F479244
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 754 | 394 | 754 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100021230|Ga0070711_1000212302 |
| Length | 187 |
| Sequence | LLRCNHTFDCSAAALAAAFDIRQQDPNALAMNKIPMTAEGFNRLREELKRLKTVDRPAIIRAIADARDHGDLAENAEYHAARDRQSFIEGRVAELEDKVARAEVIDVSKLSGSVIKFGAKVTLADEETDEEQTFQIVGEDEADIASGRLSVTSPLARALIGKGKGDSVEVTTPRGAKSYEVVTVAFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 128 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 149 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 158 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 161 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 242 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 245 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 258 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 259 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 280 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 281 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 282 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 283 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 284 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 285 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 286 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 287 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 288 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 289 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 290 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 291 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 292 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 293 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 294 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 295 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 296 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 297 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 298 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 299 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 300 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 301 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 302 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 303 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 304 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 305 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 306 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 307 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 392 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 2.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 3.98 |
| Rhizosphere | 92.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1824184 | 2162886007 | Bacteria | 4333 |
| 2 | JGI24746J21847_1018425 | 3300001977 | Bacteria | 987 |
| 3 | JGI24740J21852_10138953 | 3300001979 | Bacteria | 605 |
| 4 | JGI24739J22299_10057414 | 3300001989 | Bacteria | 1239 |
| 5 | JGI24737J22298_10104162 | 3300001990 | Bacteria | 840 |
| 6 | JGI24743J22301_10019173 | 3300001991 | Bacteria | 1298 |
| 7 | JGI24750J21931_1036118 | 3300002070 | Bacteria | 739 |
| 8 | JGI24738J21930_10018485 | 3300002075 | Bacteria | 1456 |
| 9 | JGI24749J21850_1012118 | 3300002076 | Bacteria | 1211 |
| 10 | JGI24744J21845_10051751 | 3300002077 | Bacteria | 756 |
| 11 | JGI24034J26672_10041921 | 3300002239 | Bacteria | 770 |
| 12 | JGI24751J29686_10028732 | 3300002459 | Bacteria | 1155 |
| 13 | Ga0055536_1005701 | 3300003781 | Bacteria | 6010 |
| 14 | Ga0058859_11736316 | 3300004798 | Bacteria | 615 |
| 15 | Ga0058863_10021980 | 3300004799 | Bacteria | 516 |
| 16 | Ga0058862_12148936 | 3300004803 | Bacteria | 631 |
| 17 | Ga0065707_10774067 | 3300005295 | Bacteria | 543 |
| 18 | Ga0070658_10106840 | 3300005327 | Bacteria | 2316 |
| 19 | Ga0070658_10212384 | 3300005327 | Bacteria | 1635 |
| 20 | Ga0070676_10020731 | 3300005328 | Bacteria | 3675 |
| 21 | Ga0070683_100019514 | 3300005329 | Bacteria | 6022 |
| 22 | Ga0070683_100728171 | 3300005329 | Bacteria | 950 |
| 23 | Ga0070690_100002142 | 3300005330 | Bacteria | 10541 |
| 24 | Ga0070690_101206075 | 3300005330 | Bacteria | 604 |
| 25 | Ga0070670_100014885 | 3300005331 | Bacteria | 6672 |
| 26 | Ga0068869_100077072 | 3300005334 | Bacteria | 2479 |
| 27 | Ga0070666_10008032 | 3300005335 | Bacteria | 6528 |
| 28 | Ga0070680_100036366 | 3300005336 | Bacteria | 3978 |
| 29 | Ga0070680_100080294 | 3300005336 | Bacteria | 2690 |
| 30 | Ga0070680_100142714 | 3300005336 | Bacteria | 2008 |
| 31 | Ga0070680_100282269 | 3300005336 | Bacteria | 1407 |
| 32 | Ga0070682_100002624 | 3300005337 | Bacteria | 9935 |
| 33 | Ga0068868_100004569 | 3300005338 | Bacteria | 9719 |
| 34 | Ga0070660_100002725 | 3300005339 | Bacteria | 12136 |
| 35 | Ga0070689_100004193 | 3300005340 | Bacteria | 9723 |
| 36 | Ga0070691_10012213 | 3300005341 | Bacteria | 3933 |
| 37 | Ga0070687_100015260 | 3300005343 | Bacteria | 3469 |
| 38 | Ga0070687_100315716 | 3300005343 | Bacteria | 997 |
| 39 | Ga0070661_100436918 | 3300005344 | Bacteria | 1039 |
| 40 | Ga0070692_10057767 | 3300005345 | Bacteria | 2035 |
| 41 | Ga0070668_100000376 | 3300005347 | Bacteria | 29513 |
| 42 | Ga0070669_100030458 | 3300005353 | Bacteria | 3894 |
| 43 | Ga0070669_100069400 | 3300005353 | Bacteria | 2603 |
| 44 | Ga0070675_100017979 | 3300005354 | Bacteria | 5626 |
| 45 | Ga0070671_100009874 | 3300005355 | Bacteria | 7663 |
| 46 | Ga0070674_100022688 | 3300005356 | Bacteria | 4050 |
| 47 | Ga0070673_100004016 | 3300005364 | Bacteria | 9260 |
| 48 | Ga0070688_100000716 | 3300005365 | Bacteria | 16370 |
| 49 | Ga0070688_100678703 | 3300005365 | Bacteria | 796 |
| 50 | Ga0070659_100023971 | 3300005366 | Bacteria | 4674 |
| 51 | Ga0070659_100083948 | 3300005366 | Bacteria | 2546 |
| 52 | Ga0070667_100009839 | 3300005367 | Bacteria | 7927 |
| 53 | Ga0070667_100178979 | 3300005367 | Bacteria | 1875 |
| 54 | Ga0070703_10028505 | 3300005406 | Bacteria | 1670 |
| 55 | Ga0070709_10013694 | 3300005434 | Bacteria | 4566 |
| 56 | Ga0070709_10019019 | 3300005434 | Bacteria | 3963 |
| 57 | Ga0070709_10071440 | 3300005434 | Bacteria | 2240 |
| 58 | Ga0070714_100007835 | 3300005435 | Bacteria | 8319 |
| 59 | Ga0070714_100228676 | 3300005435 | Bacteria | 1713 |
| 60 | Ga0070714_100528163 | 3300005435 | Bacteria | 1128 |
| 61 | Ga0070714_100882598 | 3300005435 | Bacteria | 868 |
| 62 | Ga0070714_101511110 | 3300005435 | Bacteria | 656 |
| 63 | Ga0070713_100003311 | 3300005436 | Bacteria | 10627 |
| 64 | Ga0070713_100074696 | 3300005436 | Bacteria | 2873 |
| 65 | Ga0070713_100120415 | 3300005436 | Bacteria | 2301 |
| 66 | Ga0070713_100377453 | 3300005436 | Bacteria | 1320 |
| 67 | Ga0070710_10005364 | 3300005437 | Bacteria | 6081 |
| 68 | Ga0070710_10026516 | 3300005437 | Bacteria | 3079 |
| 69 | Ga0070710_10497872 | 3300005437 | Bacteria | 834 |
| 70 | Ga0070710_10578842 | 3300005437 | Bacteria | 779 |
| 71 | Ga0070701_10001121 | 3300005438 | Bacteria | 9784 |
| 72 | Ga0070711_100008572 | 3300005439 | Bacteria | 6269 |
| 73 | Ga0070711_100021230 | 3300005439 | Bacteria | 4194 |
| 74 | Ga0070711_100458276 | 3300005439 | Bacteria | 1045 |
| 75 | Ga0070711_101168444 | 3300005439 | Bacteria | 665 |
| 76 | Ga0070705_100005414 | 3300005440 | Bacteria | 6219 |
| 77 | Ga0070700_100003167 | 3300005441 | Bacteria | 8455 |
| 78 | Ga0070694_100001113 | 3300005444 | Bacteria | 15382 |
| 79 | Ga0070694_100785233 | 3300005444 | Bacteria | 780 |
| 80 | Ga0070663_100012931 | 3300005455 | Bacteria | 5300 |
| 81 | Ga0070678_100001623 | 3300005456 | Bacteria | 12052 |
| 82 | Ga0070662_100003055 | 3300005457 | Bacteria | 10389 |
| 83 | Ga0070681_10035427 | 3300005458 | Bacteria | 5014 |
| 84 | Ga0070681_10036316 | 3300005458 | Bacteria | 4947 |
| 85 | Ga0070681_10131879 | 3300005458 | Bacteria | 2431 |
| 86 | Ga0070681_10149663 | 3300005458 | Bacteria | 2261 |
| 87 | Ga0070681_10614958 | 3300005458 | Bacteria | 1001 |
| 88 | Ga0070681_10758819 | 3300005458 | Bacteria | 887 |
| 89 | Ga0068867_100002464 | 3300005459 | Bacteria | 13016 |
| 90 | Ga0070685_10042928 | 3300005466 | Bacteria | 2583 |
| 91 | Ga0070685_10513257 | 3300005466 | Bacteria | 850 |
| 92 | Ga0070707_100363541 | 3300005468 | Bacteria | 1406 |
| 93 | Ga0070707_101788797 | 3300005468 | Unclassified | 582 |
| 94 | Ga0070698_100002609 | 3300005471 | Bacteria | 19861 |
| 95 | Ga0070698_100115481 | 3300005471 | Bacteria | 2649 |
| 96 | Ga0070698_100319275 | 3300005471 | Bacteria | 1484 |
| 97 | Ga0070699_100153636 | 3300005518 | Bacteria | 2036 |
| 98 | Ga0070679_100001558 | 3300005530 | Bacteria | 20513 |
| 99 | Ga0070679_100025585 | 3300005530 | Bacteria | 5794 |
| 100 | Ga0070679_100039238 | 3300005530 | Bacteria | 4707 |
| 101 | Ga0070679_100236378 | 3300005530 | Bacteria | 1786 |
| 102 | Ga0070679_100433753 | 3300005530 | Bacteria | 1259 |
| 103 | Ga0070679_100670706 | 3300005530 | Bacteria | 979 |
| 104 | Ga0070679_100915508 | 3300005530 | Bacteria | 820 |
| 105 | Ga0070684_100220675 | 3300005535 | Bacteria | 1730 |
| 106 | Ga0070697_100002320 | 3300005536 | Bacteria | 14620 |
| 107 | Ga0070697_100045810 | 3300005536 | Bacteria | 3545 |
| 108 | Ga0070697_100162926 | 3300005536 | Bacteria | 1884 |
| 109 | Ga0070697_100847432 | 3300005536 | Bacteria | 810 |
| 110 | Ga0068853_100001909 | 3300005539 | Bacteria | 15347 |
| 111 | Ga0070672_100118847 | 3300005543 | Bacteria | 2161 |
| 112 | Ga0070686_100001615 | 3300005544 | Bacteria | 12651 |
| 113 | Ga0070686_100145198 | 3300005544 | Bacteria | 1656 |
| 114 | Ga0070686_100246242 | 3300005544 | Bacteria | 1304 |
| 115 | Ga0070695_100005745 | 3300005545 | Bacteria | 7310 |
| 116 | Ga0070695_100202171 | 3300005545 | Bacteria | 1420 |
| 117 | Ga0070696_100009145 | 3300005546 | Bacteria | 6633 |
| 118 | Ga0070693_100057045 | 3300005547 | Bacteria | 2256 |
| 119 | Ga0070665_100345994 | 3300005548 | Bacteria | 1492 |
| 120 | Ga0070704_100006944 | 3300005549 | Bacteria | 6712 |
| 121 | Ga0070704_100516338 | 3300005549 | Bacteria | 1039 |
| 122 | Ga0068855_100080130 | 3300005563 | Bacteria | 3786 |
| 123 | Ga0068855_101370484 | 3300005563 | Bacteria | 730 |
| 124 | Ga0070664_100002115 | 3300005564 | Bacteria | 15887 |
| 125 | Ga0068857_100014232 | 3300005577 | Bacteria | 6929 |
| 126 | Ga0068854_100031138 | 3300005578 | Bacteria | 3705 |
| 127 | Ga0068856_100009612 | 3300005614 | Bacteria | 9390 |
| 128 | Ga0068856_100246778 | 3300005614 | Bacteria | 1801 |
| 129 | Ga0068856_101166912 | 3300005614 | Bacteria | 787 |
| 130 | Ga0070702_100000110 | 3300005615 | Bacteria | 24545 |
| 131 | Ga0070702_100551391 | 3300005615 | Bacteria | 856 |
| 132 | Ga0068852_100014700 | 3300005616 | Bacteria | 6037 |
| 133 | Ga0068859_100035260 | 3300005617 | Bacteria | 5020 |
| 134 | Ga0068864_100961724 | 3300005618 | Bacteria | 845 |
| 135 | Ga0068866_10007211 | 3300005718 | Bacteria | 4650 |
| 136 | Ga0068861_100053023 | 3300005719 | Bacteria | 3084 |
| 137 | Ga0068851_10141964 | 3300005834 | Bacteria | 1307 |
| 138 | Ga0068863_100003256 | 3300005841 | Bacteria | 16051 |
| 139 | Ga0068858_100004547 | 3300005842 | Bacteria | 13589 |
| 140 | Ga0068860_100033018 | 3300005843 | Bacteria | 4969 |
| 141 | Ga0068860_101399741 | 3300005843 | Bacteria | 721 |
| 142 | Ga0068862_100001176 | 3300005844 | Bacteria | 24658 |
| 143 | Ga0068862_101812004 | 3300005844 | Bacteria | 620 |
| 144 | Ga0081455_10000393 | 3300005937 | Bacteria | 57689 |
| 145 | Ga0081455_10015402 | 3300005937 | Bacteria | 7432 |
| 146 | Ga0081455_10210092 | 3300005937 | Bacteria | 1451 |
| 147 | Ga0081540_1005532 | 3300005983 | Bacteria | 9412 |
| 148 | Ga0081540_1006326 | 3300005983 | Bacteria | 8651 |
| 149 | Ga0081540_1025362 | 3300005983 | Bacteria | 3412 |
| 150 | Ga0081540_1106663 | 3300005983 | Bacteria | 1194 |
| 151 | Ga0070717_10000755 | 3300006028 | Bacteria | 21129 |
| 152 | Ga0070717_10088692 | 3300006028 | Bacteria | 2608 |
| 153 | Ga0070717_10842952 | 3300006028 | Bacteria | 834 |
| 154 | Ga0070717_11069430 | 3300006028 | Bacteria | 735 |
| 155 | Ga0075432_10003839 | 3300006058 | Bacteria | 5121 |
| 156 | Ga0075432_10050954 | 3300006058 | Bacteria | 1461 |
| 157 | Ga0070715_10037993 | 3300006163 | Bacteria | 1996 |
| 158 | Ga0070715_10120587 | 3300006163 | Bacteria | 1250 |
| 159 | Ga0070715_10331566 | 3300006163 | Bacteria | 825 |
| 160 | Ga0070716_100000813 | 3300006173 | Bacteria | 13438 |
| 161 | Ga0070716_100047414 | 3300006173 | Bacteria | 2424 |
| 162 | Ga0070712_100005408 | 3300006175 | Bacteria | 7906 |
| 163 | Ga0070712_100006409 | 3300006175 | Bacteria | 7297 |
| 164 | Ga0070712_100049760 | 3300006175 | Bacteria | 2912 |
| 165 | Ga0070712_100083928 | 3300006175 | Bacteria | 2314 |
| 166 | Ga0070712_100107707 | 3300006175 | Bacteria | 2074 |
| 167 | Ga0070712_100357943 | 3300006175 | Bacteria | 1196 |
| 168 | Ga0070712_100513712 | 3300006175 | Bacteria | 1006 |
| 169 | Ga0070712_101061667 | 3300006175 | Bacteria | 702 |
| 170 | Ga0075427_10005123 | 3300006194 | Bacteria | 1861 |
| 171 | Ga0097621_100660997 | 3300006237 | Bacteria | 960 |
| 172 | Ga0097621_100757775 | 3300006237 | Bacteria | 897 |
| 173 | Ga0075428_100001364 | 3300006844 | Bacteria | 25941 |
| 174 | Ga0075428_100003582 | 3300006844 | Bacteria | 17018 |
| 175 | Ga0075428_100675474 | 3300006844 | Bacteria | 1101 |
| 176 | Ga0075428_100777146 | 3300006844 | Bacteria | 1018 |
| 177 | Ga0075430_100000565 | 3300006846 | Bacteria | 28128 |
| 178 | Ga0075430_100151982 | 3300006846 | Bacteria | 1928 |
| 179 | Ga0075430_100649312 | 3300006846 | Bacteria | 870 |
| 180 | Ga0075430_100876153 | 3300006846 | Bacteria | 740 |
| 181 | Ga0075431_100001518 | 3300006847 | Bacteria | 21525 |
| 182 | Ga0075431_100572539 | 3300006847 | Bacteria | 1115 |
| 183 | Ga0075433_10000126 | 3300006852 | Bacteria | 38866 |
| 184 | Ga0075433_10001448 | 3300006852 | Bacteria | 17525 |
| 185 | Ga0075433_10583882 | 3300006852 | Bacteria | 981 |
| 186 | Ga0075434_100000393 | 3300006871 | Bacteria | 32008 |
| 187 | Ga0075434_100000572 | 3300006871 | Bacteria | 28363 |
| 188 | Ga0075434_100426252 | 3300006871 | Bacteria | 1348 |
| 189 | Ga0075434_101394810 | 3300006871 | Bacteria | 711 |
| 190 | Ga0075429_100000531 | 3300006880 | Bacteria | 28975 |
| 191 | Ga0075429_100046549 | 3300006880 | Bacteria | 3774 |
| 192 | Ga0075429_100772130 | 3300006880 | Bacteria | 842 |
| 193 | Ga0068865_100002919 | 3300006881 | Bacteria | 10196 |
| 194 | Ga0075436_100022371 | 3300006914 | Bacteria | 4342 |
| 195 | Ga0097620_100035256 | 3300006931 | Bacteria | 5020 |
| 196 | Ga0075435_100001611 | 3300007076 | Bacteria | 14593 |
| 197 | Ga0075435_100023273 | 3300007076 | Bacteria | 4788 |
| 198 | Ga0075435_100030125 | 3300007076 | Bacteria | 4263 |
| 199 | Ga0075435_100182727 | 3300007076 | Bacteria | 1773 |
| 200 | Ga0075435_100934842 | 3300007076 | Bacteria | 756 |
| 201 | Ga0099795_10055890 | 3300007788 | Bacteria | 1450 |
| 202 | Ga0105251_10087930 | 3300009011 | Bacteria | 1430 |
| 203 | Ga0105244_10180822 | 3300009036 | Bacteria | 1000 |
| 204 | Ga0105250_10009593 | 3300009092 | Bacteria | 4072 |
| 205 | Ga0105240_10059223 | 3300009093 | Bacteria | 4780 |
| 206 | Ga0105240_10101794 | 3300009093 | Bacteria | 3492 |
| 207 | Ga0111539_10000954 | 3300009094 | Bacteria | 37915 |
| 208 | Ga0111539_10005141 | 3300009094 | Bacteria | 16962 |
| 209 | Ga0111539_10469891 | 3300009094 | Bacteria | 1465 |
| 210 | Ga0111539_10836499 | 3300009094 | Bacteria | 1071 |
| 211 | Ga0111539_10877760 | 3300009094 | Bacteria | 1043 |
| 212 | Ga0105245_10022595 | 3300009098 | Bacteria | 5522 |
| 213 | Ga0105247_10001876 | 3300009101 | Bacteria | 14720 |
| 214 | Ga0105247_10104621 | 3300009101 | Bacteria | 1814 |
| 215 | Ga0114129_10039564 | 3300009147 | Bacteria | 6648 |
| 216 | Ga0114129_10153938 | 3300009147 | Bacteria | 3146 |
| 217 | Ga0114129_10265055 | 3300009147 | Bacteria | 2301 |
| 218 | Ga0114129_10995848 | 3300009147 | Bacteria | 1056 |
| 219 | Ga0105243_10008763 | 3300009148 | Bacteria | 7749 |
| 220 | Ga0105243_10264322 | 3300009148 | Bacteria | 1542 |
| 221 | Ga0105241_10007439 | 3300009174 | Bacteria | 8062 |
| 222 | Ga0105242_10116504 | 3300009176 | Bacteria | 2286 |
| 223 | Ga0105248_10004856 | 3300009177 | Bacteria | 14885 |
| 224 | Ga0105248_10618853 | 3300009177 | Bacteria | 1222 |
| 225 | Ga0105248_10648917 | 3300009177 | Bacteria | 1191 |
| 226 | Ga0105237_10004828 | 3300009545 | Bacteria | 15484 |
| 227 | Ga0105238_10096976 | 3300009551 | Bacteria | 2934 |
| 228 | Ga0105249_10000914 | 3300009553 | Bacteria | 26099 |
| 229 | Ga0105249_11311248 | 3300009553 | Bacteria | 796 |
| 230 | Ga0099796_10005898 | 3300010159 | Bacteria | 3094 |
| 231 | Ga0105239_10006584 | 3300010375 | Bacteria | 13454 |
| 232 | Ga0105246_10001402 | 3300011119 | Bacteria | 14256 |
| 233 | Ga0157317_1005551 | 3300012475 | Bacteria | 856 |
| 234 | Ga0157328_1001584 | 3300012478 | Bacteria | 996 |
| 235 | Ga0157373_10074412 | 3300013100 | Bacteria | 2396 |
| 236 | Ga0157371_10002409 | 3300013102 | Bacteria | 17899 |
| 237 | Ga0157371_10177299 | 3300013102 | Bacteria | 1524 |
| 238 | Ga0157370_10085525 | 3300013104 | Bacteria | 2963 |
| 239 | Ga0157370_10151923 | 3300013104 | Bacteria | 2155 |
| 240 | Ga0157370_10348894 | 3300013104 | Bacteria | 1364 |
| 241 | Ga0157369_10004115 | 3300013105 | Bacteria | 17222 |
| 242 | Ga0157369_10010257 | 3300013105 | Bacteria | 10690 |
| 243 | Ga0157369_10343057 | 3300013105 | Bacteria | 1551 |
| 244 | Ga0157369_11111164 | 3300013105 | Bacteria | 808 |
| 245 | Ga0157374_10023226 | 3300013296 | Bacteria | 5543 |
| 246 | Ga0157374_10886412 | 3300013296 | Bacteria | 910 |
| 247 | Ga0157374_11144284 | 3300013296 | Bacteria | 799 |
| 248 | Ga0157378_10007071 | 3300013297 | Bacteria | 9799 |
| 249 | Ga0163162_10136687 | 3300013306 | Bacteria | 2562 |
| 250 | Ga0163162_10325816 | 3300013306 | Bacteria | 1669 |
| 251 | Ga0157372_10052459 | 3300013307 | Bacteria | 4541 |
| 252 | Ga0157372_10061458 | 3300013307 | Bacteria | 4207 |
| 253 | Ga0157372_10742363 | 3300013307 | Bacteria | 1141 |
| 254 | Ga0157375_10069209 | 3300013308 | Bacteria | 3535 |
| 255 | Ga0157375_11714282 | 3300013308 | Bacteria | 744 |
| 256 | Ga0163163_10086134 | 3300014325 | Bacteria | 3150 |
| 257 | Ga0163163_10543768 | 3300014325 | Bacteria | 1224 |
| 258 | Ga0163163_11624789 | 3300014325 | Bacteria | 707 |
| 259 | Ga0163163_11811369 | 3300014325 | Unclassified | 671 |
| 260 | Ga0157380_10007096 | 3300014326 | Bacteria | 7935 |
| 261 | Ga0157380_10136283 | 3300014326 | Bacteria | 2102 |
| 262 | Ga0182008_10023771 | 3300014497 | Bacteria | 3124 |
| 263 | Ga0157379_10006126 | 3300014968 | Bacteria | 10352 |
| 264 | Ga0157379_11890102 | 3300014968 | Bacteria | 588 |
| 265 | Ga0157376_10001070 | 3300014969 | Bacteria | 17928 |
| 266 | Ga0157376_10380898 | 3300014969 | Bacteria | 1359 |
| 267 | Ga0157376_10499584 | 3300014969 | Bacteria | 1195 |
| 268 | Ga0157376_10792377 | 3300014969 | Bacteria | 960 |
| 269 | Ga0157376_12247899 | 3300014969 | Bacteria | 584 |
| 270 | Ga0182007_10056846 | 3300015262 | Bacteria | 1284 |
| 271 | Ga0163161_10002750 | 3300017792 | Bacteria | 12504 |
| 272 | Ga0184602_101631 | 3300019161 | Bacteria | 927 |
| 273 | Ga0197907_10394529 | 3300020069 | Bacteria | 516 |
| 274 | Ga0197907_11338434 | 3300020069 | Bacteria | 671 |
| 275 | Ga0197907_11500817 | 3300020069 | Bacteria | 613 |
| 276 | Ga0206356_10683826 | 3300020070 | Bacteria | 877 |
| 277 | Ga0206355_1200295 | 3300020076 | Bacteria | 550 |
| 278 | Ga0206352_11045053 | 3300020078 | Bacteria | 793 |
| 279 | Ga0206350_10309521 | 3300020080 | Bacteria | 781 |
| 280 | Ga0206354_10705081 | 3300020081 | Bacteria | 587 |
| 281 | Ga0206353_10939575 | 3300020082 | Bacteria | 635 |
| 282 | Ga0213873_10018764 | 3300021358 | Bacteria | 1595 |
| 283 | Ga0213872_10036060 | 3300021361 | Bacteria | 2260 |
| 284 | Ga0213872_10145270 | 3300021361 | Bacteria | 1039 |
| 285 | Ga0213874_10025053 | 3300021377 | Bacteria | 1679 |
| 286 | Ga0213874_10131003 | 3300021377 | Bacteria | 861 |
| 287 | Ga0213876_10150809 | 3300021384 | Bacteria | 1236 |
| 288 | Ga0213876_10315869 | 3300021384 | Bacteria | 830 |
| 289 | Ga0213875_10011874 | 3300021388 | Bacteria | 4318 |
| 290 | Ga0213875_10036138 | 3300021388 | Bacteria | 2329 |
| 291 | Ga0213875_10261519 | 3300021388 | Bacteria | 816 |
| 292 | Ga0224712_10200467 | 3300022467 | Bacteria | 907 |
| 293 | Ga0224712_10281498 | 3300022467 | Bacteria | 774 |
| 294 | Ga0224712_10473638 | 3300022467 | Bacteria | 603 |
| 295 | Ga0247550_100224 | 3300023660 | Bacteria | 1354 |
| 296 | Ga0228598_1049194 | 3300024227 | Bacteria | 835 |
| 297 | Ga0209676_1000256 | 3300025292 | Bacteria | 112819 |
| 298 | Ga0209050_1005370 | 3300025298 | Bacteria | 8095 |
| 299 | Ga0207656_10102532 | 3300025321 | Bacteria | 1313 |
| 300 | Ga0207696_1016029 | 3300025711 | Bacteria | 2520 |
| 301 | Ga0207713_1196926 | 3300025735 | Bacteria | 620 |
| 302 | Ga0207653_10008058 | 3300025885 | Bacteria | 3284 |
| 303 | Ga0207692_10001791 | 3300025898 | Bacteria | 8146 |
| 304 | Ga0207692_10018922 | 3300025898 | Bacteria | 3101 |
| 305 | Ga0207692_10246024 | 3300025898 | Bacteria | 1070 |
| 306 | Ga0207642_10144275 | 3300025899 | Bacteria | 1259 |
| 307 | Ga0207710_10005196 | 3300025900 | Bacteria | 5626 |
| 308 | Ga0207688_10003708 | 3300025901 | Bacteria | 8339 |
| 309 | Ga0207680_10016657 | 3300025903 | Bacteria | 3864 |
| 310 | Ga0207647_10006532 | 3300025904 | Bacteria | 8473 |
| 311 | Ga0207647_10153973 | 3300025904 | Bacteria | 1343 |
| 312 | Ga0207685_10031345 | 3300025905 | Bacteria | 1903 |
| 313 | Ga0207685_10373655 | 3300025905 | Unclassified | 724 |
| 314 | Ga0207699_10058501 | 3300025906 | Bacteria | 2306 |
| 315 | Ga0207699_10262516 | 3300025906 | Bacteria | 1194 |
| 316 | Ga0207699_10486636 | 3300025906 | Bacteria | 889 |
| 317 | Ga0207645_10003136 | 3300025907 | Bacteria | 12679 |
| 318 | Ga0207705_10100876 | 3300025909 | Bacteria | 2123 |
| 319 | Ga0207705_10648786 | 3300025909 | Bacteria | 821 |
| 320 | Ga0207654_10004248 | 3300025911 | Bacteria | 7226 |
| 321 | Ga0207707_10004903 | 3300025912 | Bacteria | 11760 |
| 322 | Ga0207707_10024365 | 3300025912 | Bacteria | 5295 |
| 323 | Ga0207707_10064245 | 3300025912 | Bacteria | 3195 |
| 324 | Ga0207707_10114973 | 3300025912 | Bacteria | 2351 |
| 325 | Ga0207707_10539070 | 3300025912 | Bacteria | 992 |
| 326 | Ga0207707_10626820 | 3300025912 | Bacteria | 908 |
| 327 | Ga0207695_10079426 | 3300025913 | Bacteria | 3325 |
| 328 | Ga0207695_10102075 | 3300025913 | Bacteria | 2862 |
| 329 | Ga0207695_10315019 | 3300025913 | Bacteria | 1454 |
| 330 | Ga0207671_10057004 | 3300025914 | Bacteria | 2895 |
| 331 | Ga0207693_10000133 | 3300025915 | Bacteria | 67586 |
| 332 | Ga0207693_10002561 | 3300025915 | Bacteria | 15808 |
| 333 | Ga0207693_10014015 | 3300025915 | Bacteria | 6454 |
| 334 | Ga0207693_10056665 | 3300025915 | Bacteria | 3072 |
| 335 | Ga0207693_10072969 | 3300025915 | Bacteria | 2687 |
| 336 | Ga0207693_10678572 | 3300025915 | Bacteria | 799 |
| 337 | Ga0207663_10104205 | 3300025916 | Bacteria | 1912 |
| 338 | Ga0207663_10238755 | 3300025916 | Bacteria | 1332 |
| 339 | Ga0207663_10303876 | 3300025916 | Bacteria | 1193 |
| 340 | Ga0207660_10070521 | 3300025917 | Bacteria | 2541 |
| 341 | Ga0207660_10105796 | 3300025917 | Bacteria | 2109 |
| 342 | Ga0207660_10119948 | 3300025917 | Bacteria | 1991 |
| 343 | Ga0207660_10289305 | 3300025917 | Bacteria | 1302 |
| 344 | Ga0207662_10136076 | 3300025918 | Bacteria | 1553 |
| 345 | Ga0207657_10001128 | 3300025919 | Bacteria | 28356 |
| 346 | Ga0207649_10054047 | 3300025920 | Bacteria | 2498 |
| 347 | Ga0207652_10118118 | 3300025921 | Bacteria | 2356 |
| 348 | Ga0207652_10188746 | 3300025921 | Bacteria | 1853 |
| 349 | Ga0207652_10257717 | 3300025921 | Bacteria | 1573 |
| 350 | Ga0207652_10783573 | 3300025921 | Bacteria | 847 |
| 351 | Ga0207646_10212763 | 3300025922 | Bacteria | 1746 |
| 352 | Ga0207681_10033342 | 3300025923 | Bacteria | 3375 |
| 353 | Ga0207681_10070595 | 3300025923 | Bacteria | 2433 |
| 354 | Ga0207694_10063947 | 3300025924 | Bacteria | 2867 |
| 355 | Ga0207650_10022731 | 3300025925 | Bacteria | 4442 |
| 356 | Ga0207650_10281582 | 3300025925 | Bacteria | 1354 |
| 357 | Ga0207659_10027019 | 3300025926 | Bacteria | 3881 |
| 358 | Ga0207687_10125270 | 3300025927 | Bacteria | 1928 |
| 359 | Ga0207700_10032759 | 3300025928 | Bacteria | 3710 |
| 360 | Ga0207700_10065789 | 3300025928 | Bacteria | 2767 |
| 361 | Ga0207700_10091840 | 3300025928 | Bacteria | 2399 |
| 362 | Ga0207700_10210610 | 3300025928 | Bacteria | 1643 |
| 363 | Ga0207700_10622316 | 3300025928 | Bacteria | 961 |
| 364 | Ga0207664_10010395 | 3300025929 | Bacteria | 6573 |
| 365 | Ga0207664_10346695 | 3300025929 | Bacteria | 1314 |
| 366 | Ga0207664_10509901 | 3300025929 | Bacteria | 1077 |
| 367 | Ga0207664_10572016 | 3300025929 | Bacteria | 1014 |
| 368 | Ga0207664_11167425 | 3300025929 | Bacteria | 687 |
| 369 | Ga0207690_10091782 | 3300025932 | Bacteria | 2147 |
| 370 | Ga0207690_10350395 | 3300025932 | Bacteria | 1167 |
| 371 | Ga0207706_10000195 | 3300025933 | Bacteria | 67422 |
| 372 | Ga0207686_10017996 | 3300025934 | Bacteria | 3993 |
| 373 | Ga0207709_10035084 | 3300025935 | Bacteria | 2963 |
| 374 | Ga0207670_10043823 | 3300025936 | Bacteria | 2957 |
| 375 | Ga0207669_10809179 | 3300025937 | Bacteria | 777 |
| 376 | Ga0207704_10020332 | 3300025938 | Bacteria | 3509 |
| 377 | Ga0207665_10000068 | 3300025939 | Bacteria | 67429 |
| 378 | Ga0207665_10118516 | 3300025939 | Bacteria | 1868 |
| 379 | Ga0207665_10260148 | 3300025939 | Bacteria | 1285 |
| 380 | Ga0207691_10028162 | 3300025940 | Bacteria | 5262 |
| 381 | Ga0207711_10018110 | 3300025941 | Bacteria | 5856 |
| 382 | Ga0207689_10086451 | 3300025942 | Bacteria | 2577 |
| 383 | Ga0207661_10216974 | 3300025944 | Bacteria | 1689 |
| 384 | Ga0207661_10733309 | 3300025944 | Bacteria | 909 |
| 385 | Ga0207679_10354102 | 3300025945 | Bacteria | 1280 |
| 386 | Ga0207679_10490371 | 3300025945 | Bacteria | 1095 |
| 387 | Ga0207667_10024633 | 3300025949 | Bacteria | 6603 |
| 388 | Ga0207667_10537731 | 3300025949 | Bacteria | 1183 |
| 389 | Ga0207667_10761467 | 3300025949 | Bacteria | 967 |
| 390 | Ga0207667_10810425 | 3300025949 | Bacteria | 932 |
| 391 | Ga0207651_10002885 | 3300025960 | Bacteria | 8293 |
| 392 | Ga0207712_10010392 | 3300025961 | Bacteria | 5909 |
| 393 | Ga0207668_10071575 | 3300025972 | Bacteria | 2477 |
| 394 | Ga0207640_10289804 | 3300025981 | Bacteria | 1290 |
| 395 | Ga0207658_10014654 | 3300025986 | Bacteria | 5370 |
| 396 | Ga0207658_10793819 | 3300025986 | Bacteria | 859 |
| 397 | Ga0207677_10025401 | 3300026023 | Bacteria | 3695 |
| 398 | Ga0207703_10161212 | 3300026035 | Bacteria | 1964 |
| 399 | Ga0207639_10009419 | 3300026041 | Bacteria | 6737 |
| 400 | Ga0207678_10000128 | 3300026067 | Bacteria | 63331 |
| 401 | Ga0207708_10002350 | 3300026075 | Bacteria | 13892 |
| 402 | Ga0207702_10095875 | 3300026078 | Bacteria | 2608 |
| 403 | Ga0207702_10177059 | 3300026078 | Bacteria | 1961 |
| 404 | Ga0207641_10297380 | 3300026088 | Bacteria | 1523 |
| 405 | Ga0207648_10005087 | 3300026089 | Bacteria | 13323 |
| 406 | Ga0207648_10432043 | 3300026089 | Bacteria | 1197 |
| 407 | Ga0207676_10225010 | 3300026095 | Bacteria | 1673 |
| 408 | Ga0207674_10000779 | 3300026116 | Bacteria | 41558 |
| 409 | Ga0207675_100001033 | 3300026118 | Bacteria | 27590 |
| 410 | Ga0207683_10000553 | 3300026121 | Bacteria | 34552 |
| 411 | Ga0207698_10016409 | 3300026142 | Bacteria | 4990 |
| 412 | Ga0209179_1019179 | 3300027512 | Bacteria | 1314 |
| 413 | Ga0209999_1020169 | 3300027543 | Bacteria | 1224 |
| 414 | Ga0210002_1054009 | 3300027617 | Bacteria | 695 |
| 415 | Ga0209983_1023805 | 3300027665 | Bacteria | 1288 |
| 416 | Ga0209971_1073413 | 3300027682 | Bacteria | 831 |
| 417 | Ga0209998_10008320 | 3300027717 | Bacteria | 2150 |
| 418 | Ga0209998_10087786 | 3300027717 | Bacteria | 759 |
| 419 | Ga0209974_10013053 | 3300027876 | Bacteria | 2770 |
| 420 | Ga0209974_10314048 | 3300027876 | Bacteria | 602 |
| 421 | Ga0207428_10000200 | 3300027907 | Bacteria | 83533 |
| 422 | Ga0207428_10010018 | 3300027907 | Bacteria | 8481 |
| 423 | Ga0207428_10172852 | 3300027907 | Bacteria | 1635 |
| 424 | Ga0207428_10388048 | 3300027907 | Bacteria | 1024 |
| 425 | Ga0268266_10142324 | 3300028379 | Bacteria | 2153 |
| 426 | Ga0268265_10321389 | 3300028380 | Bacteria | 1402 |
| 427 | Ga0268265_10347817 | 3300028380 | Bacteria | 1352 |
| 428 | Ga0268264_10986751 | 3300028381 | Bacteria | 848 |
| 429 | Ga0268264_11193804 | 3300028381 | Bacteria | 770 |
| 430 | Ga0265338_10064804 | 3300028800 | Bacteria | 3174 |
| 431 | Ga0265338_10122535 | 3300028800 | Bacteria | 2069 |
| 432 | Ga0265766_1013371 | 3300030863 | Bacteria | 615 |
| 433 | Ga0265325_10000092 | 3300031241 | Bacteria | 63555 |
| 434 | Ga0265340_10016361 | 3300031247 | Bacteria | 3842 |
| 435 | Ga0265339_10007234 | 3300031249 | Bacteria | 7194 |
| 436 | Ga0265339_10104178 | 3300031249 | Bacteria | 1473 |
| 437 | Ga0265327_10001216 | 3300031251 | Bacteria | 34696 |
| 438 | Ga0265316_10036056 | 3300031344 | Bacteria | 4001 |
| 439 | Ga0265316_10324989 | 3300031344 | Bacteria | 1117 |
| 440 | Ga0307408_100030599 | 3300031548 | Bacteria | 3739 |
| 441 | Ga0307408_100495120 | 3300031548 | Bacteria | 1069 |
| 442 | Ga0265313_10001177 | 3300031595 | Bacteria | 25003 |
| 443 | Ga0307405_10039197 | 3300031731 | Bacteria | 2861 |
| 444 | Ga0307413_10687309 | 3300031824 | Bacteria | 848 |
| 445 | Ga0307410_10265885 | 3300031852 | Bacteria | 1340 |
| 446 | Ga0307406_10220856 | 3300031901 | Bacteria | 1408 |
| 447 | Ga0307409_100387584 | 3300031995 | Bacteria | 1331 |
| 448 | Ga0307409_101126326 | 3300031995 | Bacteria | 806 |
| 449 | Ga0307416_100006633 | 3300032002 | Bacteria | 7265 |
| 450 | Ga0307416_100047655 | 3300032002 | Bacteria | 3394 |
| 451 | Ga0307416_100514615 | 3300032002 | Bacteria | 1264 |
| 452 | Ga0307416_100740607 | 3300032002 | Bacteria | 1075 |
| 453 | Ga0307414_10054989 | 3300032004 | Bacteria | 2785 |
| 454 | Ga0307414_10293803 | 3300032004 | Bacteria | 1371 |
| 455 | Ga0307414_10732001 | 3300032004 | Bacteria | 898 |
| 456 | Ga0307411_10068425 | 3300032005 | Bacteria | 2393 |
| 457 | Ga0307415_100025995 | 3300032126 | Bacteria | 3685 |
| 458 | Ga0307415_100047074 | 3300032126 | Bacteria | 2901 |
| 459 | Ga0373948_0054418 | 3300034817 | Bacteria | 866 |
| 460 | Ga0373938_0104725 | 3300034957 | Bacteria | 714 |
| 461 | Ga0373928_0019751 | 3300035084 | Bacteria | 1408 |
| 462 | Ga0373936_0149619 | 3300035113 | Bacteria | 1012 |
| 463 | Ga0373941_0023759 | 3300035115 | Bacteria | 1754 |
| 464 | Ga0373953_0003102 | 3300035117 | Bacteria | 5115 |
| 465 | Ga0373953_0186672 | 3300035117 | Bacteria | 895 |
| 466 | Ga0373954_0048267 | 3300035118 | Bacteria | 1994 |
| 467 | Ga0373954_0197886 | 3300035118 | Bacteria | 987 |
| 468 | Ga0373956_0208660 | 3300035119 | Bacteria | 926 |
| 469 | Ga0373956_0278593 | 3300035119 | Bacteria | 796 |
| 470 | Ga0373956_0290680 | 3300035119 | Bacteria | 778 |
| 471 | Ga0373960_0013817 | 3300035121 | Bacteria | 2033 |
| 472 | Ga0373955_0008701 | 3300035172 | Bacteria | 4724 |
| 473 | Ga0373955_0185292 | 3300035172 | Bacteria | 1236 |
| 474 | Ga0373931_0051788 | 3300035691 | Bacteria | 2188 |
| 475 | Ga0373931_0172072 | 3300035691 | Bacteria | 1277 |
| 476 | Ga0373935_0146169 | 3300035692 | Bacteria | 1601 |
| 477 | Ga0373927_0291172 | 3300035695 | Bacteria | 1075 |
| 478 | Ga0373927_0359892 | 3300035695 | Bacteria | 959 |
| 479 | Ga0373933_0003617 | 3300035724 | Bacteria | 8568 |
| 480 | Ga0373933_0125904 | 3300035724 | Bacteria | 1607 |
| 481 | Ga0373933_0186414 | 3300035724 | Bacteria | 1324 |
| 482 | Ga0373937_0013477 | 3300036401 | Bacteria | 7199 |
| 483 | Ga0373937_0023906 | 3300036401 | Bacteria | 5510 |
| 484 | Ga0373937_0430483 | 3300036401 | Bacteria | 1252 |
| 485 | Ga0316582_0113549 | 3300036647 | Bacteria | 1806 |
| 486 | Ga0395899_0483270 | 3300037312 | Bacteria | 806 |
| 487 | Ga0395900_0007214 | 3300037418 | Bacteria | 11515 |
| 488 | Ga0395900_0032445 | 3300037418 | Bacteria | 5371 |
| 489 | Ga0395900_0042510 | 3300037418 | Bacteria | 4683 |
| 490 | Ga0395898_0019026 | 3300037466 | Bacteria | 6993 |
| 491 | Ga0395898_0179065 | 3300037466 | Bacteria | 2026 |
| 492 | Ga0395905_0001391 | 3300037471 | Bacteria | 29353 |
| 493 | Ga0395905_0484351 | 3300037471 | Bacteria | 1137 |
| 494 | Ga0395905_1098085 | 3300037471 | Bacteria | 699 |
| 495 | Ga0436364_0067324 | 3300037853 | Bacteria | 1994 |
| 496 | Ga0436364_0179449 | 3300037853 | Bacteria | 2053 |
| 497 | Ga0436364_0234163 | 3300037853 | Bacteria | 967 |
| 498 | Ga0436364_0400376 | 3300037853 | Bacteria | 49321 |
| 499 | Ga0436364_1370990 | 3300037853 | Bacteria | 2669 |
| 500 | Ga0436364_1419253 | 3300037853 | Bacteria | 1612 |
| 501 | Ga0436364_1525673 | 3300037853 | Bacteria | 28219 |
| 502 | Ga0395901_0005667 | 3300038443 | Bacteria | 12640 |
| 503 | Ga0242420_020262 | 3300038996 | Bacteria | 1182 |
| 504 | Ga0400483_100023 | 3300039062 | Bacteria | 1057 |
| 505 | Ga0436365_0550921 | 3300039437 | Bacteria | 1901 |
| 506 | Ga0436365_0704032 | 3300039437 | Bacteria | 811 |
| 507 | Ga0436365_0909950 | 3300039437 | Bacteria | 1828 |
| 508 | Ga0436365_1816817 | 3300039437 | Bacteria | 1267 |
| 509 | Ga0436360_0326890 | 3300039438 | Bacteria | 721 |
| 510 | Ga0436360_0452948 | 3300039438 | Unclassified | 581 |
| 511 | Ga0436360_0589360 | 3300039438 | Bacteria | 773 |
| 512 | Ga0436360_0613967 | 3300039438 | Bacteria | 604 |
| 513 | Ga0436360_0872042 | 3300039438 | Bacteria | 1001 |
| 514 | Ga0436360_1267705 | 3300039438 | Bacteria | 1142 |
| 515 | Ga0436361_0085183 | 3300039447 | Bacteria | 3480 |
| 516 | Ga0436361_0175350 | 3300039447 | Bacteria | 1655 |
| 517 | Ga0436361_0333471 | 3300039447 | Bacteria | 2396 |
| 518 | Ga0436361_0335349 | 3300039447 | Bacteria | 596 |
| 519 | Ga0436361_0450564 | 3300039447 | Bacteria | 1304 |
| 520 | Ga0436361_0502336 | 3300039447 | Bacteria | 2496 |
| 521 | Ga0436361_0666217 | 3300039447 | Bacteria | 5230 |
| 522 | Ga0436361_0819040 | 3300039447 | Bacteria | 7493 |
| 523 | Ga0436361_0863493 | 3300039447 | Bacteria | 1344 |
| 524 | Ga0436363_0572892 | 3300039450 | Bacteria | 1804 |
| 525 | Ga0436363_0902918 | 3300039450 | Bacteria | 1190 |
| 526 | Ga0436363_1345528 | 3300039450 | Unclassified | 806 |
| 527 | Ga0436362_0111635 | 3300039453 | Bacteria | 2888 |
| 528 | Ga0436362_0345536 | 3300039453 | Bacteria | 1301 |
| 529 | Ga0436362_0626657 | 3300039453 | Bacteria | 1734 |
| 530 | Ga0436362_0651475 | 3300039453 | Unclassified | 584 |
| 531 | Ga0436362_0826199 | 3300039453 | Bacteria | 9169 |
| 532 | Ga0436362_0994734 | 3300039453 | Unclassified | 635 |
| 533 | Ga0436362_1000199 | 3300039453 | Bacteria | 2332 |
| 534 | Ga0439453_0032804 | 3300041408 | Bacteria | 990 |
| 535 | Ga0439433_0044230 | 3300041999 | Bacteria | 1041 |
| 536 | Ga0439451_001574 | 3300042009 | Bacteria | 4506 |
| 537 | Ga0450923_007964 | 3300042125 | Bacteria | 1810 |
| 538 | Ga0450895_020951 | 3300042132 | Bacteria | 606 |
| 539 | Ga0450896_005227 | 3300042133 | Bacteria | 1770 |
| 540 | Ga0450899_014284 | 3300042135 | Bacteria | 902 |
| 541 | Ga0450907_004045 | 3300042146 | Bacteria | 2548 |
| 542 | Ga0450910_001892 | 3300042147 | Bacteria | 2706 |
| 543 | Ga0450910_007240 | 3300042147 | Bacteria | 1544 |
| 544 | Ga0439446_0008107 | 3300042156 | Bacteria | 2779 |
| 545 | Ga0439446_0118106 | 3300042156 | Bacteria | 851 |
| 546 | Ga0439446_0230532 | 3300042156 | Bacteria | 633 |
| 547 | Ga0450908_002235 | 3300042184 | Bacteria | 3789 |
| 548 | Ga0439434_0011318 | 3300042435 | Bacteria | 2637 |
| 549 | Ga0439444_0001542 | 3300042437 | Bacteria | 3025 |
| 550 | Ga0439460_0126681 | 3300042461 | Bacteria | 839 |
| 551 | Ga0450918_011772 | 3300042531 | Bacteria | 1523 |
| 552 | Ga0450918_013242 | 3300042531 | Bacteria | 1435 |
| 553 | Ga0451577_0364153 | 3300042876 | Bacteria | 1311 |
| 554 | Ga0453683_0017389 | 3300044673 | Bacteria | 4628 |
| 555 | Ga0453684_0028811 | 3300044712 | Bacteria | 7906 |
| 556 | Ga0451576_0220457 | 3300045051 | Bacteria | 1980 |
| 557 | Ga0466958_0243534 | 3300045836 | Bacteria | 1149 |
| 558 | Ga0466958_0351522 | 3300045836 | Bacteria | 949 |
| 559 | Ga0466967_0165687 | 3300045976 | Bacteria | 2077 |
| 560 | Ga0495651_0170931 | 3300046462 | Bacteria | 1548 |
| 561 | Ga0495580_0450470 | 3300046472 | Bacteria | 864 |
| 562 | Ga0495664_0106068 | 3300046477 | Bacteria | 1694 |
| 563 | Ga0495584_0024182 | 3300046491 | Bacteria | 3080 |
| 564 | Ga0495584_0240759 | 3300046491 | Bacteria | 920 |
| 565 | Ga0495583_0123893 | 3300046506 | Bacteria | 1086 |
| 566 | Ga0495608_0124238 | 3300046511 | Bacteria | 1654 |
| 567 | Ga0495630_0280948 | 3300046517 | Bacteria | 1272 |
| 568 | Ga0495631_0034954 | 3300046518 | Bacteria | 2251 |
| 569 | Ga0495652_0075755 | 3300046529 | Bacteria | 2793 |
| 570 | Ga0495586_0229207 | 3300046535 | Bacteria | 1057 |
| 571 | Ga0495587_0054218 | 3300046536 | Bacteria | 2363 |
| 572 | Ga0495667_0018210 | 3300046559 | Bacteria | 4745 |
| 573 | Ga0495656_0215587 | 3300046615 | Bacteria | 958 |
| 574 | Ga0495611_0345718 | 3300046648 | Bacteria | 683 |
| 575 | Ga0495625_0410888 | 3300046660 | Bacteria | 844 |
| 576 | Ga0495659_0078167 | 3300046664 | Bacteria | 1251 |
| 577 | Ga0495657_0083702 | 3300046675 | Bacteria | 2059 |
| 578 | Ga0495657_0284045 | 3300046675 | Bacteria | 990 |
| 579 | Ga0495604_0260725 | 3300047317 | Bacteria | 1178 |
| 580 | Ga0495604_0403361 | 3300047317 | Bacteria | 900 |
| 581 | Ga0495674_1067422 | 3300047319 | Bacteria | 616 |
| 582 | Ga0495680_0372217 | 3300047322 | Bacteria | 991 |
| 583 | Ga0495675_0038422 | 3300047444 | Bacteria | 3048 |
| 584 | Ga0495675_0756996 | 3300047444 | Bacteria | 540 |
| 585 | Ga0495684_0566971 | 3300047471 | Bacteria | 771 |
| 586 | Ga0495602_0296436 | 3300048088 | Bacteria | 1185 |
| 587 | Ga0496100_0099267 | 3300048903 | Bacteria | 2003 |
| 588 | Ga0496100_0179121 | 3300048903 | Bacteria | 1532 |
| 589 | Ga0496100_0247054 | 3300048903 | Bacteria | 1318 |
| 590 | Ga0496101_0712003 | 3300048904 | Bacteria | 792 |
| 591 | Ga0496102_0196390 | 3300048905 | Bacteria | 1901 |
| 592 | Ga0496103_0012541 | 3300048906 | Bacteria | 5025 |
| 593 | Ga0496103_0179477 | 3300048906 | Bacteria | 1361 |
| 594 | Ga0496104_0251297 | 3300048907 | Bacteria | 1681 |
| 595 | Ga0496104_0895370 | 3300048907 | Bacteria | 792 |
| 596 | Ga0496104_1524454 | 3300048907 | Bacteria | 571 |
| 597 | Ga0496105_0678740 | 3300048908 | Bacteria | 792 |
| 598 | Ga0496106_0075445 | 3300048909 | Bacteria | 2582 |
| 599 | Ga0496106_0246443 | 3300048909 | Bacteria | 1428 |
| 600 | Ga0496106_0316320 | 3300048909 | Bacteria | 1253 |
| 601 | Ga0496107_0011017 | 3300048910 | Bacteria | 6289 |
| 602 | Ga0496108_0165715 | 3300048911 | Bacteria | 1910 |
| 603 | Ga0496109_0029266 | 3300048912 | Bacteria | 4932 |
| 604 | Ga0496109_0257745 | 3300048912 | Bacteria | 1643 |
| 605 | Ga0496110_0179984 | 3300048913 | Bacteria | 1920 |
| 606 | Ga0496110_0991183 | 3300048913 | Bacteria | 747 |
| 607 | Ga0496111_0466043 | 3300048914 | Bacteria | 931 |
| 608 | Ga0496111_0499680 | 3300048914 | Bacteria | 895 |
| 609 | Ga0496111_0769317 | 3300048914 | Bacteria | 698 |
| 610 | Ga0496112_0596229 | 3300048915 | Bacteria | 1037 |
| 611 | Ga0496112_0599467 | 3300048915 | Bacteria | 1033 |
| 612 | Ga0496113_1108676 | 3300048916 | Bacteria | 620 |
| 613 | Ga0496114_0018184 | 3300048917 | Bacteria | 5678 |
| 614 | Ga0496114_0364115 | 3300048917 | Bacteria | 1279 |
| 615 | Ga0496115_0019140 | 3300048918 | Bacteria | 5266 |
| 616 | Ga0496115_0412181 | 3300048918 | Bacteria | 1095 |
| 617 | Ga0501312_039911 | 3300049528 | Bacteria | 764 |
| 618 | Ga0501031_0029391 | 3300049568 | Bacteria | 3585 |
| 619 | Ga0501031_0113004 | 3300049568 | Bacteria | 1774 |
| 620 | Ga0501031_0261281 | 3300049568 | Bacteria | 1125 |
| 621 | Ga0501033_0124715 | 3300049570 | Bacteria | 1868 |
| 622 | Ga0501036_0221895 | 3300049572 | Bacteria | 1587 |
| 623 | Ga0501036_0476817 | 3300049572 | Bacteria | 1039 |
| 624 | Ga0501036_0846268 | 3300049572 | Bacteria | 752 |
| 625 | Ga0501036_1105143 | 3300049572 | Bacteria | 648 |
| 626 | Ga0501036_1269607 | 3300049572 | Bacteria | 599 |
| 627 | Ga0501037_0069290 | 3300049573 | Bacteria | 2568 |
| 628 | Ga0501038_0251962 | 3300049574 | Bacteria | 1398 |
| 629 | Ga0501039_0032551 | 3300049575 | Bacteria | 4021 |
| 630 | Ga0501039_0192000 | 3300049575 | Bacteria | 1606 |
| 631 | Ga0501039_0811279 | 3300049575 | Bacteria | 730 |
| 632 | Ga0501040_0007949 | 3300049576 | Bacteria | 6882 |
| 633 | Ga0501040_0016236 | 3300049576 | Bacteria | 4925 |
| 634 | Ga0501040_0064021 | 3300049576 | Bacteria | 2531 |
| 635 | Ga0501041_0085577 | 3300049577 | Bacteria | 1944 |
| 636 | Ga0501041_0397731 | 3300049577 | Bacteria | 872 |
| 637 | Ga0501042_0031965 | 3300049578 | Bacteria | 3725 |
| 638 | Ga0501042_0059139 | 3300049578 | Bacteria | 2737 |
| 639 | Ga0501042_0063858 | 3300049578 | Bacteria | 2631 |
| 640 | Ga0501042_0072530 | 3300049578 | Bacteria | 2464 |
| 641 | Ga0501042_0156202 | 3300049578 | Bacteria | 1645 |
| 642 | Ga0501042_0269183 | 3300049578 | Bacteria | 1230 |
| 643 | Ga0501046_0269573 | 3300049580 | Bacteria | 1249 |
| 644 | Ga0501046_0668736 | 3300049580 | Bacteria | 733 |
| 645 | Ga0501048_0042789 | 3300049582 | Bacteria | 3242 |
| 646 | Ga0501048_0089789 | 3300049582 | Bacteria | 2168 |
| 647 | Ga0501048_0476587 | 3300049582 | Bacteria | 894 |
| 648 | Ga0501048_0623758 | 3300049582 | Bacteria | 774 |
| 649 | Ga0501048_0868830 | 3300049582 | Bacteria | 648 |
| 650 | Ga0501068_0438549 | 3300049584 | Bacteria | 844 |
| 651 | Ga0501068_0564344 | 3300049584 | Bacteria | 741 |
| 652 | Ga0501068_0610429 | 3300049584 | Bacteria | 711 |
| 653 | Ga0501068_1018202 | 3300049584 | Bacteria | 547 |
| 654 | Ga0501069_0145066 | 3300049585 | Bacteria | 1363 |
| 655 | Ga0501070_0065514 | 3300049586 | Bacteria | 3008 |
| 656 | Ga0501070_0168233 | 3300049586 | Bacteria | 1806 |
| 657 | Ga0501071_0026051 | 3300049587 | Bacteria | 4102 |
| 658 | Ga0501071_0046812 | 3300049587 | Bacteria | 3106 |
| 659 | Ga0501071_0465399 | 3300049587 | Bacteria | 968 |
| 660 | Ga0501071_0850835 | 3300049587 | Bacteria | 703 |
| 661 | Ga0501072_0005695 | 3300049588 | Bacteria | 9486 |
| 662 | Ga0501072_0074472 | 3300049588 | Bacteria | 2685 |
| 663 | Ga0501072_0189069 | 3300049588 | Bacteria | 1642 |
| 664 | Ga0501072_0332867 | 3300049588 | Bacteria | 1206 |
| 665 | Ga0501072_0417389 | 3300049588 | Bacteria | 1064 |
| 666 | Ga0501072_0540317 | 3300049588 | Bacteria | 921 |
| 667 | Ga0501073_0151261 | 3300049589 | Bacteria | 1609 |
| 668 | Ga0501074_0051472 | 3300049590 | Bacteria | 2972 |
| 669 | Ga0501075_0015392 | 3300049591 | Bacteria | 5489 |
| 670 | Ga0501075_0047800 | 3300049591 | Bacteria | 3215 |
| 671 | Ga0501075_0051778 | 3300049591 | Bacteria | 3088 |
| 672 | Ga0501075_0120292 | 3300049591 | Bacteria | 1998 |
| 673 | Ga0501075_0208139 | 3300049591 | Bacteria | 1492 |
| 674 | Ga0501076_0089354 | 3300049592 | Bacteria | 2476 |
| 675 | Ga0501076_0090170 | 3300049592 | Bacteria | 2465 |
| 676 | Ga0501076_0100927 | 3300049592 | Bacteria | 2325 |
| 677 | Ga0501076_0323256 | 3300049592 | Bacteria | 1265 |
| 678 | Ga0501076_0677482 | 3300049592 | Bacteria | 851 |
| 679 | Ga0501076_0740292 | 3300049592 | Bacteria | 811 |
| 680 | Ga0501077_0017260 | 3300049593 | Bacteria | 4552 |
| 681 | Ga0501077_0101271 | 3300049593 | Bacteria | 1825 |
| 682 | Ga0501077_0760638 | 3300049593 | Bacteria | 623 |
| 683 | Ga0501257_030909 | 3300049686 | Bacteria | 1291 |
| 684 | Ga0501079_0056766 | 3300049741 | Bacteria | 3021 |
| 685 | Ga0501079_0176018 | 3300049741 | Bacteria | 1668 |
| 686 | Ga0501079_0181299 | 3300049741 | Bacteria | 1643 |
| 687 | Ga0501079_0182918 | 3300049741 | Bacteria | 1636 |
| 688 | Ga0501080_0256463 | 3300049742 | Bacteria | 1594 |
| 689 | Ga0501080_0280985 | 3300049742 | Bacteria | 1513 |
| 690 | Ga0501080_0732112 | 3300049742 | Bacteria | 871 |
| 691 | Ga0501080_1105412 | 3300049742 | Bacteria | 684 |
| 692 | Ga0501081_0038695 | 3300049743 | Bacteria | 3260 |
| 693 | Ga0501081_0206551 | 3300049743 | Bacteria | 1425 |
| 694 | Ga0501081_0318836 | 3300049743 | Bacteria | 1142 |
| 695 | Ga0501081_0362369 | 3300049743 | Bacteria | 1069 |
| 696 | Ga0501083_0018378 | 3300049744 | Bacteria | 4872 |
| 697 | Ga0501083_0155206 | 3300049744 | Bacteria | 1499 |
| 698 | Ga0501083_0327450 | 3300049744 | Bacteria | 996 |
| 699 | Ga0501035_0053148 | 3300049822 | Bacteria | 3624 |
| 700 | Ga0501035_0311329 | 3300049822 | Bacteria | 1325 |
| 701 | Ga0501045_0023824 | 3300049824 | Bacteria | 4393 |
| 702 | Ga0501045_0097216 | 3300049824 | Bacteria | 2178 |
| 703 | Ga0501045_0610792 | 3300049824 | Bacteria | 807 |
| 704 | nmdc:mga05p37_273272_c1 | 3300050507 | Bacteria | 2018 |
| 705 | nmdc:mga05p37_295773_c1 | 3300050507 | Bacteria | 1926 |
| 706 | nmdc:mga05p37_70706_c1 | 3300050507 | Bacteria | 4293 |
| 707 | nmdc:mga05p37_71_c2 | 3300050507 | Bacteria | 60785 |
| 708 | nmdc:mga09592_2253_c1 | 3300050508 | Bacteria | 15524 |
| 709 | nmdc:mga09592_33396_c1 | 3300050508 | Bacteria | 4294 |
| 710 | nmdc:mga09592_584391_c1 | 3300050508 | Bacteria | 958 |
| 711 | nmdc:mga0qj67_254_c1 | 3300050509 | Bacteria | 36579 |
| 712 | nmdc:mga0qj67_613158_c1 | 3300050509 | Bacteria | 870 |
| 713 | nmdc:mga0qj67_623672_c1 | 3300050509 | Bacteria | 861 |
| 714 | nmdc:mga06r32_1565_c1 | 3300050510 | Bacteria | 20637 |
| 715 | nmdc:mga06r32_98331_c1 | 3300050510 | Bacteria | 2869 |
| 716 | nmdc:mga08y16_10021_c1 | 3300050511 | Bacteria | 9947 |
| 717 | nmdc:mga08y16_14527_c1 | 3300050511 | Bacteria | 8284 |
| 718 | nmdc:mga08y16_671322_c1 | 3300050511 | Bacteria | 1039 |
| 719 | nmdc:mga0n895_18142_c1 | 3300050512 | Bacteria | 6506 |
| 720 | nmdc:mga0n895_328516_c1 | 3300050512 | Bacteria | 1550 |
| 721 | nmdc:mga0n895_397475_c1 | 3300050512 | Bacteria | 1394 |
| 722 | nmdc:mga0rr50_253738_c1 | 3300050513 | Bacteria | 1461 |
| 723 | nmdc:mga0rr50_28747_c1 | 3300050513 | Bacteria | 3912 |
| 724 | nmdc:mga0rr50_44266_c1 | 3300050513 | Bacteria | 3264 |
| 725 | nmdc:mga0rr50_601444_c1 | 3300050513 | Bacteria | 937 |
| 726 | nmdc:mga08x19_137391_c1 | 3300050514 | Bacteria | 1649 |
| 727 | nmdc:mga08x19_29955_c1 | 3300050514 | Bacteria | 3416 |
| 728 | nmdc:mga0a205_1146184_c1 | 3300050515 | Bacteria | 625 |
| 729 | nmdc:mga0a205_186_c1 | 3300050515 | Bacteria | 42838 |
| 730 | nmdc:mga0a205_212060_c1 | 3300050515 | Bacteria | 1825 |
| 731 | nmdc:mga0a205_603_c1 | 3300050515 | Bacteria | 28564 |
| 732 | nmdc:mga0a205_958630_c1 | 3300050515 | Bacteria | 702 |
| 733 | Ga0495601_0063817 | 3300053077 | Bacteria | 2341 |
| 734 | Ga0495612_0396385 | 3300053078 | Bacteria | 627 |
| 735 | Ga0495655_0001448 | 3300053083 | Bacteria | 3631 |
| 736 | Ga0495595_0182556 | 3300053084 | Bacteria | 1041 |
| 737 | Ga0495595_0409570 | 3300053084 | Bacteria | 687 |
| 738 | Ga0495595_0439882 | 3300053084 | Bacteria | 662 |
| 739 | Ga0495619_0043670 | 3300053085 | Bacteria | 2939 |
| 740 | Ga0495619_0100928 | 3300053085 | Bacteria | 1964 |
| 741 | Ga0500573_0177570 | 3300053140 | Bacteria | 1147 |
| 742 | Ga0501084_0097418 | 3300054114 | Bacteria | 2469 |
| 743 | Ga0501084_0108308 | 3300054114 | Bacteria | 2334 |
| 744 | Ga0501084_0229430 | 3300054114 | Bacteria | 1567 |
| 745 | Ga0501084_0652719 | 3300054114 | Bacteria | 888 |
| 746 | Ga0590071_031392 | 3300059421 | Bacteria | 1267 |
| 747 | Ga0590074_021574 | 3300059423 | Bacteria | 1111 |
| 748 | Ga0501082_0045243 | 3300060353 | Bacteria | 3796 |
| 749 | Ga0501082_0058732 | 3300060353 | Bacteria | 3314 |
| 750 | Ga0501082_0098964 | 3300060353 | Bacteria | 2521 |
| 751 | Ga0501082_0122693 | 3300060353 | Bacteria | 2253 |
| 752 | Ga0501082_0139925 | 3300060353 | Bacteria | 2100 |
| 753 | Ga0530510_0075169 | 3300061734 | Bacteria | 2453 |
| 754 | Ga0530510_0176584 | 3300061734 | Bacteria | 1583 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0740292 | Ga0501076_0740292_404_796 | 129 |
| 2 | 3300006844 | Ga0075428_100003582 | Ga0075428_1000035822 | 150 |
| 3 | 3300009094 | Ga0111539_10005141 | Ga0111539_100051418 | 150 |
| 4 | 3300009094 | Ga0111539_10469891 | Ga0111539_104698911 | 150 |
| 5 | 3300009147 | Ga0114129_10153938 | Ga0114129_101539382 | 150 |
| 6 | 3300014969 | Ga0157376_12247899 | Ga0157376_122478991 | 150 |
| 7 | 3300021361 | Ga0213872_10036060 | Ga0213872_100360601 | 150 |
| 8 | 3300021361 | Ga0213872_10145270 | Ga0213872_101452701 | 150 |
| 9 | 3300027907 | Ga0207428_10010018 | Ga0207428_100100182 | 150 |
| 10 | 3300039447 | Ga0436361_0666217 | Ga0436361_0666217_3513_3968 | 150 |
| 11 | 3300039447 | Ga0436361_0819040 | Ga0436361_0819040_4997_5452 | 150 |
| 12 | 3300039447 | Ga0436361_0863493 | Ga0436361_0863493_383_838 | 150 |
| 13 | 3300041999 | Ga0439433_0044230 | Ga0439433_0044230_242_697 | 150 |
| 14 | 3300050507 | nmdc:mga05p37_273272_c1 | nmdc:mga05p37_273272_c1_174_629 | 150 |
| 15 | 3300050511 | nmdc:mga08y16_14527_c1 | nmdc:mga08y16_14527_c1_2220_2675 | 150 |
| 16 | 3300050515 | nmdc:mga0a205_958630_c1 | nmdc:mga0a205_958630_c1_65_520 | 150 |
| 17 | 3300005439 | Ga0070711_100458276 | Ga0070711_1004582762 | 151 |
| 18 | 3300005458 | Ga0070681_10036316 | Ga0070681_100363162 | 151 |
| 19 | 3300005614 | Ga0068856_101166912 | Ga0068856_1011669122 | 151 |
| 20 | 3300005983 | Ga0081540_1106663 | Ga0081540_11066632 | 151 |
| 21 | 3300006175 | Ga0070712_100357943 | Ga0070712_1003579432 | 151 |
| 22 | 3300009093 | Ga0105240_10101794 | Ga0105240_101017944 | 151 |
| 23 | 3300009553 | Ga0105249_11311248 | Ga0105249_113112482 | 151 |
| 24 | 3300013307 | Ga0157372_10061458 | Ga0157372_100614582 | 151 |
| 25 | 3300020069 | Ga0197907_11338434 | Ga0197907_113384341 | 151 |
| 26 | 3300020069 | Ga0197907_11500817 | Ga0197907_115008171 | 151 |
| 27 | 3300020070 | Ga0206356_10683826 | Ga0206356_106838262 | 151 |
| 28 | 3300020080 | Ga0206350_10309521 | Ga0206350_103095212 | 151 |
| 29 | 3300020081 | Ga0206354_10705081 | Ga0206354_107050811 | 151 |
| 30 | 3300021377 | Ga0213874_10131003 | Ga0213874_101310031 | 151 |
| 31 | 3300021384 | Ga0213876_10150809 | Ga0213876_101508092 | 151 |
| 32 | 3300021388 | Ga0213875_10036138 | Ga0213875_100361383 | 151 |
| 33 | 3300022467 | Ga0224712_10200467 | Ga0224712_102004671 | 151 |
| 34 | 3300022467 | Ga0224712_10281498 | Ga0224712_102814982 | 151 |
| 35 | 3300022467 | Ga0224712_10473638 | Ga0224712_104736381 | 151 |
| 36 | 3300025904 | Ga0207647_10153973 | Ga0207647_101539732 | 151 |
| 37 | 3300025912 | Ga0207707_10064245 | Ga0207707_100642452 | 151 |
| 38 | 3300025912 | Ga0207707_10539070 | Ga0207707_105390702 | 151 |
| 39 | 3300025917 | Ga0207660_10289305 | Ga0207660_102893052 | 151 |
| 40 | 3300025921 | Ga0207652_10783573 | Ga0207652_107835732 | 151 |
| 41 | 3300025949 | Ga0207667_10761467 | Ga0207667_107614672 | 151 |
| 42 | 3300031344 | Ga0265316_10324989 | Ga0265316_103249892 | 151 |
| 43 | 3300035119 | Ga0373956_0278593 | Ga0373956_0278593_17_475 | 151 |
| 44 | 3300035724 | Ga0373933_0125904 | Ga0373933_0125904_558_1016 | 151 |
| 45 | 3300036401 | Ga0373937_0023906 | Ga0373937_0023906_3206_3664 | 151 |
| 46 | 3300037466 | Ga0395898_0179065 | Ga0395898_0179065_963_1421 | 151 |
| 47 | 3300037853 | Ga0436364_1419253 | Ga0436364_1419253_313_771 | 151 |
| 48 | 3300039062 | Ga0400483_100023 | Ga0400483_100023_462_920 | 151 |
| 49 | 3300039437 | Ga0436365_0704032 | Ga0436365_0704032_186_644 | 151 |
| 50 | 3300039437 | Ga0436365_0909950 | Ga0436365_0909950_1147_1605 | 151 |
| 51 | 3300039437 | Ga0436365_1816817 | Ga0436365_1816817_448_906 | 151 |
| 52 | 3300039450 | Ga0436363_0902918 | Ga0436363_0902918_481_939 | 151 |
| 53 | 3300039453 | Ga0436362_0626657 | Ga0436362_0626657_668_1126 | 151 |
| 54 | 3300042876 | Ga0451577_0364153 | Ga0451577_0364153_483_971 | 151 |
| 55 | 3300044673 | Ga0453683_0017389 | Ga0453683_0017389_4052_4540 | 151 |
| 56 | 3300044712 | Ga0453684_0028811 | Ga0453684_0028811_3228_3716 | 151 |
| 57 | 3300045051 | Ga0451576_0220457 | Ga0451576_0220457_340_828 | 151 |
| 58 | 3300045836 | Ga0466958_0243534 | Ga0466958_0243534_196_654 | 151 |
| 59 | 3300045976 | Ga0466967_0165687 | Ga0466967_0165687_1374_1832 | 151 |
| 60 | 3300046472 | Ga0495580_0450470 | Ga0495580_0450470_311_769 | 151 |
| 61 | 3300046517 | Ga0495630_0280948 | Ga0495630_0280948_552_1010 | 151 |
| 62 | 3300046535 | Ga0495586_0229207 | Ga0495586_0229207_58_516 | 151 |
| 63 | 3300049586 | Ga0501070_0168233 | Ga0501070_0168233_493_951 | 151 |
| 64 | 3300050515 | nmdc:mga0a205_1146184_c1 | nmdc:mga0a205_1146184_c1_27_485 | 151 |
| 65 | 3300032002 | Ga0307416_100047655 | Ga0307416_1000476552 | 153 |
| 66 | 3300032004 | Ga0307414_10732001 | Ga0307414_107320011 | 153 |
| 67 | 3300049742 | Ga0501080_0732112 | Ga0501080_0732112_278_742 | 153 |
| 68 | 3300005471 | Ga0070698_100115481 | Ga0070698_1001154814 | 155 |
| 69 | 3300037471 | Ga0395905_0484351 | Ga0395905_0484351_515_985 | 155 |
| 70 | 3300001977 | JGI24746J21847_1018425 | JGI24746J21847_10184252 | 156 |
| 71 | 3300001979 | JGI24740J21852_10138953 | JGI24740J21852_101389531 | 156 |
| 72 | 3300001989 | JGI24739J22299_10057414 | JGI24739J22299_100574142 | 156 |
| 73 | 3300001990 | JGI24737J22298_10104162 | JGI24737J22298_101041621 | 156 |
| 74 | 3300001991 | JGI24743J22301_10019173 | JGI24743J22301_100191732 | 156 |
| 75 | 3300002070 | JGI24750J21931_1036118 | JGI24750J21931_10361181 | 156 |
| 76 | 3300002075 | JGI24738J21930_10018485 | JGI24738J21930_100184852 | 156 |
| 77 | 3300002076 | JGI24749J21850_1012118 | JGI24749J21850_10121181 | 156 |
| 78 | 3300002077 | JGI24744J21845_10051751 | JGI24744J21845_100517511 | 156 |
| 79 | 3300002239 | JGI24034J26672_10041921 | JGI24034J26672_100419211 | 156 |
| 80 | 3300002459 | JGI24751J29686_10028732 | JGI24751J29686_100287322 | 156 |
| 81 | 3300003781 | Ga0055536_1005701 | Ga0055536_10057013 | 156 |
| 82 | 3300004798 | Ga0058859_11736316 | Ga0058859_117363161 | 156 |
| 83 | 3300004799 | Ga0058863_10021980 | Ga0058863_100219801 | 156 |
| 84 | 3300004803 | Ga0058862_12148936 | Ga0058862_121489361 | 156 |
| 85 | 3300005295 | Ga0065707_10774067 | Ga0065707_107740671 | 156 |
| 86 | 3300005327 | Ga0070658_10106840 | Ga0070658_101068402 | 156 |
| 87 | 3300005327 | Ga0070658_10212384 | Ga0070658_102123843 | 156 |
| 88 | 3300005328 | Ga0070676_10020731 | Ga0070676_100207312 | 156 |
| 89 | 3300005329 | Ga0070683_100019514 | Ga0070683_1000195142 | 156 |
| 90 | 3300005329 | Ga0070683_100728171 | Ga0070683_1007281712 | 156 |
| 91 | 3300005330 | Ga0070690_100002142 | Ga0070690_1000021424 | 156 |
| 92 | 3300005330 | Ga0070690_101206075 | Ga0070690_1012060751 | 156 |
| 93 | 3300005331 | Ga0070670_100014885 | Ga0070670_1000148851 | 156 |
| 94 | 3300005334 | Ga0068869_100077072 | Ga0068869_1000770722 | 156 |
| 95 | 3300005335 | Ga0070666_10008032 | Ga0070666_100080321 | 156 |
| 96 | 3300005336 | Ga0070680_100036366 | Ga0070680_1000363661 | 156 |
| 97 | 3300005336 | Ga0070680_100080294 | Ga0070680_1000802943 | 156 |
| 98 | 3300005336 | Ga0070680_100142714 | Ga0070680_1001427142 | 156 |
| 99 | 3300005336 | Ga0070680_100282269 | Ga0070680_1002822692 | 156 |
| 100 | 3300005337 | Ga0070682_100002624 | Ga0070682_10000262413 | 156 |
| 101 | 3300005338 | Ga0068868_100004569 | Ga0068868_1000045696 | 156 |
| 102 | 3300005339 | Ga0070660_100002725 | Ga0070660_1000027259 | 156 |
| 103 | 3300005340 | Ga0070689_100004193 | Ga0070689_1000041937 | 156 |
| 104 | 3300005341 | Ga0070691_10012213 | Ga0070691_100122132 | 156 |
| 105 | 3300005343 | Ga0070687_100015260 | Ga0070687_1000152602 | 156 |
| 106 | 3300005343 | Ga0070687_100315716 | Ga0070687_1003157162 | 156 |
| 107 | 3300005344 | Ga0070661_100436918 | Ga0070661_1004369182 | 156 |
| 108 | 3300005345 | Ga0070692_10057767 | Ga0070692_100577672 | 156 |
| 109 | 3300005347 | Ga0070668_100000376 | Ga0070668_10000037610 | 156 |
| 110 | 3300005353 | Ga0070669_100030458 | Ga0070669_1000304581 | 156 |
| 111 | 3300005353 | Ga0070669_100069400 | Ga0070669_1000694003 | 156 |
| 112 | 3300005354 | Ga0070675_100017979 | Ga0070675_1000179793 | 156 |
| 113 | 3300005355 | Ga0070671_100009874 | Ga0070671_1000098744 | 156 |
| 114 | 3300005356 | Ga0070674_100022688 | Ga0070674_1000226885 | 156 |
| 115 | 3300005364 | Ga0070673_100004016 | Ga0070673_1000040165 | 156 |
| 116 | 3300005365 | Ga0070688_100000716 | Ga0070688_10000071610 | 156 |
| 117 | 3300005365 | Ga0070688_100678703 | Ga0070688_1006787032 | 156 |
| 118 | 3300005366 | Ga0070659_100023971 | Ga0070659_1000239712 | 156 |
| 119 | 3300005366 | Ga0070659_100083948 | Ga0070659_1000839482 | 156 |
| 120 | 3300005367 | Ga0070667_100009839 | Ga0070667_1000098392 | 156 |
| 121 | 3300005406 | Ga0070703_10028505 | Ga0070703_100285051 | 156 |
| 122 | 3300005434 | Ga0070709_10013694 | Ga0070709_100136942 | 156 |
| 123 | 3300005434 | Ga0070709_10019019 | Ga0070709_100190194 | 156 |
| 124 | 3300005434 | Ga0070709_10071440 | Ga0070709_100714402 | 156 |
| 125 | 3300005435 | Ga0070714_100007835 | Ga0070714_1000078356 | 156 |
| 126 | 3300005435 | Ga0070714_100228676 | Ga0070714_1002286762 | 156 |
| 127 | 3300005435 | Ga0070714_100528163 | Ga0070714_1005281632 | 156 |
| 128 | 3300005435 | Ga0070714_100882598 | Ga0070714_1008825982 | 156 |
| 129 | 3300005435 | Ga0070714_101511110 | Ga0070714_1015111101 | 156 |
| 130 | 3300005436 | Ga0070713_100003311 | Ga0070713_1000033119 | 156 |
| 131 | 3300005436 | Ga0070713_100074696 | Ga0070713_1000746962 | 156 |
| 132 | 3300005436 | Ga0070713_100120415 | Ga0070713_1001204151 | 156 |
| 133 | 3300005436 | Ga0070713_100377453 | Ga0070713_1003774533 | 156 |
| 134 | 3300005437 | Ga0070710_10005364 | Ga0070710_100053642 | 156 |
| 135 | 3300005437 | Ga0070710_10026516 | Ga0070710_100265161 | 156 |
| 136 | 3300005437 | Ga0070710_10497872 | Ga0070710_104978721 | 156 |
| 137 | 3300005437 | Ga0070710_10578842 | Ga0070710_105788421 | 156 |
| 138 | 3300005438 | Ga0070701_10001121 | Ga0070701_100011213 | 156 |
| 139 | 3300005439 | Ga0070711_100008572 | Ga0070711_1000085724 | 156 |
| 140 | 3300005439 | Ga0070711_100021230 | Ga0070711_1000212302 | 156 |
| 141 | 3300005439 | Ga0070711_101168444 | Ga0070711_1011684441 | 156 |
| 142 | 3300005440 | Ga0070705_100005414 | Ga0070705_1000054142 | 156 |
| 143 | 3300005441 | Ga0070700_100003167 | Ga0070700_1000031674 | 156 |
| 144 | 3300005444 | Ga0070694_100001113 | Ga0070694_1000011137 | 156 |
| 145 | 3300005444 | Ga0070694_100785233 | Ga0070694_1007852332 | 156 |
| 146 | 3300005455 | Ga0070663_100012931 | Ga0070663_1000129317 | 156 |
| 147 | 3300005456 | Ga0070678_100001623 | Ga0070678_1000016232 | 156 |
| 148 | 3300005457 | Ga0070662_100003055 | Ga0070662_1000030552 | 156 |
| 149 | 3300005458 | Ga0070681_10035427 | Ga0070681_100354274 | 156 |
| 150 | 3300005458 | Ga0070681_10131879 | Ga0070681_101318793 | 156 |
| 151 | 3300005458 | Ga0070681_10149663 | Ga0070681_101496632 | 156 |
| 152 | 3300005458 | Ga0070681_10614958 | Ga0070681_106149582 | 156 |
| 153 | 3300005458 | Ga0070681_10758819 | Ga0070681_107588191 | 156 |
| 154 | 3300005459 | Ga0068867_100002464 | Ga0068867_1000024641 | 156 |
| 155 | 3300005466 | Ga0070685_10042928 | Ga0070685_100429282 | 156 |
| 156 | 3300005466 | Ga0070685_10513257 | Ga0070685_105132572 | 156 |
| 157 | 3300005468 | Ga0070707_100363541 | Ga0070707_1003635412 | 156 |
| 158 | 3300005468 | Ga0070707_101788797 | Ga0070707_1017887971 | 156 |
| 159 | 3300005471 | Ga0070698_100002609 | Ga0070698_10000260914 | 156 |
| 160 | 3300005471 | Ga0070698_100319275 | Ga0070698_1003192751 | 156 |
| 161 | 3300005518 | Ga0070699_100153636 | Ga0070699_1001536363 | 156 |
| 162 | 3300005530 | Ga0070679_100001558 | Ga0070679_1000015582 | 156 |
| 163 | 3300005530 | Ga0070679_100025585 | Ga0070679_1000255854 | 156 |
| 164 | 3300005530 | Ga0070679_100039238 | Ga0070679_1000392382 | 156 |
| 165 | 3300005530 | Ga0070679_100236378 | Ga0070679_1002363782 | 156 |
| 166 | 3300005530 | Ga0070679_100433753 | Ga0070679_1004337533 | 156 |
| 167 | 3300005530 | Ga0070679_100670706 | Ga0070679_1006707062 | 156 |
| 168 | 3300005530 | Ga0070679_100915508 | Ga0070679_1009155081 | 156 |
| 169 | 3300005535 | Ga0070684_100220675 | Ga0070684_1002206752 | 156 |
| 170 | 3300005536 | Ga0070697_100002320 | Ga0070697_1000023208 | 156 |
| 171 | 3300005536 | Ga0070697_100045810 | Ga0070697_1000458102 | 156 |
| 172 | 3300005536 | Ga0070697_100162926 | Ga0070697_1001629262 | 156 |
| 173 | 3300005536 | Ga0070697_100847432 | Ga0070697_1008474322 | 156 |
| 174 | 3300005539 | Ga0068853_100001909 | Ga0068853_10000190915 | 156 |
| 175 | 3300005543 | Ga0070672_100118847 | Ga0070672_1001188472 | 156 |
| 176 | 3300005544 | Ga0070686_100001615 | Ga0070686_1000016157 | 156 |
| 177 | 3300005544 | Ga0070686_100145198 | Ga0070686_1001451982 | 156 |
| 178 | 3300005544 | Ga0070686_100246242 | Ga0070686_1002462422 | 156 |
| 179 | 3300005545 | Ga0070695_100005745 | Ga0070695_1000057453 | 156 |
| 180 | 3300005545 | Ga0070695_100202171 | Ga0070695_1002021712 | 156 |
| 181 | 3300005546 | Ga0070696_100009145 | Ga0070696_1000091452 | 156 |
| 182 | 3300005547 | Ga0070693_100057045 | Ga0070693_1000570452 | 156 |
| 183 | 3300005548 | Ga0070665_100345994 | Ga0070665_1003459942 | 156 |
| 184 | 3300005549 | Ga0070704_100006944 | Ga0070704_1000069443 | 156 |
| 185 | 3300005549 | Ga0070704_100516338 | Ga0070704_1005163382 | 156 |
| 186 | 3300005563 | Ga0068855_100080130 | Ga0068855_1000801303 | 156 |
| 187 | 3300005563 | Ga0068855_101370484 | Ga0068855_1013704842 | 156 |
| 188 | 3300005564 | Ga0070664_100002115 | Ga0070664_1000021153 | 156 |
| 189 | 3300005577 | Ga0068857_100014232 | Ga0068857_1000142324 | 156 |
| 190 | 3300005578 | Ga0068854_100031138 | Ga0068854_1000311383 | 156 |
| 191 | 3300005614 | Ga0068856_100009612 | Ga0068856_1000096125 | 156 |
| 192 | 3300005614 | Ga0068856_100246778 | Ga0068856_1002467782 | 156 |
| 193 | 3300005615 | Ga0070702_100000110 | Ga0070702_10000011012 | 156 |
| 194 | 3300005615 | Ga0070702_100551391 | Ga0070702_1005513912 | 156 |
| 195 | 3300005616 | Ga0068852_100014700 | Ga0068852_1000147002 | 156 |
| 196 | 3300005617 | Ga0068859_100035260 | Ga0068859_1000352605 | 156 |
| 197 | 3300005618 | Ga0068864_100961724 | Ga0068864_1009617241 | 156 |
| 198 | 3300005718 | Ga0068866_10007211 | Ga0068866_100072112 | 156 |
| 199 | 3300005719 | Ga0068861_100053023 | Ga0068861_1000530232 | 156 |
| 200 | 3300005834 | Ga0068851_10141964 | Ga0068851_101419642 | 156 |
| 201 | 3300005841 | Ga0068863_100003256 | Ga0068863_1000032565 | 156 |
| 202 | 3300005842 | Ga0068858_100004547 | Ga0068858_10000454710 | 156 |
| 203 | 3300005843 | Ga0068860_100033018 | Ga0068860_1000330182 | 156 |
| 204 | 3300005843 | Ga0068860_101399741 | Ga0068860_1013997411 | 156 |
| 205 | 3300005844 | Ga0068862_100001176 | Ga0068862_10000117611 | 156 |
| 206 | 3300005844 | Ga0068862_101812004 | Ga0068862_1018120041 | 156 |
| 207 | 3300005937 | Ga0081455_10000393 | Ga0081455_100003933 | 156 |
| 208 | 3300005937 | Ga0081455_10015402 | Ga0081455_100154022 | 156 |
| 209 | 3300005937 | Ga0081455_10210092 | Ga0081455_102100922 | 156 |
| 210 | 3300005983 | Ga0081540_1005532 | Ga0081540_10055326 | 156 |
| 211 | 3300005983 | Ga0081540_1006326 | Ga0081540_10063262 | 156 |
| 212 | 3300005983 | Ga0081540_1025362 | Ga0081540_10253622 | 156 |
| 213 | 3300006028 | Ga0070717_10000755 | Ga0070717_100007554 | 156 |
| 214 | 3300006028 | Ga0070717_10088692 | Ga0070717_100886923 | 156 |
| 215 | 3300006028 | Ga0070717_10842952 | Ga0070717_108429521 | 156 |
| 216 | 3300006028 | Ga0070717_11069430 | Ga0070717_110694302 | 156 |
| 217 | 3300006058 | Ga0075432_10003839 | Ga0075432_100038391 | 156 |
| 218 | 3300006058 | Ga0075432_10050954 | Ga0075432_100509542 | 156 |
| 219 | 3300006163 | Ga0070715_10037993 | Ga0070715_100379931 | 156 |
| 220 | 3300006163 | Ga0070715_10120587 | Ga0070715_101205872 | 156 |
| 221 | 3300006163 | Ga0070715_10331566 | Ga0070715_103315662 | 156 |
| 222 | 3300006173 | Ga0070716_100000813 | Ga0070716_10000081319 | 156 |
| 223 | 3300006173 | Ga0070716_100047414 | Ga0070716_1000474142 | 156 |
| 224 | 3300006175 | Ga0070712_100005408 | Ga0070712_1000054085 | 156 |
| 225 | 3300006175 | Ga0070712_100006409 | Ga0070712_1000064094 | 156 |
| 226 | 3300006175 | Ga0070712_100049760 | Ga0070712_1000497602 | 156 |
| 227 | 3300006175 | Ga0070712_100083928 | Ga0070712_1000839282 | 156 |
| 228 | 3300006175 | Ga0070712_100107707 | Ga0070712_1001077072 | 156 |
| 229 | 3300006175 | Ga0070712_100513712 | Ga0070712_1005137122 | 156 |
| 230 | 3300006175 | Ga0070712_101061667 | Ga0070712_1010616671 | 156 |
| 231 | 3300006194 | Ga0075427_10005123 | Ga0075427_100051232 | 156 |
| 232 | 3300006237 | Ga0097621_100660997 | Ga0097621_1006609971 | 156 |
| 233 | 3300006237 | Ga0097621_100757775 | Ga0097621_1007577752 | 156 |
| 234 | 3300006844 | Ga0075428_100001364 | Ga0075428_10000136414 | 156 |
| 235 | 3300006844 | Ga0075428_100675474 | Ga0075428_1006754742 | 156 |
| 236 | 3300006844 | Ga0075428_100777146 | Ga0075428_1007771462 | 156 |
| 237 | 3300006846 | Ga0075430_100000565 | Ga0075430_10000056512 | 156 |
| 238 | 3300006846 | Ga0075430_100151982 | Ga0075430_1001519824 | 156 |
| 239 | 3300006846 | Ga0075430_100649312 | Ga0075430_1006493121 | 156 |
| 240 | 3300006846 | Ga0075430_100876153 | Ga0075430_1008761531 | 156 |
| 241 | 3300006847 | Ga0075431_100001518 | Ga0075431_10000151815 | 156 |
| 242 | 3300006847 | Ga0075431_100572539 | Ga0075431_1005725392 | 156 |
| 243 | 3300006852 | Ga0075433_10000126 | Ga0075433_1000012612 | 156 |
| 244 | 3300006852 | Ga0075433_10001448 | Ga0075433_100014482 | 156 |
| 245 | 3300006852 | Ga0075433_10583882 | Ga0075433_105838822 | 156 |
| 246 | 3300006871 | Ga0075434_100000393 | Ga0075434_10000039312 | 156 |
| 247 | 3300006871 | Ga0075434_100000572 | Ga0075434_10000057216 | 156 |
| 248 | 3300006871 | Ga0075434_100426252 | Ga0075434_1004262524 | 156 |
| 249 | 3300006871 | Ga0075434_101394810 | Ga0075434_1013948101 | 156 |
| 250 | 3300006880 | Ga0075429_100000531 | Ga0075429_10000053117 | 156 |
| 251 | 3300006880 | Ga0075429_100046549 | Ga0075429_1000465494 | 156 |
| 252 | 3300006880 | Ga0075429_100772130 | Ga0075429_1007721302 | 156 |
| 253 | 3300006881 | Ga0068865_100002919 | Ga0068865_1000029198 | 156 |
| 254 | 3300006914 | Ga0075436_100022371 | Ga0075436_1000223712 | 156 |
| 255 | 3300006931 | Ga0097620_100035256 | Ga0097620_1000352565 | 156 |
| 256 | 3300007076 | Ga0075435_100001611 | Ga0075435_1000016117 | 156 |
| 257 | 3300007076 | Ga0075435_100023273 | Ga0075435_1000232733 | 156 |
| 258 | 3300007076 | Ga0075435_100030125 | Ga0075435_1000301252 | 156 |
| 259 | 3300007076 | Ga0075435_100182727 | Ga0075435_1001827275 | 156 |
| 260 | 3300007076 | Ga0075435_100934842 | Ga0075435_1009348421 | 156 |
| 261 | 3300007788 | Ga0099795_10055890 | Ga0099795_100558903 | 156 |
| 262 | 3300009011 | Ga0105251_10087930 | Ga0105251_100879301 | 156 |
| 263 | 3300009036 | Ga0105244_10180822 | Ga0105244_101808222 | 156 |
| 264 | 3300009092 | Ga0105250_10009593 | Ga0105250_100095932 | 156 |
| 265 | 3300009093 | Ga0105240_10059223 | Ga0105240_100592232 | 156 |
| 266 | 3300009094 | Ga0111539_10000954 | Ga0111539_1000095424 | 156 |
| 267 | 3300009094 | Ga0111539_10836499 | Ga0111539_108364992 | 156 |
| 268 | 3300009094 | Ga0111539_10877760 | Ga0111539_108777602 | 156 |
| 269 | 3300009098 | Ga0105245_10022595 | Ga0105245_100225953 | 156 |
| 270 | 3300009101 | Ga0105247_10001876 | Ga0105247_100018767 | 156 |
| 271 | 3300009101 | Ga0105247_10104621 | Ga0105247_101046212 | 156 |
| 272 | 3300009147 | Ga0114129_10039564 | Ga0114129_100395643 | 156 |
| 273 | 3300009147 | Ga0114129_10265055 | Ga0114129_102650552 | 156 |
| 274 | 3300009147 | Ga0114129_10995848 | Ga0114129_109958482 | 156 |
| 275 | 3300009148 | Ga0105243_10008763 | Ga0105243_100087632 | 156 |
| 276 | 3300009148 | Ga0105243_10264322 | Ga0105243_102643222 | 156 |
| 277 | 3300009174 | Ga0105241_10007439 | Ga0105241_100074397 | 156 |
| 278 | 3300009176 | Ga0105242_10116504 | Ga0105242_101165042 | 156 |
| 279 | 3300009177 | Ga0105248_10004856 | Ga0105248_100048562 | 156 |
| 280 | 3300009177 | Ga0105248_10618853 | Ga0105248_106188532 | 156 |
| 281 | 3300009177 | Ga0105248_10648917 | Ga0105248_106489171 | 156 |
| 282 | 3300009545 | Ga0105237_10004828 | Ga0105237_100048282 | 156 |
| 283 | 3300009551 | Ga0105238_10096976 | Ga0105238_100969762 | 156 |
| 284 | 3300009553 | Ga0105249_10000914 | Ga0105249_1000091411 | 156 |
| 285 | 3300010159 | Ga0099796_10005898 | Ga0099796_100058982 | 156 |
| 286 | 3300010375 | Ga0105239_10006584 | Ga0105239_100065846 | 156 |
| 287 | 3300011119 | Ga0105246_10001402 | Ga0105246_100014026 | 156 |
| 288 | 3300012475 | Ga0157317_1005551 | Ga0157317_10055512 | 156 |
| 289 | 3300012478 | Ga0157328_1001584 | Ga0157328_10015841 | 156 |
| 290 | 3300013100 | Ga0157373_10074412 | Ga0157373_100744122 | 156 |
| 291 | 3300013102 | Ga0157371_10002409 | Ga0157371_100024096 | 156 |
| 292 | 3300013102 | Ga0157371_10177299 | Ga0157371_101772992 | 156 |
| 293 | 3300013104 | Ga0157370_10085525 | Ga0157370_100855253 | 156 |
| 294 | 3300013104 | Ga0157370_10151923 | Ga0157370_101519232 | 156 |
| 295 | 3300013104 | Ga0157370_10348894 | Ga0157370_103488941 | 156 |
| 296 | 3300013105 | Ga0157369_10004115 | Ga0157369_100041152 | 156 |
| 297 | 3300013105 | Ga0157369_10010257 | Ga0157369_1001025714 | 156 |
| 298 | 3300013105 | Ga0157369_10343057 | Ga0157369_103430573 | 156 |
| 299 | 3300013105 | Ga0157369_11111164 | Ga0157369_111111641 | 156 |
| 300 | 3300013296 | Ga0157374_10023226 | Ga0157374_100232262 | 156 |
| 301 | 3300013296 | Ga0157374_10886412 | Ga0157374_108864122 | 156 |
| 302 | 3300013296 | Ga0157374_11144284 | Ga0157374_111442841 | 156 |
| 303 | 3300013297 | Ga0157378_10007071 | Ga0157378_1000707110 | 156 |
| 304 | 3300013306 | Ga0163162_10136687 | Ga0163162_101366873 | 156 |
| 305 | 3300013306 | Ga0163162_10325816 | Ga0163162_103258161 | 156 |
| 306 | 3300013307 | Ga0157372_10052459 | Ga0157372_100524593 | 156 |
| 307 | 3300013307 | Ga0157372_10742363 | Ga0157372_107423632 | 156 |
| 308 | 3300013308 | Ga0157375_10069209 | Ga0157375_100692092 | 156 |
| 309 | 3300013308 | Ga0157375_11714282 | Ga0157375_117142821 | 156 |
| 310 | 3300014325 | Ga0163163_10086134 | Ga0163163_100861342 | 156 |
| 311 | 3300014325 | Ga0163163_10543768 | Ga0163163_105437682 | 156 |
| 312 | 3300014325 | Ga0163163_11624789 | Ga0163163_116247891 | 156 |
| 313 | 3300014325 | Ga0163163_11811369 | Ga0163163_118113691 | 156 |
| 314 | 3300014326 | Ga0157380_10007096 | Ga0157380_100070966 | 156 |
| 315 | 3300014326 | Ga0157380_10136283 | Ga0157380_101362832 | 156 |
| 316 | 3300014497 | Ga0182008_10023771 | Ga0182008_100237714 | 156 |
| 317 | 3300014968 | Ga0157379_10006126 | Ga0157379_100061263 | 156 |
| 318 | 3300014968 | Ga0157379_11890102 | Ga0157379_118901021 | 156 |
| 319 | 3300014969 | Ga0157376_10001070 | Ga0157376_100010707 | 156 |
| 320 | 3300014969 | Ga0157376_10380898 | Ga0157376_103808982 | 156 |
| 321 | 3300014969 | Ga0157376_10499584 | Ga0157376_104995842 | 156 |
| 322 | 3300014969 | Ga0157376_10792377 | Ga0157376_107923771 | 156 |
| 323 | 3300015262 | Ga0182007_10056846 | Ga0182007_100568462 | 156 |
| 324 | 3300017792 | Ga0163161_10002750 | Ga0163161_100027502 | 156 |
| 325 | 3300019161 | Ga0184602_101631 | Ga0184602_1016311 | 156 |
| 326 | 3300020069 | Ga0197907_10394529 | Ga0197907_103945291 | 156 |
| 327 | 3300020076 | Ga0206355_1200295 | Ga0206355_12002951 | 156 |
| 328 | 3300020078 | Ga0206352_11045053 | Ga0206352_110450532 | 156 |
| 329 | 3300020082 | Ga0206353_10939575 | Ga0206353_109395751 | 156 |
| 330 | 3300021358 | Ga0213873_10018764 | Ga0213873_100187642 | 156 |
| 331 | 3300021377 | Ga0213874_10025053 | Ga0213874_100250533 | 156 |
| 332 | 3300021384 | Ga0213876_10315869 | Ga0213876_103158691 | 156 |
| 333 | 3300021388 | Ga0213875_10011874 | Ga0213875_100118742 | 156 |
| 334 | 3300021388 | Ga0213875_10261519 | Ga0213875_102615191 | 156 |
| 335 | 3300023660 | Ga0247550_100224 | Ga0247550_1002242 | 156 |
| 336 | 3300024227 | Ga0228598_1049194 | Ga0228598_10491941 | 156 |
| 337 | 3300025292 | Ga0209676_1000256 | Ga0209676_100025632 | 156 |
| 338 | 3300025298 | Ga0209050_1005370 | Ga0209050_10053705 | 156 |
| 339 | 3300025321 | Ga0207656_10102532 | Ga0207656_101025322 | 156 |
| 340 | 3300025711 | Ga0207696_1016029 | Ga0207696_10160291 | 156 |
| 341 | 3300025735 | Ga0207713_1196926 | Ga0207713_11969261 | 156 |
| 342 | 3300025885 | Ga0207653_10008058 | Ga0207653_100080583 | 156 |
| 343 | 3300025898 | Ga0207692_10001791 | Ga0207692_100017916 | 156 |
| 344 | 3300025898 | Ga0207692_10018922 | Ga0207692_100189223 | 156 |
| 345 | 3300025898 | Ga0207692_10246024 | Ga0207692_102460242 | 156 |
| 346 | 3300025899 | Ga0207642_10144275 | Ga0207642_101442752 | 156 |
| 347 | 3300025900 | Ga0207710_10005196 | Ga0207710_100051962 | 156 |
| 348 | 3300025901 | Ga0207688_10003708 | Ga0207688_100037082 | 156 |
| 349 | 3300025903 | Ga0207680_10016657 | Ga0207680_100166572 | 156 |
| 350 | 3300025904 | Ga0207647_10006532 | Ga0207647_100065322 | 156 |
| 351 | 3300025905 | Ga0207685_10031345 | Ga0207685_100313452 | 156 |
| 352 | 3300025905 | Ga0207685_10373655 | Ga0207685_103736551 | 156 |
| 353 | 3300025906 | Ga0207699_10058501 | Ga0207699_100585012 | 156 |
| 354 | 3300025906 | Ga0207699_10262516 | Ga0207699_102625162 | 156 |
| 355 | 3300025906 | Ga0207699_10486636 | Ga0207699_104866362 | 156 |
| 356 | 3300025907 | Ga0207645_10003136 | Ga0207645_100031362 | 156 |
| 357 | 3300025909 | Ga0207705_10100876 | Ga0207705_101008762 | 156 |
| 358 | 3300025909 | Ga0207705_10648786 | Ga0207705_106487862 | 156 |
| 359 | 3300025911 | Ga0207654_10004248 | Ga0207654_100042484 | 156 |
| 360 | 3300025912 | Ga0207707_10004903 | Ga0207707_100049034 | 156 |
| 361 | 3300025912 | Ga0207707_10024365 | Ga0207707_100243654 | 156 |
| 362 | 3300025912 | Ga0207707_10114973 | Ga0207707_101149733 | 156 |
| 363 | 3300025912 | Ga0207707_10626820 | Ga0207707_106268202 | 156 |
| 364 | 3300025913 | Ga0207695_10079426 | Ga0207695_100794264 | 156 |
| 365 | 3300025913 | Ga0207695_10102075 | Ga0207695_101020752 | 156 |
| 366 | 3300025913 | Ga0207695_10315019 | Ga0207695_103150192 | 156 |
| 367 | 3300025914 | Ga0207671_10057004 | Ga0207671_100570042 | 156 |
| 368 | 3300025915 | Ga0207693_10000133 | Ga0207693_1000013359 | 156 |
| 369 | 3300025915 | Ga0207693_10002561 | Ga0207693_100025617 | 156 |
| 370 | 3300025915 | Ga0207693_10014015 | Ga0207693_100140154 | 156 |
| 371 | 3300025915 | Ga0207693_10056665 | Ga0207693_100566652 | 156 |
| 372 | 3300025915 | Ga0207693_10072969 | Ga0207693_100729693 | 156 |
| 373 | 3300025915 | Ga0207693_10678572 | Ga0207693_106785721 | 156 |
| 374 | 3300025916 | Ga0207663_10104205 | Ga0207663_101042051 | 156 |
| 375 | 3300025916 | Ga0207663_10238755 | Ga0207663_102387552 | 156 |
| 376 | 3300025916 | Ga0207663_10303876 | Ga0207663_103038762 | 156 |
| 377 | 3300025917 | Ga0207660_10070521 | Ga0207660_100705212 | 156 |
| 378 | 3300025917 | Ga0207660_10105796 | Ga0207660_101057962 | 156 |
| 379 | 3300025917 | Ga0207660_10119948 | Ga0207660_101199482 | 156 |
| 380 | 3300025918 | Ga0207662_10136076 | Ga0207662_101360762 | 156 |
| 381 | 3300025919 | Ga0207657_10001128 | Ga0207657_100011286 | 156 |
| 382 | 3300025920 | Ga0207649_10054047 | Ga0207649_100540472 | 156 |
| 383 | 3300025921 | Ga0207652_10118118 | Ga0207652_101181183 | 156 |
| 384 | 3300025921 | Ga0207652_10188746 | Ga0207652_101887462 | 156 |
| 385 | 3300025921 | Ga0207652_10257717 | Ga0207652_102577172 | 156 |
| 386 | 3300025922 | Ga0207646_10212763 | Ga0207646_102127632 | 156 |
| 387 | 3300025923 | Ga0207681_10033342 | Ga0207681_100333423 | 156 |
| 388 | 3300025923 | Ga0207681_10070595 | Ga0207681_100705953 | 156 |
| 389 | 3300025924 | Ga0207694_10063947 | Ga0207694_100639472 | 156 |
| 390 | 3300025925 | Ga0207650_10022731 | Ga0207650_100227312 | 156 |
| 391 | 3300025925 | Ga0207650_10281582 | Ga0207650_102815822 | 156 |
| 392 | 3300025926 | Ga0207659_10027019 | Ga0207659_100270192 | 156 |
| 393 | 3300025927 | Ga0207687_10125270 | Ga0207687_101252702 | 156 |
| 394 | 3300025928 | Ga0207700_10032759 | Ga0207700_100327592 | 156 |
| 395 | 3300025928 | Ga0207700_10065789 | Ga0207700_100657893 | 156 |
| 396 | 3300025928 | Ga0207700_10091840 | Ga0207700_100918403 | 156 |
| 397 | 3300025928 | Ga0207700_10210610 | Ga0207700_102106102 | 156 |
| 398 | 3300025928 | Ga0207700_10622316 | Ga0207700_106223162 | 156 |
| 399 | 3300025929 | Ga0207664_10010395 | Ga0207664_100103952 | 156 |
| 400 | 3300025929 | Ga0207664_10346695 | Ga0207664_103466951 | 156 |
| 401 | 3300025929 | Ga0207664_10509901 | Ga0207664_105099012 | 156 |
| 402 | 3300025929 | Ga0207664_10572016 | Ga0207664_105720161 | 156 |
| 403 | 3300025929 | Ga0207664_11167425 | Ga0207664_111674251 | 156 |
| 404 | 3300025932 | Ga0207690_10091782 | Ga0207690_100917822 | 156 |
| 405 | 3300025932 | Ga0207690_10350395 | Ga0207690_103503952 | 156 |
| 406 | 3300025933 | Ga0207706_10000195 | Ga0207706_1000019561 | 156 |
| 407 | 3300025934 | Ga0207686_10017996 | Ga0207686_100179961 | 156 |
| 408 | 3300025935 | Ga0207709_10035084 | Ga0207709_100350842 | 156 |
| 409 | 3300025936 | Ga0207670_10043823 | Ga0207670_100438232 | 156 |
| 410 | 3300025937 | Ga0207669_10809179 | Ga0207669_108091791 | 156 |
| 411 | 3300025938 | Ga0207704_10020332 | Ga0207704_100203324 | 156 |
| 412 | 3300025939 | Ga0207665_10000068 | Ga0207665_1000006818 | 156 |
| 413 | 3300025939 | Ga0207665_10118516 | Ga0207665_101185163 | 156 |
| 414 | 3300025939 | Ga0207665_10260148 | Ga0207665_102601482 | 156 |
| 415 | 3300025940 | Ga0207691_10028162 | Ga0207691_100281622 | 156 |
| 416 | 3300025941 | Ga0207711_10018110 | Ga0207711_100181104 | 156 |
| 417 | 3300025942 | Ga0207689_10086451 | Ga0207689_100864512 | 156 |
| 418 | 3300025944 | Ga0207661_10216974 | Ga0207661_102169742 | 156 |
| 419 | 3300025944 | Ga0207661_10733309 | Ga0207661_107333092 | 156 |
| 420 | 3300025945 | Ga0207679_10354102 | Ga0207679_103541022 | 156 |
| 421 | 3300025945 | Ga0207679_10490371 | Ga0207679_104903712 | 156 |
| 422 | 3300025949 | Ga0207667_10024633 | Ga0207667_100246333 | 156 |
| 423 | 3300025949 | Ga0207667_10537731 | Ga0207667_105377312 | 156 |
| 424 | 3300025949 | Ga0207667_10810425 | Ga0207667_108104252 | 156 |
| 425 | 3300025960 | Ga0207651_10002885 | Ga0207651_100028853 | 156 |
| 426 | 3300025961 | Ga0207712_10010392 | Ga0207712_100103923 | 156 |
| 427 | 3300025972 | Ga0207668_10071575 | Ga0207668_100715752 | 156 |
| 428 | 3300025981 | Ga0207640_10289804 | Ga0207640_102898042 | 156 |
| 429 | 3300025986 | Ga0207658_10014654 | Ga0207658_100146541 | 156 |
| 430 | 3300025986 | Ga0207658_10793819 | Ga0207658_107938191 | 156 |
| 431 | 3300026023 | Ga0207677_10025401 | Ga0207677_100254012 | 156 |
| 432 | 3300026035 | Ga0207703_10161212 | Ga0207703_101612122 | 156 |
| 433 | 3300026041 | Ga0207639_10009419 | Ga0207639_100094193 | 156 |
| 434 | 3300026067 | Ga0207678_10000128 | Ga0207678_1000012822 | 156 |
| 435 | 3300026075 | Ga0207708_10002350 | Ga0207708_100023507 | 156 |
| 436 | 3300026078 | Ga0207702_10095875 | Ga0207702_100958753 | 156 |
| 437 | 3300026078 | Ga0207702_10177059 | Ga0207702_101770593 | 156 |
| 438 | 3300026088 | Ga0207641_10297380 | Ga0207641_102973802 | 156 |
| 439 | 3300026089 | Ga0207648_10005087 | Ga0207648_1000508711 | 156 |
| 440 | 3300026095 | Ga0207676_10225010 | Ga0207676_102250101 | 156 |
| 441 | 3300026116 | Ga0207674_10000779 | Ga0207674_1000077926 | 156 |
| 442 | 3300026118 | Ga0207675_100001033 | Ga0207675_10000103320 | 156 |
| 443 | 3300026121 | Ga0207683_10000553 | Ga0207683_100005539 | 156 |
| 444 | 3300026142 | Ga0207698_10016409 | Ga0207698_100164092 | 156 |
| 445 | 3300027512 | Ga0209179_1019179 | Ga0209179_10191792 | 156 |
| 446 | 3300027543 | Ga0209999_1020169 | Ga0209999_10201692 | 156 |
| 447 | 3300027617 | Ga0210002_1054009 | Ga0210002_10540091 | 156 |
| 448 | 3300027665 | Ga0209983_1023805 | Ga0209983_10238052 | 156 |
| 449 | 3300027682 | Ga0209971_1073413 | Ga0209971_10734133 | 156 |
| 450 | 3300027717 | Ga0209998_10008320 | Ga0209998_100083202 | 156 |
| 451 | 3300027717 | Ga0209998_10087786 | Ga0209998_100877861 | 156 |
| 452 | 3300027876 | Ga0209974_10013053 | Ga0209974_100130532 | 156 |
| 453 | 3300027876 | Ga0209974_10314048 | Ga0209974_103140482 | 156 |
| 454 | 3300027907 | Ga0207428_10000200 | Ga0207428_1000020052 | 156 |
| 455 | 3300027907 | Ga0207428_10172852 | Ga0207428_101728521 | 156 |
| 456 | 3300027907 | Ga0207428_10388048 | Ga0207428_103880482 | 156 |
| 457 | 3300028379 | Ga0268266_10142324 | Ga0268266_101423243 | 156 |
| 458 | 3300028380 | Ga0268265_10321389 | Ga0268265_103213891 | 156 |
| 459 | 3300028380 | Ga0268265_10347817 | Ga0268265_103478172 | 156 |
| 460 | 3300028381 | Ga0268264_10986751 | Ga0268264_109867512 | 156 |
| 461 | 3300028381 | Ga0268264_11193804 | Ga0268264_111938041 | 156 |
| 462 | 3300028800 | Ga0265338_10064804 | Ga0265338_100648042 | 156 |
| 463 | 3300028800 | Ga0265338_10122535 | Ga0265338_101225352 | 156 |
| 464 | 3300030863 | Ga0265766_1013371 | Ga0265766_10133711 | 156 |
| 465 | 3300031241 | Ga0265325_10000092 | Ga0265325_1000009267 | 156 |
| 466 | 3300031247 | Ga0265340_10016361 | Ga0265340_100163612 | 156 |
| 467 | 3300031249 | Ga0265339_10007234 | Ga0265339_100072343 | 156 |
| 468 | 3300031249 | Ga0265339_10104178 | Ga0265339_101041782 | 156 |
| 469 | 3300031251 | Ga0265327_10001216 | Ga0265327_1000121619 | 156 |
| 470 | 3300031344 | Ga0265316_10036056 | Ga0265316_100360562 | 156 |
| 471 | 3300031548 | Ga0307408_100030599 | Ga0307408_1000305992 | 156 |
| 472 | 3300031548 | Ga0307408_100495120 | Ga0307408_1004951202 | 156 |
| 473 | 3300031595 | Ga0265313_10001177 | Ga0265313_100011779 | 156 |
| 474 | 3300031731 | Ga0307405_10039197 | Ga0307405_100391972 | 156 |
| 475 | 3300031824 | Ga0307413_10687309 | Ga0307413_106873092 | 156 |
| 476 | 3300031901 | Ga0307406_10220856 | Ga0307406_102208563 | 156 |
| 477 | 3300031995 | Ga0307409_100387584 | Ga0307409_1003875842 | 156 |
| 478 | 3300032002 | Ga0307416_100006633 | Ga0307416_1000066332 | 156 |
| 479 | 3300032002 | Ga0307416_100740607 | Ga0307416_1007406072 | 156 |
| 480 | 3300032004 | Ga0307414_10293803 | Ga0307414_102938032 | 156 |
| 481 | 3300032126 | Ga0307415_100047074 | Ga0307415_1000470743 | 156 |
| 482 | 3300034817 | Ga0373948_0054418 | Ga0373948_0054418_53_529 | 156 |
| 483 | 3300034957 | Ga0373938_0104725 | Ga0373938_0104725_211_687 | 156 |
| 484 | 3300035084 | Ga0373928_0019751 | Ga0373928_0019751_716_1192 | 156 |
| 485 | 3300035113 | Ga0373936_0149619 | Ga0373936_0149619_471_944 | 156 |
| 486 | 3300035115 | Ga0373941_0023759 | Ga0373941_0023759_1264_1740 | 156 |
| 487 | 3300035117 | Ga0373953_0003102 | Ga0373953_0003102_3046_3519 | 156 |
| 488 | 3300035117 | Ga0373953_0186672 | Ga0373953_0186672_77_550 | 156 |
| 489 | 3300035118 | Ga0373954_0048267 | Ga0373954_0048267_1191_1664 | 156 |
| 490 | 3300035118 | Ga0373954_0197886 | Ga0373954_0197886_425_904 | 156 |
| 491 | 3300035119 | Ga0373956_0208660 | Ga0373956_0208660_301_774 | 156 |
| 492 | 3300035119 | Ga0373956_0290680 | Ga0373956_0290680_237_710 | 156 |
| 493 | 3300035121 | Ga0373960_0013817 | Ga0373960_0013817_39_515 | 156 |
| 494 | 3300035172 | Ga0373955_0008701 | Ga0373955_0008701_2202_2675 | 156 |
| 495 | 3300035172 | Ga0373955_0185292 | Ga0373955_0185292_396_869 | 156 |
| 496 | 3300035691 | Ga0373931_0051788 | Ga0373931_0051788_407_883 | 156 |
| 497 | 3300035691 | Ga0373931_0172072 | Ga0373931_0172072_577_1074 | 156 |
| 498 | 3300035692 | Ga0373935_0146169 | Ga0373935_0146169_761_1240 | 156 |
| 499 | 3300035695 | Ga0373927_0291172 | Ga0373927_0291172_545_1021 | 156 |
| 500 | 3300035695 | Ga0373927_0359892 | Ga0373927_0359892_276_761 | 156 |
| 501 | 3300035724 | Ga0373933_0003617 | Ga0373933_0003617_1972_2445 | 156 |
| 502 | 3300035724 | Ga0373933_0186414 | Ga0373933_0186414_186_659 | 156 |
| 503 | 3300036401 | Ga0373937_0013477 | Ga0373937_0013477_1490_1963 | 156 |
| 504 | 3300036401 | Ga0373937_0430483 | Ga0373937_0430483_388_861 | 156 |
| 505 | 3300036647 | Ga0316582_0113549 | Ga0316582_0113549_963_1436 | 156 |
| 506 | 3300037312 | Ga0395899_0483270 | Ga0395899_0483270_145_621 | 156 |
| 507 | 3300037418 | Ga0395900_0007214 | Ga0395900_0007214_6008_6484 | 156 |
| 508 | 3300037418 | Ga0395900_0032445 | Ga0395900_0032445_3239_3712 | 156 |
| 509 | 3300037466 | Ga0395898_0019026 | Ga0395898_0019026_5838_6314 | 156 |
| 510 | 3300037471 | Ga0395905_0001391 | Ga0395905_0001391_19637_20113 | 156 |
| 511 | 3300037471 | Ga0395905_1098085 | Ga0395905_1098085_55_576 | 156 |
| 512 | 3300037853 | Ga0436364_0067324 | Ga0436364_0067324_296_769 | 156 |
| 513 | 3300037853 | Ga0436364_0179449 | Ga0436364_0179449_163_636 | 156 |
| 514 | 3300037853 | Ga0436364_0234163 | Ga0436364_0234163_76_549 | 156 |
| 515 | 3300037853 | Ga0436364_0400376 | Ga0436364_0400376_3574_4047 | 156 |
| 516 | 3300037853 | Ga0436364_1370990 | Ga0436364_1370990_519_992 | 156 |
| 517 | 3300037853 | Ga0436364_1525673 | Ga0436364_1525673_18074_18547 | 156 |
| 518 | 3300038443 | Ga0395901_0005667 | Ga0395901_0005667_1488_1964 | 156 |
| 519 | 3300038996 | Ga0242420_020262 | Ga0242420_020262_695_1171 | 156 |
| 520 | 3300039437 | Ga0436365_0550921 | Ga0436365_0550921_1001_1474 | 156 |
| 521 | 3300039438 | Ga0436360_0326890 | Ga0436360_0326890_171_644 | 156 |
| 522 | 3300039438 | Ga0436360_0452948 | Ga0436360_0452948_17_490 | 156 |
| 523 | 3300039438 | Ga0436360_0589360 | Ga0436360_0589360_57_530 | 156 |
| 524 | 3300039438 | Ga0436360_0613967 | Ga0436360_0613967_89_562 | 156 |
| 525 | 3300039438 | Ga0436360_0872042 | Ga0436360_0872042_296_769 | 156 |
| 526 | 3300039438 | Ga0436360_1267705 | Ga0436360_1267705_310_783 | 156 |
| 527 | 3300039447 | Ga0436361_0085183 | Ga0436361_0085183_161_634 | 156 |
| 528 | 3300039447 | Ga0436361_0175350 | Ga0436361_0175350_962_1435 | 156 |
| 529 | 3300039447 | Ga0436361_0333471 | Ga0436361_0333471_1732_2205 | 156 |
| 530 | 3300039447 | Ga0436361_0335349 | Ga0436361_0335349_70_543 | 156 |
| 531 | 3300039447 | Ga0436361_0450564 | Ga0436361_0450564_691_1164 | 156 |
| 532 | 3300039447 | Ga0436361_0502336 | Ga0436361_0502336_905_1378 | 156 |
| 533 | 3300039450 | Ga0436363_0572892 | Ga0436363_0572892_813_1286 | 156 |
| 534 | 3300039450 | Ga0436363_1345528 | Ga0436363_1345528_231_704 | 156 |
| 535 | 3300039453 | Ga0436362_0111635 | Ga0436362_0111635_195_668 | 156 |
| 536 | 3300039453 | Ga0436362_0345536 | Ga0436362_0345536_501_1040 | 156 |
| 537 | 3300039453 | Ga0436362_0651475 | Ga0436362_0651475_41_514 | 156 |
| 538 | 3300039453 | Ga0436362_0826199 | Ga0436362_0826199_3573_4046 | 156 |
| 539 | 3300039453 | Ga0436362_0994734 | Ga0436362_0994734_58_531 | 156 |
| 540 | 3300039453 | Ga0436362_1000199 | Ga0436362_1000199_1144_1617 | 156 |
| 541 | 3300041408 | Ga0439453_0032804 | Ga0439453_0032804_453_926 | 156 |
| 542 | 3300042009 | Ga0439451_001574 | Ga0439451_001574_1855_2328 | 156 |
| 543 | 3300042125 | Ga0450923_007964 | Ga0450923_007964_1112_1585 | 156 |
| 544 | 3300042132 | Ga0450895_020951 | Ga0450895_020951_62_535 | 156 |
| 545 | 3300042133 | Ga0450896_005227 | Ga0450896_005227_1107_1580 | 156 |
| 546 | 3300042135 | Ga0450899_014284 | Ga0450899_014284_231_704 | 156 |
| 547 | 3300042146 | Ga0450907_004045 | Ga0450907_004045_1698_2171 | 156 |
| 548 | 3300042147 | Ga0450910_001892 | Ga0450910_001892_576_1049 | 156 |
| 549 | 3300042147 | Ga0450910_007240 | Ga0450910_007240_741_1214 | 156 |
| 550 | 3300042156 | Ga0439446_0008107 | Ga0439446_0008107_183_656 | 156 |
| 551 | 3300042156 | Ga0439446_0118106 | Ga0439446_0118106_90_563 | 156 |
| 552 | 3300042156 | Ga0439446_0230532 | Ga0439446_0230532_142_615 | 156 |
| 553 | 3300042184 | Ga0450908_002235 | Ga0450908_002235_2729_3202 | 156 |
| 554 | 3300042435 | Ga0439434_0011318 | Ga0439434_0011318_1088_1561 | 156 |
| 555 | 3300042437 | Ga0439444_0001542 | Ga0439444_0001542_2539_3012 | 156 |
| 556 | 3300042461 | Ga0439460_0126681 | Ga0439460_0126681_28_501 | 156 |
| 557 | 3300042531 | Ga0450918_011772 | Ga0450918_011772_428_901 | 156 |
| 558 | 3300042531 | Ga0450918_013242 | Ga0450918_013242_904_1377 | 156 |
| 559 | 3300045836 | Ga0466958_0351522 | Ga0466958_0351522_163_636 | 156 |
| 560 | 3300046462 | Ga0495651_0170931 | Ga0495651_0170931_967_1446 | 156 |
| 561 | 3300046477 | Ga0495664_0106068 | Ga0495664_0106068_238_717 | 156 |
| 562 | 3300046491 | Ga0495584_0024182 | Ga0495584_0024182_1019_1492 | 156 |
| 563 | 3300046491 | Ga0495584_0240759 | Ga0495584_0240759_68_541 | 156 |
| 564 | 3300046506 | Ga0495583_0123893 | Ga0495583_0123893_316_792 | 156 |
| 565 | 3300046511 | Ga0495608_0124238 | Ga0495608_0124238_697_1176 | 156 |
| 566 | 3300046518 | Ga0495631_0034954 | Ga0495631_0034954_387_863 | 156 |
| 567 | 3300046529 | Ga0495652_0075755 | Ga0495652_0075755_899_1396 | 156 |
| 568 | 3300046536 | Ga0495587_0054218 | Ga0495587_0054218_812_1291 | 156 |
| 569 | 3300046559 | Ga0495667_0018210 | Ga0495667_0018210_1807_2280 | 156 |
| 570 | 3300046615 | Ga0495656_0215587 | Ga0495656_0215587_224_700 | 156 |
| 571 | 3300046648 | Ga0495611_0345718 | Ga0495611_0345718_56_532 | 156 |
| 572 | 3300046660 | Ga0495625_0410888 | Ga0495625_0410888_152_628 | 156 |
| 573 | 3300046664 | Ga0495659_0078167 | Ga0495659_0078167_136_612 | 156 |
| 574 | 3300046675 | Ga0495657_0083702 | Ga0495657_0083702_460_933 | 156 |
| 575 | 3300046675 | Ga0495657_0284045 | Ga0495657_0284045_85_564 | 156 |
| 576 | 3300047317 | Ga0495604_0260725 | Ga0495604_0260725_311_808 | 156 |
| 577 | 3300047317 | Ga0495604_0403361 | Ga0495604_0403361_216_689 | 156 |
| 578 | 3300047319 | Ga0495674_1067422 | Ga0495674_1067422_58_531 | 156 |
| 579 | 3300047322 | Ga0495680_0372217 | Ga0495680_0372217_64_543 | 156 |
| 580 | 3300047444 | Ga0495675_0038422 | Ga0495675_0038422_163_660 | 156 |
| 581 | 3300047444 | Ga0495675_0756996 | Ga0495675_0756996_30_503 | 156 |
| 582 | 3300047471 | Ga0495684_0566971 | Ga0495684_0566971_87_560 | 156 |
| 583 | 3300048088 | Ga0495602_0296436 | Ga0495602_0296436_348_821 | 156 |
| 584 | 3300048903 | Ga0496100_0099267 | Ga0496100_0099267_132_605 | 156 |
| 585 | 3300048903 | Ga0496100_0179121 | Ga0496100_0179121_417_890 | 156 |
| 586 | 3300048903 | Ga0496100_0247054 | Ga0496100_0247054_548_1024 | 156 |
| 587 | 3300048904 | Ga0496101_0712003 | Ga0496101_0712003_295_771 | 156 |
| 588 | 3300048905 | Ga0496102_0196390 | Ga0496102_0196390_548_1024 | 156 |
| 589 | 3300048906 | Ga0496103_0012541 | Ga0496103_0012541_4528_5004 | 156 |
| 590 | 3300048906 | Ga0496103_0179477 | Ga0496103_0179477_457_933 | 156 |
| 591 | 3300048907 | Ga0496104_0251297 | Ga0496104_0251297_820_1299 | 156 |
| 592 | 3300048907 | Ga0496104_0895370 | Ga0496104_0895370_22_498 | 156 |
| 593 | 3300048907 | Ga0496104_1524454 | Ga0496104_1524454_27_506 | 156 |
| 594 | 3300048908 | Ga0496105_0678740 | Ga0496105_0678740_295_771 | 156 |
| 595 | 3300048909 | Ga0496106_0075445 | Ga0496106_0075445_724_1200 | 156 |
| 596 | 3300048909 | Ga0496106_0246443 | Ga0496106_0246443_453_926 | 156 |
| 597 | 3300048909 | Ga0496106_0316320 | Ga0496106_0316320_359_838 | 156 |
| 598 | 3300048910 | Ga0496107_0011017 | Ga0496107_0011017_4013_4489 | 156 |
| 599 | 3300048911 | Ga0496108_0165715 | Ga0496108_0165715_263_739 | 156 |
| 600 | 3300048912 | Ga0496109_0029266 | Ga0496109_0029266_316_792 | 156 |
| 601 | 3300048912 | Ga0496109_0257745 | Ga0496109_0257745_764_1243 | 156 |
| 602 | 3300048913 | Ga0496110_0179984 | Ga0496110_0179984_595_1071 | 156 |
| 603 | 3300048913 | Ga0496110_0991183 | Ga0496110_0991183_22_498 | 156 |
| 604 | 3300048914 | Ga0496111_0466043 | Ga0496111_0466043_295_771 | 156 |
| 605 | 3300048914 | Ga0496111_0499680 | Ga0496111_0499680_212_688 | 156 |
| 606 | 3300048914 | Ga0496111_0769317 | Ga0496111_0769317_23_520 | 156 |
| 607 | 3300048915 | Ga0496112_0596229 | Ga0496112_0596229_100_579 | 156 |
| 608 | 3300048915 | Ga0496112_0599467 | Ga0496112_0599467_263_739 | 156 |
| 609 | 3300048916 | Ga0496113_1108676 | Ga0496113_1108676_22_498 | 156 |
| 610 | 3300048917 | Ga0496114_0018184 | Ga0496114_0018184_1190_1666 | 156 |
| 611 | 3300048917 | Ga0496114_0364115 | Ga0496114_0364115_376_855 | 156 |
| 612 | 3300048918 | Ga0496115_0019140 | Ga0496115_0019140_263_739 | 156 |
| 613 | 3300048918 | Ga0496115_0412181 | Ga0496115_0412181_141_614 | 156 |
| 614 | 3300049528 | Ga0501312_039911 | Ga0501312_039911_61_534 | 156 |
| 615 | 3300049568 | Ga0501031_0029391 | Ga0501031_0029391_579_1052 | 156 |
| 616 | 3300049568 | Ga0501031_0113004 | Ga0501031_0113004_792_1274 | 156 |
| 617 | 3300049568 | Ga0501031_0261281 | Ga0501031_0261281_620_1093 | 156 |
| 618 | 3300049570 | Ga0501033_0124715 | Ga0501033_0124715_38_511 | 156 |
| 619 | 3300049572 | Ga0501036_0221895 | Ga0501036_0221895_984_1457 | 156 |
| 620 | 3300049572 | Ga0501036_0476817 | Ga0501036_0476817_358_831 | 156 |
| 621 | 3300049572 | Ga0501036_0846268 | Ga0501036_0846268_40_513 | 156 |
| 622 | 3300049572 | Ga0501036_1105143 | Ga0501036_1105143_52_525 | 156 |
| 623 | 3300049573 | Ga0501037_0069290 | Ga0501037_0069290_551_1024 | 156 |
| 624 | 3300049574 | Ga0501038_0251962 | Ga0501038_0251962_46_519 | 156 |
| 625 | 3300049575 | Ga0501039_0032551 | Ga0501039_0032551_1054_1527 | 156 |
| 626 | 3300049575 | Ga0501039_0192000 | Ga0501039_0192000_717_1190 | 156 |
| 627 | 3300049575 | Ga0501039_0811279 | Ga0501039_0811279_25_498 | 156 |
| 628 | 3300049576 | Ga0501040_0007949 | Ga0501040_0007949_960_1433 | 156 |
| 629 | 3300049576 | Ga0501040_0016236 | Ga0501040_0016236_3972_4445 | 156 |
| 630 | 3300049576 | Ga0501040_0064021 | Ga0501040_0064021_792_1265 | 156 |
| 631 | 3300049577 | Ga0501041_0085577 | Ga0501041_0085577_593_1066 | 156 |
| 632 | 3300049577 | Ga0501041_0397731 | Ga0501041_0397731_383_856 | 156 |
| 633 | 3300049578 | Ga0501042_0031965 | Ga0501042_0031965_1044_1517 | 156 |
| 634 | 3300049578 | Ga0501042_0059139 | Ga0501042_0059139_449_922 | 156 |
| 635 | 3300049578 | Ga0501042_0063858 | Ga0501042_0063858_1020_1493 | 156 |
| 636 | 3300049578 | Ga0501042_0072530 | Ga0501042_0072530_1511_1984 | 156 |
| 637 | 3300049578 | Ga0501042_0156202 | Ga0501042_0156202_36_509 | 156 |
| 638 | 3300049578 | Ga0501042_0269183 | Ga0501042_0269183_200_673 | 156 |
| 639 | 3300049580 | Ga0501046_0269573 | Ga0501046_0269573_223_696 | 156 |
| 640 | 3300049580 | Ga0501046_0668736 | Ga0501046_0668736_140_613 | 156 |
| 641 | 3300049582 | Ga0501048_0042789 | Ga0501048_0042789_2320_2793 | 156 |
| 642 | 3300049582 | Ga0501048_0089789 | Ga0501048_0089789_277_750 | 156 |
| 643 | 3300049582 | Ga0501048_0476587 | Ga0501048_0476587_23_496 | 156 |
| 644 | 3300049582 | Ga0501048_0623758 | Ga0501048_0623758_17_490 | 156 |
| 645 | 3300049582 | Ga0501048_0868830 | Ga0501048_0868830_60_533 | 156 |
| 646 | 3300049584 | Ga0501068_0438549 | Ga0501068_0438549_338_814 | 156 |
| 647 | 3300049584 | Ga0501068_0610429 | Ga0501068_0610429_146_619 | 156 |
| 648 | 3300049584 | Ga0501068_1018202 | Ga0501068_1018202_32_505 | 156 |
| 649 | 3300049585 | Ga0501069_0145066 | Ga0501069_0145066_13_489 | 156 |
| 650 | 3300049586 | Ga0501070_0065514 | Ga0501070_0065514_1395_1868 | 156 |
| 651 | 3300049587 | Ga0501071_0026051 | Ga0501071_0026051_1833_2306 | 156 |
| 652 | 3300049587 | Ga0501071_0046812 | Ga0501071_0046812_1088_1561 | 156 |
| 653 | 3300049587 | Ga0501071_0465399 | Ga0501071_0465399_336_809 | 156 |
| 654 | 3300049587 | Ga0501071_0850835 | Ga0501071_0850835_159_632 | 156 |
| 655 | 3300049588 | Ga0501072_0005695 | Ga0501072_0005695_8421_8894 | 156 |
| 656 | 3300049588 | Ga0501072_0074472 | Ga0501072_0074472_1366_1839 | 156 |
| 657 | 3300049588 | Ga0501072_0189069 | Ga0501072_0189069_1120_1602 | 156 |
| 658 | 3300049588 | Ga0501072_0332867 | Ga0501072_0332867_278_751 | 156 |
| 659 | 3300049588 | Ga0501072_0417389 | Ga0501072_0417389_50_523 | 156 |
| 660 | 3300049588 | Ga0501072_0540317 | Ga0501072_0540317_134_607 | 156 |
| 661 | 3300049589 | Ga0501073_0151261 | Ga0501073_0151261_659_1132 | 156 |
| 662 | 3300049590 | Ga0501074_0051472 | Ga0501074_0051472_1557_2030 | 156 |
| 663 | 3300049591 | Ga0501075_0015392 | Ga0501075_0015392_1321_1794 | 156 |
| 664 | 3300049591 | Ga0501075_0047800 | Ga0501075_0047800_880_1353 | 156 |
| 665 | 3300049591 | Ga0501075_0051778 | Ga0501075_0051778_1066_1539 | 156 |
| 666 | 3300049591 | Ga0501075_0120292 | Ga0501075_0120292_585_1058 | 156 |
| 667 | 3300049591 | Ga0501075_0208139 | Ga0501075_0208139_725_1198 | 156 |
| 668 | 3300049592 | Ga0501076_0089354 | Ga0501076_0089354_1038_1511 | 156 |
| 669 | 3300049592 | Ga0501076_0090170 | Ga0501076_0090170_169_642 | 156 |
| 670 | 3300049592 | Ga0501076_0100927 | Ga0501076_0100927_335_808 | 156 |
| 671 | 3300049592 | Ga0501076_0323256 | Ga0501076_0323256_410_883 | 156 |
| 672 | 3300049593 | Ga0501077_0017260 | Ga0501077_0017260_2374_2847 | 156 |
| 673 | 3300049593 | Ga0501077_0101271 | Ga0501077_0101271_136_609 | 156 |
| 674 | 3300049593 | Ga0501077_0760638 | Ga0501077_0760638_134_607 | 156 |
| 675 | 3300049686 | Ga0501257_030909 | Ga0501257_030909_491_967 | 156 |
| 676 | 3300049741 | Ga0501079_0056766 | Ga0501079_0056766_2271_2744 | 156 |
| 677 | 3300049741 | Ga0501079_0176018 | Ga0501079_0176018_86_559 | 156 |
| 678 | 3300049741 | Ga0501079_0181299 | Ga0501079_0181299_572_1045 | 156 |
| 679 | 3300049741 | Ga0501079_0182918 | Ga0501079_0182918_892_1365 | 156 |
| 680 | 3300049742 | Ga0501080_0256463 | Ga0501080_0256463_62_535 | 156 |
| 681 | 3300049742 | Ga0501080_0280985 | Ga0501080_0280985_356_829 | 156 |
| 682 | 3300049742 | Ga0501080_1105412 | Ga0501080_1105412_145_618 | 156 |
| 683 | 3300049743 | Ga0501081_0038695 | Ga0501081_0038695_2604_3077 | 156 |
| 684 | 3300049743 | Ga0501081_0206551 | Ga0501081_0206551_934_1407 | 156 |
| 685 | 3300049743 | Ga0501081_0318836 | Ga0501081_0318836_652_1125 | 156 |
| 686 | 3300049743 | Ga0501081_0362369 | Ga0501081_0362369_96_569 | 156 |
| 687 | 3300049744 | Ga0501083_0018378 | Ga0501083_0018378_3375_3848 | 156 |
| 688 | 3300049744 | Ga0501083_0155206 | Ga0501083_0155206_520_993 | 156 |
| 689 | 3300049744 | Ga0501083_0327450 | Ga0501083_0327450_501_974 | 156 |
| 690 | 3300049822 | Ga0501035_0053148 | Ga0501035_0053148_641_1114 | 156 |
| 691 | 3300049822 | Ga0501035_0311329 | Ga0501035_0311329_144_617 | 156 |
| 692 | 3300049824 | Ga0501045_0023824 | Ga0501045_0023824_965_1438 | 156 |
| 693 | 3300049824 | Ga0501045_0097216 | Ga0501045_0097216_1608_2081 | 156 |
| 694 | 3300049824 | Ga0501045_0610792 | Ga0501045_0610792_116_589 | 156 |
| 695 | 3300050507 | nmdc:mga05p37_295773_c1 | nmdc:mga05p37_295773_c1_490_966 | 156 |
| 696 | 3300050507 | nmdc:mga05p37_70706_c1 | nmdc:mga05p37_70706_c1_3525_3998 | 156 |
| 697 | 3300050507 | nmdc:mga05p37_71_c2 | nmdc:mga05p37_71_c2_22560_23033 | 156 |
| 698 | 3300050508 | nmdc:mga09592_2253_c1 | nmdc:mga09592_2253_c1_1179_1652 | 156 |
| 699 | 3300050508 | nmdc:mga09592_33396_c1 | nmdc:mga09592_33396_c1_674_1150 | 156 |
| 700 | 3300050508 | nmdc:mga09592_584391_c1 | nmdc:mga09592_584391_c1_123_596 | 156 |
| 701 | 3300050509 | nmdc:mga0qj67_254_c1 | nmdc:mga0qj67_254_c1_25208_25681 | 156 |
| 702 | 3300050509 | nmdc:mga0qj67_613158_c1 | nmdc:mga0qj67_613158_c1_380_856 | 156 |
| 703 | 3300050509 | nmdc:mga0qj67_623672_c1 | nmdc:mga0qj67_623672_c1_11_484 | 156 |
| 704 | 3300050510 | nmdc:mga06r32_1565_c1 | nmdc:mga06r32_1565_c1_15292_15765 | 156 |
| 705 | 3300050510 | nmdc:mga06r32_98331_c1 | nmdc:mga06r32_98331_c1_528_1004 | 156 |
| 706 | 3300050511 | nmdc:mga08y16_10021_c1 | nmdc:mga08y16_10021_c1_2817_3290 | 156 |
| 707 | 3300050511 | nmdc:mga08y16_671322_c1 | nmdc:mga08y16_671322_c1_469_945 | 156 |
| 708 | 3300050512 | nmdc:mga0n895_18142_c1 | nmdc:mga0n895_18142_c1_4727_5200 | 156 |
| 709 | 3300050512 | nmdc:mga0n895_328516_c1 | nmdc:mga0n895_328516_c1_570_1043 | 156 |
| 710 | 3300050512 | nmdc:mga0n895_397475_c1 | nmdc:mga0n895_397475_c1_260_736 | 156 |
| 711 | 3300050513 | nmdc:mga0rr50_253738_c1 | nmdc:mga0rr50_253738_c1_292_768 | 156 |
| 712 | 3300050513 | nmdc:mga0rr50_28747_c1 | nmdc:mga0rr50_28747_c1_2309_2782 | 156 |
| 713 | 3300050513 | nmdc:mga0rr50_44266_c1 | nmdc:mga0rr50_44266_c1_2615_3091 | 156 |
| 714 | 3300050513 | nmdc:mga0rr50_601444_c1 | nmdc:mga0rr50_601444_c1_293_766 | 156 |
| 715 | 3300050514 | nmdc:mga08x19_137391_c1 | nmdc:mga08x19_137391_c1_246_722 | 156 |
| 716 | 3300050514 | nmdc:mga08x19_29955_c1 | nmdc:mga08x19_29955_c1_117_590 | 156 |
| 717 | 3300050515 | nmdc:mga0a205_186_c1 | nmdc:mga0a205_186_c1_30940_31413 | 156 |
| 718 | 3300050515 | nmdc:mga0a205_212060_c1 | nmdc:mga0a205_212060_c1_693_1169 | 156 |
| 719 | 3300050515 | nmdc:mga0a205_603_c1 | nmdc:mga0a205_603_c1_15890_16363 | 156 |
| 720 | 3300053077 | Ga0495601_0063817 | Ga0495601_0063817_347_820 | 156 |
| 721 | 3300053078 | Ga0495612_0396385 | Ga0495612_0396385_14_487 | 156 |
| 722 | 3300053083 | Ga0495655_0001448 | Ga0495655_0001448_809_1282 | 156 |
| 723 | 3300053084 | Ga0495595_0182556 | Ga0495595_0182556_436_909 | 156 |
| 724 | 3300053084 | Ga0495595_0409570 | Ga0495595_0409570_40_519 | 156 |
| 725 | 3300053084 | Ga0495595_0439882 | Ga0495595_0439882_47_520 | 156 |
| 726 | 3300053085 | Ga0495619_0043670 | Ga0495619_0043670_2175_2648 | 156 |
| 727 | 3300053085 | Ga0495619_0100928 | Ga0495619_0100928_1239_1718 | 156 |
| 728 | 3300053140 | Ga0500573_0177570 | Ga0500573_0177570_264_737 | 156 |
| 729 | 3300054114 | Ga0501084_0097418 | Ga0501084_0097418_1567_2040 | 156 |
| 730 | 3300054114 | Ga0501084_0108308 | Ga0501084_0108308_1723_2196 | 156 |
| 731 | 3300054114 | Ga0501084_0229430 | Ga0501084_0229430_100_573 | 156 |
| 732 | 3300054114 | Ga0501084_0652719 | Ga0501084_0652719_81_554 | 156 |
| 733 | 3300059421 | Ga0590071_031392 | Ga0590071_031392_82_555 | 156 |
| 734 | 3300059423 | Ga0590074_021574 | Ga0590074_021574_375_848 | 156 |
| 735 | 3300060353 | Ga0501082_0045243 | Ga0501082_0045243_1333_1806 | 156 |
| 736 | 3300060353 | Ga0501082_0058732 | Ga0501082_0058732_404_877 | 156 |
| 737 | 3300060353 | Ga0501082_0098964 | Ga0501082_0098964_397_870 | 156 |
| 738 | 3300060353 | Ga0501082_0122693 | Ga0501082_0122693_364_837 | 156 |
| 739 | 3300060353 | Ga0501082_0139925 | Ga0501082_0139925_1609_2082 | 156 |
| 740 | 3300061734 | Ga0530510_0075169 | Ga0530510_0075169_863_1336 | 156 |
| 741 | 3300061734 | Ga0530510_0176584 | Ga0530510_0176584_891_1364 | 156 |
| 742 | 2162886007 | SwRhRL2b_contig_1824184 | SwRhRL2b_0742.00007370 | 157 |
| 743 | 3300005367 | Ga0070667_100178979 | Ga0070667_1001789792 | 157 |
| 744 | 3300026089 | Ga0207648_10432043 | Ga0207648_104320432 | 157 |
| 745 | 3300031852 | Ga0307410_10265885 | Ga0307410_102658851 | 157 |
| 746 | 3300031995 | Ga0307409_101126326 | Ga0307409_1011263262 | 157 |
| 747 | 3300032002 | Ga0307416_100514615 | Ga0307416_1005146151 | 157 |
| 748 | 3300032004 | Ga0307414_10054989 | Ga0307414_100549891 | 157 |
| 749 | 3300032005 | Ga0307411_10068425 | Ga0307411_100684254 | 157 |
| 750 | 3300032126 | Ga0307415_100025995 | Ga0307415_1000259954 | 157 |
| 751 | 3300037418 | Ga0395900_0042510 | Ga0395900_0042510_90_578 | 157 |
| 752 | 3300049572 | Ga0501036_1269607 | Ga0501036_1269607_51_524 | 157 |
| 753 | 3300049584 | Ga0501068_0564344 | Ga0501068_0564344_225_701 | 157 |
| 754 | 3300049592 | Ga0501076_0677482 | Ga0501076_0677482_302_778 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1grj-assembly1.cif.gz_A | grea transcript cleavage factor from escherichia coli | 0.9084 | 2 | 157 |
| 1grj-assembly1.cif.gz_A | grea transcript cleavage factor from escherichia coli | 0.9027 | 2 | 157 |
| 4wqt-assembly3.cif.gz_Z | thermus thermophilus rna polymerase complexed with an rna cleavage stimulating factor (a grea/gfh1 chimeric protein) | 0.9009 | 3 | 155 |
| 4wqt-assembly3.cif.gz_Z | thermus thermophilus rna polymerase complexed with an rna cleavage stimulating factor (a grea/gfh1 chimeric protein) | 0.8846 | 3 | 155 |
| 6rin-assembly1.cif.gz_F | cryo-em structure of e. coli rna polymerase backtracked elongation complex bound to greb transcription factor | 0.8834 | 5 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6W5_1_75_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9936 | 1 | 75 | 1.10.287.180 |
| 1grjA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9852 | 2 | 75 | 1.10.287.180 |
| af_P0A6W5_1_75_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9806 | 1 | 75 | 1.10.287.180 |
| 1grjA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9723 | 2 | 75 | 1.10.287.180 |
| af_Q2FXW7_4_78_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9694 | 1 | 75 | 1.10.287.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1WF27-F1-model_v4 | Transcription elongation factor GreA | 0.9872 | 87 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-E3HNV0-F1-model_v4 | Transcription elongation factor GreA (Transcript cleavage factor GreA) | 0.9798 | 1 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A847PGP4-F1-model_v4 | Transcription elongation factor GreA (Transcript cleavage factor GreA) | 0.9765 | 2 | 154 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A2S6TA47-F1-model_v4 | Transcription elongation factor GreA (Transcript cleavage factor GreA) | 0.9757 | 1 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A7V8KLB0-F1-model_v4 | deleted | 0.9747 | 88 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar