F479232
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 753 | 304 | 1506 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300053136|Ga0500559_0020426|Ga0500559_0020426_203_1243 |
| Length | 320 |
| Sequence | LRIAQKHPKGDIFHLNQWLVNHSSYQIKLPQFEGPFDLLLFFIERDELDIYNIPITRIIKDFMDYIHSLEKLNIELSSEFILFISTLMRIKAKMLLPRKELDAQGNEIDPRQELVDKILEYKRYKEAALRMAEMEAIRMLMVKRGNAVKEMSTIGEDSGEGTEIQSITLFKLMKTFEKVMKKLEQRNIKPVHTVVSYNYTMDGSRTYMLETVKTEKLMSFEKIFDICQDRIHAIFLFLSMLELVQMKYMSIMVGEGRNNFILEFNENREEDATFDIDALRESQFSDRKVVNEEVTEGLFAKAADDVVEAAHDELDKALRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 208 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 209 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 210 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 253 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 256 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 271 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 272 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 273 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 274 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 275 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 276 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 278 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 279 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 280 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 282 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 283 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 284 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 287 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 288 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 289 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 294 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 295 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 296 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 297 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 298 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 299 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 300 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 301 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 302 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 303 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 304 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 0 |
| Isolates | 1.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.7 |
| Nodule | 0 |
| Rhizoplane | 0.8 |
| Rhizosphere | 86.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500559_0020426 | 3300053136 | Bacteria | 2801 |
| 2 | SwRhRL2b_contig_1663468 | 2162886007 | Bacteria | 272152 |
| 3 | SwRhRL2b_contig_3813669 | 2162886007 | Bacteria | 2946 |
| 4 | JGI24740J21852_10002134 | 3300001979 | Bacteria | 9036 |
| 5 | JGI24740J21852_10018449 | 3300001979 | Bacteria | 2473 |
| 6 | JGI24739J22299_10009728 | 3300001989 | Bacteria | 3577 |
| 7 | JGI24737J22298_10054058 | 3300001990 | Bacteria | 1216 |
| 8 | JGI24751J29686_10001433 | 3300002459 | Bacteria | 4992 |
| 9 | JGI24751J29686_10028347 | 3300002459 | Unclassified | 1162 |
| 10 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 11 | JGI25157J39369_1004371 | 3300002741 | Bacteria | 2584 |
| 12 | JGI25153J46596_10005500 | 3300003215 | Bacteria | 6632 |
| 13 | JGI25153J46596_10014489 | 3300003215 | Bacteria | 3274 |
| 14 | rootH1_10038598 | 3300003316 | Bacteria | 2239 |
| 15 | rootH1_10066544 | 3300003316 | Bacteria | 1936 |
| 16 | rootH2_10032113 | 3300003320 | Bacteria | 3959 |
| 17 | rootH2_10094418 | 3300003320 | Bacteria | 2042 |
| 18 | rootH2_10253391 | 3300003320 | Bacteria | 2929 |
| 19 | rootL2_10014283 | 3300003322 | Bacteria | 15569 |
| 20 | rootL2_10019832 | 3300003322 | Bacteria | 19078 |
| 21 | rootL2_10119408 | 3300003322 | Bacteria | 1689 |
| 22 | rootL2_10180565 | 3300003322 | Bacteria | 2060 |
| 23 | rootL2_10319470 | 3300003322 | Unclassified | 3137 |
| 24 | rootH1_10027463 | 3300003323 | Bacteria | 3175 |
| 25 | rootH1_10137836 | 3300003323 | Bacteria | 5647 |
| 26 | rootH1_10310403 | 3300003323 | Bacteria | 1057 |
| 27 | JGI25160J50197_1005758 | 3300003354 | Bacteria | 5110 |
| 28 | JGI25160J50197_1010184 | 3300003354 | Bacteria | 3419 |
| 29 | JGI25160J50197_1012948 | 3300003354 | Bacteria | 2866 |
| 30 | Ga0055542_1004003 | 3300003762 | Bacteria | 3741 |
| 31 | Ga0055526_1010659 | 3300003771 | Bacteria | 4247 |
| 32 | Ga0055528_1000077 | 3300003790 | Bacteria | 75704 |
| 33 | Ga0055530_10002824 | 3300003791 | Bacteria | 10657 |
| 34 | Ga0055531_10000005 | 3300003794 | Bacteria | 242179 |
| 35 | Ga0055531_10024937 | 3300003794 | Bacteria | 2189 |
| 36 | Ga0065165_1000042 | 3300005262 | Bacteria | 203874 |
| 37 | Ga0065165_1011865 | 3300005262 | Bacteria | 3590 |
| 38 | Ga0065714_10087840 | 3300005288 | Unclassified | 2042 |
| 39 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 40 | Ga0065704_10077708 | 3300005289 | Bacteria | 4645 |
| 41 | Ga0065712_10074422 | 3300005290 | Bacteria | 4098 |
| 42 | Ga0065712_10175767 | 3300005290 | Bacteria | 1218 |
| 43 | Ga0065712_10198684 | 3300005290 | Bacteria | 1117 |
| 44 | Ga0065715_10006633 | 3300005293 | Bacteria | 4735 |
| 45 | Ga0065707_10405757 | 3300005295 | Unclassified | 847 |
| 46 | Ga0070658_10000515 | 3300005327 | Bacteria | 33566 |
| 47 | Ga0070658_10005427 | 3300005327 | Bacteria | 10344 |
| 48 | Ga0070658_10472927 | 3300005327 | Bacteria | 1081 |
| 49 | Ga0070658_10648437 | 3300005327 | Bacteria | 916 |
| 50 | Ga0070676_10000341 | 3300005328 | Bacteria | 21305 |
| 51 | Ga0070676_10026193 | 3300005328 | Bacteria | 3301 |
| 52 | Ga0070676_10185212 | 3300005328 | Unclassified | 1356 |
| 53 | Ga0070683_100070766 | 3300005329 | Bacteria | 3254 |
| 54 | Ga0070690_100230224 | 3300005330 | Bacteria | 1303 |
| 55 | Ga0070670_100011332 | 3300005331 | Bacteria | 7619 |
| 56 | Ga0070670_100015247 | 3300005331 | Bacteria | 6596 |
| 57 | Ga0070670_100063043 | 3300005331 | Bacteria | 3181 |
| 58 | Ga0070670_100166167 | 3300005331 | Bacteria | 1913 |
| 59 | Ga0070670_100227187 | 3300005331 | Bacteria | 1624 |
| 60 | Ga0070670_100257085 | 3300005331 | Bacteria | 1522 |
| 61 | Ga0070670_100726849 | 3300005331 | Bacteria | 894 |
| 62 | Ga0070677_10013665 | 3300005333 | Bacteria | 2844 |
| 63 | Ga0068869_100006045 | 3300005334 | Bacteria | 7657 |
| 64 | Ga0068869_100018070 | 3300005334 | Unclassified | 4793 |
| 65 | Ga0068869_100088707 | 3300005334 | Bacteria | 2322 |
| 66 | Ga0068869_100215495 | 3300005334 | Bacteria | 1520 |
| 67 | Ga0068869_100326658 | 3300005334 | Bacteria | 1245 |
| 68 | Ga0068869_100391470 | 3300005334 | Bacteria | 1141 |
| 69 | Ga0070666_10000172 | 3300005335 | Bacteria | 44437 |
| 70 | Ga0070666_10000185 | 3300005335 | Bacteria | 42683 |
| 71 | Ga0070666_10163481 | 3300005335 | Bacteria | 1556 |
| 72 | Ga0070666_10293408 | 3300005335 | Bacteria | 1157 |
| 73 | Ga0070680_100001877 | 3300005336 | Bacteria | 15408 |
| 74 | Ga0070682_100000259 | 3300005337 | Bacteria | 38232 |
| 75 | Ga0070682_100002348 | 3300005337 | Bacteria | 10477 |
| 76 | Ga0068868_100001522 | 3300005338 | Bacteria | 15890 |
| 77 | Ga0068868_100330141 | 3300005338 | Bacteria | 1302 |
| 78 | Ga0070660_100052435 | 3300005339 | Bacteria | 3145 |
| 79 | Ga0070689_100013704 | 3300005340 | Bacteria | 5873 |
| 80 | Ga0070689_100103172 | 3300005340 | Unclassified | 2260 |
| 81 | Ga0070689_100215127 | 3300005340 | Bacteria | 1574 |
| 82 | Ga0070691_10000875 | 3300005341 | Bacteria | 12204 |
| 83 | Ga0070687_100081113 | 3300005343 | Bacteria | 1770 |
| 84 | Ga0070661_100071198 | 3300005344 | Bacteria | 2558 |
| 85 | Ga0070692_10019052 | 3300005345 | Bacteria | 3309 |
| 86 | Ga0070668_100000169 | 3300005347 | Bacteria | 41705 |
| 87 | Ga0070668_100035392 | 3300005347 | Bacteria | 3807 |
| 88 | Ga0070668_100067980 | 3300005347 | Unclassified | 2769 |
| 89 | Ga0070668_100299370 | 3300005347 | Bacteria | 1349 |
| 90 | Ga0070669_100002549 | 3300005353 | Bacteria | 13166 |
| 91 | Ga0070669_100329052 | 3300005353 | Bacteria | 1235 |
| 92 | Ga0070675_100004810 | 3300005354 | Bacteria | 10303 |
| 93 | Ga0070675_100019684 | 3300005354 | Bacteria | 5381 |
| 94 | Ga0070675_100027677 | 3300005354 | Bacteria | 4557 |
| 95 | Ga0070671_100007849 | 3300005355 | Bacteria | 8530 |
| 96 | Ga0070671_100022580 | 3300005355 | Bacteria | 5139 |
| 97 | Ga0070671_100037901 | 3300005355 | Unclassified | 4000 |
| 98 | Ga0070671_100343410 | 3300005355 | Bacteria | 1274 |
| 99 | Ga0070671_100350488 | 3300005355 | Bacteria | 1260 |
| 100 | Ga0070671_100448603 | 3300005355 | Bacteria | 1107 |
| 101 | Ga0070671_100621612 | 3300005355 | Bacteria | 934 |
| 102 | Ga0070673_100000813 | 3300005364 | Bacteria | 17473 |
| 103 | Ga0070673_100003572 | 3300005364 | Bacteria | 9712 |
| 104 | Ga0070673_100029120 | 3300005364 | Bacteria | 4115 |
| 105 | Ga0070673_100514598 | 3300005364 | Bacteria | 1084 |
| 106 | Ga0070688_100007036 | 3300005365 | Bacteria | 6050 |
| 107 | Ga0070688_100016843 | 3300005365 | Bacteria | 4185 |
| 108 | Ga0070688_100027353 | 3300005365 | Bacteria | 3397 |
| 109 | Ga0070688_100219473 | 3300005365 | Unclassified | 1339 |
| 110 | Ga0070688_100224516 | 3300005365 | Unclassified | 1325 |
| 111 | Ga0070659_100003003 | 3300005366 | Bacteria | 12009 |
| 112 | Ga0070659_100299513 | 3300005366 | Bacteria | 1341 |
| 113 | Ga0070667_100000553 | 3300005367 | Bacteria | 37217 |
| 114 | Ga0070667_100002163 | 3300005367 | Bacteria | 17311 |
| 115 | Ga0070667_100003932 | 3300005367 | Bacteria | 12623 |
| 116 | Ga0070667_100011960 | 3300005367 | Bacteria | 7180 |
| 117 | Ga0070667_100042562 | 3300005367 | Unclassified | 3811 |
| 118 | Ga0070700_100037548 | 3300005441 | Bacteria | 2947 |
| 119 | Ga0070663_100018961 | 3300005455 | Bacteria | 4523 |
| 120 | Ga0070663_100465514 | 3300005455 | Bacteria | 1044 |
| 121 | Ga0070663_100551384 | 3300005455 | Bacteria | 964 |
| 122 | Ga0070678_100048144 | 3300005456 | Bacteria | 3068 |
| 123 | Ga0070678_100057436 | 3300005456 | Unclassified | 2851 |
| 124 | Ga0070678_100334582 | 3300005456 | Bacteria | 1297 |
| 125 | Ga0070678_100404682 | 3300005456 | Unclassified | 1186 |
| 126 | Ga0070662_100002884 | 3300005457 | Bacteria | 10668 |
| 127 | Ga0070681_10014936 | 3300005458 | Bacteria | 7721 |
| 128 | Ga0070681_10057796 | 3300005458 | Unclassified | 3859 |
| 129 | Ga0070681_10356665 | 3300005458 | Bacteria | 1373 |
| 130 | Ga0068867_100001171 | 3300005459 | Bacteria | 17945 |
| 131 | Ga0068867_100016028 | 3300005459 | Bacteria | 5321 |
| 132 | Ga0068867_100020227 | 3300005459 | Unclassified | 4743 |
| 133 | Ga0068867_100031203 | 3300005459 | Unclassified | 3846 |
| 134 | Ga0068867_100252856 | 3300005459 | Unclassified | 1433 |
| 135 | Ga0068867_100522800 | 3300005459 | Unclassified | 1023 |
| 136 | Ga0070685_10003193 | 3300005466 | Bacteria | 8344 |
| 137 | Ga0070685_10012670 | 3300005466 | Unclassified | 4435 |
| 138 | Ga0070685_10069633 | 3300005466 | Bacteria | 2081 |
| 139 | Ga0070698_100001684 | 3300005471 | Bacteria | 24662 |
| 140 | Ga0070698_100084673 | 3300005471 | Bacteria | 3158 |
| 141 | Ga0070699_100206464 | 3300005518 | Bacteria | 1748 |
| 142 | Ga0070679_100002688 | 3300005530 | Bacteria | 16195 |
| 143 | Ga0070679_100220775 | 3300005530 | Bacteria | 1856 |
| 144 | Ga0070679_100244734 | 3300005530 | Bacteria | 1750 |
| 145 | Ga0068853_100000272 | 3300005539 | Bacteria | 36612 |
| 146 | Ga0068853_100047923 | 3300005539 | Unclassified | 3668 |
| 147 | Ga0068853_100372051 | 3300005539 | Bacteria | 1333 |
| 148 | Ga0068853_100377660 | 3300005539 | Bacteria | 1323 |
| 149 | Ga0070672_100000061 | 3300005543 | Bacteria | 49701 |
| 150 | Ga0070672_100066056 | 3300005543 | Unclassified | 2863 |
| 151 | Ga0070672_100134964 | 3300005543 | Bacteria | 2032 |
| 152 | Ga0070672_100246378 | 3300005543 | Unclassified | 1504 |
| 153 | Ga0070672_100289545 | 3300005543 | Bacteria | 1386 |
| 154 | Ga0070665_100000612 | 3300005548 | Bacteria | 48973 |
| 155 | Ga0070665_100008108 | 3300005548 | Bacteria | 10633 |
| 156 | Ga0070665_100177167 | 3300005548 | Bacteria | 2133 |
| 157 | Ga0070665_100396854 | 3300005548 | Bacteria | 1387 |
| 158 | Ga0068855_100003883 | 3300005563 | Bacteria | 18266 |
| 159 | Ga0068855_100016351 | 3300005563 | Bacteria | 8921 |
| 160 | Ga0068855_100110959 | 3300005563 | Bacteria | 3148 |
| 161 | Ga0068855_100137468 | 3300005563 | Bacteria | 2787 |
| 162 | Ga0068855_100277230 | 3300005563 | Unclassified | 1863 |
| 163 | Ga0070664_100009965 | 3300005564 | Bacteria | 7703 |
| 164 | Ga0070664_100042674 | 3300005564 | Bacteria | 3828 |
| 165 | Ga0070664_100139449 | 3300005564 | Unclassified | 2134 |
| 166 | Ga0068857_100007129 | 3300005577 | Bacteria | 9627 |
| 167 | Ga0068857_100104068 | 3300005577 | Unclassified | 2549 |
| 168 | Ga0068857_100494269 | 3300005577 | Bacteria | 1147 |
| 169 | Ga0068857_100661929 | 3300005577 | Bacteria | 990 |
| 170 | Ga0068854_100013145 | 3300005578 | Bacteria | 5426 |
| 171 | Ga0068854_100071501 | 3300005578 | Unclassified | 2538 |
| 172 | Ga0068856_100034665 | 3300005614 | Bacteria | 4943 |
| 173 | Ga0068856_100068876 | 3300005614 | Bacteria | 3498 |
| 174 | Ga0070702_100019944 | 3300005615 | Unclassified | 3505 |
| 175 | Ga0068852_100000787 | 3300005616 | Bacteria | 20834 |
| 176 | Ga0068852_100008187 | 3300005616 | Bacteria | 7681 |
| 177 | Ga0068852_100047286 | 3300005616 | Bacteria | 3670 |
| 178 | Ga0068852_100086895 | 3300005616 | Bacteria | 2789 |
| 179 | Ga0068852_100457813 | 3300005616 | Bacteria | 1264 |
| 180 | Ga0068852_100612956 | 3300005616 | Unclassified | 1094 |
| 181 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 182 | Ga0068859_100028460 | 3300005617 | Bacteria | 5602 |
| 183 | Ga0068859_100041010 | 3300005617 | Bacteria | 4650 |
| 184 | Ga0068859_100047799 | 3300005617 | Unclassified | 4299 |
| 185 | Ga0068859_100052217 | 3300005617 | Unclassified | 4109 |
| 186 | Ga0068859_100090425 | 3300005617 | Bacteria | 3112 |
| 187 | Ga0068859_100095284 | 3300005617 | Bacteria | 3029 |
| 188 | Ga0068859_100185090 | 3300005617 | Bacteria | 2166 |
| 189 | Ga0068864_100004846 | 3300005618 | Bacteria | 11021 |
| 190 | Ga0068864_100014384 | 3300005618 | Bacteria | 6572 |
| 191 | Ga0068864_100029845 | 3300005618 | Bacteria | 4621 |
| 192 | Ga0068864_100062003 | 3300005618 | Bacteria | 3239 |
| 193 | Ga0068864_100079933 | 3300005618 | Bacteria | 2864 |
| 194 | Ga0068864_100082789 | 3300005618 | Bacteria | 2816 |
| 195 | Ga0068866_10053858 | 3300005718 | Bacteria | 2059 |
| 196 | Ga0068861_100076877 | 3300005719 | Unclassified | 2602 |
| 197 | Ga0068861_100091750 | 3300005719 | Bacteria | 2399 |
| 198 | Ga0068851_10001728 | 3300005834 | Bacteria | 9542 |
| 199 | Ga0068851_10036515 | 3300005834 | Unclassified | 2460 |
| 200 | Ga0068851_10051254 | 3300005834 | Bacteria | 2097 |
| 201 | Ga0068851_10138654 | 3300005834 | Unclassified | 1321 |
| 202 | Ga0068870_10004264 | 3300005840 | Bacteria | 6146 |
| 203 | Ga0068870_10038156 | 3300005840 | Unclassified | 2479 |
| 204 | Ga0068870_10207759 | 3300005840 | Bacteria | 1191 |
| 205 | Ga0068863_100001273 | 3300005841 | Bacteria | 25131 |
| 206 | Ga0068863_100015573 | 3300005841 | Bacteria | 7306 |
| 207 | Ga0068863_100021719 | 3300005841 | Bacteria | 6123 |
| 208 | Ga0068863_100021933 | 3300005841 | Bacteria | 6094 |
| 209 | Ga0068863_100027233 | 3300005841 | Bacteria | 5451 |
| 210 | Ga0068863_100296048 | 3300005841 | Bacteria | 1569 |
| 211 | Ga0068863_100604925 | 3300005841 | Bacteria | 1085 |
| 212 | Ga0068858_100000930 | 3300005842 | Bacteria | 30365 |
| 213 | Ga0068858_100014471 | 3300005842 | Bacteria | 7434 |
| 214 | Ga0068858_100819832 | 3300005842 | Unclassified | 908 |
| 215 | Ga0068860_100000443 | 3300005843 | Bacteria | 52294 |
| 216 | Ga0068860_100000591 | 3300005843 | Bacteria | 43327 |
| 217 | Ga0068860_100005524 | 3300005843 | Bacteria | 12798 |
| 218 | Ga0068860_100029363 | 3300005843 | Bacteria | 5288 |
| 219 | Ga0068860_100052013 | 3300005843 | Bacteria | 3896 |
| 220 | Ga0068860_100155219 | 3300005843 | Unclassified | 2205 |
| 221 | Ga0068862_100001278 | 3300005844 | Bacteria | 23579 |
| 222 | Ga0068862_100002721 | 3300005844 | Bacteria | 15516 |
| 223 | Ga0068862_100108492 | 3300005844 | Bacteria | 2435 |
| 224 | Ga0068862_100187645 | 3300005844 | Bacteria | 1859 |
| 225 | Ga0068862_100278398 | 3300005844 | Bacteria | 1532 |
| 226 | Ga0068862_100403206 | 3300005844 | Bacteria | 1280 |
| 227 | Ga0068862_100480724 | 3300005844 | Bacteria | 1176 |
| 228 | Ga0075366_10010141 | 3300006195 | Bacteria | 5282 |
| 229 | Ga0075366_10146725 | 3300006195 | Bacteria | 1428 |
| 230 | Ga0097621_100000531 | 3300006237 | Bacteria | 26760 |
| 231 | Ga0097621_100000821 | 3300006237 | Bacteria | 21965 |
| 232 | Ga0097621_100004954 | 3300006237 | Bacteria | 9336 |
| 233 | Ga0097621_100011962 | 3300006237 | Bacteria | 6419 |
| 234 | Ga0097621_100046435 | 3300006237 | Bacteria | 3514 |
| 235 | Ga0097621_100291543 | 3300006237 | Bacteria | 1439 |
| 236 | Ga0097621_100388892 | 3300006237 | Unclassified | 1247 |
| 237 | Ga0068871_100001554 | 3300006358 | Bacteria | 15398 |
| 238 | Ga0068871_100002710 | 3300006358 | Bacteria | 12089 |
| 239 | Ga0068871_100016561 | 3300006358 | Bacteria | 5558 |
| 240 | Ga0068871_100075852 | 3300006358 | Unclassified | 2776 |
| 241 | Ga0075428_100143572 | 3300006844 | Bacteria | 2595 |
| 242 | Ga0075428_100960321 | 3300006844 | Unclassified | 905 |
| 243 | Ga0075430_100007849 | 3300006846 | Bacteria | 9022 |
| 244 | Ga0075431_100005370 | 3300006847 | Bacteria | 12650 |
| 245 | Ga0075431_100414130 | 3300006847 | Unclassified | 1347 |
| 246 | Ga0075429_100019843 | 3300006880 | Bacteria | 5829 |
| 247 | Ga0075429_100051926 | 3300006880 | Bacteria | 3566 |
| 248 | Ga0068865_100003524 | 3300006881 | Bacteria | 9385 |
| 249 | Ga0068865_100047931 | 3300006881 | Unclassified | 2939 |
| 250 | Ga0068865_100336596 | 3300006881 | Bacteria | 1218 |
| 251 | Ga0068865_100364145 | 3300006881 | Bacteria | 1175 |
| 252 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 253 | Ga0097620_100028459 | 3300006931 | Bacteria | 5602 |
| 254 | Ga0097620_100041010 | 3300006931 | Bacteria | 4650 |
| 255 | Ga0097620_100047801 | 3300006931 | Unclassified | 4299 |
| 256 | Ga0097620_100052221 | 3300006931 | Unclassified | 4109 |
| 257 | Ga0097620_100090425 | 3300006931 | Bacteria | 3112 |
| 258 | Ga0097620_100095283 | 3300006931 | Bacteria | 3029 |
| 259 | Ga0097620_100185076 | 3300006931 | Bacteria | 2166 |
| 260 | Ga0105240_10000020 | 3300009093 | Bacteria | 399699 |
| 261 | Ga0105240_10038515 | 3300009093 | Bacteria | 6132 |
| 262 | Ga0105240_10048639 | 3300009093 | Bacteria | 5358 |
| 263 | Ga0105240_10050783 | 3300009093 | Bacteria | 5225 |
| 264 | Ga0105240_10060139 | 3300009093 | Bacteria | 4737 |
| 265 | Ga0105240_10239040 | 3300009093 | Unclassified | 2106 |
| 266 | Ga0111539_10004662 | 3300009094 | Bacteria | 17918 |
| 267 | Ga0111539_10174473 | 3300009094 | Unclassified | 2511 |
| 268 | Ga0111539_10199038 | 3300009094 | Bacteria | 2336 |
| 269 | Ga0111539_10694191 | 3300009094 | Bacteria | 1185 |
| 270 | Ga0111539_10823758 | 3300009094 | Bacteria | 1080 |
| 271 | Ga0105245_10127548 | 3300009098 | Bacteria | 2383 |
| 272 | Ga0105245_10179891 | 3300009098 | Bacteria | 2020 |
| 273 | Ga0105247_10022723 | 3300009101 | Bacteria | 3776 |
| 274 | Ga0105247_10027512 | 3300009101 | Unclassified | 3439 |
| 275 | Ga0105247_10046132 | 3300009101 | Unclassified | 2674 |
| 276 | Ga0114129_10052463 | 3300009147 | Bacteria | 5723 |
| 277 | Ga0105243_10106734 | 3300009148 | Unclassified | 2335 |
| 278 | Ga0105241_10000686 | 3300009174 | Bacteria | 25490 |
| 279 | Ga0105241_10009515 | 3300009174 | Bacteria | 7139 |
| 280 | Ga0105241_10091344 | 3300009174 | Bacteria | 2402 |
| 281 | Ga0105242_10059707 | 3300009176 | Bacteria | 3130 |
| 282 | Ga0105248_10014203 | 3300009177 | Bacteria | 8767 |
| 283 | Ga0105248_10016765 | 3300009177 | Bacteria | 8067 |
| 284 | Ga0105237_10004476 | 3300009545 | Bacteria | 16155 |
| 285 | Ga0105237_10025289 | 3300009545 | Bacteria | 6073 |
| 286 | Ga0105238_10122640 | 3300009551 | Unclassified | 2578 |
| 287 | Ga0105249_10001226 | 3300009553 | Bacteria | 22548 |
| 288 | Ga0105249_10002749 | 3300009553 | Bacteria | 15219 |
| 289 | Ga0105249_10003197 | 3300009553 | Bacteria | 14178 |
| 290 | Ga0105249_10006427 | 3300009553 | Bacteria | 10217 |
| 291 | Ga0105249_10085379 | 3300009553 | Bacteria | 2941 |
| 292 | Ga0105249_10173838 | 3300009553 | Bacteria | 2090 |
| 293 | Ga0105249_10448012 | 3300009553 | Bacteria | 1329 |
| 294 | Ga0105239_10000631 | 3300010375 | Bacteria | 50176 |
| 295 | Ga0105239_10010893 | 3300010375 | Bacteria | 10159 |
| 296 | Ga0105239_10023189 | 3300010375 | Bacteria | 6840 |
| 297 | Ga0105239_10153260 | 3300010375 | Bacteria | 2573 |
| 298 | Ga0105239_10389660 | 3300010375 | Bacteria | 1576 |
| 299 | Ga0105246_10016419 | 3300011119 | Bacteria | 4689 |
| 300 | Ga0105246_10059288 | 3300011119 | Bacteria | 2655 |
| 301 | Ga0157373_10090369 | 3300013100 | Bacteria | 2157 |
| 302 | Ga0157371_10036269 | 3300013102 | Bacteria | 3531 |
| 303 | Ga0157371_10110099 | 3300013102 | Bacteria | 1955 |
| 304 | Ga0157370_10003149 | 3300013104 | Bacteria | 19547 |
| 305 | Ga0157370_10003666 | 3300013104 | Bacteria | 17942 |
| 306 | Ga0157370_10276782 | 3300013104 | Bacteria | 1551 |
| 307 | Ga0157370_10350688 | 3300013104 | Bacteria | 1360 |
| 308 | Ga0157369_10021680 | 3300013105 | Bacteria | 7184 |
| 309 | Ga0157369_10024505 | 3300013105 | Bacteria | 6711 |
| 310 | Ga0157369_10297725 | 3300013105 | Unclassified | 1679 |
| 311 | Ga0157374_10002119 | 3300013296 | Bacteria | 16701 |
| 312 | Ga0157374_10184301 | 3300013296 | Bacteria | 2040 |
| 313 | Ga0157378_10007403 | 3300013297 | Bacteria | 9589 |
| 314 | Ga0157378_10028471 | 3300013297 | Bacteria | 4930 |
| 315 | Ga0157378_10039607 | 3300013297 | Bacteria | 4180 |
| 316 | Ga0157378_10044580 | 3300013297 | Bacteria | 3939 |
| 317 | Ga0157378_10070013 | 3300013297 | Bacteria | 3148 |
| 318 | Ga0157378_10077863 | 3300013297 | Unclassified | 2989 |
| 319 | Ga0157378_10095523 | 3300013297 | Bacteria | 2707 |
| 320 | Ga0157378_10147947 | 3300013297 | Unclassified | 2186 |
| 321 | Ga0157378_10204847 | 3300013297 | Bacteria | 1868 |
| 322 | Ga0163162_10000752 | 3300013306 | Bacteria | 30172 |
| 323 | Ga0163162_10000931 | 3300013306 | Bacteria | 27155 |
| 324 | Ga0163162_10001214 | 3300013306 | Bacteria | 24073 |
| 325 | Ga0163162_10002506 | 3300013306 | Bacteria | 17371 |
| 326 | Ga0163162_10003220 | 3300013306 | Bacteria | 15616 |
| 327 | Ga0163162_10009367 | 3300013306 | Bacteria | 9524 |
| 328 | Ga0163162_10012998 | 3300013306 | Bacteria | 8124 |
| 329 | Ga0163162_10031439 | 3300013306 | Bacteria | 5265 |
| 330 | Ga0163162_10052834 | 3300013306 | Unclassified | 4082 |
| 331 | Ga0163162_10109057 | 3300013306 | Bacteria | 2865 |
| 332 | Ga0163162_10132165 | 3300013306 | Bacteria | 2605 |
| 333 | Ga0163162_10164252 | 3300013306 | Bacteria | 2344 |
| 334 | Ga0163162_10695331 | 3300013306 | Bacteria | 1139 |
| 335 | Ga0157372_10001914 | 3300013307 | Bacteria | 22584 |
| 336 | Ga0157372_10006438 | 3300013307 | Bacteria | 12502 |
| 337 | Ga0157372_10055213 | 3300013307 | Bacteria | 4435 |
| 338 | Ga0157372_10074901 | 3300013307 | Bacteria | 3818 |
| 339 | Ga0157372_10083103 | 3300013307 | Bacteria | 3627 |
| 340 | Ga0157372_10095723 | 3300013307 | Bacteria | 3383 |
| 341 | Ga0157372_10145310 | 3300013307 | Bacteria | 2735 |
| 342 | Ga0157372_10151256 | 3300013307 | Unclassified | 2679 |
| 343 | Ga0157372_10173548 | 3300013307 | Bacteria | 2494 |
| 344 | Ga0157372_10195474 | 3300013307 | Bacteria | 2343 |
| 345 | Ga0157372_10379645 | 3300013307 | Bacteria | 1647 |
| 346 | Ga0157372_10428392 | 3300013307 | Bacteria | 1542 |
| 347 | Ga0157372_10516102 | 3300013307 | Bacteria | 1393 |
| 348 | Ga0157372_10588569 | 3300013307 | Bacteria | 1297 |
| 349 | Ga0157375_10000098 | 3300013308 | Bacteria | 88130 |
| 350 | Ga0157375_10001055 | 3300013308 | Bacteria | 23768 |
| 351 | Ga0157375_10020946 | 3300013308 | Bacteria | 5983 |
| 352 | Ga0157375_10028942 | 3300013308 | Bacteria | 5202 |
| 353 | Ga0157375_10042760 | 3300013308 | Bacteria | 4388 |
| 354 | Ga0157375_10135361 | 3300013308 | Unclassified | 2587 |
| 355 | Ga0157375_10234186 | 3300013308 | Bacteria | 1995 |
| 356 | Ga0157375_10363596 | 3300013308 | Unclassified | 1613 |
| 357 | Ga0157375_10985028 | 3300013308 | Bacteria | 983 |
| 358 | Ga0163163_10000272 | 3300014325 | Bacteria | 51699 |
| 359 | Ga0163163_10000888 | 3300014325 | Bacteria | 25452 |
| 360 | Ga0163163_10013960 | 3300014325 | Bacteria | 7371 |
| 361 | Ga0163163_10072762 | 3300014325 | Bacteria | 3427 |
| 362 | Ga0163163_10411207 | 3300014325 | Unclassified | 1411 |
| 363 | Ga0163163_10500357 | 3300014325 | Bacteria | 1277 |
| 364 | Ga0163163_10505951 | 3300014325 | Bacteria | 1270 |
| 365 | Ga0157380_10005493 | 3300014326 | Bacteria | 8859 |
| 366 | Ga0157380_10017785 | 3300014326 | Bacteria | 5267 |
| 367 | Ga0157380_10063918 | 3300014326 | Bacteria | 2952 |
| 368 | Ga0157380_10196875 | 3300014326 | Bacteria | 1784 |
| 369 | Ga0157380_10201079 | 3300014326 | Bacteria | 1768 |
| 370 | Ga0157377_10000659 | 3300014745 | Bacteria | 14381 |
| 371 | Ga0157379_10000103 | 3300014968 | Bacteria | 58102 |
| 372 | Ga0157379_10011365 | 3300014968 | Bacteria | 7764 |
| 373 | Ga0157379_10185046 | 3300014968 | Bacteria | 1882 |
| 374 | Ga0157379_10313229 | 3300014968 | Bacteria | 1432 |
| 375 | Ga0157376_10000484 | 3300014969 | Bacteria | 25711 |
| 376 | Ga0157376_10002103 | 3300014969 | Bacteria | 13391 |
| 377 | Ga0157376_10014571 | 3300014969 | Bacteria | 5907 |
| 378 | Ga0157376_10047458 | 3300014969 | Bacteria | 3545 |
| 379 | Ga0157376_10058583 | 3300014969 | Bacteria | 3227 |
| 380 | Ga0157376_10294773 | 3300014969 | Bacteria | 1533 |
| 381 | Ga0182005_1000017 | 3300015265 | Bacteria | 331828 |
| 382 | Ga0163161_10008445 | 3300017792 | Bacteria | 7131 |
| 383 | Ga0163161_10011545 | 3300017792 | Bacteria | 6130 |
| 384 | Ga0163161_10102585 | 3300017792 | Bacteria | 2131 |
| 385 | Ga0163161_10275346 | 3300017792 | Bacteria | 1318 |
| 386 | Ga0213876_10003307 | 3300021384 | Bacteria | 9246 |
| 387 | Ga0213876_10076218 | 3300021384 | Bacteria | 1771 |
| 388 | Ga0209436_108355 | 3300025208 | Bacteria | 2069 |
| 389 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 390 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 391 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 392 | Ga0209148_1000089 | 3300025254 | Bacteria | 253548 |
| 393 | Ga0207666_1007724 | 3300025271 | Unclassified | 1423 |
| 394 | Ga0209673_1000113 | 3300025273 | Bacteria | 179012 |
| 395 | Ga0209564_1008803 | 3300025295 | Bacteria | 4916 |
| 396 | Ga0209758_1006508 | 3300025297 | Bacteria | 8344 |
| 397 | Ga0209758_1011612 | 3300025297 | Bacteria | 5070 |
| 398 | Ga0209758_1014394 | 3300025297 | Bacteria | 4211 |
| 399 | Ga0209050_1000185 | 3300025298 | Bacteria | 141889 |
| 400 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 401 | Ga0207426_1000263 | 3300025302 | Bacteria | 110923 |
| 402 | Ga0207426_1001392 | 3300025302 | Bacteria | 20412 |
| 403 | Ga0209051_1036469 | 3300025303 | Bacteria | 1815 |
| 404 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 405 | Ga0209257_1000257 | 3300025304 | Bacteria | 122448 |
| 406 | Ga0207656_10001251 | 3300025321 | Bacteria | 8374 |
| 407 | Ga0207642_10097883 | 3300025899 | Bacteria | 1465 |
| 408 | Ga0207710_10011276 | 3300025900 | Bacteria | 3762 |
| 409 | Ga0207688_10023048 | 3300025901 | Unclassified | 3407 |
| 410 | Ga0207688_10254065 | 3300025901 | Bacteria | 1065 |
| 411 | Ga0207680_10000083 | 3300025903 | Bacteria | 42904 |
| 412 | Ga0207680_10001345 | 3300025903 | Bacteria | 11631 |
| 413 | Ga0207680_10517955 | 3300025903 | Unclassified | 850 |
| 414 | Ga0207647_10000050 | 3300025904 | Bacteria | 88099 |
| 415 | Ga0207647_10000824 | 3300025904 | Bacteria | 24071 |
| 416 | Ga0207647_10091077 | 3300025904 | Unclassified | 1818 |
| 417 | Ga0207647_10286827 | 3300025904 | Bacteria | 939 |
| 418 | Ga0207685_10006469 | 3300025905 | Bacteria | 3192 |
| 419 | Ga0207645_10000793 | 3300025907 | Bacteria | 26435 |
| 420 | Ga0207645_10008445 | 3300025907 | Bacteria | 7184 |
| 421 | Ga0207645_10015568 | 3300025907 | Bacteria | 5050 |
| 422 | Ga0207645_10021983 | 3300025907 | Bacteria | 4154 |
| 423 | Ga0207645_10036615 | 3300025907 | Bacteria | 3151 |
| 424 | Ga0207643_10004365 | 3300025908 | Bacteria | 7598 |
| 425 | Ga0207705_10005062 | 3300025909 | Bacteria | 9880 |
| 426 | Ga0207705_10017322 | 3300025909 | Bacteria | 5158 |
| 427 | Ga0207705_10163510 | 3300025909 | Bacteria | 1673 |
| 428 | Ga0207705_10214304 | 3300025909 | Bacteria | 1461 |
| 429 | Ga0207654_10002274 | 3300025911 | Bacteria | 9849 |
| 430 | Ga0207654_10021156 | 3300025911 | Unclassified | 3456 |
| 431 | Ga0207707_10000160 | 3300025912 | Bacteria | 70695 |
| 432 | Ga0207707_10085211 | 3300025912 | Bacteria | 2760 |
| 433 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 434 | Ga0207695_10002404 | 3300025913 | Bacteria | 27705 |
| 435 | Ga0207695_10009558 | 3300025913 | Bacteria | 11985 |
| 436 | Ga0207695_10169883 | 3300025913 | Unclassified | 2106 |
| 437 | Ga0207671_10000025 | 3300025914 | Bacteria | 271617 |
| 438 | Ga0207671_10001991 | 3300025914 | Bacteria | 22515 |
| 439 | Ga0207671_10023773 | 3300025914 | Bacteria | 4618 |
| 440 | Ga0207660_10048464 | 3300025917 | Bacteria | 3006 |
| 441 | Ga0207662_10139080 | 3300025918 | Unclassified | 1537 |
| 442 | Ga0207657_10030556 | 3300025919 | Bacteria | 4889 |
| 443 | Ga0207657_10124095 | 3300025919 | Bacteria | 2122 |
| 444 | Ga0207649_10020444 | 3300025920 | Bacteria | 3798 |
| 445 | Ga0207652_10001880 | 3300025921 | Bacteria | 18225 |
| 446 | Ga0207646_10025366 | 3300025922 | Bacteria | 5423 |
| 447 | Ga0207681_10066965 | 3300025923 | Bacteria | 2488 |
| 448 | Ga0207681_10075399 | 3300025923 | Unclassified | 2365 |
| 449 | Ga0207681_10196688 | 3300025923 | Bacteria | 1546 |
| 450 | Ga0207650_10000562 | 3300025925 | Bacteria | 30092 |
| 451 | Ga0207650_10058657 | 3300025925 | Unclassified | 2866 |
| 452 | Ga0207650_10380939 | 3300025925 | Unclassified | 1165 |
| 453 | Ga0207659_10012376 | 3300025926 | Bacteria | 5425 |
| 454 | Ga0207659_10029121 | 3300025926 | Bacteria | 3760 |
| 455 | Ga0207659_10030626 | 3300025926 | Unclassified | 3678 |
| 456 | Ga0207644_10040917 | 3300025931 | Unclassified | 3277 |
| 457 | Ga0207644_10175389 | 3300025931 | Bacteria | 1677 |
| 458 | Ga0207644_10191172 | 3300025931 | Bacteria | 1609 |
| 459 | Ga0207690_10068711 | 3300025932 | Bacteria | 2435 |
| 460 | Ga0207706_10006661 | 3300025933 | Bacteria | 10681 |
| 461 | Ga0207706_10036362 | 3300025933 | Unclassified | 4374 |
| 462 | Ga0207686_10000498 | 3300025934 | Bacteria | 25770 |
| 463 | Ga0207670_10042309 | 3300025936 | Bacteria | 3001 |
| 464 | Ga0207670_10183435 | 3300025936 | Bacteria | 1578 |
| 465 | Ga0207670_10197247 | 3300025936 | Bacteria | 1527 |
| 466 | Ga0207670_10249889 | 3300025936 | Unclassified | 1370 |
| 467 | Ga0207704_10004460 | 3300025938 | Bacteria | 6400 |
| 468 | Ga0207704_10007802 | 3300025938 | Bacteria | 5078 |
| 469 | Ga0207704_10047803 | 3300025938 | Bacteria | 2561 |
| 470 | Ga0207704_10112702 | 3300025938 | Bacteria | 1843 |
| 471 | Ga0207704_10282893 | 3300025938 | Bacteria | 1262 |
| 472 | Ga0207704_10626890 | 3300025938 | Bacteria | 883 |
| 473 | Ga0207691_10000154 | 3300025940 | Bacteria | 64281 |
| 474 | Ga0207691_10006412 | 3300025940 | Bacteria | 11367 |
| 475 | Ga0207691_10011687 | 3300025940 | Bacteria | 8431 |
| 476 | Ga0207691_10014404 | 3300025940 | Bacteria | 7541 |
| 477 | Ga0207691_10183619 | 3300025940 | Bacteria | 1827 |
| 478 | Ga0207691_10504664 | 3300025940 | Bacteria | 1027 |
| 479 | Ga0207711_10170821 | 3300025941 | Unclassified | 1973 |
| 480 | Ga0207711_10213139 | 3300025941 | Bacteria | 1765 |
| 481 | Ga0207689_10006246 | 3300025942 | Bacteria | 10557 |
| 482 | Ga0207689_10009576 | 3300025942 | Bacteria | 8356 |
| 483 | Ga0207689_10029427 | 3300025942 | Bacteria | 4586 |
| 484 | Ga0207689_10043843 | 3300025942 | Bacteria | 3698 |
| 485 | Ga0207689_10045161 | 3300025942 | Unclassified | 3644 |
| 486 | Ga0207689_10053634 | 3300025942 | Bacteria | 3322 |
| 487 | Ga0207689_10084762 | 3300025942 | Bacteria | 2605 |
| 488 | Ga0207689_10172962 | 3300025942 | Unclassified | 1781 |
| 489 | Ga0207661_10164742 | 3300025944 | Bacteria | 1925 |
| 490 | Ga0207661_10185926 | 3300025944 | Bacteria | 1818 |
| 491 | Ga0207661_10312518 | 3300025944 | Unclassified | 1411 |
| 492 | Ga0207679_10008672 | 3300025945 | Bacteria | 6482 |
| 493 | Ga0207679_10120701 | 3300025945 | Unclassified | 2086 |
| 494 | Ga0207679_10215503 | 3300025945 | Unclassified | 1613 |
| 495 | Ga0207667_10002576 | 3300025949 | Bacteria | 22534 |
| 496 | Ga0207667_10009791 | 3300025949 | Bacteria | 11271 |
| 497 | Ga0207667_10031890 | 3300025949 | Bacteria | 5683 |
| 498 | Ga0207667_10102839 | 3300025949 | Bacteria | 2947 |
| 499 | Ga0207651_10002520 | 3300025960 | Bacteria | 8743 |
| 500 | Ga0207651_10006411 | 3300025960 | Bacteria | 6157 |
| 501 | Ga0207651_10475106 | 3300025960 | Bacteria | 1076 |
| 502 | Ga0207712_10001312 | 3300025961 | Bacteria | 17052 |
| 503 | Ga0207712_10001788 | 3300025961 | Bacteria | 14267 |
| 504 | Ga0207712_10001935 | 3300025961 | Bacteria | 13612 |
| 505 | Ga0207712_10028489 | 3300025961 | Bacteria | 3736 |
| 506 | Ga0207712_10124567 | 3300025961 | Bacteria | 1955 |
| 507 | Ga0207668_10001109 | 3300025972 | Bacteria | 16020 |
| 508 | Ga0207668_10028706 | 3300025972 | Unclassified | 3641 |
| 509 | Ga0207668_10059509 | 3300025972 | Bacteria | 2677 |
| 510 | Ga0207668_10197003 | 3300025972 | Bacteria | 1601 |
| 511 | Ga0207640_10024352 | 3300025981 | Unclassified | 3651 |
| 512 | Ga0207640_10439909 | 3300025981 | Bacteria | 1072 |
| 513 | Ga0207658_10001366 | 3300025986 | Bacteria | 19064 |
| 514 | Ga0207658_10013336 | 3300025986 | Bacteria | 5612 |
| 515 | Ga0207658_10023762 | 3300025986 | Bacteria | 4282 |
| 516 | Ga0207677_10000862 | 3300026023 | Bacteria | 17343 |
| 517 | Ga0207677_10020413 | 3300026023 | Bacteria | 4022 |
| 518 | Ga0207677_10031797 | 3300026023 | Unclassified | 3384 |
| 519 | Ga0207703_10000883 | 3300026035 | Bacteria | 29482 |
| 520 | Ga0207703_10002119 | 3300026035 | Bacteria | 17466 |
| 521 | Ga0207703_10171225 | 3300026035 | Unclassified | 1910 |
| 522 | Ga0207639_10001017 | 3300026041 | Bacteria | 19080 |
| 523 | Ga0207639_10029612 | 3300026041 | Bacteria | 4010 |
| 524 | Ga0207639_10085753 | 3300026041 | Unclassified | 2505 |
| 525 | Ga0207639_10127810 | 3300026041 | Bacteria | 2099 |
| 526 | Ga0207639_10490443 | 3300026041 | Bacteria | 1121 |
| 527 | Ga0207678_10019079 | 3300026067 | Bacteria | 6020 |
| 528 | Ga0207678_10101700 | 3300026067 | Bacteria | 2454 |
| 529 | Ga0207708_10309440 | 3300026075 | Unclassified | 1287 |
| 530 | Ga0207702_10196693 | 3300026078 | Bacteria | 1866 |
| 531 | Ga0207702_10211179 | 3300026078 | Bacteria | 1804 |
| 532 | Ga0207641_10000159 | 3300026088 | Bacteria | 96072 |
| 533 | Ga0207641_10000467 | 3300026088 | Bacteria | 45772 |
| 534 | Ga0207641_10006669 | 3300026088 | Bacteria | 9691 |
| 535 | Ga0207641_10015293 | 3300026088 | Bacteria | 6290 |
| 536 | Ga0207641_10034813 | 3300026088 | Bacteria | 4192 |
| 537 | Ga0207641_10045765 | 3300026088 | Bacteria | 3687 |
| 538 | Ga0207641_10247688 | 3300026088 | Bacteria | 1663 |
| 539 | Ga0207641_10445119 | 3300026088 | Bacteria | 1251 |
| 540 | Ga0207648_10006104 | 3300026089 | Bacteria | 12012 |
| 541 | Ga0207648_10009539 | 3300026089 | Bacteria | 9284 |
| 542 | Ga0207648_10031304 | 3300026089 | Unclassified | 4703 |
| 543 | Ga0207648_10042198 | 3300026089 | Unclassified | 4005 |
| 544 | Ga0207648_10114813 | 3300026089 | Bacteria | 2366 |
| 545 | Ga0207676_10003634 | 3300026095 | Bacteria | 10911 |
| 546 | Ga0207676_10017905 | 3300026095 | Bacteria | 5141 |
| 547 | Ga0207676_10051548 | 3300026095 | Bacteria | 3213 |
| 548 | Ga0207676_10131650 | 3300026095 | Bacteria | 2127 |
| 549 | Ga0207676_10319895 | 3300026095 | Bacteria | 1424 |
| 550 | Ga0207674_10003180 | 3300026116 | Bacteria | 20225 |
| 551 | Ga0207674_10138551 | 3300026116 | Unclassified | 2394 |
| 552 | Ga0207674_10296442 | 3300026116 | Bacteria | 1566 |
| 553 | Ga0207674_10322908 | 3300026116 | Bacteria | 1493 |
| 554 | Ga0207674_10395713 | 3300026116 | Bacteria | 1335 |
| 555 | Ga0207675_100000299 | 3300026118 | Bacteria | 47665 |
| 556 | Ga0207675_100087826 | 3300026118 | Bacteria | 2921 |
| 557 | Ga0207675_100243328 | 3300026118 | Unclassified | 1739 |
| 558 | Ga0207675_100288481 | 3300026118 | Bacteria | 1596 |
| 559 | Ga0207683_10155017 | 3300026121 | Bacteria | 2069 |
| 560 | Ga0207683_10372064 | 3300026121 | Bacteria | 1313 |
| 561 | Ga0207698_10007436 | 3300026142 | Bacteria | 6859 |
| 562 | Ga0207698_10013839 | 3300026142 | Bacteria | 5341 |
| 563 | Ga0207698_10111803 | 3300026142 | Bacteria | 2291 |
| 564 | Ga0207698_10181167 | 3300026142 | Bacteria | 1866 |
| 565 | Ga0207698_10258072 | 3300026142 | Bacteria | 1599 |
| 566 | Ga0268266_10003931 | 3300028379 | Bacteria | 14446 |
| 567 | Ga0268266_10015510 | 3300028379 | Bacteria | 6536 |
| 568 | Ga0268266_10321214 | 3300028379 | Bacteria | 1449 |
| 569 | Ga0268265_10035362 | 3300028380 | Unclassified | 3649 |
| 570 | Ga0268265_10157914 | 3300028380 | Bacteria | 1922 |
| 571 | Ga0268265_10241940 | 3300028380 | Bacteria | 1593 |
| 572 | Ga0268265_10280983 | 3300028380 | Bacteria | 1489 |
| 573 | Ga0268265_10427027 | 3300028380 | Bacteria | 1232 |
| 574 | Ga0268265_10701788 | 3300028380 | Bacteria | 977 |
| 575 | Ga0268264_10000507 | 3300028381 | Bacteria | 50105 |
| 576 | Ga0268264_10001126 | 3300028381 | Bacteria | 26251 |
| 577 | Ga0268264_10004873 | 3300028381 | Bacteria | 11372 |
| 578 | Ga0268264_10006450 | 3300028381 | Bacteria | 9876 |
| 579 | Ga0268264_10020330 | 3300028381 | Bacteria | 5426 |
| 580 | Ga0268264_10056847 | 3300028381 | Bacteria | 3271 |
| 581 | Ga0268264_10104551 | 3300028381 | Bacteria | 2468 |
| 582 | Ga0268264_10347698 | 3300028381 | Bacteria | 1410 |
| 583 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 584 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 585 | Ga0265327_10000254 | 3300031251 | Bacteria | 106076 |
| 586 | Ga0265327_10000338 | 3300031251 | Bacteria | 88898 |
| 587 | Ga0307513_10169854 | 3300031456 | Bacteria | 2060 |
| 588 | Ga0307513_10404499 | 3300031456 | Bacteria | 1099 |
| 589 | Ga0307509_10124545 | 3300031507 | Bacteria | 2547 |
| 590 | Ga0307516_10172946 | 3300031730 | Bacteria | 1899 |
| 591 | Ga0307414_10046741 | 3300032004 | Bacteria | 2974 |
| 592 | Ga0373946_0066109 | 3300035171 | Bacteria | 1550 |
| 593 | Ga0373937_0097898 | 3300036401 | Bacteria | 2721 |
| 594 | Ga0395900_0068807 | 3300037418 | Bacteria | 3638 |
| 595 | Ga0395898_0275009 | 3300037466 | Unclassified | 1606 |
| 596 | Ga0395905_0405082 | 3300037471 | Unclassified | 1259 |
| 597 | Ga0395901_0202023 | 3300038443 | Bacteria | 2083 |
| 598 | Ga0436365_0262267 | 3300039437 | Bacteria | 30470 |
| 599 | Ga0436365_1373625 | 3300039437 | Bacteria | 10587 |
| 600 | Ga0439436_0000111 | 3300041404 | Bacteria | 19019 |
| 601 | Ga0439439_0002871 | 3300041406 | Bacteria | 3732 |
| 602 | Ga0439465_0006736 | 3300041413 | Bacteria | 3648 |
| 603 | Ga0451807_2294192 | 3300041486 | Bacteria | 1034 |
| 604 | Ga0451807_2667275 | 3300041486 | Bacteria | 877 |
| 605 | Ga0439431_0000197 | 3300041997 | Bacteria | 11821 |
| 606 | Ga0439449_0020400 | 3300042007 | Bacteria | 2484 |
| 607 | Ga0439449_0027421 | 3300042007 | Bacteria | 2126 |
| 608 | Ga0439457_002905 | 3300042014 | Bacteria | 4772 |
| 609 | Ga0439457_011412 | 3300042014 | Bacteria | 2022 |
| 610 | Ga0450894_008280 | 3300042131 | Bacteria | 1344 |
| 611 | Ga0451577_0055911 | 3300042876 | Bacteria | 3520 |
| 612 | Ga0451577_0236409 | 3300042876 | Bacteria | 1653 |
| 613 | Ga0466969_0001641 | 3300044656 | Bacteria | 11999 |
| 614 | Ga0466972_0000016 | 3300044658 | Bacteria | 208802 |
| 615 | Ga0466972_0000280 | 3300044658 | Bacteria | 31990 |
| 616 | Ga0466972_0009058 | 3300044658 | Bacteria | 4998 |
| 617 | Ga0466966_0102349 | 3300044684 | Bacteria | 1770 |
| 618 | Ga0453684_0030064 | 3300044712 | Bacteria | 7687 |
| 619 | Ga0453684_0048086 | 3300044712 | Bacteria | 5647 |
| 620 | Ga0466968_0013709 | 3300044735 | Bacteria | 3191 |
| 621 | Ga0466968_0093645 | 3300044735 | Bacteria | 1335 |
| 622 | Ga0466970_0038551 | 3300044765 | Bacteria | 2535 |
| 623 | Ga0466970_0061205 | 3300044765 | Bacteria | 2016 |
| 624 | Ga0466957_0000247 | 3300044842 | Bacteria | 25944 |
| 625 | Ga0466960_0149370 | 3300044901 | Bacteria | 1247 |
| 626 | Ga0466959_0000196 | 3300045049 | Bacteria | 39994 |
| 627 | Ga0495632_0050268 | 3300046519 | Bacteria | 2057 |
| 628 | Ga0495643_0117132 | 3300046522 | Unclassified | 1349 |
| 629 | Ga0495621_0004188 | 3300046539 | Bacteria | 4030 |
| 630 | Ga0495668_0000114 | 3300046616 | Bacteria | 127503 |
| 631 | Ga0495668_0000312 | 3300046616 | Bacteria | 66963 |
| 632 | Ga0495668_0005338 | 3300046616 | Bacteria | 8763 |
| 633 | Ga0495635_0091858 | 3300046663 | Bacteria | 2076 |
| 634 | Ga0495636_0000026 | 3300047318 | Bacteria | 63897 |
| 635 | Ga0495674_0095688 | 3300047319 | Bacteria | 2532 |
| 636 | Ga0495674_0238633 | 3300047319 | Bacteria | 1499 |
| 637 | Ga0495674_0258672 | 3300047319 | Bacteria | 1431 |
| 638 | Ga0495672_0070038 | 3300047320 | Bacteria | 1989 |
| 639 | Ga0495686_0000595 | 3300047472 | Bacteria | 50402 |
| 640 | Ga0495686_0037002 | 3300047472 | Bacteria | 3129 |
| 641 | Ga0496108_0243972 | 3300048911 | Bacteria | 1563 |
| 642 | Ga0496109_0059366 | 3300048912 | Unclassified | 3494 |
| 643 | Ga0496113_0338271 | 3300048916 | Unclassified | 1207 |
| 644 | Ga0496114_0004733 | 3300048917 | Bacteria | 10591 |
| 645 | Ga0496121_0000008 | 3300048924 | Bacteria | 843593 |
| 646 | Ga0501031_0013524 | 3300049568 | Bacteria | 5319 |
| 647 | Ga0501032_0004022 | 3300049569 | Bacteria | 11148 |
| 648 | Ga0501032_0004687 | 3300049569 | Bacteria | 10262 |
| 649 | Ga0501032_0214592 | 3300049569 | Bacteria | 1254 |
| 650 | Ga0501033_0050870 | 3300049570 | Bacteria | 3072 |
| 651 | Ga0501034_0000007 | 3300049571 | Bacteria | 357805 |
| 652 | Ga0501034_0007830 | 3300049571 | Bacteria | 11364 |
| 653 | Ga0501034_0029202 | 3300049571 | Bacteria | 5605 |
| 654 | Ga0501034_0051985 | 3300049571 | Bacteria | 4130 |
| 655 | Ga0501034_0094207 | 3300049571 | Unclassified | 2991 |
| 656 | Ga0501036_0003416 | 3300049572 | Bacteria | 12692 |
| 657 | Ga0501036_0014802 | 3300049572 | Bacteria | 6505 |
| 658 | Ga0501037_0022376 | 3300049573 | Bacteria | 4677 |
| 659 | Ga0501037_0148621 | 3300049573 | Bacteria | 1675 |
| 660 | Ga0501037_0333160 | 3300049573 | Bacteria | 1049 |
| 661 | Ga0501038_0010673 | 3300049574 | Bacteria | 8401 |
| 662 | Ga0501038_0025484 | 3300049574 | Bacteria | 5271 |
| 663 | Ga0501038_0035197 | 3300049574 | Bacteria | 4397 |
| 664 | Ga0501043_0014070 | 3300049579 | Bacteria | 6263 |
| 665 | Ga0501043_0020417 | 3300049579 | Bacteria | 5196 |
| 666 | Ga0501043_0043381 | 3300049579 | Bacteria | 3535 |
| 667 | Ga0501046_0003510 | 3300049580 | Bacteria | 14366 |
| 668 | Ga0501046_0036206 | 3300049580 | Bacteria | 3974 |
| 669 | Ga0501047_0029006 | 3300049581 | Bacteria | 5338 |
| 670 | Ga0501047_0051091 | 3300049581 | Bacteria | 3993 |
| 671 | Ga0501047_0055611 | 3300049581 | Bacteria | 3826 |
| 672 | Ga0501047_0360584 | 3300049581 | Bacteria | 1289 |
| 673 | Ga0501047_0680403 | 3300049581 | Bacteria | 847 |
| 674 | Ga0501048_0472450 | 3300049582 | Unclassified | 899 |
| 675 | Ga0501067_0025268 | 3300049583 | Unclassified | 3292 |
| 676 | Ga0501068_0035423 | 3300049584 | Bacteria | 2979 |
| 677 | Ga0501068_0127984 | 3300049584 | Unclassified | 1587 |
| 678 | Ga0501069_0271516 | 3300049585 | Bacteria | 991 |
| 679 | Ga0501070_0012717 | 3300049586 | Bacteria | 7098 |
| 680 | Ga0501073_0058049 | 3300049589 | Bacteria | 2705 |
| 681 | Ga0501073_0080725 | 3300049589 | Unclassified | 2262 |
| 682 | Ga0501073_0117757 | 3300049589 | Bacteria | 1841 |
| 683 | Ga0501074_0003003 | 3300049590 | Bacteria | 11870 |
| 684 | Ga0501238_009483 | 3300049671 | Bacteria | 1292 |
| 685 | Ga0501242_005381 | 3300049674 | Bacteria | 1439 |
| 686 | Ga0501250_000367 | 3300049680 | Bacteria | 2913 |
| 687 | Ga0501257_024192 | 3300049686 | Bacteria | 1442 |
| 688 | Ga0501225_0000821 | 3300049705 | Bacteria | 9670 |
| 689 | Ga0501079_0054613 | 3300049741 | Unclassified | 3081 |
| 690 | Ga0501079_0133957 | 3300049741 | Bacteria | 1929 |
| 691 | Ga0501080_0252933 | 3300049742 | Unclassified | 1606 |
| 692 | Ga0501083_0001228 | 3300049744 | Bacteria | 17354 |
| 693 | Ga0501083_0036991 | 3300049744 | Bacteria | 3326 |
| 694 | Ga0501269_002728 | 3300049766 | Bacteria | 2156 |
| 695 | Ga0501035_0009147 | 3300049822 | Bacteria | 9212 |
| 696 | Ga0501035_0117132 | 3300049822 | Bacteria | 2331 |
| 697 | Ga0501044_0005300 | 3300049823 | Bacteria | 14338 |
| 698 | Ga0501044_0008422 | 3300049823 | Bacteria | 11308 |
| 699 | Ga0501044_0009756 | 3300049823 | Bacteria | 10444 |
| 700 | Ga0501044_0205022 | 3300049823 | Bacteria | 1929 |
| 701 | Ga0501044_0232454 | 3300049823 | Bacteria | 1791 |
| 702 | Ga0501044_0257031 | 3300049823 | Bacteria | 1686 |
| 703 | nmdc:mga0k408_217689_c1 | 3300050493 | Bacteria | 1140 |
| 704 | nmdc:mga05p37_41996_c1 | 3300050507 | Bacteria | 5617 |
| 705 | nmdc:mga09592_50342_c1 | 3300050508 | Bacteria | 3514 |
| 706 | nmdc:mga09592_88102_c1 | 3300050508 | Bacteria | 2651 |
| 707 | nmdc:mga09592_9212_c1 | 3300050508 | Bacteria | 8030 |
| 708 | nmdc:mga0qj67_21761_c1 | 3300050509 | Bacteria | 4920 |
| 709 | nmdc:mga06r32_28621_c1 | 3300050510 | Bacteria | 5217 |
| 710 | nmdc:mga06r32_44707_c1 | 3300050510 | Bacteria | 4218 |
| 711 | nmdc:mga08y16_126691_c1 | 3300050511 | Bacteria | 2656 |
| 712 | nmdc:mga08y16_31684_c1 | 3300050511 | Bacteria | 5559 |
| 713 | nmdc:mga08y16_39859_c1 | 3300050511 | Bacteria | 4926 |
| 714 | Ga0500644_0000094 | 3300053088 | Bacteria | 55669 |
| 715 | Ga0500644_0084851 | 3300053088 | Bacteria | 1173 |
| 716 | Ga0500646_0010047 | 3300053090 | Bacteria | 2425 |
| 717 | Ga0500583_0000159 | 3300053092 | Bacteria | 27775 |
| 718 | Ga0500641_0054643 | 3300053096 | Bacteria | 1652 |
| 719 | Ga0500556_0009527 | 3300053104 | Bacteria | 2825 |
| 720 | Ga0500562_000051 | 3300053108 | Bacteria | 59249 |
| 721 | Ga0500569_001123 | 3300053109 | Bacteria | 4917 |
| 722 | Ga0500572_072941 | 3300053111 | Bacteria | 1064 |
| 723 | Ga0500607_016731 | 3300053121 | Bacteria | 4196 |
| 724 | Ga0500642_0008937 | 3300053130 | Bacteria | 3454 |
| 725 | Ga0500655_022515 | 3300053133 | Bacteria | 1186 |
| 726 | Ga0500658_0004020 | 3300053134 | Bacteria | 5524 |
| 727 | Ga0500559_0022952 | 3300053136 | Bacteria | 2647 |
| 728 | Ga0500577_0000926 | 3300053142 | Bacteria | 7601 |
| 729 | Ga0500588_0001484 | 3300053146 | Bacteria | 4471 |
| 730 | Ga0500589_047071 | 3300053147 | Bacteria | 2007 |
| 731 | Ga0500589_047371 | 3300053147 | Bacteria | 2001 |
| 732 | Ga0500590_109305 | 3300053148 | Bacteria | 1314 |
| 733 | Ga0500616_0003769 | 3300053153 | Bacteria | 11289 |
| 734 | Ga0500619_076061 | 3300053154 | Bacteria | 1123 |
| 735 | Ga0500622_0000161 | 3300053156 | Bacteria | 70719 |
| 736 | Ga0500633_0003709 | 3300053160 | Bacteria | 3381 |
| 737 | Ga0500636_0032034 | 3300053177 | Bacteria | 3111 |
| 738 | Ga0500636_0045950 | 3300053177 | Bacteria | 2575 |
| 739 | Ga0500645_016932 | 3300053730 | Bacteria | 2290 |
| 740 | Ga0501084_0695299 | 3300054114 | Unclassified | 857 |
| 741 | Ga0501082_0152939 | 3300060353 | Unclassified | 2004 |
| 742 | 2738724691 | 2738541278 | Bacteria | 9755573 |
| 743 | 2819575292 | 2818991442 | Bacteria | 8318214 |
| 744 | 2819590417 | 2818991444 | Bacteria | 6968812 |
| 745 | 2821141392 | 2821136567 | Bacteria | 8080116 |
| 746 | 2840679120 | 2840677318 | Bacteria | 2664183 |
| 747 | 2883070208 | 2883068021 | Bacteria | 6192739 |
| 748 | 2896086932 | 2896085136 | Bacteria | 6129793 |
| 749 | 2896115734 | 2896109856 | Bacteria | 7140722 |
| 750 | 2904471003 | 2904467357 | Bacteria | 8057758 |
| 751 | 2929158546 | 2929154850 | Bacteria | 6753285 |
| 752 | 2929921401 | 2929921140 | Bacteria | 8649150 |
| 753 | 8003157558 | 8003151029 | Bacteria | 8187759 |
| 754 | Ga0500559_0020426 | |||
| 755 | SwRhRL2b_contig_1663468 | |||
| 756 | SwRhRL2b_contig_3813669 | |||
| 757 | JGI24740J21852_10002134 | |||
| 758 | JGI24740J21852_10018449 | |||
| 759 | JGI24739J22299_10009728 | |||
| 760 | JGI24737J22298_10054058 | |||
| 761 | JGI24751J29686_10001433 | |||
| 762 | JGI24751J29686_10028347 | |||
| 763 | JGI25154J39366_1000006 | |||
| 764 | JGI25157J39369_1004371 | |||
| 765 | JGI25153J46596_10005500 | |||
| 766 | JGI25153J46596_10014489 | |||
| 767 | rootH1_10038598 | |||
| 768 | rootH1_10066544 | |||
| 769 | rootH2_10032113 | |||
| 770 | rootH2_10094418 | |||
| 771 | rootH2_10253391 | |||
| 772 | rootL2_10014283 | |||
| 773 | rootL2_10019832 | |||
| 774 | rootL2_10119408 | |||
| 775 | rootL2_10180565 | |||
| 776 | rootL2_10319470 | |||
| 777 | rootH1_10027463 | |||
| 778 | rootH1_10137836 | |||
| 779 | rootH1_10310403 | |||
| 780 | JGI25160J50197_1005758 | |||
| 781 | JGI25160J50197_1010184 | |||
| 782 | JGI25160J50197_1012948 | |||
| 783 | Ga0055542_1004003 | |||
| 784 | Ga0055526_1010659 | |||
| 785 | Ga0055528_1000077 | |||
| 786 | Ga0055530_10002824 | |||
| 787 | Ga0055531_10000005 | |||
| 788 | Ga0055531_10024937 | |||
| 789 | Ga0065165_1000042 | |||
| 790 | Ga0065165_1011865 | |||
| 791 | Ga0065714_10087840 | |||
| 792 | Ga0065704_10070133 | |||
| 793 | Ga0065704_10077708 | |||
| 794 | Ga0065712_10074422 | |||
| 795 | Ga0065712_10175767 | |||
| 796 | Ga0065712_10198684 | |||
| 797 | Ga0065715_10006633 | |||
| 798 | Ga0065707_10405757 | |||
| 799 | Ga0070658_10000515 | |||
| 800 | Ga0070658_10005427 | |||
| 801 | Ga0070658_10472927 | |||
| 802 | Ga0070658_10648437 | |||
| 803 | Ga0070676_10000341 | |||
| 804 | Ga0070676_10026193 | |||
| 805 | Ga0070676_10185212 | |||
| 806 | Ga0070683_100070766 | |||
| 807 | Ga0070690_100230224 | |||
| 808 | Ga0070670_100011332 | |||
| 809 | Ga0070670_100015247 | |||
| 810 | Ga0070670_100063043 | |||
| 811 | Ga0070670_100166167 | |||
| 812 | Ga0070670_100227187 | |||
| 813 | Ga0070670_100257085 | |||
| 814 | Ga0070670_100726849 | |||
| 815 | Ga0070677_10013665 | |||
| 816 | Ga0068869_100006045 | |||
| 817 | Ga0068869_100018070 | |||
| 818 | Ga0068869_100088707 | |||
| 819 | Ga0068869_100215495 | |||
| 820 | Ga0068869_100326658 | |||
| 821 | Ga0068869_100391470 | |||
| 822 | Ga0070666_10000172 | |||
| 823 | Ga0070666_10000185 | |||
| 824 | Ga0070666_10163481 | |||
| 825 | Ga0070666_10293408 | |||
| 826 | Ga0070680_100001877 | |||
| 827 | Ga0070682_100000259 | |||
| 828 | Ga0070682_100002348 | |||
| 829 | Ga0068868_100001522 | |||
| 830 | Ga0068868_100330141 | |||
| 831 | Ga0070660_100052435 | |||
| 832 | Ga0070689_100013704 | |||
| 833 | Ga0070689_100103172 | |||
| 834 | Ga0070689_100215127 | |||
| 835 | Ga0070691_10000875 | |||
| 836 | Ga0070687_100081113 | |||
| 837 | Ga0070661_100071198 | |||
| 838 | Ga0070692_10019052 | |||
| 839 | Ga0070668_100000169 | |||
| 840 | Ga0070668_100035392 | |||
| 841 | Ga0070668_100067980 | |||
| 842 | Ga0070668_100299370 | |||
| 843 | Ga0070669_100002549 | |||
| 844 | Ga0070669_100329052 | |||
| 845 | Ga0070675_100004810 | |||
| 846 | Ga0070675_100019684 | |||
| 847 | Ga0070675_100027677 | |||
| 848 | Ga0070671_100007849 | |||
| 849 | Ga0070671_100022580 | |||
| 850 | Ga0070671_100037901 | |||
| 851 | Ga0070671_100343410 | |||
| 852 | Ga0070671_100350488 | |||
| 853 | Ga0070671_100448603 | |||
| 854 | Ga0070671_100621612 | |||
| 855 | Ga0070673_100000813 | |||
| 856 | Ga0070673_100003572 | |||
| 857 | Ga0070673_100029120 | |||
| 858 | Ga0070673_100514598 | |||
| 859 | Ga0070688_100007036 | |||
| 860 | Ga0070688_100016843 | |||
| 861 | Ga0070688_100027353 | |||
| 862 | Ga0070688_100219473 | |||
| 863 | Ga0070688_100224516 | |||
| 864 | Ga0070659_100003003 | |||
| 865 | Ga0070659_100299513 | |||
| 866 | Ga0070667_100000553 | |||
| 867 | Ga0070667_100002163 | |||
| 868 | Ga0070667_100003932 | |||
| 869 | Ga0070667_100011960 | |||
| 870 | Ga0070667_100042562 | |||
| 871 | Ga0070700_100037548 | |||
| 872 | Ga0070663_100018961 | |||
| 873 | Ga0070663_100465514 | |||
| 874 | Ga0070663_100551384 | |||
| 875 | Ga0070678_100048144 | |||
| 876 | Ga0070678_100057436 | |||
| 877 | Ga0070678_100334582 | |||
| 878 | Ga0070678_100404682 | |||
| 879 | Ga0070662_100002884 | |||
| 880 | Ga0070681_10014936 | |||
| 881 | Ga0070681_10057796 | |||
| 882 | Ga0070681_10356665 | |||
| 883 | Ga0068867_100001171 | |||
| 884 | Ga0068867_100016028 | |||
| 885 | Ga0068867_100020227 | |||
| 886 | Ga0068867_100031203 | |||
| 887 | Ga0068867_100252856 | |||
| 888 | Ga0068867_100522800 | |||
| 889 | Ga0070685_10003193 | |||
| 890 | Ga0070685_10012670 | |||
| 891 | Ga0070685_10069633 | |||
| 892 | Ga0070698_100001684 | |||
| 893 | Ga0070698_100084673 | |||
| 894 | Ga0070699_100206464 | |||
| 895 | Ga0070679_100002688 | |||
| 896 | Ga0070679_100220775 | |||
| 897 | Ga0070679_100244734 | |||
| 898 | Ga0068853_100000272 | |||
| 899 | Ga0068853_100047923 | |||
| 900 | Ga0068853_100372051 | |||
| 901 | Ga0068853_100377660 | |||
| 902 | Ga0070672_100000061 | |||
| 903 | Ga0070672_100066056 | |||
| 904 | Ga0070672_100134964 | |||
| 905 | Ga0070672_100246378 | |||
| 906 | Ga0070672_100289545 | |||
| 907 | Ga0070665_100000612 | |||
| 908 | Ga0070665_100008108 | |||
| 909 | Ga0070665_100177167 | |||
| 910 | Ga0070665_100396854 | |||
| 911 | Ga0068855_100003883 | |||
| 912 | Ga0068855_100016351 | |||
| 913 | Ga0068855_100110959 | |||
| 914 | Ga0068855_100137468 | |||
| 915 | Ga0068855_100277230 | |||
| 916 | Ga0070664_100009965 | |||
| 917 | Ga0070664_100042674 | |||
| 918 | Ga0070664_100139449 | |||
| 919 | Ga0068857_100007129 | |||
| 920 | Ga0068857_100104068 | |||
| 921 | Ga0068857_100494269 | |||
| 922 | Ga0068857_100661929 | |||
| 923 | Ga0068854_100013145 | |||
| 924 | Ga0068854_100071501 | |||
| 925 | Ga0068856_100034665 | |||
| 926 | Ga0068856_100068876 | |||
| 927 | Ga0070702_100019944 | |||
| 928 | Ga0068852_100000787 | |||
| 929 | Ga0068852_100008187 | |||
| 930 | Ga0068852_100047286 | |||
| 931 | Ga0068852_100086895 | |||
| 932 | Ga0068852_100457813 | |||
| 933 | Ga0068852_100612956 | |||
| 934 | Ga0068859_100000013 | |||
| 935 | Ga0068859_100028460 | |||
| 936 | Ga0068859_100041010 | |||
| 937 | Ga0068859_100047799 | |||
| 938 | Ga0068859_100052217 | |||
| 939 | Ga0068859_100090425 | |||
| 940 | Ga0068859_100095284 | |||
| 941 | Ga0068859_100185090 | |||
| 942 | Ga0068864_100004846 | |||
| 943 | Ga0068864_100014384 | |||
| 944 | Ga0068864_100029845 | |||
| 945 | Ga0068864_100062003 | |||
| 946 | Ga0068864_100079933 | |||
| 947 | Ga0068864_100082789 | |||
| 948 | Ga0068866_10053858 | |||
| 949 | Ga0068861_100076877 | |||
| 950 | Ga0068861_100091750 | |||
| 951 | Ga0068851_10001728 | |||
| 952 | Ga0068851_10036515 | |||
| 953 | Ga0068851_10051254 | |||
| 954 | Ga0068851_10138654 | |||
| 955 | Ga0068870_10004264 | |||
| 956 | Ga0068870_10038156 | |||
| 957 | Ga0068870_10207759 | |||
| 958 | Ga0068863_100001273 | |||
| 959 | Ga0068863_100015573 | |||
| 960 | Ga0068863_100021719 | |||
| 961 | Ga0068863_100021933 | |||
| 962 | Ga0068863_100027233 | |||
| 963 | Ga0068863_100296048 | |||
| 964 | Ga0068863_100604925 | |||
| 965 | Ga0068858_100000930 | |||
| 966 | Ga0068858_100014471 | |||
| 967 | Ga0068858_100819832 | |||
| 968 | Ga0068860_100000443 | |||
| 969 | Ga0068860_100000591 | |||
| 970 | Ga0068860_100005524 | |||
| 971 | Ga0068860_100029363 | |||
| 972 | Ga0068860_100052013 | |||
| 973 | Ga0068860_100155219 | |||
| 974 | Ga0068862_100001278 | |||
| 975 | Ga0068862_100002721 | |||
| 976 | Ga0068862_100108492 | |||
| 977 | Ga0068862_100187645 | |||
| 978 | Ga0068862_100278398 | |||
| 979 | Ga0068862_100403206 | |||
| 980 | Ga0068862_100480724 | |||
| 981 | Ga0075366_10010141 | |||
| 982 | Ga0075366_10146725 | |||
| 983 | Ga0097621_100000531 | |||
| 984 | Ga0097621_100000821 | |||
| 985 | Ga0097621_100004954 | |||
| 986 | Ga0097621_100011962 | |||
| 987 | Ga0097621_100046435 | |||
| 988 | Ga0097621_100291543 | |||
| 989 | Ga0097621_100388892 | |||
| 990 | Ga0068871_100001554 | |||
| 991 | Ga0068871_100002710 | |||
| 992 | Ga0068871_100016561 | |||
| 993 | Ga0068871_100075852 | |||
| 994 | Ga0075428_100143572 | |||
| 995 | Ga0075428_100960321 | |||
| 996 | Ga0075430_100007849 | |||
| 997 | Ga0075431_100005370 | |||
| 998 | Ga0075431_100414130 | |||
| 999 | Ga0075429_100019843 | |||
| 1000 | Ga0075429_100051926 | |||
| 1001 | Ga0068865_100003524 | |||
| 1002 | Ga0068865_100047931 | |||
| 1003 | Ga0068865_100336596 | |||
| 1004 | Ga0068865_100364145 | |||
| 1005 | Ga0097620_100000013 | |||
| 1006 | Ga0097620_100028459 | |||
| 1007 | Ga0097620_100041010 | |||
| 1008 | Ga0097620_100047801 | |||
| 1009 | Ga0097620_100052221 | |||
| 1010 | Ga0097620_100090425 | |||
| 1011 | Ga0097620_100095283 | |||
| 1012 | Ga0097620_100185076 | |||
| 1013 | Ga0105240_10000020 | |||
| 1014 | Ga0105240_10038515 | |||
| 1015 | Ga0105240_10048639 | |||
| 1016 | Ga0105240_10050783 | |||
| 1017 | Ga0105240_10060139 | |||
| 1018 | Ga0105240_10239040 | |||
| 1019 | Ga0111539_10004662 | |||
| 1020 | Ga0111539_10174473 | |||
| 1021 | Ga0111539_10199038 | |||
| 1022 | Ga0111539_10694191 | |||
| 1023 | Ga0111539_10823758 | |||
| 1024 | Ga0105245_10127548 | |||
| 1025 | Ga0105245_10179891 | |||
| 1026 | Ga0105247_10022723 | |||
| 1027 | Ga0105247_10027512 | |||
| 1028 | Ga0105247_10046132 | |||
| 1029 | Ga0114129_10052463 | |||
| 1030 | Ga0105243_10106734 | |||
| 1031 | Ga0105241_10000686 | |||
| 1032 | Ga0105241_10009515 | |||
| 1033 | Ga0105241_10091344 | |||
| 1034 | Ga0105242_10059707 | |||
| 1035 | Ga0105248_10014203 | |||
| 1036 | Ga0105248_10016765 | |||
| 1037 | Ga0105237_10004476 | |||
| 1038 | Ga0105237_10025289 | |||
| 1039 | Ga0105238_10122640 | |||
| 1040 | Ga0105249_10001226 | |||
| 1041 | Ga0105249_10002749 | |||
| 1042 | Ga0105249_10003197 | |||
| 1043 | Ga0105249_10006427 | |||
| 1044 | Ga0105249_10085379 | |||
| 1045 | Ga0105249_10173838 | |||
| 1046 | Ga0105249_10448012 | |||
| 1047 | Ga0105239_10000631 | |||
| 1048 | Ga0105239_10010893 | |||
| 1049 | Ga0105239_10023189 | |||
| 1050 | Ga0105239_10153260 | |||
| 1051 | Ga0105239_10389660 | |||
| 1052 | Ga0105246_10016419 | |||
| 1053 | Ga0105246_10059288 | |||
| 1054 | Ga0157373_10090369 | |||
| 1055 | Ga0157371_10036269 | |||
| 1056 | Ga0157371_10110099 | |||
| 1057 | Ga0157370_10003149 | |||
| 1058 | Ga0157370_10003666 | |||
| 1059 | Ga0157370_10276782 | |||
| 1060 | Ga0157370_10350688 | |||
| 1061 | Ga0157369_10021680 | |||
| 1062 | Ga0157369_10024505 | |||
| 1063 | Ga0157369_10297725 | |||
| 1064 | Ga0157374_10002119 | |||
| 1065 | Ga0157374_10184301 | |||
| 1066 | Ga0157378_10007403 | |||
| 1067 | Ga0157378_10028471 | |||
| 1068 | Ga0157378_10039607 | |||
| 1069 | Ga0157378_10044580 | |||
| 1070 | Ga0157378_10070013 | |||
| 1071 | Ga0157378_10077863 | |||
| 1072 | Ga0157378_10095523 | |||
| 1073 | Ga0157378_10147947 | |||
| 1074 | Ga0157378_10204847 | |||
| 1075 | Ga0163162_10000752 | |||
| 1076 | Ga0163162_10000931 | |||
| 1077 | Ga0163162_10001214 | |||
| 1078 | Ga0163162_10002506 | |||
| 1079 | Ga0163162_10003220 | |||
| 1080 | Ga0163162_10009367 | |||
| 1081 | Ga0163162_10012998 | |||
| 1082 | Ga0163162_10031439 | |||
| 1083 | Ga0163162_10052834 | |||
| 1084 | Ga0163162_10109057 | |||
| 1085 | Ga0163162_10132165 | |||
| 1086 | Ga0163162_10164252 | |||
| 1087 | Ga0163162_10695331 | |||
| 1088 | Ga0157372_10001914 | |||
| 1089 | Ga0157372_10006438 | |||
| 1090 | Ga0157372_10055213 | |||
| 1091 | Ga0157372_10074901 | |||
| 1092 | Ga0157372_10083103 | |||
| 1093 | Ga0157372_10095723 | |||
| 1094 | Ga0157372_10145310 | |||
| 1095 | Ga0157372_10151256 | |||
| 1096 | Ga0157372_10173548 | |||
| 1097 | Ga0157372_10195474 | |||
| 1098 | Ga0157372_10379645 | |||
| 1099 | Ga0157372_10428392 | |||
| 1100 | Ga0157372_10516102 | |||
| 1101 | Ga0157372_10588569 | |||
| 1102 | Ga0157375_10000098 | |||
| 1103 | Ga0157375_10001055 | |||
| 1104 | Ga0157375_10020946 | |||
| 1105 | Ga0157375_10028942 | |||
| 1106 | Ga0157375_10042760 | |||
| 1107 | Ga0157375_10135361 | |||
| 1108 | Ga0157375_10234186 | |||
| 1109 | Ga0157375_10363596 | |||
| 1110 | Ga0157375_10985028 | |||
| 1111 | Ga0163163_10000272 | |||
| 1112 | Ga0163163_10000888 | |||
| 1113 | Ga0163163_10013960 | |||
| 1114 | Ga0163163_10072762 | |||
| 1115 | Ga0163163_10411207 | |||
| 1116 | Ga0163163_10500357 | |||
| 1117 | Ga0163163_10505951 | |||
| 1118 | Ga0157380_10005493 | |||
| 1119 | Ga0157380_10017785 | |||
| 1120 | Ga0157380_10063918 | |||
| 1121 | Ga0157380_10196875 | |||
| 1122 | Ga0157380_10201079 | |||
| 1123 | Ga0157377_10000659 | |||
| 1124 | Ga0157379_10000103 | |||
| 1125 | Ga0157379_10011365 | |||
| 1126 | Ga0157379_10185046 | |||
| 1127 | Ga0157379_10313229 | |||
| 1128 | Ga0157376_10000484 | |||
| 1129 | Ga0157376_10002103 | |||
| 1130 | Ga0157376_10014571 | |||
| 1131 | Ga0157376_10047458 | |||
| 1132 | Ga0157376_10058583 | |||
| 1133 | Ga0157376_10294773 | |||
| 1134 | Ga0182005_1000017 | |||
| 1135 | Ga0163161_10008445 | |||
| 1136 | Ga0163161_10011545 | |||
| 1137 | Ga0163161_10102585 | |||
| 1138 | Ga0163161_10275346 | |||
| 1139 | Ga0213876_10003307 | |||
| 1140 | Ga0213876_10076218 | |||
| 1141 | Ga0209436_108355 | |||
| 1142 | Ga0209258_100029 | |||
| 1143 | Ga0209646_1000031 | |||
| 1144 | Ga0209026_1000019 | |||
| 1145 | Ga0209148_1000089 | |||
| 1146 | Ga0207666_1007724 | |||
| 1147 | Ga0209673_1000113 | |||
| 1148 | Ga0209564_1008803 | |||
| 1149 | Ga0209758_1006508 | |||
| 1150 | Ga0209758_1011612 | |||
| 1151 | Ga0209758_1014394 | |||
| 1152 | Ga0209050_1000185 | |||
| 1153 | Ga0207426_1000026 | |||
| 1154 | Ga0207426_1000263 | |||
| 1155 | Ga0207426_1001392 | |||
| 1156 | Ga0209051_1036469 | |||
| 1157 | Ga0209257_1000004 | |||
| 1158 | Ga0209257_1000257 | |||
| 1159 | Ga0207656_10001251 | |||
| 1160 | Ga0207642_10097883 | |||
| 1161 | Ga0207710_10011276 | |||
| 1162 | Ga0207688_10023048 | |||
| 1163 | Ga0207688_10254065 | |||
| 1164 | Ga0207680_10000083 | |||
| 1165 | Ga0207680_10001345 | |||
| 1166 | Ga0207680_10517955 | |||
| 1167 | Ga0207647_10000050 | |||
| 1168 | Ga0207647_10000824 | |||
| 1169 | Ga0207647_10091077 | |||
| 1170 | Ga0207647_10286827 | |||
| 1171 | Ga0207685_10006469 | |||
| 1172 | Ga0207645_10000793 | |||
| 1173 | Ga0207645_10008445 | |||
| 1174 | Ga0207645_10015568 | |||
| 1175 | Ga0207645_10021983 | |||
| 1176 | Ga0207645_10036615 | |||
| 1177 | Ga0207643_10004365 | |||
| 1178 | Ga0207705_10005062 | |||
| 1179 | Ga0207705_10017322 | |||
| 1180 | Ga0207705_10163510 | |||
| 1181 | Ga0207705_10214304 | |||
| 1182 | Ga0207654_10002274 | |||
| 1183 | Ga0207654_10021156 | |||
| 1184 | Ga0207707_10000160 | |||
| 1185 | Ga0207707_10085211 | |||
| 1186 | Ga0207695_10000020 | |||
| 1187 | Ga0207695_10002404 | |||
| 1188 | Ga0207695_10009558 | |||
| 1189 | Ga0207695_10169883 | |||
| 1190 | Ga0207671_10000025 | |||
| 1191 | Ga0207671_10001991 | |||
| 1192 | Ga0207671_10023773 | |||
| 1193 | Ga0207660_10048464 | |||
| 1194 | Ga0207662_10139080 | |||
| 1195 | Ga0207657_10030556 | |||
| 1196 | Ga0207657_10124095 | |||
| 1197 | Ga0207649_10020444 | |||
| 1198 | Ga0207652_10001880 | |||
| 1199 | Ga0207646_10025366 | |||
| 1200 | Ga0207681_10066965 | |||
| 1201 | Ga0207681_10075399 | |||
| 1202 | Ga0207681_10196688 | |||
| 1203 | Ga0207650_10000562 | |||
| 1204 | Ga0207650_10058657 | |||
| 1205 | Ga0207650_10380939 | |||
| 1206 | Ga0207659_10012376 | |||
| 1207 | Ga0207659_10029121 | |||
| 1208 | Ga0207659_10030626 | |||
| 1209 | Ga0207644_10040917 | |||
| 1210 | Ga0207644_10175389 | |||
| 1211 | Ga0207644_10191172 | |||
| 1212 | Ga0207690_10068711 | |||
| 1213 | Ga0207706_10006661 | |||
| 1214 | Ga0207706_10036362 | |||
| 1215 | Ga0207686_10000498 | |||
| 1216 | Ga0207670_10042309 | |||
| 1217 | Ga0207670_10183435 | |||
| 1218 | Ga0207670_10197247 | |||
| 1219 | Ga0207670_10249889 | |||
| 1220 | Ga0207704_10004460 | |||
| 1221 | Ga0207704_10007802 | |||
| 1222 | Ga0207704_10047803 | |||
| 1223 | Ga0207704_10112702 | |||
| 1224 | Ga0207704_10282893 | |||
| 1225 | Ga0207704_10626890 | |||
| 1226 | Ga0207691_10000154 | |||
| 1227 | Ga0207691_10006412 | |||
| 1228 | Ga0207691_10011687 | |||
| 1229 | Ga0207691_10014404 | |||
| 1230 | Ga0207691_10183619 | |||
| 1231 | Ga0207691_10504664 | |||
| 1232 | Ga0207711_10170821 | |||
| 1233 | Ga0207711_10213139 | |||
| 1234 | Ga0207689_10006246 | |||
| 1235 | Ga0207689_10009576 | |||
| 1236 | Ga0207689_10029427 | |||
| 1237 | Ga0207689_10043843 | |||
| 1238 | Ga0207689_10045161 | |||
| 1239 | Ga0207689_10053634 | |||
| 1240 | Ga0207689_10084762 | |||
| 1241 | Ga0207689_10172962 | |||
| 1242 | Ga0207661_10164742 | |||
| 1243 | Ga0207661_10185926 | |||
| 1244 | Ga0207661_10312518 | |||
| 1245 | Ga0207679_10008672 | |||
| 1246 | Ga0207679_10120701 | |||
| 1247 | Ga0207679_10215503 | |||
| 1248 | Ga0207667_10002576 | |||
| 1249 | Ga0207667_10009791 | |||
| 1250 | Ga0207667_10031890 | |||
| 1251 | Ga0207667_10102839 | |||
| 1252 | Ga0207651_10002520 | |||
| 1253 | Ga0207651_10006411 | |||
| 1254 | Ga0207651_10475106 | |||
| 1255 | Ga0207712_10001312 | |||
| 1256 | Ga0207712_10001788 | |||
| 1257 | Ga0207712_10001935 | |||
| 1258 | Ga0207712_10028489 | |||
| 1259 | Ga0207712_10124567 | |||
| 1260 | Ga0207668_10001109 | |||
| 1261 | Ga0207668_10028706 | |||
| 1262 | Ga0207668_10059509 | |||
| 1263 | Ga0207668_10197003 | |||
| 1264 | Ga0207640_10024352 | |||
| 1265 | Ga0207640_10439909 | |||
| 1266 | Ga0207658_10001366 | |||
| 1267 | Ga0207658_10013336 | |||
| 1268 | Ga0207658_10023762 | |||
| 1269 | Ga0207677_10000862 | |||
| 1270 | Ga0207677_10020413 | |||
| 1271 | Ga0207677_10031797 | |||
| 1272 | Ga0207703_10000883 | |||
| 1273 | Ga0207703_10002119 | |||
| 1274 | Ga0207703_10171225 | |||
| 1275 | Ga0207639_10001017 | |||
| 1276 | Ga0207639_10029612 | |||
| 1277 | Ga0207639_10085753 | |||
| 1278 | Ga0207639_10127810 | |||
| 1279 | Ga0207639_10490443 | |||
| 1280 | Ga0207678_10019079 | |||
| 1281 | Ga0207678_10101700 | |||
| 1282 | Ga0207708_10309440 | |||
| 1283 | Ga0207702_10196693 | |||
| 1284 | Ga0207702_10211179 | |||
| 1285 | Ga0207641_10000159 | |||
| 1286 | Ga0207641_10000467 | |||
| 1287 | Ga0207641_10006669 | |||
| 1288 | Ga0207641_10015293 | |||
| 1289 | Ga0207641_10034813 | |||
| 1290 | Ga0207641_10045765 | |||
| 1291 | Ga0207641_10247688 | |||
| 1292 | Ga0207641_10445119 | |||
| 1293 | Ga0207648_10006104 | |||
| 1294 | Ga0207648_10009539 | |||
| 1295 | Ga0207648_10031304 | |||
| 1296 | Ga0207648_10042198 | |||
| 1297 | Ga0207648_10114813 | |||
| 1298 | Ga0207676_10003634 | |||
| 1299 | Ga0207676_10017905 | |||
| 1300 | Ga0207676_10051548 | |||
| 1301 | Ga0207676_10131650 | |||
| 1302 | Ga0207676_10319895 | |||
| 1303 | Ga0207674_10003180 | |||
| 1304 | Ga0207674_10138551 | |||
| 1305 | Ga0207674_10296442 | |||
| 1306 | Ga0207674_10322908 | |||
| 1307 | Ga0207674_10395713 | |||
| 1308 | Ga0207675_100000299 | |||
| 1309 | Ga0207675_100087826 | |||
| 1310 | Ga0207675_100243328 | |||
| 1311 | Ga0207675_100288481 | |||
| 1312 | Ga0207683_10155017 | |||
| 1313 | Ga0207683_10372064 | |||
| 1314 | Ga0207698_10007436 | |||
| 1315 | Ga0207698_10013839 | |||
| 1316 | Ga0207698_10111803 | |||
| 1317 | Ga0207698_10181167 | |||
| 1318 | Ga0207698_10258072 | |||
| 1319 | Ga0268266_10003931 | |||
| 1320 | Ga0268266_10015510 | |||
| 1321 | Ga0268266_10321214 | |||
| 1322 | Ga0268265_10035362 | |||
| 1323 | Ga0268265_10157914 | |||
| 1324 | Ga0268265_10241940 | |||
| 1325 | Ga0268265_10280983 | |||
| 1326 | Ga0268265_10427027 | |||
| 1327 | Ga0268265_10701788 | |||
| 1328 | Ga0268264_10000507 | |||
| 1329 | Ga0268264_10001126 | |||
| 1330 | Ga0268264_10004873 | |||
| 1331 | Ga0268264_10006450 | |||
| 1332 | Ga0268264_10020330 | |||
| 1333 | Ga0268264_10056847 | |||
| 1334 | Ga0268264_10104551 | |||
| 1335 | Ga0268264_10347698 | |||
| 1336 | Ga0307515_10000001 | |||
| 1337 | Ga0265327_10000013 | |||
| 1338 | Ga0265327_10000254 | |||
| 1339 | Ga0265327_10000338 | |||
| 1340 | Ga0307513_10169854 | |||
| 1341 | Ga0307513_10404499 | |||
| 1342 | Ga0307509_10124545 | |||
| 1343 | Ga0307516_10172946 | |||
| 1344 | Ga0307414_10046741 | |||
| 1345 | Ga0373946_0066109 | |||
| 1346 | Ga0373937_0097898 | |||
| 1347 | Ga0395900_0068807 | |||
| 1348 | Ga0395898_0275009 | |||
| 1349 | Ga0395905_0405082 | |||
| 1350 | Ga0395901_0202023 | |||
| 1351 | Ga0436365_0262267 | |||
| 1352 | Ga0436365_1373625 | |||
| 1353 | Ga0439436_0000111 | |||
| 1354 | Ga0439439_0002871 | |||
| 1355 | Ga0439465_0006736 | |||
| 1356 | Ga0451807_2294192 | |||
| 1357 | Ga0451807_2667275 | |||
| 1358 | Ga0439431_0000197 | |||
| 1359 | Ga0439449_0020400 | |||
| 1360 | Ga0439449_0027421 | |||
| 1361 | Ga0439457_002905 | |||
| 1362 | Ga0439457_011412 | |||
| 1363 | Ga0450894_008280 | |||
| 1364 | Ga0451577_0055911 | |||
| 1365 | Ga0451577_0236409 | |||
| 1366 | Ga0466969_0001641 | |||
| 1367 | Ga0466972_0000016 | |||
| 1368 | Ga0466972_0000280 | |||
| 1369 | Ga0466972_0009058 | |||
| 1370 | Ga0466966_0102349 | |||
| 1371 | Ga0453684_0030064 | |||
| 1372 | Ga0453684_0048086 | |||
| 1373 | Ga0466968_0013709 | |||
| 1374 | Ga0466968_0093645 | |||
| 1375 | Ga0466970_0038551 | |||
| 1376 | Ga0466970_0061205 | |||
| 1377 | Ga0466957_0000247 | |||
| 1378 | Ga0466960_0149370 | |||
| 1379 | Ga0466959_0000196 | |||
| 1380 | Ga0495632_0050268 | |||
| 1381 | Ga0495643_0117132 | |||
| 1382 | Ga0495621_0004188 | |||
| 1383 | Ga0495668_0000114 | |||
| 1384 | Ga0495668_0000312 | |||
| 1385 | Ga0495668_0005338 | |||
| 1386 | Ga0495635_0091858 | |||
| 1387 | Ga0495636_0000026 | |||
| 1388 | Ga0495674_0095688 | |||
| 1389 | Ga0495674_0238633 | |||
| 1390 | Ga0495674_0258672 | |||
| 1391 | Ga0495672_0070038 | |||
| 1392 | Ga0495686_0000595 | |||
| 1393 | Ga0495686_0037002 | |||
| 1394 | Ga0496108_0243972 | |||
| 1395 | Ga0496109_0059366 | |||
| 1396 | Ga0496113_0338271 | |||
| 1397 | Ga0496114_0004733 | |||
| 1398 | Ga0496121_0000008 | |||
| 1399 | Ga0501031_0013524 | |||
| 1400 | Ga0501032_0004022 | |||
| 1401 | Ga0501032_0004687 | |||
| 1402 | Ga0501032_0214592 | |||
| 1403 | Ga0501033_0050870 | |||
| 1404 | Ga0501034_0000007 | |||
| 1405 | Ga0501034_0007830 | |||
| 1406 | Ga0501034_0029202 | |||
| 1407 | Ga0501034_0051985 | |||
| 1408 | Ga0501034_0094207 | |||
| 1409 | Ga0501036_0003416 | |||
| 1410 | Ga0501036_0014802 | |||
| 1411 | Ga0501037_0022376 | |||
| 1412 | Ga0501037_0148621 | |||
| 1413 | Ga0501037_0333160 | |||
| 1414 | Ga0501038_0010673 | |||
| 1415 | Ga0501038_0025484 | |||
| 1416 | Ga0501038_0035197 | |||
| 1417 | Ga0501043_0014070 | |||
| 1418 | Ga0501043_0020417 | |||
| 1419 | Ga0501043_0043381 | |||
| 1420 | Ga0501046_0003510 | |||
| 1421 | Ga0501046_0036206 | |||
| 1422 | Ga0501047_0029006 | |||
| 1423 | Ga0501047_0051091 | |||
| 1424 | Ga0501047_0055611 | |||
| 1425 | Ga0501047_0360584 | |||
| 1426 | Ga0501047_0680403 | |||
| 1427 | Ga0501048_0472450 | |||
| 1428 | Ga0501067_0025268 | |||
| 1429 | Ga0501068_0035423 | |||
| 1430 | Ga0501068_0127984 | |||
| 1431 | Ga0501069_0271516 | |||
| 1432 | Ga0501070_0012717 | |||
| 1433 | Ga0501073_0058049 | |||
| 1434 | Ga0501073_0080725 | |||
| 1435 | Ga0501073_0117757 | |||
| 1436 | Ga0501074_0003003 | |||
| 1437 | Ga0501238_009483 | |||
| 1438 | Ga0501242_005381 | |||
| 1439 | Ga0501250_000367 | |||
| 1440 | Ga0501257_024192 | |||
| 1441 | Ga0501225_0000821 | |||
| 1442 | Ga0501079_0054613 | |||
| 1443 | Ga0501079_0133957 | |||
| 1444 | Ga0501080_0252933 | |||
| 1445 | Ga0501083_0001228 | |||
| 1446 | Ga0501083_0036991 | |||
| 1447 | Ga0501269_002728 | |||
| 1448 | Ga0501035_0009147 | |||
| 1449 | Ga0501035_0117132 | |||
| 1450 | Ga0501044_0005300 | |||
| 1451 | Ga0501044_0008422 | |||
| 1452 | Ga0501044_0009756 | |||
| 1453 | Ga0501044_0205022 | |||
| 1454 | Ga0501044_0232454 | |||
| 1455 | Ga0501044_0257031 | |||
| 1456 | nmdc:mga0k408_217689_c1 | |||
| 1457 | nmdc:mga05p37_41996_c1 | |||
| 1458 | nmdc:mga09592_50342_c1 | |||
| 1459 | nmdc:mga09592_88102_c1 | |||
| 1460 | nmdc:mga09592_9212_c1 | |||
| 1461 | nmdc:mga0qj67_21761_c1 | |||
| 1462 | nmdc:mga06r32_28621_c1 | |||
| 1463 | nmdc:mga06r32_44707_c1 | |||
| 1464 | nmdc:mga08y16_126691_c1 | |||
| 1465 | nmdc:mga08y16_31684_c1 | |||
| 1466 | nmdc:mga08y16_39859_c1 | |||
| 1467 | Ga0500644_0000094 | |||
| 1468 | Ga0500644_0084851 | |||
| 1469 | Ga0500646_0010047 | |||
| 1470 | Ga0500583_0000159 | |||
| 1471 | Ga0500641_0054643 | |||
| 1472 | Ga0500556_0009527 | |||
| 1473 | Ga0500562_000051 | |||
| 1474 | Ga0500569_001123 | |||
| 1475 | Ga0500572_072941 | |||
| 1476 | Ga0500607_016731 | |||
| 1477 | Ga0500642_0008937 | |||
| 1478 | Ga0500655_022515 | |||
| 1479 | Ga0500658_0004020 | |||
| 1480 | Ga0500559_0022952 | |||
| 1481 | Ga0500577_0000926 | |||
| 1482 | Ga0500588_0001484 | |||
| 1483 | Ga0500589_047071 | |||
| 1484 | Ga0500589_047371 | |||
| 1485 | Ga0500590_109305 | |||
| 1486 | Ga0500616_0003769 | |||
| 1487 | Ga0500619_076061 | |||
| 1488 | Ga0500622_0000161 | |||
| 1489 | Ga0500633_0003709 | |||
| 1490 | Ga0500636_0032034 | |||
| 1491 | Ga0500636_0045950 | |||
| 1492 | Ga0500645_016932 | |||
| 1493 | Ga0501084_0695299 | |||
| 1494 | Ga0501082_0152939 | |||
| 1495 | 2738724691 | |||
| 1496 | 2819575292 | |||
| 1497 | 2819590417 | |||
| 1498 | 2821141392 | |||
| 1499 | 2840679120 | |||
| 1500 | 2883070208 | |||
| 1501 | 2896086932 | |||
| 1502 | 2896115734 | |||
| 1503 | 2904471003 | |||
| 1504 | 2929158546 | |||
| 1505 | 2929921401 | |||
| 1506 | 8003157558 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy