100604925 3300005841 Bacteria 1085
212 Ga0068858_100000930 3300005842 Bacteria 30365
213 Ga0068858_100014471 3300005842 Bacteria 7434
214 Ga0068858_100819832 3300005842 Unclassified 908
215 Ga0068860_100000443 3300005843 Bacteria 52294
216 Ga0068860_100000591 3300005843 Bacteria 43327
217 Ga0068860_100005524 3300005843 Bacteria 12798
218 Ga0068860_100029363 3300005843 Bacteria 5288
219 Ga0068860_100052013 3300005843 Bacteria 3896
220 Ga0068860_100155219 3300005843 Unclassified 2205
221 Ga0068862_100001278 3300005844 Bacteria 23579
222 Ga0068862_100002721 3300005844 Bacteria 15516
223 Ga0068862_100108492 3300005844 Bacteria 2435
224 Ga0068862_100187645 3300005844 Bacteria 1859
225 Ga0068862_100278398 3300005844 Bacteria 1532
226 Ga0068862_100403206 3300005844 Bacteria 1280
227 Ga0068862_100480724 3300005844 Bacteria 1176
228 Ga0075366_10010141 3300006195 Bacteria 5282
229 Ga0075366_10146725 3300006195 Bacteria 1428
230 Ga0097621_100000531 3300006237 Bacteria 26760
231 Ga0097621_100000821 3300006237 Bacteria 21965
232 Ga0097621_100004954 3300006237 Bacteria 9336
233 Ga0097621_100011962 3300006237 Bacteria 6419
234 Ga0097621_100046435 3300006237 Bacteria 3514
235 Ga0097621_100291543 3300006237 Bacteria 1439
236 Ga0097621_100388892 3300006237 Unclassified 1247
237 Ga0068871_100001554 3300006358 Bacteria 15398
238 Ga0068871_100002710 3300006358 Bacteria 12089
239 Ga0068871_100016561 3300006358 Bacteria 5558
240 Ga0068871_100075852 3300006358 Unclassified 2776
241 Ga0075428_100143572 3300006844 Bacteria 2595
242 Ga0075428_100960321 3300006844 Unclassified 905
243 Ga0075430_100007849 3300006846 Bacteria 9022
244 Ga0075431_100005370 3300006847 Bacteria 12650
245 Ga0075431_100414130 3300006847 Unclassified 1347
246 Ga0075429_100019843 3300006880 Bacteria 5829
247 Ga0075429_100051926 3300006880 Bacteria 3566
248 Ga0068865_100003524 3300006881 Bacteria 9385
249 Ga0068865_100047931 3300006881 Unclassified 2939
250 Ga0068865_100336596 3300006881 Bacteria 1218
251 Ga0068865_100364145 3300006881 Bacteria 1175
252 Ga0097620_100000013 3300006931 Bacteria 291126
253 Ga0097620_100028459 3300006931 Bacteria 5602
254 Ga0097620_100041010 3300006931 Bacteria 4650
255 Ga0097620_100047801 3300006931 Unclassified 4299
256 Ga0097620_100052221 3300006931 Unclassified 4109
257 Ga0097620_100090425 3300006931 Bacteria 3112
258 Ga0097620_100095283 3300006931 Bacteria 3029
259 Ga0097620_100185076 3300006931 Bacteria 2166
260 Ga0105240_10000020 3300009093 Bacteria 399699
261 Ga0105240_10038515 3300009093 Bacteria 6132
262 Ga0105240_10048639 3300009093 Bacteria 5358
263 Ga0105240_10050783 3300009093 Bacteria 5225
264 Ga0105240_10060139 3300009093 Bacteria 4737
265 Ga0105240_10239040 3300009093 Unclassified 2106
266 Ga0111539_10004662 3300009094 Bacteria 17918
267 Ga0111539_10174473 3300009094 Unclassified 2511
268 Ga0111539_10199038 3300009094 Bacteria 2336
269 Ga0111539_10694191 3300009094 Bacteria 1185
270 Ga0111539_10823758 3300009094 Bacteria 1080
271 Ga0105245_10127548 3300009098 Bacteria 2383
272 Ga0105245_10179891 3300009098 Bacteria 2020
273 Ga0105247_10022723 3300009101 Bacteria 3776
274 Ga0105247_10027512 3300009101 Unclassified 3439
275 Ga0105247_10046132 3300009101 Unclassified 2674
276 Ga0114129_10052463 3300009147 Bacteria 5723
277 Ga0105243_10106734 3300009148 Unclassified 2335
278 Ga0105241_10000686 3300009174 Bacteria 25490
279 Ga0105241_10009515 3300009174 Bacteria 7139
280 Ga0105241_10091344 3300009174 Bacteria 2402
281 Ga0105242_10059707 3300009176 Bacteria 3130
282 Ga0105248_10014203 3300009177 Bacteria 8767
283 Ga0105248_10016765 3300009177 Bacteria 8067
284 Ga0105237_10004476 3300009545 Bacteria 16155
285 Ga0105237_10025289 3300009545 Bacteria 6073
286 Ga0105238_10122640 3300009551 Unclassified 2578
287 Ga0105249_10001226 3300009553 Bacteria 22548
288 Ga0105249_10002749 3300009553 Bacteria 15219
289 Ga0105249_10003197 3300009553 Bacteria 14178
290 Ga0105249_10006427 3300009553 Bacteria 10217
291 Ga0105249_10085379 3300009553 Bacteria 2941
292 Ga0105249_10173838 3300009553 Bacteria 2090
293 Ga0105249_10448012 3300009553 Bacteria 1329
294 Ga0105239_10000631 3300010375 Bacteria 50176
295 Ga0105239_10010893 3300010375 Bacteria 10159
296 Ga0105239_10023189 3300010375 Bacteria 6840
297 Ga0105239_10153260 3300010375 Bacteria 2573
298 Ga0105239_10389660 3300010375 Bacteria 1576
299 Ga0105246_10016419 3300011119 Bacteria 4689
300 Ga0105246_10059288 3300011119 Bacteria 2655
301 Ga0157373_10090369 3300013100 Bacteria 2157
302 Ga0157371_10036269 3300013102 Bacteria 3531
303 Ga0157371_10110099 3300013102 Bacteria 1955
304 Ga0157370_10003149 3300013104 Bacteria 19547
305 Ga0157370_10003666 3300013104 Bacteria 17942
306 Ga0157370_10276782 3300013104 Bacteria 1551
307 Ga0157370_10350688 3300013104 Bacteria 1360
308 Ga0157369_10021680 3300013105 Bacteria 7184
309 Ga0157369_10024505 3300013105 Bacteria 6711
310 Ga0157369_10297725 3300013105 Unclassified 1679
311 Ga0157374_10002119 3300013296 Bacteria 16701
312 Ga0157374_10184301 3300013296 Bacteria 2040
313 Ga0157378_10007403 3300013297 Bacteria 9589
314 Ga0157378_10028471 3300013297 Bacteria 4930
315 Ga0157378_10039607 3300013297 Bacteria 4180
316 Ga0157378_10044580 3300013297 Bacteria 3939
317 Ga0157378_10070013 3300013297 Bacteria 3148
318 Ga0157378_10077863 3300013297 Unclassified 2989
319 Ga0157378_10095523 3300013297 Bacteria 2707
320 Ga0157378_10147947 3300013297 Unclassified 2186
321 Ga0157378_10204847 3300013297 Bacteria 1868
322 Ga0163162_10000752 3300013306 Bacteria 30172
323 Ga0163162_10000931 3300013306 Bacteria 27155
324 Ga0163162_10001214 3300013306 Bacteria 24073
325 Ga0163162_10002506 3300013306 Bacteria 17371
326 Ga0163162_10003220 3300013306 Bacteria 15616
327 Ga0163162_10009367 3300013306 Bacteria 9524
328 Ga0163162_10012998 3300013306 Bacteria 8124
329 Ga0163162_10031439 3300013306 Bacteria 5265
330 Ga0163162_10052834 3300013306 Unclassified 4082
331 Ga0163162_10109057 3300013306 Bacteria 2865
332 Ga0163162_10132165 3300013306 Bacteria 2605
333 Ga0163162_10164252 3300013306 Bacteria 2344
334 Ga0163162_10695331 3300013306 Bacteria 1139
335 Ga0157372_10001914 3300013307 Bacteria 22584
336 Ga0157372_10006438 3300013307 Bacteria 12502
337 Ga0157372_10055213 3300013307 Bacteria 4435
338 Ga0157372_10074901 3300013307 Bacteria 3818
339 Ga0157372_10083103 3300013307 Bacteria 3627
340 Ga0157372_10095723 3300013307 Bacteria 3383
341 Ga0157372_10145310 3300013307 Bacteria 2735
342 Ga0157372_10151256 3300013307 Unclassified 2679
343 Ga0157372_10173548 3300013307 Bacteria 2494
344 Ga0157372_10195474 3300013307 Bacteria 2343
345 Ga0157372_10379645 3300013307 Bacteria 1647
346 Ga0157372_10428392 3300013307 Bacteria 1542
347 Ga0157372_10516102 3300013307 Bacteria 1393
348 Ga0157372_10588569 3300013307 Bacteria 1297
349 Ga0157375_10000098 3300013308 Bacteria 88130
350 Ga0157375_10001055 3300013308 Bacteria 23768
351 Ga0157375_10020946 3300013308 Bacteria 5983
352 Ga0157375_10028942 3300013308 Bacteria 5202
353 Ga0157375_10042760 3300013308 Bacteria 4388
354 Ga0157375_10135361 3300013308 Unclassified 2587
355 Ga0157375_10234186 3300013308 Bacteria 1995
356 Ga0157375_10363596 3300013308 Unclassified 1613
357 Ga0157375_10985028 3300013308 Bacteria 983
358 Ga0163163_10000272 3300014325 Bacteria 51699
359 Ga0163163_10000888 3300014325 Bacteria 25452
360 Ga0163163_10013960 3300014325 Bacteria 7371
361 Ga0163163_10072762 3300014325 Bacteria 3427
362 Ga0163163_10411207 3300014325 Unclassified 1411
363 Ga0163163_10500357 3300014325 Bacteria 1277
364 Ga0163163_10505951 3300014325 Bacteria 1270
365 Ga0157380_10005493 3300014326 Bacteria 8859
366 Ga0157380_10017785 3300014326 Bacteria 5267
367 Ga0157380_10063918 3300014326 Bacteria 2952
368 Ga0157380_10196875 3300014326 Bacteria 1784
369 Ga0157380_10201079 3300014326 Bacteria 1768
370 Ga0157377_10000659 3300014745 Bacteria 14381
371 Ga0157379_10000103 3300014968 Bacteria 58102
372 Ga0157379_10011365 3300014968 Bacteria 7764
373 Ga0157379_10185046 3300014968 Bacteria 1882
374 Ga0157379_10313229 3300014968 Bacteria 1432
375 Ga0157376_10000484 3300014969 Bacteria 25711
376 Ga0157376_10002103 3300014969 Bacteria 13391
377 Ga0157376_10014571 3300014969 Bacteria 5907
378 Ga0157376_10047458 3300014969 Bacteria 3545
379 Ga0157376_10058583 3300014969 Bacteria 3227
380 Ga0157376_10294773 3300014969 Bacteria 1533
381 Ga0182005_1000017 3300015265 Bacteria 331828
382 Ga0163161_10008445 3300017792 Bacteria 7131
383 Ga0163161_10011545 3300017792 Bacteria 6130
384 Ga0163161_10102585 3300017792 Bacteria 2131
385 Ga0163161_10275346 3300017792 Bacteria 1318
386 Ga0213876_10003307 3300021384 Bacteria 9246
387 Ga0213876_10076218 3300021384 Bacteria 1771
388 Ga0209436_108355 3300025208 Bacteria 2069
389 Ga0209258_100029 3300025242 Bacteria 490648
390 Ga0209646_1000031 3300025246 Bacteria 381260
391 Ga0209026_1000019 3300025250 Bacteria 381260
392 Ga0209148_1000089 3300025254 Bacteria 253548
393 Ga0207666_1007724 3300025271 Unclassified 1423
394 Ga0209673_1000113 3300025273 Bacteria 179012
395 Ga0209564_1008803 3300025295 Bacteria 4916
396 Ga0209758_1006508 3300025297 Bacteria 8344
397 Ga0209758_1011612 3300025297 Bacteria 5070
398 Ga0209758_1014394 3300025297 Bacteria 4211
399 Ga0209050_1000185 3300025298 Bacteria 141889
400 Ga0207426_1000026 3300025302 Bacteria 515228
401 Ga0207426_1000263 3300025302 Bacteria 110923
402 Ga0207426_1001392 3300025302 Bacteria 20412
403 Ga0209051_1036469 3300025303 Bacteria 1815
404 Ga0209257_1000004 3300025304 Bacteria 1678347
405 Ga0209257_1000257 3300025304 Bacteria 122448
406 Ga0207656_10001251 3300025321 Bacteria 8374
407 Ga0207642_10097883 3300025899 Bacteria 1465
408 Ga0207710_10011276 3300025900 Bacteria 3762
409 Ga0207688_10023048 3300025901 Unclassified 3407
410 Ga0207688_10254065 3300025901 Bacteria 1065
411 Ga0207680_10000083 3300025903 Bacteria 42904
412 Ga0207680_10001345 3300025903 Bacteria 11631
413 Ga0207680_10517955 3300025903 Unclassified 850
414 Ga0207647_10000050 3300025904 Bacteria 88099
415 Ga0207647_10000824 3300025904 Bacteria 24071
416 Ga0207647_10091077 3300025904 Unclassified 1818
417 Ga0207647_10286827 3300025904 Bacteria 939
418 Ga0207685_10006469 3300025905 Bacteria 3192
419 Ga0207645_10000793 3300025907 Bacteria 26435
420 Ga0207645_10008445 3300025907 Bacteria 7184
421 Ga0207645_10015568 3300025907 Bacteria 5050
422 Ga0207645_10021983 3300025907 Bacteria 4154
423 Ga0207645_10036615 3300025907 Bacteria 3151
424 Ga0207643_10004365 3300025908 Bacteria 7598
425 Ga0207705_10005062 3300025909 Bacteria 9880
426 Ga0207705_10017322 3300025909 Bacteria 5158
427 Ga0207705_10163510 3300025909 Bacteria 1673
428 Ga0207705_10214304 3300025909 Bacteria 1461
429 Ga0207654_10002274 3300025911 Bacteria 9849
430 Ga0207654_10021156 3300025911 Unclassified 3456
431 Ga0207707_10000160 3300025912 Bacteria 70695
432 Ga0207707_10085211 3300025912 Bacteria 2760
433 Ga0207695_10000020 3300025913 Bacteria 723025
434 Ga0207695_10002404 3300025913 Bacteria 27705
435 Ga0207695_10009558 3300025913 Bacteria 11985
436 Ga0207695_10169883 3300025913 Unclassified 2106
437 Ga0207671_10000025 3300025914 Bacteria 271617
438 Ga0207671_10001991 3300025914 Bacteria 22515
439 Ga0207671_10023773 3300025914 Bacteria 4618
440 Ga0207660_10048464 3300025917 Bacteria 3006
441 Ga0207662_10139080 3300025918 Unclassified 1537
442 Ga0207657_10030556 3300025919 Bacteria 4889
443 Ga0207657_10124095 3300025919 Bacteria 2122
444 Ga0207649_10020444 3300025920 Bacteria 3798
445 Ga0207652_10001880 3300025921 Bacteria 18225
446 Ga0207646_10025366 3300025922 Bacteria 5423
447 Ga0207681_10066965 3300025923 Bacteria 2488
448 Ga0207681_10075399 3300025923 Unclassified 2365
449 Ga0207681_10196688 3300025923 Bacteria 1546
450 Ga0207650_10000562 3300025925 Bacteria 30092
451 Ga0207650_10058657 3300025925 Unclassified 2866
452 Ga0207650_10380939 3300025925 Unclassified 1165
453 Ga0207659_10012376 3300025926 Bacteria 5425
454 Ga0207659_10029121 3300025926 Bacteria 3760
455 Ga0207659_10030626 3300025926 Unclassified 3678
456 Ga0207644_10040917 3300025931 Unclassified 3277
457 Ga0207644_10175389 3300025931 Bacteria 1677
458 Ga0207644_10191172 3300025931 Bacteria 1609
459 Ga0207690_10068711 3300025932 Bacteria 2435
460 Ga0207706_10006661 3300025933 Bacteria 10681
461 Ga0207706_10036362 3300025933 Unclassified 4374
462 Ga0207686_10000498 3300025934 Bacteria 25770
463 Ga0207670_10042309 3300025936 Bacteria 3001
464 Ga0207670_10183435 3300025936 Bacteria 1578
465 Ga0207670_10197247 3300025936 Bacteria 1527
466 Ga0207670_10249889 3300025936 Unclassified 1370
467 Ga0207704_10004460 3300025938 Bacteria 6400
468 Ga0207704_10007802 3300025938 Bacteria 5078
469 Ga0207704_10047803 3300025938 Bacteria 2561
470 Ga0207704_10112702 3300025938 Bacteria 1843
471 Ga0207704_10282893 3300025938 Bacteria 1262
472 Ga0207704_10626890 3300025938 Bacteria 883
473 Ga0207691_10000154 3300025940 Bacteria 64281
474 Ga0207691_10006412 3300025940 Bacteria 11367
475 Ga0207691_10011687 3300025940 Bacteria 8431
476 Ga0207691_10014404 3300025940 Bacteria 7541
477 Ga0207691_10183619 3300025940 Bacteria 1827
478 Ga0207691_10504664 3300025940 Bacteria 1027
479 Ga0207711_10170821 3300025941 Unclassified 1973
480 Ga0207711_10213139 3300025941 Bacteria 1765
481 Ga0207689_10006246 3300025942 Bacteria 10557
482 Ga0207689_10009576 3300025942 Bacteria 8356
483 Ga0207689_10029427 3300025942 Bacteria 4586
484 Ga0207689_10043843 3300025942 Bacteria 3698
485 Ga0207689_10045161 3300025942 Unclassified 3644
486 Ga0207689_10053634 3300025942 Bacteria 3322
487 Ga0207689_10084762 3300025942 Bacteria 2605
488 Ga0207689_10172962 3300025942 Unclassified 1781
489 Ga0207661_10164742 3300025944 Bacteria 1925
490 Ga0207661_10185926 3300025944 Bacteria 1818
491 Ga0207661_10312518 3300025944 Unclassified 1411
492 Ga0207679_10008672 3300025945 Bacteria 6482
493 Ga0207679_10120701 3300025945 Unclassified 2086
494 Ga0207679_10215503 3300025945 Unclassified 1613
495 Ga0207667_10002576 3300025949 Bacteria 22534
496 Ga0207667_10009791 3300025949 Bacteria 11271
497 Ga0207667_10031890 3300025949 Bacteria 5683
498 Ga0207667_10102839 3300025949 Bacteria 2947
499 Ga0207651_10002520 3300025960 Bacteria 8743
500 Ga0207651_10006411 3300025960 Bacteria 6157
501 Ga0207651_10475106 3300025960 Bacteria 1076
502 Ga0207712_10001312 3300025961 Bacteria 17052
503 Ga0207712_10001788 3300025961 Bacteria 14267
504 Ga0207712_10001935 3300025961 Bacteria 13612
505 Ga0207712_10028489 3300025961 Bacteria 3736
506 Ga0207712_10124567 3300025961 Bacteria 1955
507 Ga0207668_10001109 3300025972 Bacteria 16020
508 Ga0207668_10028706 3300025972 Unclassified 3641
509 Ga0207668_10059509 3300025972 Bacteria 2677
510 Ga0207668_10197003 3300025972 Bacteria 1601
511 Ga0207640_10024352 3300025981 Unclassified 3651
512 Ga0207640_10439909 3300025981 Bacteria 1072
513 Ga0207658_10001366 3300025986 Bacteria 19064
514 Ga0207658_10013336 3300025986 Bacteria 5612
515 Ga0207658_10023762 3300025986 Bacteria 4282
516 Ga0207677_10000862 3300026023 Bacteria 17343
517 Ga0207677_10020413 3300026023 Bacteria 4022
518 Ga0207677_10031797 3300026023 Unclassified 3384
519 Ga0207703_10000883 3300026035 Bacteria 29482
520 Ga0207703_10002119 3300026035 Bacteria 17466
521 Ga0207703_10171225 3300026035 Unclassified 1910
522 Ga0207639_10001017 3300026041 Bacteria 19080
523 Ga0207639_10029612 3300026041 Bacteria 4010
524 Ga0207639_10085753 3300026041 Unclassified 2505
525 Ga0207639_10127810 3300026041 Bacteria 2099
526 Ga0207639_10490443 3300026041 Bacteria 1121
527 Ga0207678_10019079 3300026067 Bacteria 6020
528 Ga0207678_10101700 3300026067 Bacteria 2454
529 Ga0207708_10309440 3300026075 Unclassified 1287
530 Ga0207702_10196693 3300026078 Bacteria 1866
531 Ga0207702_10211179 3300026078 Bacteria 1804
532 Ga0207641_10000159 3300026088 Bacteria 96072
533 Ga0207641_10000467 3300026088 Bacteria 45772
534 Ga0207641_10006669 3300026088 Bacteria 9691
535 Ga0207641_10015293 3300026088 Bacteria 6290
536 Ga0207641_10034813 3300026088 Bacteria 4192
537 Ga0207641_10045765 3300026088 Bacteria 3687
538 Ga0207641_10247688 3300026088 Bacteria 1663
539 Ga0207641_10445119 3300026088 Bacteria 1251
540 Ga0207648_10006104 3300026089 Bacteria 12012
541 Ga0207648_10009539 3300026089 Bacteria 9284
542 Ga0207648_10031304 3300026089 Unclassified 4703
543 Ga0207648_10042198 3300026089 Unclassified 4005
544 Ga0207648_10114813 3300026089 Bacteria 2366
545 Ga0207676_10003634 3300026095 Bacteria 10911
546 Ga0207676_10017905 3300026095 Bacteria 5141
547 Ga0207676_10051548 3300026095 Bacteria 3213
548 Ga0207676_10131650 3300026095 Bacteria 2127
549 Ga0207676_10319895 3300026095 Bacteria 1424
550 Ga0207674_10003180 3300026116 Bacteria 20225
551 Ga0207674_10138551 3300026116 Unclassified 2394
552 Ga0207674_10296442 3300026116 Bacteria 1566
553 Ga0207674_10322908 3300026116 Bacteria 1493
554 Ga0207674_10395713 3300026116 Bacteria 1335
555 Ga0207675_100000299 3300026118 Bacteria 47665
556 Ga0207675_100087826 3300026118 Bacteria 2921
557 Ga0207675_100243328 3300026118 Unclassified 1739
558 Ga0207675_100288481 3300026118 Bacteria 1596
559 Ga0207683_10155017 3300026121 Bacteria 2069
560 Ga0207683_10372064 3300026121 Bacteria 1313
561 Ga0207698_10007436 3300026142 Bacteria 6859
562 Ga0207698_10013839 3300026142 Bacteria 5341
563 Ga0207698_10111803 3300026142 Bacteria 2291
564 Ga0207698_10181167 3300026142 Bacteria 1866
565 Ga0207698_10258072 3300026142 Bacteria 1599
566 Ga0268266_10003931 3300028379 Bacteria 14446
567 Ga0268266_10015510 3300028379 Bacteria 6536
568 Ga0268266_10321214 3300028379 Bacteria 1449
569 Ga0268265_10035362 3300028380 Unclassified 3649
570 Ga0268265_10157914 3300028380 Bacteria 1922
571 Ga0268265_10241940 3300028380 Bacteria 1593
572 Ga0268265_10280983 3300028380 Bacteria 1489
573 Ga0268265_10427027 3300028380 Bacteria 1232
574 Ga0268265_10701788 3300028380 Bacteria 977
575 Ga0268264_10000507 3300028381 Bacteria 50105
576 Ga0268264_10001126 3300028381 Bacteria 26251
577 Ga0268264_10004873 3300028381 Bacteria 11372
578 Ga0268264_10006450 3300028381 Bacteria 9876
579 Ga0268264_10020330 3300028381 Bacteria 5426
580 Ga0268264_10056847 3300028381 Bacteria 3271
581 Ga0268264_10104551 3300028381 Bacteria 2468
582 Ga0268264_10347698 3300028381 Bacteria 1410
583 Ga0307515_10000001 3300028794 Bacteria 4259510
584 Ga0265327_10000013 3300031251 Bacteria 519549
585 Ga0265327_10000254 3300031251 Bacteria 106076
586 Ga0265327_10000338 3300031251 Bacteria 88898
587 Ga0307513_10169854 3300031456 Bacteria 2060
588 Ga0307513_10404499 3300031456 Bacteria 1099
589 Ga0307509_10124545 3300031507 Bacteria 2547
590 Ga0307516_10172946 3300031730 Bacteria 1899
591 Ga0307414_10046741 3300032004 Bacteria 2974
592 Ga0373946_0066109 3300035171 Bacteria 1550
593 Ga0373937_0097898 3300036401 Bacteria 2721
594 Ga0395900_0068807 3300037418 Bacteria 3638
595 Ga0395898_0275009 3300037466 Unclassified 1606
596 Ga0395905_0405082 3300037471 Unclassified 1259
597 Ga0395901_0202023 3300038443 Bacteria 2083
598 Ga0436365_0262267 3300039437 Bacteria 30470
599 Ga0436365_1373625 3300039437 Bacteria 10587
600 Ga0439436_0000111 3300041404 Bacteria 19019
601 Ga0439439_0002871 3300041406 Bacteria 3732
602 Ga0439465_0006736 3300041413 Bacteria 3648
603 Ga0451807_2294192 3300041486 Bacteria 1034
604 Ga0451807_2667275 3300041486 Bacteria 877
605 Ga0439431_0000197 3300041997 Bacteria 11821
606 Ga0439449_0020400 3300042007 Bacteria 2484
607 Ga0439449_0027421 3300042007 Bacteria 2126
608 Ga0439457_002905 3300042014 Bacteria 4772
609 Ga0439457_011412 3300042014 Bacteria 2022
610 Ga0450894_008280 3300042131 Bacteria 1344
611 Ga0451577_0055911 3300042876 Bacteria 3520
612 Ga0451577_0236409 3300042876 Bacteria 1653
613 Ga0466969_0001641 3300044656 Bacteria 11999
614 Ga0466972_0000016 3300044658 Bacteria 208802
615 Ga0466972_0000280 3300044658 Bacteria 31990
616 Ga0466972_0009058 3300044658 Bacteria 4998
617 Ga0466966_0102349 3300044684 Bacteria 1770
618 Ga0453684_0030064 3300044712 Bacteria 7687
619 Ga0453684_0048086 3300044712 Bacteria 5647
620 Ga0466968_0013709 3300044735 Bacteria 3191
621 Ga0466968_0093645 3300044735 Bacteria 1335
622 Ga0466970_0038551 3300044765 Bacteria 2535
623 Ga0466970_0061205 3300044765 Bacteria 2016
624 Ga0466957_0000247 3300044842 Bacteria 25944
625 Ga0466960_0149370 3300044901 Bacteria 1247
626 Ga0466959_0000196 3300045049 Bacteria 39994
627 Ga0495632_0050268 3300046519 Bacteria 2057
628 Ga0495643_0117132 3300046522 Unclassified 1349
629 Ga0495621_0004188 3300046539 Bacteria 4030
630 Ga0495668_0000114 3300046616 Bacteria 127503
631 Ga0495668_0000312 3300046616 Bacteria 66963
632 Ga0495668_0005338 3300046616 Bacteria 8763
633 Ga0495635_0091858 3300046663 Bacteria 2076
634 Ga0495636_0000026 3300047318 Bacteria 63897
635 Ga0495674_0095688 3300047319 Bacteria 2532
636 Ga0495674_0238633 3300047319 Bacteria 1499
637 Ga0495674_0258672 3300047319 Bacteria 1431
638 Ga0495672_0070038 3300047320 Bacteria 1989
639 Ga0495686_0000595 3300047472 Bacteria 50402
640 Ga0495686_0037002 3300047472 Bacteria 3129
641 Ga0496108_0243972 3300048911 Bacteria 1563
642 Ga0496109_0059366 3300048912 Unclassified 3494
643 Ga0496113_0338271 3300048916 Unclassified 1207
644 Ga0496114_0004733 3300048917 Bacteria 10591
645 Ga0496121_0000008 3300048924 Bacteria 843593
646 Ga0501031_0013524 3300049568 Bacteria 5319
647 Ga0501032_0004022 3300049569 Bacteria 11148
648 Ga0501032_0004687 3300049569 Bacteria 10262
649 Ga0501032_0214592 3300049569 Bacteria 1254
650 Ga0501033_0050870 3300049570 Bacteria 3072
651 Ga0501034_0000007 3300049571 Bacteria 357805
652 Ga0501034_0007830 3300049571 Bacteria 11364
653 Ga0501034_0029202 3300049571 Bacteria 5605
654 Ga0501034_0051985 3300049571 Bacteria 4130
655 Ga0501034_0094207 3300049571 Unclassified 2991
656 Ga0501036_0003416 3300049572 Bacteria 12692
657 Ga0501036_0014802 3300049572 Bacteria 6505
658 Ga0501037_0022376 3300049573 Bacteria 4677
659 Ga0501037_0148621 3300049573 Bacteria 1675
660 Ga0501037_0333160 3300049573 Bacteria 1049
661 Ga0501038_0010673 3300049574 Bacteria 8401
662 Ga0501038_0025484 3300049574 Bacteria 5271
663 Ga0501038_0035197 3300049574 Bacteria 4397
664 Ga0501043_0014070 3300049579 Bacteria 6263
665 Ga0501043_0020417 3300049579 Bacteria 5196
666 Ga0501043_0043381 3300049579 Bacteria 3535
667 Ga0501046_0003510 3300049580 Bacteria 14366
668 Ga0501046_0036206 3300049580 Bacteria 3974
669 Ga0501047_0029006 3300049581 Bacteria 5338
670 Ga0501047_0051091 3300049581 Bacteria 3993
671 Ga0501047_0055611 3300049581 Bacteria 3826
672 Ga0501047_0360584 3300049581 Bacteria 1289
673 Ga0501047_0680403 3300049581 Bacteria 847
674 Ga0501048_0472450 3300049582 Unclassified 899
675 Ga0501067_0025268 3300049583 Unclassified 3292
676 Ga0501068_0035423 3300049584 Bacteria 2979
677 Ga0501068_0127984 3300049584 Unclassified 1587
678 Ga0501069_0271516 3300049585 Bacteria 991
679 Ga0501070_0012717 3300049586 Bacteria 7098
680 Ga0501073_0058049 3300049589 Bacteria 2705
681 Ga0501073_0080725 3300049589 Unclassified 2262
682 Ga0501073_0117757 3300049589 Bacteria 1841
683 Ga0501074_0003003 3300049590 Bacteria 11870
684 Ga0501238_009483 3300049671 Bacteria 1292
685 Ga0501242_005381 3300049674 Bacteria 1439
686 Ga0501250_000367 3300049680 Bacteria 2913
687 Ga0501257_024192 3300049686 Bacteria 1442
688 Ga0501225_0000821 3300049705 Bacteria 9670
689 Ga0501079_0054613 3300049741 Unclassified 3081
690 Ga0501079_0133957 3300049741 Bacteria 1929
691 Ga0501080_0252933 3300049742 Unclassified 1606
692 Ga0501083_0001228 3300049744 Bacteria 17354
693 Ga0501083_0036991 3300049744 Bacteria 3326
694 Ga0501269_002728 3300049766 Bacteria 2156
695 Ga0501035_0009147 3300049822 Bacteria 9212
696 Ga0501035_0117132 3300049822 Bacteria 2331
697 Ga0501044_0005300 3300049823 Bacteria 14338
698 Ga0501044_0008422 3300049823 Bacteria 11308
699 Ga0501044_0009756 3300049823 Bacteria 10444
700 Ga0501044_0205022 3300049823 Bacteria 1929
701 Ga0501044_0232454 3300049823 Bacteria 1791
702 Ga0501044_0257031 3300049823 Bacteria 1686
703 nmdc:mga0k408_217689_c1 3300050493 Bacteria 1140
704 nmdc:mga05p37_41996_c1 3300050507 Bacteria 5617
705 nmdc:mga09592_50342_c1 3300050508 Bacteria 3514
706 nmdc:mga09592_88102_c1 3300050508 Bacteria 2651
707 nmdc:mga09592_9212_c1 3300050508 Bacteria 8030
708 nmdc:mga0qj67_21761_c1 3300050509 Bacteria 4920
709 nmdc:mga06r32_28621_c1 3300050510 Bacteria 5217
710 nmdc:mga06r32_44707_c1 3300050510 Bacteria 4218
711 nmdc:mga08y16_126691_c1 3300050511 Bacteria 2656
712 nmdc:mga08y16_31684_c1 3300050511 Bacteria 5559
713 nmdc:mga08y16_39859_c1 3300050511 Bacteria 4926
714 Ga0500644_0000094 3300053088 Bacteria 55669
715 Ga0500644_0084851 3300053088 Bacteria 1173
716 Ga0500646_0010047 3300053090 Bacteria 2425
717 Ga0500583_0000159 3300053092 Bacteria 27775
718 Ga0500641_0054643 3300053096 Bacteria 1652
719 Ga0500556_0009527 3300053104 Bacteria 2825
720 Ga0500562_000051 3300053108 Bacteria 59249
721 Ga0500569_001123 3300053109 Bacteria 4917
722 Ga0500572_072941 3300053111 Bacteria 1064
723 Ga0500607_016731 3300053121 Bacteria 4196
724 Ga0500642_0008937 3300053130 Bacteria 3454
725 Ga0500655_022515 3300053133 Bacteria 1186
726 Ga0500658_0004020 3300053134 Bacteria 5524
727 Ga0500559_0022952 3300053136 Bacteria 2647
728 Ga0500577_0000926 3300053142 Bacteria 7601
729 Ga0500588_0001484 3300053146 Bacteria 4471
730 Ga0500589_047071 3300053147 Bacteria 2007
731 Ga0500589_047371 3300053147 Bacteria 2001
732 Ga0500590_109305 3300053148 Bacteria 1314
733 Ga0500616_0003769 3300053153 Bacteria 11289
734 Ga0500619_076061 3300053154 Bacteria 1123
735 Ga0500622_0000161 3300053156 Bacteria 70719
736 Ga0500633_0003709 3300053160 Bacteria 3381
737 Ga0500636_0032034 3300053177 Bacteria 3111
738 Ga0500636_0045950 3300053177 Bacteria 2575
739 Ga0500645_016932 3300053730 Bacteria 2290
740 Ga0501084_0695299 3300054114 Unclassified 857
741 Ga0501082_0152939 3300060353 Unclassified 2004
742 2738724691 2738541278 Bacteria 9755573
743 2819575292 2818991442 Bacteria 8318214
744 2819590417 2818991444 Bacteria 6968812
745 2821141392 2821136567 Bacteria 8080116
746 2840679120 2840677318 Bacteria 2664183
747 2883070208 2883068021 Bacteria 6192739
748 2896086932 2896085136 Bacteria 6129793
749 2896115734 2896109856 Bacteria 7140722
750 2904471003 2904467357 Bacteria 8057758
751 2929158546 2929154850 Bacteria 6753285
752 2929921401 2929921140 Bacteria 8649150
753 8003157558 8003151029 Bacteria 8187759
754 Ga0500559_0020426
755 SwRhRL2b_contig_1663468
756 SwRhRL2b_contig_3813669
757 JGI24740J21852_10002134
758 JGI24740J21852_10018449
759 JGI24739J22299_10009728
760 JGI24737J22298_10054058
761 JGI24751J29686_10001433
762 JGI24751J29686_10028347
763 JGI25154J39366_1000006
764 JGI25157J39369_1004371
765 JGI25153J46596_10005500
766 JGI25153J46596_10014489
767 rootH1_10038598
768 rootH1_10066544
769 rootH2_10032113
770 rootH2_10094418
771 rootH2_10253391
772 rootL2_10014283
773 rootL2_10019832
774 rootL2_10119408
775 rootL2_10180565
776 rootL2_10319470
777 rootH1_10027463
778 rootH1_10137836
779 rootH1_10310403
780 JGI25160J50197_1005758
781 JGI25160J50197_1010184
782 JGI25160J50197_1012948
783 Ga0055542_1004003
784 Ga0055526_1010659
785 Ga0055528_1000077
786 Ga0055530_10002824
787 Ga0055531_10000005
788 Ga0055531_10024937
789 Ga0065165_1000042
790 Ga0065165_1011865
791 Ga0065714_10087840
792 Ga0065704_10070133
793 Ga0065704_10077708
794 Ga0065712_10074422
795 Ga0065712_10175767
796 Ga0065712_10198684
797 Ga0065715_10006633
798 Ga0065707_10405757
799 Ga0070658_10000515
800 Ga0070658_10005427
801 Ga0070658_10472927
802 Ga0070658_10648437
803 Ga0070676_10000341
804 Ga0070676_10026193
805 Ga0070676_10185212
806 Ga0070683_100070766
807 Ga0070690_100230224
808 Ga0070670_100011332
809 Ga0070670_100015247
810 Ga0070670_100063043
811 Ga0070670_100166167
812 Ga0070670_100227187
813 Ga0070670_100257085
814 Ga0070670_100726849
815 Ga0070677_10013665
816 Ga0068869_100006045
817 Ga0068869_100018070
818 Ga0068869_100088707
819 Ga0068869_100215495
820 Ga0068869_100326658
821 Ga0068869_100391470
822 Ga0070666_10000172
823 Ga0070666_10000185
824 Ga0070666_10163481
825 Ga0070666_10293408
826 Ga0070680_100001877
827 Ga0070682_100000259
828 Ga0070682_100002348
829 Ga0068868_100001522
830 Ga0068868_100330141
831 Ga0070660_100052435
832 Ga0070689_100013704
833 Ga0070689_100103172
834 Ga0070689_100215127
835 Ga0070691_10000875
836 Ga0070687_100081113
837 Ga0070661_100071198
838 Ga0070692_10019052
839 Ga0070668_100000169
840 Ga0070668_100035392
841 Ga0070668_100067980
842 Ga0070668_100299370
843 Ga0070669_100002549
844 Ga0070669_100329052
845 Ga0070675_100004810
846 Ga0070675_100019684
847 Ga0070675_100027677
848 Ga0070671_100007849
849 Ga0070671_100022580
850 Ga0070671_100037901
851 Ga0070671_100343410
852 Ga0070671_100350488
853 Ga0070671_100448603
854 Ga0070671_100621612
855 Ga0070673_100000813
856 Ga0070673_100003572
857 Ga0070673_100029120
858 Ga0070673_100514598
859 Ga0070688_100007036
860 Ga0070688_100016843
861 Ga0070688_100027353
862 Ga0070688_100219473
863 Ga0070688_100224516
864 Ga0070659_100003003
865 Ga0070659_100299513
866 Ga0070667_100000553
867 Ga0070667_100002163
868 Ga0070667_100003932
869 Ga0070667_100011960
870 Ga0070667_100042562
871 Ga0070700_100037548
872 Ga0070663_100018961
873 Ga0070663_100465514
874 Ga0070663_100551384
875 Ga0070678_100048144
876 Ga0070678_100057436
877 Ga0070678_100334582
878 Ga0070678_100404682
879 Ga0070662_100002884
880 Ga0070681_10014936
881 Ga0070681_10057796
882 Ga0070681_10356665
883 Ga0068867_100001171
884 Ga0068867_100016028
885 Ga0068867_100020227
886 Ga0068867_100031203
887 Ga0068867_100252856
888 Ga0068867_100522800
889 Ga0070685_10003193
890 Ga0070685_10012670
891 Ga0070685_10069633
892 Ga0070698_100001684
893 Ga0070698_100084673
894 Ga0070699_100206464
895 Ga0070679_100002688
896 Ga0070679_100220775
897 Ga0070679_100244734
898 Ga0068853_100000272
899 Ga0068853_100047923
900 Ga0068853_100372051
901 Ga0068853_100377660
902 Ga0070672_100000061
903 Ga0070672_100066056
904 Ga0070672_100134964
905 Ga0070672_100246378
906 Ga0070672_100289545
907 Ga0070665_100000612
908 Ga0070665_100008108
909 Ga0070665_100177167
910 Ga0070665_100396854
911 Ga0068855_100003883
912 Ga0068855_100016351
913 Ga0068855_100110959
914 Ga0068855_100137468
915 Ga0068855_100277230
916 Ga0070664_100009965
917 Ga0070664_100042674
918 Ga0070664_100139449
919 Ga0068857_100007129
920 Ga0068857_100104068
921 Ga0068857_100494269
922 Ga0068857_100661929
923 Ga0068854_100013145
924 Ga0068854_100071501
925 Ga0068856_100034665
926 Ga0068856_100068876
927 Ga0070702_100019944
928 Ga0068852_100000787
929 Ga0068852_100008187
930 Ga0068852_100047286
931 Ga0068852_100086895
932 Ga0068852_100457813
933 Ga0068852_100612956
934 Ga0068859_100000013
935 Ga0068859_100028460
936 Ga0068859_100041010
937 Ga0068859_100047799
938 Ga0068859_100052217
939 Ga0068859_100090425
940 Ga0068859_100095284
941 Ga0068859_100185090
942 Ga0068864_100004846
943 Ga0068864_100014384
944 Ga0068864_100029845
945 Ga0068864_100062003
946 Ga0068864_100079933
947 Ga0068864_100082789
948 Ga0068866_10053858
949 Ga0068861_100076877
950 Ga0068861_100091750
951 Ga0068851_10001728
952 Ga0068851_10036515
953 Ga0068851_10051254
954 Ga0068851_10138654
955 Ga0068870_10004264
956 Ga0068870_10038156
957 Ga0068870_10207759
958 Ga0068863_100001273
959 Ga0068863_100015573
960 Ga0068863_100021719
961 Ga0068863_100021933
962 Ga0068863_100027233
963 Ga0068863_100296048
964 Ga0068863_100604925
965 Ga0068858_100000930
966 Ga0068858_100014471
967 Ga0068858_100819832
968 Ga0068860_100000443
969 Ga0068860_100000591
970 Ga0068860_100005524
971 Ga0068860_100029363
972 Ga0068860_100052013
973 Ga0068860_100155219
974 Ga0068862_100001278
975 Ga0068862_100002721
976 Ga0068862_100108492
977 Ga0068862_100187645
978 Ga0068862_100278398
979 Ga0068862_100403206
980 Ga0068862_100480724
981 Ga0075366_10010141
982 Ga0075366_10146725
983 Ga0097621_100000531
984 Ga0097621_100000821
985 Ga0097621_100004954
986 Ga0097621_100011962
987 Ga0097621_100046435
988 Ga0097621_100291543
989 Ga0097621_100388892
990 Ga0068871_100001554
991 Ga0068871_100002710
992 Ga0068871_100016561
993 Ga0068871_100075852
994 Ga0075428_100143572
995 Ga0075428_100960321
996 Ga0075430_100007849
997 Ga0075431_100005370
998 Ga0075431_100414130
999 Ga0075429_100019843
1000 Ga0075429_100051926
1001 Ga0068865_100003524
1002 Ga0068865_100047931
1003 Ga0068865_100336596
1004 Ga0068865_100364145
1005 Ga0097620_100000013
1006 Ga0097620_100028459
1007 Ga0097620_100041010
1008 Ga0097620_100047801
1009 Ga0097620_100052221
1010 Ga0097620_100090425
1011 Ga0097620_100095283
1012 Ga0097620_100185076
1013 Ga0105240_10000020
1014 Ga0105240_10038515
1015 Ga0105240_10048639
1016 Ga0105240_10050783
1017 Ga0105240_10060139
1018 Ga0105240_10239040
1019 Ga0111539_10004662
1020 Ga0111539_10174473
1021 Ga0111539_10199038
1022 Ga0111539_10694191
1023 Ga0111539_10823758
1024 Ga0105245_10127548
1025 Ga0105245_10179891
1026 Ga0105247_10022723
1027 Ga0105247_10027512
1028 Ga0105247_10046132
1029 Ga0114129_10052463
1030 Ga0105243_10106734
1031 Ga0105241_10000686
1032 Ga0105241_10009515
1033 Ga0105241_10091344
1034 Ga0105242_10059707
1035 Ga0105248_10014203
1036 Ga0105248_10016765
1037 Ga0105237_10004476
1038 Ga0105237_10025289
1039 Ga0105238_10122640
1040 Ga0105249_10001226
1041 Ga0105249_10002749
1042 Ga0105249_10003197
1043 Ga0105249_10006427
1044 Ga0105249_10085379
1045 Ga0105249_10173838
1046 Ga0105249_10448012
1047 Ga0105239_10000631
1048 Ga0105239_10010893
1049 Ga0105239_10023189
1050 Ga0105239_10153260
1051 Ga0105239_10389660
1052 Ga0105246_10016419
1053 Ga0105246_10059288
1054 Ga0157373_10090369
1055 Ga0157371_10036269
1056 Ga0157371_10110099
1057 Ga0157370_10003149
1058 Ga0157370_10003666
1059 Ga0157370_10276782
1060 Ga0157370_10350688
1061 Ga0157369_10021680
1062 Ga0157369_10024505
1063 Ga0157369_10297725
1064 Ga0157374_10002119
1065 Ga0157374_10184301
1066 Ga0157378_10007403
1067 Ga0157378_10028471
1068 Ga0157378_10039607
1069 Ga0157378_10044580
1070 Ga0157378_10070013
1071 Ga0157378_10077863
1072 Ga0157378_10095523
1073 Ga0157378_10147947
1074 Ga0157378_10204847
1075 Ga0163162_10000752
1076 Ga0163162_10000931
1077 Ga0163162_10001214
1078 Ga0163162_10002506
1079 Ga0163162_10003220
1080 Ga0163162_10009367
1081 Ga0163162_10012998
1082 Ga0163162_10031439
1083 Ga0163162_10052834
1084 Ga0163162_10109057
1085 Ga0163162_10132165
1086 Ga0163162_10164252
1087 Ga0163162_10695331
1088 Ga0157372_10001914
1089 Ga0157372_10006438
1090 Ga0157372_10055213
1091 Ga0157372_10074901
1092 Ga0157372_10083103
1093 Ga0157372_10095723
1094 Ga0157372_10145310
1095 Ga0157372_10151256
1096 Ga0157372_10173548
1097 Ga0157372_10195474
1098 Ga0157372_10379645
1099 Ga0157372_10428392
1100 Ga0157372_10516102
1101 Ga0157372_10588569
1102 Ga0157375_10000098
1103 Ga0157375_10001055
1104 Ga0157375_10020946
1105 Ga0157375_10028942
1106 Ga0157375_10042760
1107 Ga0157375_10135361
1108 Ga0157375_10234186
1109 Ga0157375_10363596
1110 Ga0157375_10985028
1111 Ga0163163_10000272
1112 Ga0163163_10000888
1113 Ga0163163_10013960
1114 Ga0163163_10072762
1115 Ga0163163_10411207
1116 Ga0163163_10500357
1117 Ga0163163_10505951
1118 Ga0157380_10005493
1119 Ga0157380_10017785
1120 Ga0157380_10063918
1121 Ga0157380_10196875
1122 Ga0157380_10201079
1123 Ga0157377_10000659
1124 Ga0157379_10000103
1125 Ga0157379_10011365
1126 Ga0157379_10185046
1127 Ga0157379_10313229
1128 Ga0157376_10000484
1129 Ga0157376_10002103
1130 Ga0157376_10014571
1131 Ga0157376_10047458
1132 Ga0157376_10058583
1133 Ga0157376_10294773
1134 Ga0182005_1000017
1135 Ga0163161_10008445
1136 Ga0163161_10011545
1137 Ga0163161_10102585
1138 Ga0163161_10275346
1139 Ga0213876_10003307
1140 Ga0213876_10076218
1141 Ga0209436_108355
1142 Ga0209258_100029
1143 Ga0209646_1000031
1144 Ga0209026_1000019
1145 Ga0209148_1000089
1146 Ga0207666_1007724
1147 Ga0209673_1000113
1148 Ga0209564_1008803
1149 Ga0209758_1006508
1150 Ga0209758_1011612
1151 Ga0209758_1014394
1152 Ga0209050_1000185
1153 Ga0207426_1000026
1154 Ga0207426_1000263
1155 Ga0207426_1001392
1156 Ga0209051_1036469
1157 Ga0209257_1000004
1158 Ga0209257_1000257
1159 Ga0207656_10001251
1160 Ga0207642_10097883
1161 Ga0207710_10011276
1162 Ga0207688_10023048
1163 Ga0207688_10254065
1164 Ga0207680_10000083
1165 Ga0207680_10001345
1166 Ga0207680_10517955
1167 Ga0207647_10000050
1168 Ga0207647_10000824
1169 Ga0207647_10091077
1170 Ga0207647_10286827
1171 Ga0207685_10006469
1172 Ga0207645_10000793
1173 Ga0207645_10008445
1174 Ga0207645_10015568
1175 Ga0207645_10021983
1176 Ga0207645_10036615
1177 Ga0207643_10004365
1178 Ga0207705_10005062
1179 Ga0207705_10017322
1180 Ga0207705_10163510
1181 Ga0207705_10214304
1182 Ga0207654_10002274
1183 Ga0207654_10021156
1184 Ga0207707_10000160
1185 Ga0207707_10085211
1186 Ga0207695_10000020
1187 Ga0207695_10002404
1188 Ga0207695_10009558
1189 Ga0207695_10169883
1190 Ga0207671_10000025
1191 Ga0207671_10001991
1192 Ga0207671_10023773
1193 Ga0207660_10048464
1194 Ga0207662_10139080
1195 Ga0207657_10030556
1196 Ga0207657_10124095
1197 Ga0207649_10020444
1198 Ga0207652_10001880
1199 Ga0207646_10025366
1200 Ga0207681_10066965
1201 Ga0207681_10075399
1202 Ga0207681_10196688
1203 Ga0207650_10000562
1204 Ga0207650_10058657
1205 Ga0207650_10380939
1206 Ga0207659_10012376
1207 Ga0207659_10029121
1208 Ga0207659_10030626
1209 Ga0207644_10040917
1210 Ga0207644_10175389
1211 Ga0207644_10191172
1212 Ga0207690_10068711
1213 Ga0207706_10006661
1214 Ga0207706_10036362
1215 Ga0207686_10000498
1216 Ga0207670_10042309
1217 Ga0207670_10183435
1218 Ga0207670_10197247
1219 Ga0207670_10249889
1220 Ga0207704_10004460
1221 Ga0207704_10007802
1222 Ga0207704_10047803
1223 Ga0207704_10112702
1224 Ga0207704_10282893
1225 Ga0207704_10626890
1226 Ga0207691_10000154
1227 Ga0207691_10006412
1228 Ga0207691_10011687
1229 Ga0207691_10014404
1230 Ga0207691_10183619
1231 Ga0207691_10504664
1232 Ga0207711_10170821
1233 Ga0207711_10213139
1234 Ga0207689_10006246
1235 Ga0207689_10009576
1236 Ga0207689_10029427
1237 Ga0207689_10043843
1238 Ga0207689_10045161
1239 Ga0207689_10053634
1240 Ga0207689_10084762
1241 Ga0207689_10172962
1242 Ga0207661_10164742
1243 Ga0207661_10185926
1244 Ga0207661_10312518
1245 Ga0207679_10008672
1246 Ga0207679_10120701
1247 Ga0207679_10215503
1248 Ga0207667_10002576
1249 Ga0207667_10009791
1250 Ga0207667_10031890
1251 Ga0207667_10102839
1252 Ga0207651_10002520
1253 Ga0207651_10006411
1254 Ga0207651_10475106
1255 Ga0207712_10001312
1256 Ga0207712_10001788
1257 Ga0207712_10001935
1258 Ga0207712_10028489
1259 Ga0207712_10124567
1260 Ga0207668_10001109
1261 Ga0207668_10028706
1262 Ga0207668_10059509
1263 Ga0207668_10197003
1264 Ga0207640_10024352
1265 Ga0207640_10439909
1266 Ga0207658_10001366
1267 Ga0207658_10013336
1268 Ga0207658_10023762
1269 Ga0207677_10000862
1270 Ga0207677_10020413
1271 Ga0207677_10031797
1272 Ga0207703_10000883
1273 Ga0207703_10002119
1274 Ga0207703_10171225
1275 Ga0207639_10001017
1276 Ga0207639_10029612
1277 Ga0207639_10085753
1278 Ga0207639_10127810
1279 Ga0207639_10490443
1280 Ga0207678_10019079
1281 Ga0207678_10101700
1282 Ga0207708_10309440
1283 Ga0207702_10196693
1284 Ga0207702_10211179
1285 Ga0207641_10000159
1286 Ga0207641_10000467
1287 Ga0207641_10006669
1288 Ga0207641_10015293
1289 Ga0207641_10034813
1290 Ga0207641_10045765
1291 Ga0207641_10247688
1292 Ga0207641_10445119
1293 Ga0207648_10006104
1294 Ga0207648_10009539
1295 Ga0207648_10031304
1296 Ga0207648_10042198
1297 Ga0207648_10114813
1298 Ga0207676_10003634
1299 Ga0207676_10017905
1300 Ga0207676_10051548
1301 Ga0207676_10131650
1302 Ga0207676_10319895
1303 Ga0207674_10003180
1304 Ga0207674_10138551
1305 Ga0207674_10296442
1306 Ga0207674_10322908
1307 Ga0207674_10395713
1308 Ga0207675_100000299
1309 Ga0207675_100087826
1310 Ga0207675_100243328
1311 Ga0207675_100288481
1312 Ga0207683_10155017
1313 Ga0207683_10372064
1314 Ga0207698_10007436
1315 Ga0207698_10013839
1316 Ga0207698_10111803
1317 Ga0207698_10181167
1318 Ga0207698_10258072
1319 Ga0268266_10003931
1320 Ga0268266_10015510
1321 Ga0268266_10321214
1322 Ga0268265_10035362
1323 Ga0268265_10157914
1324 Ga0268265_10241940
1325 Ga0268265_10280983
1326 Ga0268265_10427027
1327 Ga0268265_10701788
1328 Ga0268264_10000507
1329 Ga0268264_10001126
1330 Ga0268264_10004873
1331 Ga0268264_10006450
1332 Ga0268264_10020330
1333 Ga0268264_10056847
1334 Ga0268264_10104551
1335 Ga0268264_10347698
1336 Ga0307515_10000001
1337 Ga0265327_10000013
1338 Ga0265327_10000254
1339 Ga0265327_10000338
1340 Ga0307513_10169854
1341 Ga0307513_10404499
1342 Ga0307509_10124545
1343 Ga0307516_10172946
1344 Ga0307414_10046741
1345 Ga0373946_0066109
1346 Ga0373937_0097898
1347 Ga0395900_0068807
1348 Ga0395898_0275009
1349 Ga0395905_0405082
1350 Ga0395901_0202023
1351 Ga0436365_0262267
1352 Ga0436365_1373625
1353 Ga0439436_0000111
1354 Ga0439439_0002871
1355 Ga0439465_0006736
1356 Ga0451807_2294192
1357 Ga0451807_2667275
1358 Ga0439431_0000197
1359 Ga0439449_0020400
1360 Ga0439449_0027421
1361 Ga0439457_002905
1362 Ga0439457_011412
1363 Ga0450894_008280
1364 Ga0451577_0055911
1365 Ga0451577_0236409
1366 Ga0466969_0001641
1367 Ga0466972_0000016
1368 Ga0466972_0000280
1369 Ga0466972_0009058
1370 Ga0466966_0102349
1371 Ga0453684_0030064
1372 Ga0453684_0048086
1373 Ga0466968_0013709
1374 Ga0466968_0093645
1375 Ga0466970_0038551
1376 Ga0466970_0061205
1377 Ga0466957_0000247
1378 Ga0466960_0149370
1379 Ga0466959_0000196
1380 Ga0495632_0050268
1381 Ga0495643_0117132
1382 Ga0495621_0004188
1383 Ga0495668_0000114
1384 Ga0495668_0000312
1385 Ga0495668_0005338
1386 Ga0495635_0091858
1387 Ga0495636_0000026
1388 Ga0495674_0095688
1389 Ga0495674_0238633
1390 Ga0495674_0258672
1391 Ga0495672_0070038
1392 Ga0495686_0000595
1393 Ga0495686_0037002
1394 Ga0496108_0243972
1395 Ga0496109_0059366
1396 Ga0496113_0338271
1397 Ga0496114_0004733
1398 Ga0496121_0000008
1399 Ga0501031_0013524
1400 Ga0501032_0004022
1401 Ga0501032_0004687
1402 Ga0501032_0214592
1403 Ga0501033_0050870
1404 Ga0501034_0000007
1405 Ga0501034_0007830
1406 Ga0501034_0029202
1407 Ga0501034_0051985
1408 Ga0501034_0094207
1409 Ga0501036_0003416
1410 Ga0501036_0014802
1411 Ga0501037_0022376
1412 Ga0501037_0148621
1413 Ga0501037_0333160
1414 Ga0501038_0010673
1415 Ga0501038_0025484
1416 Ga0501038_0035197
1417 Ga0501043_0014070
1418 Ga0501043_0020417
1419 Ga0501043_0043381
1420 Ga0501046_0003510
1421 Ga0501046_0036206
1422 Ga0501047_0029006
1423 Ga0501047_0051091
1424 Ga0501047_0055611
1425 Ga0501047_0360584
1426 Ga0501047_0680403
1427 Ga0501048_0472450
1428 Ga0501067_0025268
1429 Ga0501068_0035423
1430 Ga0501068_0127984
1431 Ga0501069_0271516
1432 Ga0501070_0012717
1433 Ga0501073_0058049
1434 Ga0501073_0080725
1435 Ga0501073_0117757
1436 Ga0501074_0003003
1437 Ga0501238_009483
1438 Ga0501242_005381
1439 Ga0501250_000367
1440 Ga0501257_024192
1441 Ga0501225_0000821
1442 Ga0501079_0054613
1443 Ga0501079_0133957
1444 Ga0501080_0252933
1445 Ga0501083_0001228
1446 Ga0501083_0036991
1447 Ga0501269_002728
1448 Ga0501035_0009147
1449 Ga0501035_0117132
1450 Ga0501044_0005300
1451 Ga0501044_0008422
1452 Ga0501044_0009756
1453 Ga0501044_0205022
1454 Ga0501044_0232454
1455 Ga0501044_0257031
1456 nmdc:mga0k408_217689_c1
1457 nmdc:mga05p37_41996_c1
1458 nmdc:mga09592_50342_c1
1459 nmdc:mga09592_88102_c1
1460 nmdc:mga09592_9212_c1
1461 nmdc:mga0qj67_21761_c1
1462 nmdc:mga06r32_28621_c1
1463 nmdc:mga06r32_44707_c1
1464 nmdc:mga08y16_126691_c1
1465 nmdc:mga08y16_31684_c1
1466 nmdc:mga08y16_39859_c1
1467 Ga0500644_0000094
1468 Ga0500644_0084851
1469 Ga0500646_0010047
1470 Ga0500583_0000159
1471 Ga0500641_0054643
1472 Ga0500556_0009527
1473 Ga0500562_000051
1474 Ga0500569_001123
1475 Ga0500572_072941
1476 Ga0500607_016731
1477 Ga0500642_0008937
1478 Ga0500655_022515
1479 Ga0500658_0004020
1480 Ga0500559_0022952
1481 Ga0500577_0000926
1482 Ga0500588_0001484
1483 Ga0500589_047071
1484 Ga0500589_047371
1485 Ga0500590_109305
1486 Ga0500616_0003769
1487 Ga0500619_076061
1488 Ga0500622_0000161
1489 Ga0500633_0003709
1490 Ga0500636_0032034
1491 Ga0500636_0045950
1492 Ga0500645_016932
1493 Ga0501084_0695299
1494 Ga0501082_0152939
1495 2738724691
1496 2819575292
1497 2819590417
1498 2821141392
1499 2840679120
1500 2883070208
1501 2896086932
1502 2896115734
1503 2904471003
1504 2929158546
1505 2929921401
1506 8003157558

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02616

SMC_ScpA

Segregation and condensation protein ScpA

42

258

0.86

Map