F479244

General Info

Members Datasets Scaffolds Average Seq Length
754 394 754 157

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100021230|Ga0070711_1000212302
Length 187
Sequence LLRCNHTFDCSAAALAAAFDIRQQDPNALAMNKIPMTAEGFNRLREELKRLKTVDRPAIIRAIADARDHGDLAENAEYHAARDRQSFIEGRVAELEDKVARAEVIDVSKLSGSVIKFGAKVTLADEETDEEQTFQIVGEDEADIASGRLSVTSPLARALIGKGKGDSVEVTTPRGAKSYEVVTVAFG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
128 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
149 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
158 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
243 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
244 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
245 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
258 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
259 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
280 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
283 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
286 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
287 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
288 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
289 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
290 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
291 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
292 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
293 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
294 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
295 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
296 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
297 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
298 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
299 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
300 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
301 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
302 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
303 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 3.98
Rhizosphere 92.44
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1824184 2162886007 Bacteria 4333
2 JGI24746J21847_1018425 3300001977 Bacteria 987
3 JGI24740J21852_10138953 3300001979 Bacteria 605
4 JGI24739J22299_10057414 3300001989 Bacteria 1239
5 JGI24737J22298_10104162 3300001990 Bacteria 840
6 JGI24743J22301_10019173 3300001991 Bacteria 1298
7 JGI24750J21931_1036118 3300002070 Bacteria 739
8 JGI24738J21930_10018485 3300002075 Bacteria 1456
9 JGI24749J21850_1012118 3300002076 Bacteria 1211
10 JGI24744J21845_10051751 3300002077 Bacteria 756
11 JGI24034J26672_10041921 3300002239 Bacteria 770
12 JGI24751J29686_10028732 3300002459 Bacteria 1155
13 Ga0055536_1005701 3300003781 Bacteria 6010
14 Ga0058859_11736316 3300004798 Bacteria 615
15 Ga0058863_10021980 3300004799 Bacteria 516
16 Ga0058862_12148936 3300004803 Bacteria 631
17 Ga0065707_10774067 3300005295 Bacteria 543
18 Ga0070658_10106840 3300005327 Bacteria 2316
19 Ga0070658_10212384 3300005327 Bacteria 1635
20 Ga0070676_10020731 3300005328 Bacteria 3675
21 Ga0070683_100019514 3300005329 Bacteria 6022
22 Ga0070683_100728171 3300005329 Bacteria 950
23 Ga0070690_100002142 3300005330 Bacteria 10541
24 Ga0070690_101206075 3300005330 Bacteria 604
25 Ga0070670_100014885 3300005331 Bacteria 6672
26 Ga0068869_100077072 3300005334 Bacteria 2479
27 Ga0070666_10008032 3300005335 Bacteria 6528
28 Ga0070680_100036366 3300005336 Bacteria 3978
29 Ga0070680_100080294 3300005336 Bacteria 2690
30 Ga0070680_100142714 3300005336 Bacteria 2008
31 Ga0070680_100282269 3300005336 Bacteria 1407
32 Ga0070682_100002624 3300005337 Bacteria 9935
33 Ga0068868_100004569 3300005338 Bacteria 9719
34 Ga0070660_100002725 3300005339 Bacteria 12136
35 Ga0070689_100004193 3300005340 Bacteria 9723
36 Ga0070691_10012213 3300005341 Bacteria 3933
37 Ga0070687_100015260 3300005343 Bacteria 3469
38 Ga0070687_100315716 3300005343 Bacteria 997
39 Ga0070661_100436918 3300005344 Bacteria 1039
40 Ga0070692_10057767 3300005345 Bacteria 2035
41 Ga0070668_100000376 3300005347 Bacteria 29513
42 Ga0070669_100030458 3300005353 Bacteria 3894
43 Ga0070669_100069400 3300005353 Bacteria 2603
44 Ga0070675_100017979 3300005354 Bacteria 5626
45 Ga0070671_100009874 3300005355 Bacteria 7663
46 Ga0070674_100022688 3300005356 Bacteria 4050
47 Ga0070673_100004016 3300005364 Bacteria 9260
48 Ga0070688_100000716 3300005365 Bacteria 16370
49 Ga0070688_100678703 3300005365 Bacteria 796
50 Ga0070659_100023971 3300005366 Bacteria 4674
51 Ga0070659_100083948 3300005366 Bacteria 2546
52 Ga0070667_100009839 3300005367 Bacteria 7927
53 Ga0070667_100178979 3300005367 Bacteria 1875
54 Ga0070703_10028505 3300005406 Bacteria 1670
55 Ga0070709_10013694 3300005434 Bacteria 4566
56 Ga0070709_10019019 3300005434 Bacteria 3963
57 Ga0070709_10071440 3300005434 Bacteria 2240
58 Ga0070714_100007835 3300005435 Bacteria 8319
59 Ga0070714_100228676 3300005435 Bacteria 1713
60 Ga0070714_100528163 3300005435 Bacteria 1128
61 Ga0070714_100882598 3300005435 Bacteria 868
62 Ga0070714_101511110 3300005435 Bacteria 656
63 Ga0070713_100003311 3300005436 Bacteria 10627
64 Ga0070713_100074696 3300005436 Bacteria 2873
65 Ga0070713_100120415 3300005436 Bacteria 2301
66 Ga0070713_100377453 3300005436 Bacteria 1320
67 Ga0070710_10005364 3300005437 Bacteria 6081
68 Ga0070710_10026516 3300005437 Bacteria 3079
69 Ga0070710_10497872 3300005437 Bacteria 834
70 Ga0070710_10578842 3300005437 Bacteria 779
71 Ga0070701_10001121 3300005438 Bacteria 9784
72 Ga0070711_100008572 3300005439 Bacteria 6269
73 Ga0070711_100021230 3300005439 Bacteria 4194
74 Ga0070711_100458276 3300005439 Bacteria 1045
75 Ga0070711_101168444 3300005439 Bacteria 665
76 Ga0070705_100005414 3300005440 Bacteria 6219
77 Ga0070700_100003167 3300005441 Bacteria 8455
78 Ga0070694_100001113 3300005444 Bacteria 15382
79 Ga0070694_100785233 3300005444 Bacteria 780
80 Ga0070663_100012931 3300005455 Bacteria 5300
81 Ga0070678_100001623 3300005456 Bacteria 12052
82 Ga0070662_100003055 3300005457 Bacteria 10389
83 Ga0070681_10035427 3300005458 Bacteria 5014
84 Ga0070681_10036316 3300005458 Bacteria 4947
85 Ga0070681_10131879 3300005458 Bacteria 2431
86 Ga0070681_10149663 3300005458 Bacteria 2261
87 Ga0070681_10614958 3300005458 Bacteria 1001
88 Ga0070681_10758819 3300005458 Bacteria 887
89 Ga0068867_100002464 3300005459 Bacteria 13016
90 Ga0070685_10042928 3300005466 Bacteria 2583
91 Ga0070685_10513257 3300005466 Bacteria 850
92 Ga0070707_100363541 3300005468 Bacteria 1406
93 Ga0070707_101788797 3300005468 Unclassified 582
94 Ga0070698_100002609 3300005471 Bacteria 19861
95 Ga0070698_100115481 3300005471 Bacteria 2649
96 Ga0070698_100319275 3300005471 Bacteria 1484
97 Ga0070699_100153636 3300005518 Bacteria 2036
98 Ga0070679_100001558 3300005530 Bacteria 20513
99 Ga0070679_100025585 3300005530 Bacteria 5794
100 Ga0070679_100039238 3300005530 Bacteria 4707
101 Ga0070679_100236378 3300005530 Bacteria 1786
102 Ga0070679_100433753 3300005530 Bacteria 1259
103 Ga0070679_100670706 3300005530 Bacteria 979
104 Ga0070679_100915508 3300005530 Bacteria 820
105 Ga0070684_100220675 3300005535 Bacteria 1730
106 Ga0070697_100002320 3300005536 Bacteria 14620
107 Ga0070697_100045810 3300005536 Bacteria 3545
108 Ga0070697_100162926 3300005536 Bacteria 1884
109 Ga0070697_100847432 3300005536 Bacteria 810
110 Ga0068853_100001909 3300005539 Bacteria 15347
111 Ga0070672_100118847 3300005543 Bacteria 2161
112 Ga0070686_100001615 3300005544 Bacteria 12651
113 Ga0070686_100145198 3300005544 Bacteria 1656
114 Ga0070686_100246242 3300005544 Bacteria 1304
115 Ga0070695_100005745 3300005545 Bacteria 7310
116 Ga0070695_100202171 3300005545 Bacteria 1420
117 Ga0070696_100009145 3300005546 Bacteria 6633
118 Ga0070693_100057045 3300005547 Bacteria 2256
119 Ga0070665_100345994 3300005548 Bacteria 1492
120 Ga0070704_100006944 3300005549 Bacteria 6712
121 Ga0070704_100516338 3300005549 Bacteria 1039
122 Ga0068855_100080130 3300005563 Bacteria 3786
123 Ga0068855_101370484 3300005563 Bacteria 730
124 Ga0070664_100002115 3300005564 Bacteria 15887
125 Ga0068857_100014232 3300005577 Bacteria 6929
126 Ga0068854_100031138 3300005578 Bacteria 3705
127 Ga0068856_100009612 3300005614 Bacteria 9390
128 Ga0068856_100246778 3300005614 Bacteria 1801
129 Ga0068856_101166912 3300005614 Bacteria 787
130 Ga0070702_100000110 3300005615 Bacteria 24545
131 Ga0070702_100551391 3300005615 Bacteria 856
132 Ga0068852_100014700 3300005616 Bacteria 6037
133 Ga0068859_100035260 3300005617 Bacteria 5020
134 Ga0068864_100961724 3300005618 Bacteria 845
135 Ga0068866_10007211 3300005718 Bacteria 4650
136 Ga0068861_100053023 3300005719 Bacteria 3084
137 Ga0068851_10141964 3300005834 Bacteria 1307
138 Ga0068863_100003256 3300005841 Bacteria 16051
139 Ga0068858_100004547 3300005842 Bacteria 13589
140 Ga0068860_100033018 3300005843 Bacteria 4969
141 Ga0068860_101399741 3300005843 Bacteria 721
142 Ga0068862_100001176 3300005844 Bacteria 24658
143 Ga0068862_101812004 3300005844 Bacteria 620
144 Ga0081455_10000393 3300005937 Bacteria 57689
145 Ga0081455_10015402 3300005937 Bacteria 7432
146 Ga0081455_10210092 3300005937 Bacteria 1451
147 Ga0081540_1005532 3300005983 Bacteria 9412
148 Ga0081540_1006326 3300005983 Bacteria 8651
149 Ga0081540_1025362 3300005983 Bacteria 3412
150 Ga0081540_1106663 3300005983 Bacteria 1194
151 Ga0070717_10000755 3300006028 Bacteria 21129
152 Ga0070717_10088692 3300006028 Bacteria 2608
153 Ga0070717_10842952 3300006028 Bacteria 834
154 Ga0070717_11069430 3300006028 Bacteria 735
155 Ga0075432_10003839 3300006058 Bacteria 5121
156 Ga0075432_10050954 3300006058 Bacteria 1461
157 Ga0070715_10037993 3300006163 Bacteria 1996
158 Ga0070715_10120587 3300006163 Bacteria 1250
159 Ga0070715_10331566 3300006163 Bacteria 825
160 Ga0070716_100000813 3300006173 Bacteria 13438
161 Ga0070716_100047414 3300006173 Bacteria 2424
162 Ga0070712_100005408 3300006175 Bacteria 7906
163 Ga0070712_100006409 3300006175 Bacteria 7297
164 Ga0070712_100049760 3300006175 Bacteria 2912
165 Ga0070712_100083928 3300006175 Bacteria 2314
166 Ga0070712_100107707 3300006175 Bacteria 2074
167 Ga0070712_100357943 3300006175 Bacteria 1196
168 Ga0070712_100513712 3300006175 Bacteria 1006
169 Ga0070712_101061667 3300006175 Bacteria 702
170 Ga0075427_10005123 3300006194 Bacteria 1861
171 Ga0097621_100660997 3300006237 Bacteria 960
172 Ga0097621_100757775 3300006237 Bacteria 897
173 Ga0075428_100001364 3300006844 Bacteria 25941
174 Ga0075428_100003582 3300006844 Bacteria 17018
175 Ga0075428_100675474 3300006844 Bacteria 1101
176 Ga0075428_100777146 3300006844 Bacteria 1018
177 Ga0075430_100000565 3300006846 Bacteria 28128
178 Ga0075430_100151982 3300006846 Bacteria 1928
179 Ga0075430_100649312 3300006846 Bacteria 870
180 Ga0075430_100876153 3300006846 Bacteria 740
181 Ga0075431_100001518 3300006847 Bacteria 21525
182 Ga0075431_100572539 3300006847 Bacteria 1115
183 Ga0075433_10000126 3300006852 Bacteria 38866
184 Ga0075433_10001448 3300006852 Bacteria 17525
185 Ga0075433_10583882 3300006852 Bacteria 981
186 Ga0075434_100000393 3300006871 Bacteria 32008
187 Ga0075434_100000572 3300006871 Bacteria 28363
188 Ga0075434_100426252 3300006871 Bacteria 1348
189 Ga0075434_101394810 3300006871 Bacteria 711
190 Ga0075429_100000531 3300006880 Bacteria 28975
191 Ga0075429_100046549 3300006880 Bacteria 3774
192 Ga0075429_100772130 3300006880 Bacteria 842
193 Ga0068865_100002919 3300006881 Bacteria 10196
194 Ga0075436_100022371 3300006914 Bacteria 4342
195 Ga0097620_100035256 3300006931 Bacteria 5020
196 Ga0075435_100001611 3300007076 Bacteria 14593
197 Ga0075435_100023273 3300007076 Bacteria 4788
198 Ga0075435_100030125 3300007076 Bacteria 4263
199 Ga0075435_100182727 3300007076 Bacteria 1773
200 Ga0075435_100934842 3300007076 Bacteria 756
201 Ga0099795_10055890 3300007788 Bacteria 1450
202 Ga0105251_10087930 3300009011 Bacteria 1430
203 Ga0105244_10180822 3300009036 Bacteria 1000
204 Ga0105250_10009593 3300009092 Bacteria 4072
205 Ga0105240_10059223 3300009093 Bacteria 4780
206 Ga0105240_10101794 3300009093 Bacteria 3492
207 Ga0111539_10000954 3300009094 Bacteria 37915
208 Ga0111539_10005141 3300009094 Bacteria 16962
209 Ga0111539_10469891 3300009094 Bacteria 1465
210 Ga0111539_10836499 3300009094 Bacteria 1071
211 Ga0111539_10877760 3300009094 Bacteria 1043
212 Ga0105245_10022595 3300009098 Bacteria 5522
213 Ga0105247_10001876 3300009101 Bacteria 14720
214 Ga0105247_10104621 3300009101 Bacteria 1814
215 Ga0114129_10039564 3300009147 Bacteria 6648
216 Ga0114129_10153938 3300009147 Bacteria 3146
217 Ga0114129_10265055 3300009147 Bacteria 2301
218 Ga0114129_10995848 3300009147 Bacteria 1056
219 Ga0105243_10008763 3300009148 Bacteria 7749
220 Ga0105243_10264322 3300009148 Bacteria 1542
221 Ga0105241_10007439 3300009174 Bacteria 8062
222 Ga0105242_10116504 3300009176 Bacteria 2286
223 Ga0105248_10004856 3300009177 Bacteria 14885
224 Ga0105248_10618853 3300009177 Bacteria 1222
225 Ga0105248_10648917 3300009177 Bacteria 1191
226 Ga0105237_10004828 3300009545 Bacteria 15484
227 Ga0105238_10096976 3300009551 Bacteria 2934
228 Ga0105249_10000914 3300009553 Bacteria 26099
229 Ga0105249_11311248 3300009553 Bacteria 796
230 Ga0099796_10005898 3300010159 Bacteria 3094
231 Ga0105239_10006584 3300010375 Bacteria 13454
232 Ga0105246_10001402 3300011119 Bacteria 14256
233 Ga0157317_1005551 3300012475 Bacteria 856
234 Ga0157328_1001584 3300012478 Bacteria 996
235 Ga0157373_10074412 3300013100 Bacteria 2396
236 Ga0157371_10002409 3300013102 Bacteria 17899
237 Ga0157371_10177299 3300013102 Bacteria 1524
238 Ga0157370_10085525 3300013104 Bacteria 2963
239 Ga0157370_10151923 3300013104 Bacteria 2155
240 Ga0157370_10348894 3300013104 Bacteria 1364
241 Ga0157369_10004115 3300013105 Bacteria 17222
242 Ga0157369_10010257 3300013105 Bacteria 10690
243 Ga0157369_10343057 3300013105 Bacteria 1551
244 Ga0157369_11111164 3300013105 Bacteria 808
245 Ga0157374_10023226 3300013296 Bacteria 5543
246 Ga0157374_10886412 3300013296 Bacteria 910
247 Ga0157374_11144284 3300013296 Bacteria 799
248 Ga0157378_10007071 3300013297 Bacteria 9799
249 Ga0163162_10136687 3300013306 Bacteria 2562
250 Ga0163162_10325816 3300013306 Bacteria 1669
251 Ga0157372_10052459 3300013307 Bacteria 4541
252 Ga0157372_10061458 3300013307 Bacteria 4207
253 Ga0157372_10742363 3300013307 Bacteria 1141
254 Ga0157375_10069209 3300013308 Bacteria 3535
255 Ga0157375_11714282 3300013308 Bacteria 744
256 Ga0163163_10086134 3300014325 Bacteria 3150
257 Ga0163163_10543768 3300014325 Bacteria 1224
258 Ga0163163_11624789 3300014325 Bacteria 707
259 Ga0163163_11811369 3300014325 Unclassified 671
260 Ga0157380_10007096 3300014326 Bacteria 7935
261 Ga0157380_10136283 3300014326 Bacteria 2102
262 Ga0182008_10023771 3300014497 Bacteria 3124
263 Ga0157379_10006126 3300014968 Bacteria 10352
264 Ga0157379_11890102 3300014968 Bacteria 588
265 Ga0157376_10001070 3300014969 Bacteria 17928
266 Ga0157376_10380898 3300014969 Bacteria 1359
267 Ga0157376_10499584 3300014969 Bacteria 1195
268 Ga0157376_10792377 3300014969 Bacteria 960
269 Ga0157376_12247899 3300014969 Bacteria 584
270 Ga0182007_10056846 3300015262 Bacteria 1284
271 Ga0163161_10002750 3300017792 Bacteria 12504
272 Ga0184602_101631 3300019161 Bacteria 927
273 Ga0197907_10394529 3300020069 Bacteria 516
274 Ga0197907_11338434 3300020069 Bacteria 671
275 Ga0197907_11500817 3300020069 Bacteria 613
276 Ga0206356_10683826 3300020070 Bacteria 877
277 Ga0206355_1200295 3300020076 Bacteria 550
278 Ga0206352_11045053 3300020078 Bacteria 793
279 Ga0206350_10309521 3300020080 Bacteria 781
280 Ga0206354_10705081 3300020081 Bacteria 587
281 Ga0206353_10939575 3300020082 Bacteria 635
282 Ga0213873_10018764 3300021358 Bacteria 1595
283 Ga0213872_10036060 3300021361 Bacteria 2260
284 Ga0213872_10145270 3300021361 Bacteria 1039
285 Ga0213874_10025053 3300021377 Bacteria 1679
286 Ga0213874_10131003 3300021377 Bacteria 861
287 Ga0213876_10150809 3300021384 Bacteria 1236
288 Ga0213876_10315869 3300021384 Bacteria 830
289 Ga0213875_10011874 3300021388 Bacteria 4318
290 Ga0213875_10036138 3300021388 Bacteria 2329
291 Ga0213875_10261519 3300021388 Bacteria 816
292 Ga0224712_10200467 3300022467 Bacteria 907
293 Ga0224712_10281498 3300022467 Bacteria 774
294 Ga0224712_10473638 3300022467 Bacteria 603
295 Ga0247550_100224 3300023660 Bacteria 1354
296 Ga0228598_1049194 3300024227 Bacteria 835
297 Ga0209676_1000256 3300025292 Bacteria 112819
298 Ga0209050_1005370 3300025298 Bacteria 8095
299 Ga0207656_10102532 3300025321 Bacteria 1313
300 Ga0207696_1016029 3300025711 Bacteria 2520
301 Ga0207713_1196926 3300025735 Bacteria 620
302 Ga0207653_10008058 3300025885 Bacteria 3284
303 Ga0207692_10001791 3300025898 Bacteria 8146
304 Ga0207692_10018922 3300025898 Bacteria 3101
305 Ga0207692_10246024 3300025898 Bacteria 1070
306 Ga0207642_10144275 3300025899 Bacteria 1259
307 Ga0207710_10005196 3300025900 Bacteria 5626
308 Ga0207688_10003708 3300025901 Bacteria 8339
309 Ga0207680_10016657 3300025903 Bacteria 3864
310 Ga0207647_10006532 3300025904 Bacteria 8473
311 Ga0207647_10153973 3300025904 Bacteria 1343
312 Ga0207685_10031345 3300025905 Bacteria 1903
313 Ga0207685_10373655 3300025905 Unclassified 724
314 Ga0207699_10058501 3300025906 Bacteria 2306
315 Ga0207699_10262516 3300025906 Bacteria 1194
316 Ga0207699_10486636 3300025906 Bacteria 889
317 Ga0207645_10003136 3300025907 Bacteria 12679
318 Ga0207705_10100876 3300025909 Bacteria 2123
319 Ga0207705_10648786 3300025909 Bacteria 821
320 Ga0207654_10004248 3300025911 Bacteria 7226
321 Ga0207707_10004903 3300025912 Bacteria 11760
322 Ga0207707_10024365 3300025912 Bacteria 5295
323 Ga0207707_10064245 3300025912 Bacteria 3195
324 Ga0207707_10114973 3300025912 Bacteria 2351
325 Ga0207707_10539070 3300025912 Bacteria 992
326 Ga0207707_10626820 3300025912 Bacteria 908
327 Ga0207695_10079426 3300025913 Bacteria 3325
328 Ga0207695_10102075 3300025913 Bacteria 2862
329 Ga0207695_10315019 3300025913 Bacteria 1454
330 Ga0207671_10057004 3300025914 Bacteria 2895
331 Ga0207693_10000133 3300025915 Bacteria 67586
332 Ga0207693_10002561 3300025915 Bacteria 15808
333 Ga0207693_10014015 3300025915 Bacteria 6454
334 Ga0207693_10056665 3300025915 Bacteria 3072
335 Ga0207693_10072969 3300025915 Bacteria 2687
336 Ga0207693_10678572 3300025915 Bacteria 799
337 Ga0207663_10104205 3300025916 Bacteria 1912
338 Ga0207663_10238755 3300025916 Bacteria 1332
339 Ga0207663_10303876 3300025916 Bacteria 1193
340 Ga0207660_10070521 3300025917 Bacteria 2541
341 Ga0207660_10105796 3300025917 Bacteria 2109
342 Ga0207660_10119948 3300025917 Bacteria 1991
343 Ga0207660_10289305 3300025917 Bacteria 1302
344 Ga0207662_10136076 3300025918 Bacteria 1553
345 Ga0207657_10001128 3300025919 Bacteria 28356
346 Ga0207649_10054047 3300025920 Bacteria 2498
347 Ga0207652_10118118 3300025921 Bacteria 2356
348 Ga0207652_10188746 3300025921 Bacteria 1853
349 Ga0207652_10257717 3300025921 Bacteria 1573
350 Ga0207652_10783573 3300025921 Bacteria 847
351 Ga0207646_10212763 3300025922 Bacteria 1746
352 Ga0207681_10033342 3300025923 Bacteria 3375
353 Ga0207681_10070595 3300025923 Bacteria 2433
354 Ga0207694_10063947 3300025924 Bacteria 2867
355 Ga0207650_10022731 3300025925 Bacteria 4442
356 Ga0207650_10281582 3300025925 Bacteria 1354
357 Ga0207659_10027019 3300025926 Bacteria 3881
358 Ga0207687_10125270 3300025927 Bacteria 1928
359 Ga0207700_10032759 3300025928 Bacteria 3710
360 Ga0207700_10065789 3300025928 Bacteria 2767
361 Ga0207700_10091840 3300025928 Bacteria 2399
362 Ga0207700_10210610 3300025928 Bacteria 1643
363 Ga0207700_10622316 3300025928 Bacteria 961
364 Ga0207664_10010395 3300025929 Bacteria 6573
365 Ga0207664_10346695 3300025929 Bacteria 1314
366 Ga0207664_10509901 3300025929 Bacteria 1077
367 Ga0207664_10572016 3300025929 Bacteria 1014
368 Ga0207664_11167425 3300025929 Bacteria 687
369 Ga0207690_10091782 3300025932 Bacteria 2147
370 Ga0207690_10350395 3300025932 Bacteria 1167
371 Ga0207706_10000195 3300025933 Bacteria 67422
372 Ga0207686_10017996 3300025934 Bacteria 3993
373 Ga0207709_10035084 3300025935 Bacteria 2963
374 Ga0207670_10043823 3300025936 Bacteria 2957
375 Ga0207669_10809179 3300025937 Bacteria 777
376 Ga0207704_10020332 3300025938 Bacteria 3509
377 Ga0207665_10000068 3300025939 Bacteria 67429
378 Ga0207665_10118516 3300025939 Bacteria 1868
379 Ga0207665_10260148 3300025939 Bacteria 1285
380 Ga0207691_10028162 3300025940 Bacteria 5262
381 Ga0207711_10018110 3300025941 Bacteria 5856
382 Ga0207689_10086451 3300025942 Bacteria 2577
383 Ga0207661_10216974 3300025944 Bacteria 1689
384 Ga0207661_10733309 3300025944 Bacteria 909
385 Ga0207679_10354102 3300025945 Bacteria 1280
386 Ga0207679_10490371 3300025945 Bacteria 1095
387 Ga0207667_10024633 3300025949 Bacteria 6603
388 Ga0207667_10537731 3300025949 Bacteria 1183
389 Ga0207667_10761467 3300025949 Bacteria 967
390 Ga0207667_10810425 3300025949 Bacteria 932
391 Ga0207651_10002885 3300025960 Bacteria 8293
392 Ga0207712_10010392 3300025961 Bacteria 5909
393 Ga0207668_10071575 3300025972 Bacteria 2477
394 Ga0207640_10289804 3300025981 Bacteria 1290
395 Ga0207658_10014654 3300025986 Bacteria 5370
396 Ga0207658_10793819 3300025986 Bacteria 859
397 Ga0207677_10025401 3300026023 Bacteria 3695
398 Ga0207703_10161212 3300026035 Bacteria 1964
399 Ga0207639_10009419 3300026041 Bacteria 6737
400 Ga0207678_10000128 3300026067 Bacteria 63331
401 Ga0207708_10002350 3300026075 Bacteria 13892
402 Ga0207702_10095875 3300026078 Bacteria 2608
403 Ga0207702_10177059 3300026078 Bacteria 1961
404 Ga0207641_10297380 3300026088 Bacteria 1523
405 Ga0207648_10005087 3300026089 Bacteria 13323
406 Ga0207648_10432043 3300026089 Bacteria 1197
407 Ga0207676_10225010 3300026095 Bacteria 1673
408 Ga0207674_10000779 3300026116 Bacteria 41558
409 Ga0207675_100001033 3300026118 Bacteria 27590
410 Ga0207683_10000553 3300026121 Bacteria 34552
411 Ga0207698_10016409 3300026142 Bacteria 4990
412 Ga0209179_1019179 3300027512 Bacteria 1314
413 Ga0209999_1020169 3300027543 Bacteria 1224
414 Ga0210002_1054009 3300027617 Bacteria 695
415 Ga0209983_1023805 3300027665 Bacteria 1288
416 Ga0209971_1073413 3300027682 Bacteria 831
417 Ga0209998_10008320 3300027717 Bacteria 2150
418 Ga0209998_10087786 3300027717 Bacteria 759
419 Ga0209974_10013053 3300027876 Bacteria 2770
420 Ga0209974_10314048 3300027876 Bacteria 602
421 Ga0207428_10000200 3300027907 Bacteria 83533
422 Ga0207428_10010018 3300027907 Bacteria 8481
423 Ga0207428_10172852 3300027907 Bacteria 1635
424 Ga0207428_10388048 3300027907 Bacteria 1024
425 Ga0268266_10142324 3300028379 Bacteria 2153
426 Ga0268265_10321389 3300028380 Bacteria 1402
427 Ga0268265_10347817 3300028380 Bacteria 1352
428 Ga0268264_10986751 3300028381 Bacteria 848
429 Ga0268264_11193804 3300028381 Bacteria 770
430 Ga0265338_10064804 3300028800 Bacteria 3174
431 Ga0265338_10122535 3300028800 Bacteria 2069
432 Ga0265766_1013371 3300030863 Bacteria 615
433 Ga0265325_10000092 3300031241 Bacteria 63555
434 Ga0265340_10016361 3300031247 Bacteria 3842
435 Ga0265339_10007234 3300031249 Bacteria 7194
436 Ga0265339_10104178 3300031249 Bacteria 1473
437 Ga0265327_10001216 3300031251 Bacteria 34696
438 Ga0265316_10036056 3300031344 Bacteria 4001
439 Ga0265316_10324989 3300031344 Bacteria 1117
440 Ga0307408_100030599 3300031548 Bacteria 3739
441 Ga0307408_100495120 3300031548 Bacteria 1069
442 Ga0265313_10001177 3300031595 Bacteria 25003
443 Ga0307405_10039197 3300031731 Bacteria 2861
444 Ga0307413_10687309 3300031824 Bacteria 848
445 Ga0307410_10265885 3300031852 Bacteria 1340
446 Ga0307406_10220856 3300031901 Bacteria 1408
447 Ga0307409_100387584 3300031995 Bacteria 1331
448 Ga0307409_101126326 3300031995 Bacteria 806
449 Ga0307416_100006633 3300032002 Bacteria 7265
450 Ga0307416_100047655 3300032002 Bacteria 3394
451 Ga0307416_100514615 3300032002 Bacteria 1264
452 Ga0307416_100740607 3300032002 Bacteria 1075
453 Ga0307414_10054989 3300032004 Bacteria 2785
454 Ga0307414_10293803 3300032004 Bacteria 1371
455 Ga0307414_10732001 3300032004 Bacteria 898
456 Ga0307411_10068425 3300032005 Bacteria 2393
457 Ga0307415_100025995 3300032126 Bacteria 3685
458 Ga0307415_100047074 3300032126 Bacteria 2901
459 Ga0373948_0054418 3300034817 Bacteria 866
460 Ga0373938_0104725 3300034957 Bacteria 714
461 Ga0373928_0019751 3300035084 Bacteria 1408
462 Ga0373936_0149619 3300035113 Bacteria 1012
463 Ga0373941_0023759 3300035115 Bacteria 1754
464 Ga0373953_0003102 3300035117 Bacteria 5115
465 Ga0373953_0186672 3300035117 Bacteria 895
466 Ga0373954_0048267 3300035118 Bacteria 1994
467 Ga0373954_0197886 3300035118 Bacteria 987
468 Ga0373956_0208660 3300035119 Bacteria 926
469 Ga0373956_0278593 3300035119 Bacteria 796
470 Ga0373956_0290680 3300035119 Bacteria 778
471 Ga0373960_0013817 3300035121 Bacteria 2033
472 Ga0373955_0008701 3300035172 Bacteria 4724
473 Ga0373955_0185292 3300035172 Bacteria 1236
474 Ga0373931_0051788 3300035691 Bacteria 2188
475 Ga0373931_0172072 3300035691 Bacteria 1277
476 Ga0373935_0146169 3300035692 Bacteria 1601
477 Ga0373927_0291172 3300035695 Bacteria 1075
478 Ga0373927_0359892 3300035695 Bacteria 959
479 Ga0373933_0003617 3300035724 Bacteria 8568
480 Ga0373933_0125904 3300035724 Bacteria 1607
481 Ga0373933_0186414 3300035724 Bacteria 1324
482 Ga0373937_0013477 3300036401 Bacteria 7199
483 Ga0373937_0023906 3300036401 Bacteria 5510
484 Ga0373937_0430483 3300036401 Bacteria 1252
485 Ga0316582_0113549 3300036647 Bacteria 1806
486 Ga0395899_0483270 3300037312 Bacteria 806
487 Ga0395900_0007214 3300037418 Bacteria 11515
488 Ga0395900_0032445 3300037418 Bacteria 5371
489 Ga0395900_0042510 3300037418 Bacteria 4683
490 Ga0395898_0019026 3300037466 Bacteria 6993
491 Ga0395898_0179065 3300037466 Bacteria 2026
492 Ga0395905_0001391 3300037471 Bacteria 29353
493 Ga0395905_0484351 3300037471 Bacteria 1137
494 Ga0395905_1098085 3300037471 Bacteria 699
495 Ga0436364_0067324 3300037853 Bacteria 1994
496 Ga0436364_0179449 3300037853 Bacteria 2053
497 Ga0436364_0234163 3300037853 Bacteria 967
498 Ga0436364_0400376 3300037853 Bacteria 49321
499 Ga0436364_1370990 3300037853 Bacteria 2669
500 Ga0436364_1419253 3300037853 Bacteria 1612
501 Ga0436364_1525673 3300037853 Bacteria 28219
502 Ga0395901_0005667 3300038443 Bacteria 12640
503 Ga0242420_020262 3300038996 Bacteria 1182
504 Ga0400483_100023 3300039062 Bacteria 1057
505 Ga0436365_0550921 3300039437 Bacteria 1901
506 Ga0436365_0704032 3300039437 Bacteria 811
507 Ga0436365_0909950 3300039437 Bacteria 1828
508 Ga0436365_1816817 3300039437 Bacteria 1267
509 Ga0436360_0326890 3300039438 Bacteria 721
510 Ga0436360_0452948 3300039438 Unclassified 581
511 Ga0436360_0589360 3300039438 Bacteria 773
512 Ga0436360_0613967 3300039438 Bacteria 604
513 Ga0436360_0872042 3300039438 Bacteria 1001
514 Ga0436360_1267705 3300039438 Bacteria 1142
515 Ga0436361_0085183 3300039447 Bacteria 3480
516 Ga0436361_0175350 3300039447 Bacteria 1655
517 Ga0436361_0333471 3300039447 Bacteria 2396
518 Ga0436361_0335349 3300039447 Bacteria 596
519 Ga0436361_0450564 3300039447 Bacteria 1304
520 Ga0436361_0502336 3300039447 Bacteria 2496
521 Ga0436361_0666217 3300039447 Bacteria 5230
522 Ga0436361_0819040 3300039447 Bacteria 7493
523 Ga0436361_0863493 3300039447 Bacteria 1344
524 Ga0436363_0572892 3300039450 Bacteria 1804
525 Ga0436363_0902918 3300039450 Bacteria 1190
526 Ga0436363_1345528 3300039450 Unclassified 806
527 Ga0436362_0111635 3300039453 Bacteria 2888
528 Ga0436362_0345536 3300039453 Bacteria 1301
529 Ga0436362_0626657 3300039453 Bacteria 1734
530 Ga0436362_0651475 3300039453 Unclassified 584
531 Ga0436362_0826199 3300039453 Bacteria 9169
532 Ga0436362_0994734 3300039453 Unclassified 635
533 Ga0436362_1000199 3300039453 Bacteria 2332
534 Ga0439453_0032804 3300041408 Bacteria 990
535 Ga0439433_0044230 3300041999 Bacteria 1041
536 Ga0439451_001574 3300042009 Bacteria 4506
537 Ga0450923_007964 3300042125 Bacteria 1810
538 Ga0450895_020951 3300042132 Bacteria 606
539 Ga0450896_005227 3300042133 Bacteria 1770
540 Ga0450899_014284 3300042135 Bacteria 902
541 Ga0450907_004045 3300042146 Bacteria 2548
542 Ga0450910_001892 3300042147 Bacteria 2706
543 Ga0450910_007240 3300042147 Bacteria 1544
544 Ga0439446_0008107 3300042156 Bacteria 2779
545 Ga0439446_0118106 3300042156 Bacteria 851
546 Ga0439446_0230532 3300042156 Bacteria 633
547 Ga0450908_002235 3300042184 Bacteria 3789
548 Ga0439434_0011318 3300042435 Bacteria 2637
549 Ga0439444_0001542 3300042437 Bacteria 3025
550 Ga0439460_0126681 3300042461 Bacteria 839
551 Ga0450918_011772 3300042531 Bacteria 1523
552 Ga0450918_013242 3300042531 Bacteria 1435
553 Ga0451577_0364153 3300042876 Bacteria 1311
554 Ga0453683_0017389 3300044673 Bacteria 4628
555 Ga0453684_0028811 3300044712 Bacteria 7906
556 Ga0451576_0220457 3300045051 Bacteria 1980
557 Ga0466958_0243534 3300045836 Bacteria 1149
558 Ga0466958_0351522 3300045836 Bacteria 949
559 Ga0466967_0165687 3300045976 Bacteria 2077
560 Ga0495651_0170931 3300046462 Bacteria 1548
561 Ga0495580_0450470 3300046472 Bacteria 864
562 Ga0495664_0106068 3300046477 Bacteria 1694
563 Ga0495584_0024182 3300046491 Bacteria 3080
564 Ga0495584_0240759 3300046491 Bacteria 920
565 Ga0495583_0123893 3300046506 Bacteria 1086
566 Ga0495608_0124238 3300046511 Bacteria 1654
567 Ga0495630_0280948 3300046517 Bacteria 1272
568 Ga0495631_0034954 3300046518 Bacteria 2251
569 Ga0495652_0075755 3300046529 Bacteria 2793
570 Ga0495586_0229207 3300046535 Bacteria 1057
571 Ga0495587_0054218 3300046536 Bacteria 2363
572 Ga0495667_0018210 3300046559 Bacteria 4745
573 Ga0495656_0215587 3300046615 Bacteria 958
574 Ga0495611_0345718 3300046648 Bacteria 683
575 Ga0495625_0410888 3300046660 Bacteria 844
576 Ga0495659_0078167 3300046664 Bacteria 1251
577 Ga0495657_0083702 3300046675 Bacteria 2059
578 Ga0495657_0284045 3300046675 Bacteria 990
579 Ga0495604_0260725 3300047317 Bacteria 1178
580 Ga0495604_0403361 3300047317 Bacteria 900
581 Ga0495674_1067422 3300047319 Bacteria 616
582 Ga0495680_0372217 3300047322 Bacteria 991
583 Ga0495675_0038422 3300047444 Bacteria 3048
584 Ga0495675_0756996 3300047444 Bacteria 540
585 Ga0495684_0566971 3300047471 Bacteria 771
586 Ga0495602_0296436 3300048088 Bacteria 1185
587 Ga0496100_0099267 3300048903 Bacteria 2003
588 Ga0496100_0179121 3300048903 Bacteria 1532
589 Ga0496100_0247054 3300048903 Bacteria 1318
590 Ga0496101_0712003 3300048904 Bacteria 792
591 Ga0496102_0196390 3300048905 Bacteria 1901
592 Ga0496103_0012541 3300048906 Bacteria 5025
593 Ga0496103_0179477 3300048906 Bacteria 1361
594 Ga0496104_0251297 3300048907 Bacteria 1681
595 Ga0496104_0895370 3300048907 Bacteria 792
596 Ga0496104_1524454 3300048907 Bacteria 571
597 Ga0496105_0678740 3300048908 Bacteria 792
598 Ga0496106_0075445 3300048909 Bacteria 2582
599 Ga0496106_0246443 3300048909 Bacteria 1428
600 Ga0496106_0316320 3300048909 Bacteria 1253
601 Ga0496107_0011017 3300048910 Bacteria 6289
602 Ga0496108_0165715 3300048911 Bacteria 1910
603 Ga0496109_0029266 3300048912 Bacteria 4932
604 Ga0496109_0257745 3300048912 Bacteria 1643
605 Ga0496110_0179984 3300048913 Bacteria 1920
606 Ga0496110_0991183 3300048913 Bacteria 747
607 Ga0496111_0466043 3300048914 Bacteria 931
608 Ga0496111_0499680 3300048914 Bacteria 895
609 Ga0496111_0769317 3300048914 Bacteria 698
610 Ga0496112_0596229 3300048915 Bacteria 1037
611 Ga0496112_0599467 3300048915 Bacteria 1033
612 Ga0496113_1108676 3300048916 Bacteria 620
613 Ga0496114_0018184 3300048917 Bacteria 5678
614 Ga0496114_0364115 3300048917 Bacteria 1279
615 Ga0496115_0019140 3300048918 Bacteria 5266
616 Ga0496115_0412181 3300048918 Bacteria 1095
617 Ga0501312_039911 3300049528 Bacteria 764
618 Ga0501031_0029391 3300049568 Bacteria 3585
619 Ga0501031_0113004 3300049568 Bacteria 1774
620 Ga0501031_0261281 3300049568 Bacteria 1125
621 Ga0501033_0124715 3300049570 Bacteria 1868
622 Ga0501036_0221895 3300049572 Bacteria 1587
623 Ga0501036_0476817 3300049572 Bacteria 1039
624 Ga0501036_0846268 3300049572 Bacteria 752
625 Ga0501036_1105143 3300049572 Bacteria 648
626 Ga0501036_1269607 3300049572 Bacteria 599
627 Ga0501037_0069290 3300049573 Bacteria 2568
628 Ga0501038_0251962 3300049574 Bacteria 1398
629 Ga0501039_0032551 3300049575 Bacteria 4021
630 Ga0501039_0192000 3300049575 Bacteria 1606
631 Ga0501039_0811279 3300049575 Bacteria 730
632 Ga0501040_0007949 3300049576 Bacteria 6882
633 Ga0501040_0016236 3300049576 Bacteria 4925
634 Ga0501040_0064021 3300049576 Bacteria 2531
635 Ga0501041_0085577 3300049577 Bacteria 1944
636 Ga0501041_0397731 3300049577 Bacteria 872
637 Ga0501042_0031965 3300049578 Bacteria 3725
638 Ga0501042_0059139 3300049578 Bacteria 2737
639 Ga0501042_0063858 3300049578 Bacteria 2631
640 Ga0501042_0072530 3300049578 Bacteria 2464
641 Ga0501042_0156202 3300049578 Bacteria 1645
642 Ga0501042_0269183 3300049578 Bacteria 1230
643 Ga0501046_0269573 3300049580 Bacteria 1249
644 Ga0501046_0668736 3300049580 Bacteria 733
645 Ga0501048_0042789 3300049582 Bacteria 3242
646 Ga0501048_0089789 3300049582 Bacteria 2168
647 Ga0501048_0476587 3300049582 Bacteria 894
648 Ga0501048_0623758 3300049582 Bacteria 774
649 Ga0501048_0868830 3300049582 Bacteria 648
650 Ga0501068_0438549 3300049584 Bacteria 844
651 Ga0501068_0564344 3300049584 Bacteria 741
652 Ga0501068_0610429 3300049584 Bacteria 711
653 Ga0501068_1018202 3300049584 Bacteria 547
654 Ga0501069_0145066 3300049585 Bacteria 1363
655 Ga0501070_0065514 3300049586 Bacteria 3008
656 Ga0501070_0168233 3300049586 Bacteria 1806
657 Ga0501071_0026051 3300049587 Bacteria 4102
658 Ga0501071_0046812 3300049587 Bacteria 3106
659 Ga0501071_0465399 3300049587 Bacteria 968
660 Ga0501071_0850835 3300049587 Bacteria 703
661 Ga0501072_0005695 3300049588 Bacteria 9486
662 Ga0501072_0074472 3300049588 Bacteria 2685
663 Ga0501072_0189069 3300049588 Bacteria 1642
664 Ga0501072_0332867 3300049588 Bacteria 1206
665 Ga0501072_0417389 3300049588 Bacteria 1064
666 Ga0501072_0540317 3300049588 Bacteria 921
667 Ga0501073_0151261 3300049589 Bacteria 1609
668 Ga0501074_0051472 3300049590 Bacteria 2972
669 Ga0501075_0015392 3300049591 Bacteria 5489
670 Ga0501075_0047800 3300049591 Bacteria 3215
671 Ga0501075_0051778 3300049591 Bacteria 3088
672 Ga0501075_0120292 3300049591 Bacteria 1998
673 Ga0501075_0208139 3300049591 Bacteria 1492
674 Ga0501076_0089354 3300049592 Bacteria 2476
675 Ga0501076_0090170 3300049592 Bacteria 2465
676 Ga0501076_0100927 3300049592 Bacteria 2325
677 Ga0501076_0323256 3300049592 Bacteria 1265
678 Ga0501076_0677482 3300049592 Bacteria 851
679 Ga0501076_0740292 3300049592 Bacteria 811
680 Ga0501077_0017260 3300049593 Bacteria 4552
681 Ga0501077_0101271 3300049593 Bacteria 1825
682 Ga0501077_0760638 3300049593 Bacteria 623
683 Ga0501257_030909 3300049686 Bacteria 1291
684 Ga0501079_0056766 3300049741 Bacteria 3021
685 Ga0501079_0176018 3300049741 Bacteria 1668
686 Ga0501079_0181299 3300049741 Bacteria 1643
687 Ga0501079_0182918 3300049741 Bacteria 1636
688 Ga0501080_0256463 3300049742 Bacteria 1594
689 Ga0501080_0280985 3300049742 Bacteria 1513
690 Ga0501080_0732112 3300049742 Bacteria 871
691 Ga0501080_1105412 3300049742 Bacteria 684
692 Ga0501081_0038695 3300049743 Bacteria 3260
693 Ga0501081_0206551 3300049743 Bacteria 1425
694 Ga0501081_0318836 3300049743 Bacteria 1142
695 Ga0501081_0362369 3300049743 Bacteria 1069
696 Ga0501083_0018378 3300049744 Bacteria 4872
697 Ga0501083_0155206 3300049744 Bacteria 1499
698 Ga0501083_0327450 3300049744 Bacteria 996
699 Ga0501035_0053148 3300049822 Bacteria 3624
700 Ga0501035_0311329 3300049822 Bacteria 1325
701 Ga0501045_0023824 3300049824 Bacteria 4393
702 Ga0501045_0097216 3300049824 Bacteria 2178
703 Ga0501045_0610792 3300049824 Bacteria 807
704 nmdc:mga05p37_273272_c1 3300050507 Bacteria 2018
705 nmdc:mga05p37_295773_c1 3300050507 Bacteria 1926
706 nmdc:mga05p37_70706_c1 3300050507 Bacteria 4293
707 nmdc:mga05p37_71_c2 3300050507 Bacteria 60785
708 nmdc:mga09592_2253_c1 3300050508 Bacteria 15524
709 nmdc:mga09592_33396_c1 3300050508 Bacteria 4294
710 nmdc:mga09592_584391_c1 3300050508 Bacteria 958
711 nmdc:mga0qj67_254_c1 3300050509 Bacteria 36579
712 nmdc:mga0qj67_613158_c1 3300050509 Bacteria 870
713 nmdc:mga0qj67_623672_c1 3300050509 Bacteria 861
714 nmdc:mga06r32_1565_c1 3300050510 Bacteria 20637
715 nmdc:mga06r32_98331_c1 3300050510 Bacteria 2869
716 nmdc:mga08y16_10021_c1 3300050511 Bacteria 9947
717 nmdc:mga08y16_14527_c1 3300050511 Bacteria 8284
718 nmdc:mga08y16_671322_c1 3300050511 Bacteria 1039
719 nmdc:mga0n895_18142_c1 3300050512 Bacteria 6506
720 nmdc:mga0n895_328516_c1 3300050512 Bacteria 1550
721 nmdc:mga0n895_397475_c1 3300050512 Bacteria 1394
722 nmdc:mga0rr50_253738_c1 3300050513 Bacteria 1461
723 nmdc:mga0rr50_28747_c1 3300050513 Bacteria 3912
724 nmdc:mga0rr50_44266_c1 3300050513 Bacteria 3264
725 nmdc:mga0rr50_601444_c1 3300050513 Bacteria 937
726 nmdc:mga08x19_137391_c1 3300050514 Bacteria 1649
727 nmdc:mga08x19_29955_c1 3300050514 Bacteria 3416
728 nmdc:mga0a205_1146184_c1 3300050515 Bacteria 625
729 nmdc:mga0a205_186_c1 3300050515 Bacteria 42838
730 nmdc:mga0a205_212060_c1 3300050515 Bacteria 1825
731 nmdc:mga0a205_603_c1 3300050515 Bacteria 28564
732 nmdc:mga0a205_958630_c1 3300050515 Bacteria 702
733 Ga0495601_0063817 3300053077 Bacteria 2341
734 Ga0495612_0396385 3300053078 Bacteria 627
735 Ga0495655_0001448 3300053083 Bacteria 3631
736 Ga0495595_0182556 3300053084 Bacteria 1041
737 Ga0495595_0409570 3300053084 Bacteria 687
738 Ga0495595_0439882 3300053084 Bacteria 662
739 Ga0495619_0043670 3300053085 Bacteria 2939
740 Ga0495619_0100928 3300053085 Bacteria 1964
741 Ga0500573_0177570 3300053140 Bacteria 1147
742 Ga0501084_0097418 3300054114 Bacteria 2469
743 Ga0501084_0108308 3300054114 Bacteria 2334
744 Ga0501084_0229430 3300054114 Bacteria 1567
745 Ga0501084_0652719 3300054114 Bacteria 888
746 Ga0590071_031392 3300059421 Bacteria 1267
747 Ga0590074_021574 3300059423 Bacteria 1111
748 Ga0501082_0045243 3300060353 Bacteria 3796
749 Ga0501082_0058732 3300060353 Bacteria 3314
750 Ga0501082_0098964 3300060353 Bacteria 2521
751 Ga0501082_0122693 3300060353 Bacteria 2253
752 Ga0501082_0139925 3300060353 Bacteria 2100
753 Ga0530510_0075169 3300061734 Bacteria 2453
754 Ga0530510_0176584 3300061734 Bacteria 1583

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0740292 Ga0501076_0740292_404_796 129
2 3300006844 Ga0075428_100003582 Ga0075428_1000035822 150
3 3300009094 Ga0111539_10005141 Ga0111539_100051418 150
4 3300009094 Ga0111539_10469891 Ga0111539_104698911 150
5 3300009147 Ga0114129_10153938 Ga0114129_101539382 150
6 3300014969 Ga0157376_12247899 Ga0157376_122478991 150
7 3300021361 Ga0213872_10036060 Ga0213872_100360601 150
8 3300021361 Ga0213872_10145270 Ga0213872_101452701 150
9 3300027907 Ga0207428_10010018 Ga0207428_100100182 150
10 3300039447 Ga0436361_0666217 Ga0436361_0666217_3513_3968 150
11 3300039447 Ga0436361_0819040 Ga0436361_0819040_4997_5452 150
12 3300039447 Ga0436361_0863493 Ga0436361_0863493_383_838 150
13 3300041999 Ga0439433_0044230 Ga0439433_0044230_242_697 150
14 3300050507 nmdc:mga05p37_273272_c1 nmdc:mga05p37_273272_c1_174_629 150
15 3300050511 nmdc:mga08y16_14527_c1 nmdc:mga08y16_14527_c1_2220_2675 150
16 3300050515 nmdc:mga0a205_958630_c1 nmdc:mga0a205_958630_c1_65_520 150
17 3300005439 Ga0070711_100458276 Ga0070711_1004582762 151
18 3300005458 Ga0070681_10036316 Ga0070681_100363162 151
19 3300005614 Ga0068856_101166912 Ga0068856_1011669122 151
20 3300005983 Ga0081540_1106663 Ga0081540_11066632 151
21 3300006175 Ga0070712_100357943 Ga0070712_1003579432 151
22 3300009093 Ga0105240_10101794 Ga0105240_101017944 151
23 3300009553 Ga0105249_11311248 Ga0105249_113112482 151
24 3300013307 Ga0157372_10061458 Ga0157372_100614582 151
25 3300020069 Ga0197907_11338434 Ga0197907_113384341 151
26 3300020069 Ga0197907_11500817 Ga0197907_115008171 151
27 3300020070 Ga0206356_10683826 Ga0206356_106838262 151
28 3300020080 Ga0206350_10309521 Ga0206350_103095212 151
29 3300020081 Ga0206354_10705081 Ga0206354_107050811 151
30 3300021377 Ga0213874_10131003 Ga0213874_101310031 151
31 3300021384 Ga0213876_10150809 Ga0213876_101508092 151
32 3300021388 Ga0213875_10036138 Ga0213875_100361383 151
33 3300022467 Ga0224712_10200467 Ga0224712_102004671 151
34 3300022467 Ga0224712_10281498 Ga0224712_102814982 151
35 3300022467 Ga0224712_10473638 Ga0224712_104736381 151
36 3300025904 Ga0207647_10153973 Ga0207647_101539732 151
37 3300025912 Ga0207707_10064245 Ga0207707_100642452 151
38 3300025912 Ga0207707_10539070 Ga0207707_105390702 151
39 3300025917 Ga0207660_10289305 Ga0207660_102893052 151
40 3300025921 Ga0207652_10783573 Ga0207652_107835732 151
41 3300025949 Ga0207667_10761467 Ga0207667_107614672 151
42 3300031344 Ga0265316_10324989 Ga0265316_103249892 151
43 3300035119 Ga0373956_0278593 Ga0373956_0278593_17_475 151
44 3300035724 Ga0373933_0125904 Ga0373933_0125904_558_1016 151
45 3300036401 Ga0373937_0023906 Ga0373937_0023906_3206_3664 151
46 3300037466 Ga0395898_0179065 Ga0395898_0179065_963_1421 151
47 3300037853 Ga0436364_1419253 Ga0436364_1419253_313_771 151
48 3300039062 Ga0400483_100023 Ga0400483_100023_462_920 151
49 3300039437 Ga0436365_0704032 Ga0436365_0704032_186_644 151
50 3300039437 Ga0436365_0909950 Ga0436365_0909950_1147_1605 151
51 3300039437 Ga0436365_1816817 Ga0436365_1816817_448_906 151
52 3300039450 Ga0436363_0902918 Ga0436363_0902918_481_939 151
53 3300039453 Ga0436362_0626657 Ga0436362_0626657_668_1126 151
54 3300042876 Ga0451577_0364153 Ga0451577_0364153_483_971 151
55 3300044673 Ga0453683_0017389 Ga0453683_0017389_4052_4540 151
56 3300044712 Ga0453684_0028811 Ga0453684_0028811_3228_3716 151
57 3300045051 Ga0451576_0220457 Ga0451576_0220457_340_828 151
58 3300045836 Ga0466958_0243534 Ga0466958_0243534_196_654 151
59 3300045976 Ga0466967_0165687 Ga0466967_0165687_1374_1832 151
60 3300046472 Ga0495580_0450470 Ga0495580_0450470_311_769 151
61 3300046517 Ga0495630_0280948 Ga0495630_0280948_552_1010 151
62 3300046535 Ga0495586_0229207 Ga0495586_0229207_58_516 151
63 3300049586 Ga0501070_0168233 Ga0501070_0168233_493_951 151
64 3300050515 nmdc:mga0a205_1146184_c1 nmdc:mga0a205_1146184_c1_27_485 151
65 3300032002 Ga0307416_100047655 Ga0307416_1000476552 153
66 3300032004 Ga0307414_10732001 Ga0307414_107320011 153
67 3300049742 Ga0501080_0732112 Ga0501080_0732112_278_742 153
68 3300005471 Ga0070698_100115481 Ga0070698_1001154814 155
69 3300037471 Ga0395905_0484351 Ga0395905_0484351_515_985 155
70 3300001977 JGI24746J21847_1018425 JGI24746J21847_10184252 156
71 3300001979 JGI24740J21852_10138953 JGI24740J21852_101389531 156
72 3300001989 JGI24739J22299_10057414 JGI24739J22299_100574142 156
73 3300001990 JGI24737J22298_10104162 JGI24737J22298_101041621 156
74 3300001991 JGI24743J22301_10019173 JGI24743J22301_100191732 156
75 3300002070 JGI24750J21931_1036118 JGI24750J21931_10361181 156
76 3300002075 JGI24738J21930_10018485 JGI24738J21930_100184852 156
77 3300002076 JGI24749J21850_1012118 JGI24749J21850_10121181 156
78 3300002077 JGI24744J21845_10051751 JGI24744J21845_100517511 156
79 3300002239 JGI24034J26672_10041921 JGI24034J26672_100419211 156
80 3300002459 JGI24751J29686_10028732 JGI24751J29686_100287322 156
81 3300003781 Ga0055536_1005701 Ga0055536_10057013 156
82 3300004798 Ga0058859_11736316 Ga0058859_117363161 156
83 3300004799 Ga0058863_10021980 Ga0058863_100219801 156
84 3300004803 Ga0058862_12148936 Ga0058862_121489361 156
85 3300005295 Ga0065707_10774067 Ga0065707_107740671 156
86 3300005327 Ga0070658_10106840 Ga0070658_101068402 156
87 3300005327 Ga0070658_10212384 Ga0070658_102123843 156
88 3300005328 Ga0070676_10020731 Ga0070676_100207312 156
89 3300005329 Ga0070683_100019514 Ga0070683_1000195142 156
90 3300005329 Ga0070683_100728171 Ga0070683_1007281712 156
91 3300005330 Ga0070690_100002142 Ga0070690_1000021424 156
92 3300005330 Ga0070690_101206075 Ga0070690_1012060751 156
93 3300005331 Ga0070670_100014885 Ga0070670_1000148851 156
94 3300005334 Ga0068869_100077072 Ga0068869_1000770722 156
95 3300005335 Ga0070666_10008032 Ga0070666_100080321 156
96 3300005336 Ga0070680_100036366 Ga0070680_1000363661 156
97 3300005336 Ga0070680_100080294 Ga0070680_1000802943 156
98 3300005336 Ga0070680_100142714 Ga0070680_1001427142 156
99 3300005336 Ga0070680_100282269 Ga0070680_1002822692 156
100 3300005337 Ga0070682_100002624 Ga0070682_10000262413 156
101 3300005338 Ga0068868_100004569 Ga0068868_1000045696 156
102 3300005339 Ga0070660_100002725 Ga0070660_1000027259 156
103 3300005340 Ga0070689_100004193 Ga0070689_1000041937 156
104 3300005341 Ga0070691_10012213 Ga0070691_100122132 156
105 3300005343 Ga0070687_100015260 Ga0070687_1000152602 156
106 3300005343 Ga0070687_100315716 Ga0070687_1003157162 156
107 3300005344 Ga0070661_100436918 Ga0070661_1004369182 156
108 3300005345 Ga0070692_10057767 Ga0070692_100577672 156
109 3300005347 Ga0070668_100000376 Ga0070668_10000037610 156
110 3300005353 Ga0070669_100030458 Ga0070669_1000304581 156
111 3300005353 Ga0070669_100069400 Ga0070669_1000694003 156
112 3300005354 Ga0070675_100017979 Ga0070675_1000179793 156
113 3300005355 Ga0070671_100009874 Ga0070671_1000098744 156
114 3300005356 Ga0070674_100022688 Ga0070674_1000226885 156
115 3300005364 Ga0070673_100004016 Ga0070673_1000040165 156
116 3300005365 Ga0070688_100000716 Ga0070688_10000071610 156
117 3300005365 Ga0070688_100678703 Ga0070688_1006787032 156
118 3300005366 Ga0070659_100023971 Ga0070659_1000239712 156
119 3300005366 Ga0070659_100083948 Ga0070659_1000839482 156
120 3300005367 Ga0070667_100009839 Ga0070667_1000098392 156
121 3300005406 Ga0070703_10028505 Ga0070703_100285051 156
122 3300005434 Ga0070709_10013694 Ga0070709_100136942 156
123 3300005434 Ga0070709_10019019 Ga0070709_100190194 156
124 3300005434 Ga0070709_10071440 Ga0070709_100714402 156
125 3300005435 Ga0070714_100007835 Ga0070714_1000078356 156
126 3300005435 Ga0070714_100228676 Ga0070714_1002286762 156
127 3300005435 Ga0070714_100528163 Ga0070714_1005281632 156
128 3300005435 Ga0070714_100882598 Ga0070714_1008825982 156
129 3300005435 Ga0070714_101511110 Ga0070714_1015111101 156
130 3300005436 Ga0070713_100003311 Ga0070713_1000033119 156
131 3300005436 Ga0070713_100074696 Ga0070713_1000746962 156
132 3300005436 Ga0070713_100120415 Ga0070713_1001204151 156
133 3300005436 Ga0070713_100377453 Ga0070713_1003774533 156
134 3300005437 Ga0070710_10005364 Ga0070710_100053642 156
135 3300005437 Ga0070710_10026516 Ga0070710_100265161 156
136 3300005437 Ga0070710_10497872 Ga0070710_104978721 156
137 3300005437 Ga0070710_10578842 Ga0070710_105788421 156
138 3300005438 Ga0070701_10001121 Ga0070701_100011213 156
139 3300005439 Ga0070711_100008572 Ga0070711_1000085724 156
140 3300005439 Ga0070711_100021230 Ga0070711_1000212302 156
141 3300005439 Ga0070711_101168444 Ga0070711_1011684441 156
142 3300005440 Ga0070705_100005414 Ga0070705_1000054142 156
143 3300005441 Ga0070700_100003167 Ga0070700_1000031674 156
144 3300005444 Ga0070694_100001113 Ga0070694_1000011137 156
145 3300005444 Ga0070694_100785233 Ga0070694_1007852332 156
146 3300005455 Ga0070663_100012931 Ga0070663_1000129317 156
147 3300005456 Ga0070678_100001623 Ga0070678_1000016232 156
148 3300005457 Ga0070662_100003055 Ga0070662_1000030552 156
149 3300005458 Ga0070681_10035427 Ga0070681_100354274 156
150 3300005458 Ga0070681_10131879 Ga0070681_101318793 156
151 3300005458 Ga0070681_10149663 Ga0070681_101496632 156
152 3300005458 Ga0070681_10614958 Ga0070681_106149582 156
153 3300005458 Ga0070681_10758819 Ga0070681_107588191 156
154 3300005459 Ga0068867_100002464 Ga0068867_1000024641 156
155 3300005466 Ga0070685_10042928 Ga0070685_100429282 156
156 3300005466 Ga0070685_10513257 Ga0070685_105132572 156
157 3300005468 Ga0070707_100363541 Ga0070707_1003635412 156
158 3300005468 Ga0070707_101788797 Ga0070707_1017887971 156
159 3300005471 Ga0070698_100002609 Ga0070698_10000260914 156
160 3300005471 Ga0070698_100319275 Ga0070698_1003192751 156
161 3300005518 Ga0070699_100153636 Ga0070699_1001536363 156
162 3300005530 Ga0070679_100001558 Ga0070679_1000015582 156
163 3300005530 Ga0070679_100025585 Ga0070679_1000255854 156
164 3300005530 Ga0070679_100039238 Ga0070679_1000392382 156
165 3300005530 Ga0070679_100236378 Ga0070679_1002363782 156
166 3300005530 Ga0070679_100433753 Ga0070679_1004337533 156
167 3300005530 Ga0070679_100670706 Ga0070679_1006707062 156
168 3300005530 Ga0070679_100915508 Ga0070679_1009155081 156
169 3300005535 Ga0070684_100220675 Ga0070684_1002206752 156
170 3300005536 Ga0070697_100002320 Ga0070697_1000023208 156
171 3300005536 Ga0070697_100045810 Ga0070697_1000458102 156
172 3300005536 Ga0070697_100162926 Ga0070697_1001629262 156
173 3300005536 Ga0070697_100847432 Ga0070697_1008474322 156
174 3300005539 Ga0068853_100001909 Ga0068853_10000190915 156
175 3300005543 Ga0070672_100118847 Ga0070672_1001188472 156
176 3300005544 Ga0070686_100001615 Ga0070686_1000016157 156
177 3300005544 Ga0070686_100145198 Ga0070686_1001451982 156
178 3300005544 Ga0070686_100246242 Ga0070686_1002462422 156
179 3300005545 Ga0070695_100005745 Ga0070695_1000057453 156
180 3300005545 Ga0070695_100202171 Ga0070695_1002021712 156
181 3300005546 Ga0070696_100009145 Ga0070696_1000091452 156
182 3300005547 Ga0070693_100057045 Ga0070693_1000570452 156
183 3300005548 Ga0070665_100345994 Ga0070665_1003459942 156
184 3300005549 Ga0070704_100006944 Ga0070704_1000069443 156
185 3300005549 Ga0070704_100516338 Ga0070704_1005163382 156
186 3300005563 Ga0068855_100080130 Ga0068855_1000801303 156
187 3300005563 Ga0068855_101370484 Ga0068855_1013704842 156
188 3300005564 Ga0070664_100002115 Ga0070664_1000021153 156
189 3300005577 Ga0068857_100014232 Ga0068857_1000142324 156
190 3300005578 Ga0068854_100031138 Ga0068854_1000311383 156
191 3300005614 Ga0068856_100009612 Ga0068856_1000096125 156
192 3300005614 Ga0068856_100246778 Ga0068856_1002467782 156
193 3300005615 Ga0070702_100000110 Ga0070702_10000011012 156
194 3300005615 Ga0070702_100551391 Ga0070702_1005513912 156
195 3300005616 Ga0068852_100014700 Ga0068852_1000147002 156
196 3300005617 Ga0068859_100035260 Ga0068859_1000352605 156
197 3300005618 Ga0068864_100961724 Ga0068864_1009617241 156
198 3300005718 Ga0068866_10007211 Ga0068866_100072112 156
199 3300005719 Ga0068861_100053023 Ga0068861_1000530232 156
200 3300005834 Ga0068851_10141964 Ga0068851_101419642 156
201 3300005841 Ga0068863_100003256 Ga0068863_1000032565 156
202 3300005842 Ga0068858_100004547 Ga0068858_10000454710 156
203 3300005843 Ga0068860_100033018 Ga0068860_1000330182 156
204 3300005843 Ga0068860_101399741 Ga0068860_1013997411 156
205 3300005844 Ga0068862_100001176 Ga0068862_10000117611 156
206 3300005844 Ga0068862_101812004 Ga0068862_1018120041 156
207 3300005937 Ga0081455_10000393 Ga0081455_100003933 156
208 3300005937 Ga0081455_10015402 Ga0081455_100154022 156
209 3300005937 Ga0081455_10210092 Ga0081455_102100922 156
210 3300005983 Ga0081540_1005532 Ga0081540_10055326 156
211 3300005983 Ga0081540_1006326 Ga0081540_10063262 156
212 3300005983 Ga0081540_1025362 Ga0081540_10253622 156
213 3300006028 Ga0070717_10000755 Ga0070717_100007554 156
214 3300006028 Ga0070717_10088692 Ga0070717_100886923 156
215 3300006028 Ga0070717_10842952 Ga0070717_108429521 156
216 3300006028 Ga0070717_11069430 Ga0070717_110694302 156
217 3300006058 Ga0075432_10003839 Ga0075432_100038391 156
218 3300006058 Ga0075432_10050954 Ga0075432_100509542 156
219 3300006163 Ga0070715_10037993 Ga0070715_100379931 156
220 3300006163 Ga0070715_10120587 Ga0070715_101205872 156
221 3300006163 Ga0070715_10331566 Ga0070715_103315662 156
222 3300006173 Ga0070716_100000813 Ga0070716_10000081319 156
223 3300006173 Ga0070716_100047414 Ga0070716_1000474142 156
224 3300006175 Ga0070712_100005408 Ga0070712_1000054085 156
225 3300006175 Ga0070712_100006409 Ga0070712_1000064094 156
226 3300006175 Ga0070712_100049760 Ga0070712_1000497602 156
227 3300006175 Ga0070712_100083928 Ga0070712_1000839282 156
228 3300006175 Ga0070712_100107707 Ga0070712_1001077072 156
229 3300006175 Ga0070712_100513712 Ga0070712_1005137122 156
230 3300006175 Ga0070712_101061667 Ga0070712_1010616671 156
231 3300006194 Ga0075427_10005123 Ga0075427_100051232 156
232 3300006237 Ga0097621_100660997 Ga0097621_1006609971 156
233 3300006237 Ga0097621_100757775 Ga0097621_1007577752 156
234 3300006844 Ga0075428_100001364 Ga0075428_10000136414 156
235 3300006844 Ga0075428_100675474 Ga0075428_1006754742 156
236 3300006844 Ga0075428_100777146 Ga0075428_1007771462 156
237 3300006846 Ga0075430_100000565 Ga0075430_10000056512 156
238 3300006846 Ga0075430_100151982 Ga0075430_1001519824 156
239 3300006846 Ga0075430_100649312 Ga0075430_1006493121 156
240 3300006846 Ga0075430_100876153 Ga0075430_1008761531 156
241 3300006847 Ga0075431_100001518 Ga0075431_10000151815 156
242 3300006847 Ga0075431_100572539 Ga0075431_1005725392 156
243 3300006852 Ga0075433_10000126 Ga0075433_1000012612 156
244 3300006852 Ga0075433_10001448 Ga0075433_100014482 156
245 3300006852 Ga0075433_10583882 Ga0075433_105838822 156
246 3300006871 Ga0075434_100000393 Ga0075434_10000039312 156
247 3300006871 Ga0075434_100000572 Ga0075434_10000057216 156
248 3300006871 Ga0075434_100426252 Ga0075434_1004262524 156
249 3300006871 Ga0075434_101394810 Ga0075434_1013948101 156
250 3300006880 Ga0075429_100000531 Ga0075429_10000053117 156
251 3300006880 Ga0075429_100046549 Ga0075429_1000465494 156
252 3300006880 Ga0075429_100772130 Ga0075429_1007721302 156
253 3300006881 Ga0068865_100002919 Ga0068865_1000029198 156
254 3300006914 Ga0075436_100022371 Ga0075436_1000223712 156
255 3300006931 Ga0097620_100035256 Ga0097620_1000352565 156
256 3300007076 Ga0075435_100001611 Ga0075435_1000016117 156
257 3300007076 Ga0075435_100023273 Ga0075435_1000232733 156
258 3300007076 Ga0075435_100030125 Ga0075435_1000301252 156
259 3300007076 Ga0075435_100182727 Ga0075435_1001827275 156
260 3300007076 Ga0075435_100934842 Ga0075435_1009348421 156
261 3300007788 Ga0099795_10055890 Ga0099795_100558903 156
262 3300009011 Ga0105251_10087930 Ga0105251_100879301 156
263 3300009036 Ga0105244_10180822 Ga0105244_101808222 156
264 3300009092 Ga0105250_10009593 Ga0105250_100095932 156
265 3300009093 Ga0105240_10059223 Ga0105240_100592232 156
266 3300009094 Ga0111539_10000954 Ga0111539_1000095424 156
267 3300009094 Ga0111539_10836499 Ga0111539_108364992 156
268 3300009094 Ga0111539_10877760 Ga0111539_108777602 156
269 3300009098 Ga0105245_10022595 Ga0105245_100225953 156
270 3300009101 Ga0105247_10001876 Ga0105247_100018767 156
271 3300009101 Ga0105247_10104621 Ga0105247_101046212 156
272 3300009147 Ga0114129_10039564 Ga0114129_100395643 156
273 3300009147 Ga0114129_10265055 Ga0114129_102650552 156
274 3300009147 Ga0114129_10995848 Ga0114129_109958482 156
275 3300009148 Ga0105243_10008763 Ga0105243_100087632 156
276 3300009148 Ga0105243_10264322 Ga0105243_102643222 156
277 3300009174 Ga0105241_10007439 Ga0105241_100074397 156
278 3300009176 Ga0105242_10116504 Ga0105242_101165042 156
279 3300009177 Ga0105248_10004856 Ga0105248_100048562 156
280 3300009177 Ga0105248_10618853 Ga0105248_106188532 156
281 3300009177 Ga0105248_10648917 Ga0105248_106489171 156
282 3300009545 Ga0105237_10004828 Ga0105237_100048282 156
283 3300009551 Ga0105238_10096976 Ga0105238_100969762 156
284 3300009553 Ga0105249_10000914 Ga0105249_1000091411 156
285 3300010159 Ga0099796_10005898 Ga0099796_100058982 156
286 3300010375 Ga0105239_10006584 Ga0105239_100065846 156
287 3300011119 Ga0105246_10001402 Ga0105246_100014026 156
288 3300012475 Ga0157317_1005551 Ga0157317_10055512 156
289 3300012478 Ga0157328_1001584 Ga0157328_10015841 156
290 3300013100 Ga0157373_10074412 Ga0157373_100744122 156
291 3300013102 Ga0157371_10002409 Ga0157371_100024096 156
292 3300013102 Ga0157371_10177299 Ga0157371_101772992 156
293 3300013104 Ga0157370_10085525 Ga0157370_100855253 156
294 3300013104 Ga0157370_10151923 Ga0157370_101519232 156
295 3300013104 Ga0157370_10348894 Ga0157370_103488941 156
296 3300013105 Ga0157369_10004115 Ga0157369_100041152 156
297 3300013105 Ga0157369_10010257 Ga0157369_1001025714 156
298 3300013105 Ga0157369_10343057 Ga0157369_103430573 156
299 3300013105 Ga0157369_11111164 Ga0157369_111111641 156
300 3300013296 Ga0157374_10023226 Ga0157374_100232262 156
301 3300013296 Ga0157374_10886412 Ga0157374_108864122 156
302 3300013296 Ga0157374_11144284 Ga0157374_111442841 156
303 3300013297 Ga0157378_10007071 Ga0157378_1000707110 156
304 3300013306 Ga0163162_10136687 Ga0163162_101366873 156
305 3300013306 Ga0163162_10325816 Ga0163162_103258161 156
306 3300013307 Ga0157372_10052459 Ga0157372_100524593 156
307 3300013307 Ga0157372_10742363 Ga0157372_107423632 156
308 3300013308 Ga0157375_10069209 Ga0157375_100692092 156
309 3300013308 Ga0157375_11714282 Ga0157375_117142821 156
310 3300014325 Ga0163163_10086134 Ga0163163_100861342 156
311 3300014325 Ga0163163_10543768 Ga0163163_105437682 156
312 3300014325 Ga0163163_11624789 Ga0163163_116247891 156
313 3300014325 Ga0163163_11811369 Ga0163163_118113691 156
314 3300014326 Ga0157380_10007096 Ga0157380_100070966 156
315 3300014326 Ga0157380_10136283 Ga0157380_101362832 156
316 3300014497 Ga0182008_10023771 Ga0182008_100237714 156
317 3300014968 Ga0157379_10006126 Ga0157379_100061263 156
318 3300014968 Ga0157379_11890102 Ga0157379_118901021 156
319 3300014969 Ga0157376_10001070 Ga0157376_100010707 156
320 3300014969 Ga0157376_10380898 Ga0157376_103808982 156
321 3300014969 Ga0157376_10499584 Ga0157376_104995842 156
322 3300014969 Ga0157376_10792377 Ga0157376_107923771 156
323 3300015262 Ga0182007_10056846 Ga0182007_100568462 156
324 3300017792 Ga0163161_10002750 Ga0163161_100027502 156
325 3300019161 Ga0184602_101631 Ga0184602_1016311 156
326 3300020069 Ga0197907_10394529 Ga0197907_103945291 156
327 3300020076 Ga0206355_1200295 Ga0206355_12002951 156
328 3300020078 Ga0206352_11045053 Ga0206352_110450532 156
329 3300020082 Ga0206353_10939575 Ga0206353_109395751 156
330 3300021358 Ga0213873_10018764 Ga0213873_100187642 156
331 3300021377 Ga0213874_10025053 Ga0213874_100250533 156
332 3300021384 Ga0213876_10315869 Ga0213876_103158691 156
333 3300021388 Ga0213875_10011874 Ga0213875_100118742 156
334 3300021388 Ga0213875_10261519 Ga0213875_102615191 156
335 3300023660 Ga0247550_100224 Ga0247550_1002242 156
336 3300024227 Ga0228598_1049194 Ga0228598_10491941 156
337 3300025292 Ga0209676_1000256 Ga0209676_100025632 156
338 3300025298 Ga0209050_1005370 Ga0209050_10053705 156
339 3300025321 Ga0207656_10102532 Ga0207656_101025322 156
340 3300025711 Ga0207696_1016029 Ga0207696_10160291 156
341 3300025735 Ga0207713_1196926 Ga0207713_11969261 156
342 3300025885 Ga0207653_10008058 Ga0207653_100080583 156
343 3300025898 Ga0207692_10001791 Ga0207692_100017916 156
344 3300025898 Ga0207692_10018922 Ga0207692_100189223 156
345 3300025898 Ga0207692_10246024 Ga0207692_102460242 156
346 3300025899 Ga0207642_10144275 Ga0207642_101442752 156
347 3300025900 Ga0207710_10005196 Ga0207710_100051962 156
348 3300025901 Ga0207688_10003708 Ga0207688_100037082 156
349 3300025903 Ga0207680_10016657 Ga0207680_100166572 156
350 3300025904 Ga0207647_10006532 Ga0207647_100065322 156
351 3300025905 Ga0207685_10031345 Ga0207685_100313452 156
352 3300025905 Ga0207685_10373655 Ga0207685_103736551 156
353 3300025906 Ga0207699_10058501 Ga0207699_100585012 156
354 3300025906 Ga0207699_10262516 Ga0207699_102625162 156
355 3300025906 Ga0207699_10486636 Ga0207699_104866362 156
356 3300025907 Ga0207645_10003136 Ga0207645_100031362 156
357 3300025909 Ga0207705_10100876 Ga0207705_101008762 156
358 3300025909 Ga0207705_10648786 Ga0207705_106487862 156
359 3300025911 Ga0207654_10004248 Ga0207654_100042484 156
360 3300025912 Ga0207707_10004903 Ga0207707_100049034 156
361 3300025912 Ga0207707_10024365 Ga0207707_100243654 156
362 3300025912 Ga0207707_10114973 Ga0207707_101149733 156
363 3300025912 Ga0207707_10626820 Ga0207707_106268202 156
364 3300025913 Ga0207695_10079426 Ga0207695_100794264 156
365 3300025913 Ga0207695_10102075 Ga0207695_101020752 156
366 3300025913 Ga0207695_10315019 Ga0207695_103150192 156
367 3300025914 Ga0207671_10057004 Ga0207671_100570042 156
368 3300025915 Ga0207693_10000133 Ga0207693_1000013359 156
369 3300025915 Ga0207693_10002561 Ga0207693_100025617 156
370 3300025915 Ga0207693_10014015 Ga0207693_100140154 156
371 3300025915 Ga0207693_10056665 Ga0207693_100566652 156
372 3300025915 Ga0207693_10072969 Ga0207693_100729693 156
373 3300025915 Ga0207693_10678572 Ga0207693_106785721 156
374 3300025916 Ga0207663_10104205 Ga0207663_101042051 156
375 3300025916 Ga0207663_10238755 Ga0207663_102387552 156
376 3300025916 Ga0207663_10303876 Ga0207663_103038762 156
377 3300025917 Ga0207660_10070521 Ga0207660_100705212 156
378 3300025917 Ga0207660_10105796 Ga0207660_101057962 156
379 3300025917 Ga0207660_10119948 Ga0207660_101199482 156
380 3300025918 Ga0207662_10136076 Ga0207662_101360762 156
381 3300025919 Ga0207657_10001128 Ga0207657_100011286 156
382 3300025920 Ga0207649_10054047 Ga0207649_100540472 156
383 3300025921 Ga0207652_10118118 Ga0207652_101181183 156
384 3300025921 Ga0207652_10188746 Ga0207652_101887462 156
385 3300025921 Ga0207652_10257717 Ga0207652_102577172 156
386 3300025922 Ga0207646_10212763 Ga0207646_102127632 156
387 3300025923 Ga0207681_10033342 Ga0207681_100333423 156
388 3300025923 Ga0207681_10070595 Ga0207681_100705953 156
389 3300025924 Ga0207694_10063947 Ga0207694_100639472 156
390 3300025925 Ga0207650_10022731 Ga0207650_100227312 156
391 3300025925 Ga0207650_10281582 Ga0207650_102815822 156
392 3300025926 Ga0207659_10027019 Ga0207659_100270192 156
393 3300025927 Ga0207687_10125270 Ga0207687_101252702 156
394 3300025928 Ga0207700_10032759 Ga0207700_100327592 156
395 3300025928 Ga0207700_10065789 Ga0207700_100657893 156
396 3300025928 Ga0207700_10091840 Ga0207700_100918403 156
397 3300025928 Ga0207700_10210610 Ga0207700_102106102 156
398 3300025928 Ga0207700_10622316 Ga0207700_106223162 156
399 3300025929 Ga0207664_10010395 Ga0207664_100103952 156
400 3300025929 Ga0207664_10346695 Ga0207664_103466951 156
401 3300025929 Ga0207664_10509901 Ga0207664_105099012 156
402 3300025929 Ga0207664_10572016 Ga0207664_105720161 156
403 3300025929 Ga0207664_11167425 Ga0207664_111674251 156
404 3300025932 Ga0207690_10091782 Ga0207690_100917822 156
405 3300025932 Ga0207690_10350395 Ga0207690_103503952 156
406 3300025933 Ga0207706_10000195 Ga0207706_1000019561 156
407 3300025934 Ga0207686_10017996 Ga0207686_100179961 156
408 3300025935 Ga0207709_10035084 Ga0207709_100350842 156
409 3300025936 Ga0207670_10043823 Ga0207670_100438232 156
410 3300025937 Ga0207669_10809179 Ga0207669_108091791 156
411 3300025938 Ga0207704_10020332 Ga0207704_100203324 156
412 3300025939 Ga0207665_10000068 Ga0207665_1000006818 156
413 3300025939 Ga0207665_10118516 Ga0207665_101185163 156
414 3300025939 Ga0207665_10260148 Ga0207665_102601482 156
415 3300025940 Ga0207691_10028162 Ga0207691_100281622 156
416 3300025941 Ga0207711_10018110 Ga0207711_100181104 156
417 3300025942 Ga0207689_10086451 Ga0207689_100864512 156
418 3300025944 Ga0207661_10216974 Ga0207661_102169742 156
419 3300025944 Ga0207661_10733309 Ga0207661_107333092 156
420 3300025945 Ga0207679_10354102 Ga0207679_103541022 156
421 3300025945 Ga0207679_10490371 Ga0207679_104903712 156
422 3300025949 Ga0207667_10024633 Ga0207667_100246333 156
423 3300025949 Ga0207667_10537731 Ga0207667_105377312 156
424 3300025949 Ga0207667_10810425 Ga0207667_108104252 156
425 3300025960 Ga0207651_10002885 Ga0207651_100028853 156
426 3300025961 Ga0207712_10010392 Ga0207712_100103923 156
427 3300025972 Ga0207668_10071575 Ga0207668_100715752 156
428 3300025981 Ga0207640_10289804 Ga0207640_102898042 156
429 3300025986 Ga0207658_10014654 Ga0207658_100146541 156
430 3300025986 Ga0207658_10793819 Ga0207658_107938191 156
431 3300026023 Ga0207677_10025401 Ga0207677_100254012 156
432 3300026035 Ga0207703_10161212 Ga0207703_101612122 156
433 3300026041 Ga0207639_10009419 Ga0207639_100094193 156
434 3300026067 Ga0207678_10000128 Ga0207678_1000012822 156
435 3300026075 Ga0207708_10002350 Ga0207708_100023507 156
436 3300026078 Ga0207702_10095875 Ga0207702_100958753 156
437 3300026078 Ga0207702_10177059 Ga0207702_101770593 156
438 3300026088 Ga0207641_10297380 Ga0207641_102973802 156
439 3300026089 Ga0207648_10005087 Ga0207648_1000508711 156
440 3300026095 Ga0207676_10225010 Ga0207676_102250101 156
441 3300026116 Ga0207674_10000779 Ga0207674_1000077926 156
442 3300026118 Ga0207675_100001033 Ga0207675_10000103320 156
443 3300026121 Ga0207683_10000553 Ga0207683_100005539 156
444 3300026142 Ga0207698_10016409 Ga0207698_100164092 156
445 3300027512 Ga0209179_1019179 Ga0209179_10191792 156
446 3300027543 Ga0209999_1020169 Ga0209999_10201692 156
447 3300027617 Ga0210002_1054009 Ga0210002_10540091 156
448 3300027665 Ga0209983_1023805 Ga0209983_10238052 156
449 3300027682 Ga0209971_1073413 Ga0209971_10734133 156
450 3300027717 Ga0209998_10008320 Ga0209998_100083202 156
451 3300027717 Ga0209998_10087786 Ga0209998_100877861 156
452 3300027876 Ga0209974_10013053 Ga0209974_100130532 156
453 3300027876 Ga0209974_10314048 Ga0209974_103140482 156
454 3300027907 Ga0207428_10000200 Ga0207428_1000020052 156
455 3300027907 Ga0207428_10172852 Ga0207428_101728521 156
456 3300027907 Ga0207428_10388048 Ga0207428_103880482 156
457 3300028379 Ga0268266_10142324 Ga0268266_101423243 156
458 3300028380 Ga0268265_10321389 Ga0268265_103213891 156
459 3300028380 Ga0268265_10347817 Ga0268265_103478172 156
460 3300028381 Ga0268264_10986751 Ga0268264_109867512 156
461 3300028381 Ga0268264_11193804 Ga0268264_111938041 156
462 3300028800 Ga0265338_10064804 Ga0265338_100648042 156
463 3300028800 Ga0265338_10122535 Ga0265338_101225352 156
464 3300030863 Ga0265766_1013371 Ga0265766_10133711 156
465 3300031241 Ga0265325_10000092 Ga0265325_1000009267 156
466 3300031247 Ga0265340_10016361 Ga0265340_100163612 156
467 3300031249 Ga0265339_10007234 Ga0265339_100072343 156
468 3300031249 Ga0265339_10104178 Ga0265339_101041782 156
469 3300031251 Ga0265327_10001216 Ga0265327_1000121619 156
470 3300031344 Ga0265316_10036056 Ga0265316_100360562 156
471 3300031548 Ga0307408_100030599 Ga0307408_1000305992 156
472 3300031548 Ga0307408_100495120 Ga0307408_1004951202 156
473 3300031595 Ga0265313_10001177 Ga0265313_100011779 156
474 3300031731 Ga0307405_10039197 Ga0307405_100391972 156
475 3300031824 Ga0307413_10687309 Ga0307413_106873092 156
476 3300031901 Ga0307406_10220856 Ga0307406_102208563 156
477 3300031995 Ga0307409_100387584 Ga0307409_1003875842 156
478 3300032002 Ga0307416_100006633 Ga0307416_1000066332 156
479 3300032002 Ga0307416_100740607 Ga0307416_1007406072 156
480 3300032004 Ga0307414_10293803 Ga0307414_102938032 156
481 3300032126 Ga0307415_100047074 Ga0307415_1000470743 156
482 3300034817 Ga0373948_0054418 Ga0373948_0054418_53_529 156
483 3300034957 Ga0373938_0104725 Ga0373938_0104725_211_687 156
484 3300035084 Ga0373928_0019751 Ga0373928_0019751_716_1192 156
485 3300035113 Ga0373936_0149619 Ga0373936_0149619_471_944 156
486 3300035115 Ga0373941_0023759 Ga0373941_0023759_1264_1740 156
487 3300035117 Ga0373953_0003102 Ga0373953_0003102_3046_3519 156
488 3300035117 Ga0373953_0186672 Ga0373953_0186672_77_550 156
489 3300035118 Ga0373954_0048267 Ga0373954_0048267_1191_1664 156
490 3300035118 Ga0373954_0197886 Ga0373954_0197886_425_904 156
491 3300035119 Ga0373956_0208660 Ga0373956_0208660_301_774 156
492 3300035119 Ga0373956_0290680 Ga0373956_0290680_237_710 156
493 3300035121 Ga0373960_0013817 Ga0373960_0013817_39_515 156
494 3300035172 Ga0373955_0008701 Ga0373955_0008701_2202_2675 156
495 3300035172 Ga0373955_0185292 Ga0373955_0185292_396_869 156
496 3300035691 Ga0373931_0051788 Ga0373931_0051788_407_883 156
497 3300035691 Ga0373931_0172072 Ga0373931_0172072_577_1074 156
498 3300035692 Ga0373935_0146169 Ga0373935_0146169_761_1240 156
499 3300035695 Ga0373927_0291172 Ga0373927_0291172_545_1021 156
500 3300035695 Ga0373927_0359892 Ga0373927_0359892_276_761 156
501 3300035724 Ga0373933_0003617 Ga0373933_0003617_1972_2445 156
502 3300035724 Ga0373933_0186414 Ga0373933_0186414_186_659 156
503 3300036401 Ga0373937_0013477 Ga0373937_0013477_1490_1963 156
504 3300036401 Ga0373937_0430483 Ga0373937_0430483_388_861 156
505 3300036647 Ga0316582_0113549 Ga0316582_0113549_963_1436 156
506 3300037312 Ga0395899_0483270 Ga0395899_0483270_145_621 156
507 3300037418 Ga0395900_0007214 Ga0395900_0007214_6008_6484 156
508 3300037418 Ga0395900_0032445 Ga0395900_0032445_3239_3712 156
509 3300037466 Ga0395898_0019026 Ga0395898_0019026_5838_6314 156
510 3300037471 Ga0395905_0001391 Ga0395905_0001391_19637_20113 156
511 3300037471 Ga0395905_1098085 Ga0395905_1098085_55_576 156
512 3300037853 Ga0436364_0067324 Ga0436364_0067324_296_769 156
513 3300037853 Ga0436364_0179449 Ga0436364_0179449_163_636 156
514 3300037853 Ga0436364_0234163 Ga0436364_0234163_76_549 156
515 3300037853 Ga0436364_0400376 Ga0436364_0400376_3574_4047 156
516 3300037853 Ga0436364_1370990 Ga0436364_1370990_519_992 156
517 3300037853 Ga0436364_1525673 Ga0436364_1525673_18074_18547 156
518 3300038443 Ga0395901_0005667 Ga0395901_0005667_1488_1964 156
519 3300038996 Ga0242420_020262 Ga0242420_020262_695_1171 156
520 3300039437 Ga0436365_0550921 Ga0436365_0550921_1001_1474 156
521 3300039438 Ga0436360_0326890 Ga0436360_0326890_171_644 156
522 3300039438 Ga0436360_0452948 Ga0436360_0452948_17_490 156
523 3300039438 Ga0436360_0589360 Ga0436360_0589360_57_530 156
524 3300039438 Ga0436360_0613967 Ga0436360_0613967_89_562 156
525 3300039438 Ga0436360_0872042 Ga0436360_0872042_296_769 156
526 3300039438 Ga0436360_1267705 Ga0436360_1267705_310_783 156
527 3300039447 Ga0436361_0085183 Ga0436361_0085183_161_634 156
528 3300039447 Ga0436361_0175350 Ga0436361_0175350_962_1435 156
529 3300039447 Ga0436361_0333471 Ga0436361_0333471_1732_2205 156
530 3300039447 Ga0436361_0335349 Ga0436361_0335349_70_543 156
531 3300039447 Ga0436361_0450564 Ga0436361_0450564_691_1164 156
532 3300039447 Ga0436361_0502336 Ga0436361_0502336_905_1378 156
533 3300039450 Ga0436363_0572892 Ga0436363_0572892_813_1286 156
534 3300039450 Ga0436363_1345528 Ga0436363_1345528_231_704 156
535 3300039453 Ga0436362_0111635 Ga0436362_0111635_195_668 156
536 3300039453 Ga0436362_0345536 Ga0436362_0345536_501_1040 156
537 3300039453 Ga0436362_0651475 Ga0436362_0651475_41_514 156
538 3300039453 Ga0436362_0826199 Ga0436362_0826199_3573_4046 156
539 3300039453 Ga0436362_0994734 Ga0436362_0994734_58_531 156
540 3300039453 Ga0436362_1000199 Ga0436362_1000199_1144_1617 156
541 3300041408 Ga0439453_0032804 Ga0439453_0032804_453_926 156
542 3300042009 Ga0439451_001574 Ga0439451_001574_1855_2328 156
543 3300042125 Ga0450923_007964 Ga0450923_007964_1112_1585 156
544 3300042132 Ga0450895_020951 Ga0450895_020951_62_535 156
545 3300042133 Ga0450896_005227 Ga0450896_005227_1107_1580 156
546 3300042135 Ga0450899_014284 Ga0450899_014284_231_704 156
547 3300042146 Ga0450907_004045 Ga0450907_004045_1698_2171 156
548 3300042147 Ga0450910_001892 Ga0450910_001892_576_1049 156
549 3300042147 Ga0450910_007240 Ga0450910_007240_741_1214 156
550 3300042156 Ga0439446_0008107 Ga0439446_0008107_183_656 156
551 3300042156 Ga0439446_0118106 Ga0439446_0118106_90_563 156
552 3300042156 Ga0439446_0230532 Ga0439446_0230532_142_615 156
553 3300042184 Ga0450908_002235 Ga0450908_002235_2729_3202 156
554 3300042435 Ga0439434_0011318 Ga0439434_0011318_1088_1561 156
555 3300042437 Ga0439444_0001542 Ga0439444_0001542_2539_3012 156
556 3300042461 Ga0439460_0126681 Ga0439460_0126681_28_501 156
557 3300042531 Ga0450918_011772 Ga0450918_011772_428_901 156
558 3300042531 Ga0450918_013242 Ga0450918_013242_904_1377 156
559 3300045836 Ga0466958_0351522 Ga0466958_0351522_163_636 156
560 3300046462 Ga0495651_0170931 Ga0495651_0170931_967_1446 156
561 3300046477 Ga0495664_0106068 Ga0495664_0106068_238_717 156
562 3300046491 Ga0495584_0024182 Ga0495584_0024182_1019_1492 156
563 3300046491 Ga0495584_0240759 Ga0495584_0240759_68_541 156
564 3300046506 Ga0495583_0123893 Ga0495583_0123893_316_792 156
565 3300046511 Ga0495608_0124238 Ga0495608_0124238_697_1176 156
566 3300046518 Ga0495631_0034954 Ga0495631_0034954_387_863 156
567 3300046529 Ga0495652_0075755 Ga0495652_0075755_899_1396 156
568 3300046536 Ga0495587_0054218 Ga0495587_0054218_812_1291 156
569 3300046559 Ga0495667_0018210 Ga0495667_0018210_1807_2280 156
570 3300046615 Ga0495656_0215587 Ga0495656_0215587_224_700 156
571 3300046648 Ga0495611_0345718 Ga0495611_0345718_56_532 156
572 3300046660 Ga0495625_0410888 Ga0495625_0410888_152_628 156
573 3300046664 Ga0495659_0078167 Ga0495659_0078167_136_612 156
574 3300046675 Ga0495657_0083702 Ga0495657_0083702_460_933 156
575 3300046675 Ga0495657_0284045 Ga0495657_0284045_85_564 156
576 3300047317 Ga0495604_0260725 Ga0495604_0260725_311_808 156
577 3300047317 Ga0495604_0403361 Ga0495604_0403361_216_689 156
578 3300047319 Ga0495674_1067422 Ga0495674_1067422_58_531 156
579 3300047322 Ga0495680_0372217 Ga0495680_0372217_64_543 156
580 3300047444 Ga0495675_0038422 Ga0495675_0038422_163_660 156
581 3300047444 Ga0495675_0756996 Ga0495675_0756996_30_503 156
582 3300047471 Ga0495684_0566971 Ga0495684_0566971_87_560 156
583 3300048088 Ga0495602_0296436 Ga0495602_0296436_348_821 156
584 3300048903 Ga0496100_0099267 Ga0496100_0099267_132_605 156
585 3300048903 Ga0496100_0179121 Ga0496100_0179121_417_890 156
586 3300048903 Ga0496100_0247054 Ga0496100_0247054_548_1024 156
587 3300048904 Ga0496101_0712003 Ga0496101_0712003_295_771 156
588 3300048905 Ga0496102_0196390 Ga0496102_0196390_548_1024 156
589 3300048906 Ga0496103_0012541 Ga0496103_0012541_4528_5004 156
590 3300048906 Ga0496103_0179477 Ga0496103_0179477_457_933 156
591 3300048907 Ga0496104_0251297 Ga0496104_0251297_820_1299 156
592 3300048907 Ga0496104_0895370 Ga0496104_0895370_22_498 156
593 3300048907 Ga0496104_1524454 Ga0496104_1524454_27_506 156
594 3300048908 Ga0496105_0678740 Ga0496105_0678740_295_771 156
595 3300048909 Ga0496106_0075445 Ga0496106_0075445_724_1200 156
596 3300048909 Ga0496106_0246443 Ga0496106_0246443_453_926 156
597 3300048909 Ga0496106_0316320 Ga0496106_0316320_359_838 156
598 3300048910 Ga0496107_0011017 Ga0496107_0011017_4013_4489 156
599 3300048911 Ga0496108_0165715 Ga0496108_0165715_263_739 156
600 3300048912 Ga0496109_0029266 Ga0496109_0029266_316_792 156
601 3300048912 Ga0496109_0257745 Ga0496109_0257745_764_1243 156
602 3300048913 Ga0496110_0179984 Ga0496110_0179984_595_1071 156
603 3300048913 Ga0496110_0991183 Ga0496110_0991183_22_498 156
604 3300048914 Ga0496111_0466043 Ga0496111_0466043_295_771 156
605 3300048914 Ga0496111_0499680 Ga0496111_0499680_212_688 156
606 3300048914 Ga0496111_0769317 Ga0496111_0769317_23_520 156
607 3300048915 Ga0496112_0596229 Ga0496112_0596229_100_579 156
608 3300048915 Ga0496112_0599467 Ga0496112_0599467_263_739 156
609 3300048916 Ga0496113_1108676 Ga0496113_1108676_22_498 156
610 3300048917 Ga0496114_0018184 Ga0496114_0018184_1190_1666 156
611 3300048917 Ga0496114_0364115 Ga0496114_0364115_376_855 156
612 3300048918 Ga0496115_0019140 Ga0496115_0019140_263_739 156
613 3300048918 Ga0496115_0412181 Ga0496115_0412181_141_614 156
614 3300049528 Ga0501312_039911 Ga0501312_039911_61_534 156
615 3300049568 Ga0501031_0029391 Ga0501031_0029391_579_1052 156
616 3300049568 Ga0501031_0113004 Ga0501031_0113004_792_1274 156
617 3300049568 Ga0501031_0261281 Ga0501031_0261281_620_1093 156
618 3300049570 Ga0501033_0124715 Ga0501033_0124715_38_511 156
619 3300049572 Ga0501036_0221895 Ga0501036_0221895_984_1457 156
620 3300049572 Ga0501036_0476817 Ga0501036_0476817_358_831 156
621 3300049572 Ga0501036_0846268 Ga0501036_0846268_40_513 156
622 3300049572 Ga0501036_1105143 Ga0501036_1105143_52_525 156
623 3300049573 Ga0501037_0069290 Ga0501037_0069290_551_1024 156
624 3300049574 Ga0501038_0251962 Ga0501038_0251962_46_519 156
625 3300049575 Ga0501039_0032551 Ga0501039_0032551_1054_1527 156
626 3300049575 Ga0501039_0192000 Ga0501039_0192000_717_1190 156
627 3300049575 Ga0501039_0811279 Ga0501039_0811279_25_498 156
628 3300049576 Ga0501040_0007949 Ga0501040_0007949_960_1433 156
629 3300049576 Ga0501040_0016236 Ga0501040_0016236_3972_4445 156
630 3300049576 Ga0501040_0064021 Ga0501040_0064021_792_1265 156
631 3300049577 Ga0501041_0085577 Ga0501041_0085577_593_1066 156
632 3300049577 Ga0501041_0397731 Ga0501041_0397731_383_856 156
633 3300049578 Ga0501042_0031965 Ga0501042_0031965_1044_1517 156
634 3300049578 Ga0501042_0059139 Ga0501042_0059139_449_922 156
635 3300049578 Ga0501042_0063858 Ga0501042_0063858_1020_1493 156
636 3300049578 Ga0501042_0072530 Ga0501042_0072530_1511_1984 156
637 3300049578 Ga0501042_0156202 Ga0501042_0156202_36_509 156
638 3300049578 Ga0501042_0269183 Ga0501042_0269183_200_673 156
639 3300049580 Ga0501046_0269573 Ga0501046_0269573_223_696 156
640 3300049580 Ga0501046_0668736 Ga0501046_0668736_140_613 156
641 3300049582 Ga0501048_0042789 Ga0501048_0042789_2320_2793 156
642 3300049582 Ga0501048_0089789 Ga0501048_0089789_277_750 156
643 3300049582 Ga0501048_0476587 Ga0501048_0476587_23_496 156
644 3300049582 Ga0501048_0623758 Ga0501048_0623758_17_490 156
645 3300049582 Ga0501048_0868830 Ga0501048_0868830_60_533 156
646 3300049584 Ga0501068_0438549 Ga0501068_0438549_338_814 156
647 3300049584 Ga0501068_0610429 Ga0501068_0610429_146_619 156
648 3300049584 Ga0501068_1018202 Ga0501068_1018202_32_505 156
649 3300049585 Ga0501069_0145066 Ga0501069_0145066_13_489 156
650 3300049586 Ga0501070_0065514 Ga0501070_0065514_1395_1868 156
651 3300049587 Ga0501071_0026051 Ga0501071_0026051_1833_2306 156
652 3300049587 Ga0501071_0046812 Ga0501071_0046812_1088_1561 156
653 3300049587 Ga0501071_0465399 Ga0501071_0465399_336_809 156
654 3300049587 Ga0501071_0850835 Ga0501071_0850835_159_632 156
655 3300049588 Ga0501072_0005695 Ga0501072_0005695_8421_8894 156
656 3300049588 Ga0501072_0074472 Ga0501072_0074472_1366_1839 156
657 3300049588 Ga0501072_0189069 Ga0501072_0189069_1120_1602 156
658 3300049588 Ga0501072_0332867 Ga0501072_0332867_278_751 156
659 3300049588 Ga0501072_0417389 Ga0501072_0417389_50_523 156
660 3300049588 Ga0501072_0540317 Ga0501072_0540317_134_607 156
661 3300049589 Ga0501073_0151261 Ga0501073_0151261_659_1132 156
662 3300049590 Ga0501074_0051472 Ga0501074_0051472_1557_2030 156
663 3300049591 Ga0501075_0015392 Ga0501075_0015392_1321_1794 156
664 3300049591 Ga0501075_0047800 Ga0501075_0047800_880_1353 156
665 3300049591 Ga0501075_0051778 Ga0501075_0051778_1066_1539 156
666 3300049591 Ga0501075_0120292 Ga0501075_0120292_585_1058 156
667 3300049591 Ga0501075_0208139 Ga0501075_0208139_725_1198 156
668 3300049592 Ga0501076_0089354 Ga0501076_0089354_1038_1511 156
669 3300049592 Ga0501076_0090170 Ga0501076_0090170_169_642 156
670 3300049592 Ga0501076_0100927 Ga0501076_0100927_335_808 156
671 3300049592 Ga0501076_0323256 Ga0501076_0323256_410_883 156
672 3300049593 Ga0501077_0017260 Ga0501077_0017260_2374_2847 156
673 3300049593 Ga0501077_0101271 Ga0501077_0101271_136_609 156
674 3300049593 Ga0501077_0760638 Ga0501077_0760638_134_607 156
675 3300049686 Ga0501257_030909 Ga0501257_030909_491_967 156
676 3300049741 Ga0501079_0056766 Ga0501079_0056766_2271_2744 156
677 3300049741 Ga0501079_0176018 Ga0501079_0176018_86_559 156
678 3300049741 Ga0501079_0181299 Ga0501079_0181299_572_1045 156
679 3300049741 Ga0501079_0182918 Ga0501079_0182918_892_1365 156
680 3300049742 Ga0501080_0256463 Ga0501080_0256463_62_535 156
681 3300049742 Ga0501080_0280985 Ga0501080_0280985_356_829 156
682 3300049742 Ga0501080_1105412 Ga0501080_1105412_145_618 156
683 3300049743 Ga0501081_0038695 Ga0501081_0038695_2604_3077 156
684 3300049743 Ga0501081_0206551 Ga0501081_0206551_934_1407 156
685 3300049743 Ga0501081_0318836 Ga0501081_0318836_652_1125 156
686 3300049743 Ga0501081_0362369 Ga0501081_0362369_96_569 156
687 3300049744 Ga0501083_0018378 Ga0501083_0018378_3375_3848 156
688 3300049744 Ga0501083_0155206 Ga0501083_0155206_520_993 156
689 3300049744 Ga0501083_0327450 Ga0501083_0327450_501_974 156
690 3300049822 Ga0501035_0053148 Ga0501035_0053148_641_1114 156
691 3300049822 Ga0501035_0311329 Ga0501035_0311329_144_617 156
692 3300049824 Ga0501045_0023824 Ga0501045_0023824_965_1438 156
693 3300049824 Ga0501045_0097216 Ga0501045_0097216_1608_2081 156
694 3300049824 Ga0501045_0610792 Ga0501045_0610792_116_589 156
695 3300050507 nmdc:mga05p37_295773_c1 nmdc:mga05p37_295773_c1_490_966 156
696 3300050507 nmdc:mga05p37_70706_c1 nmdc:mga05p37_70706_c1_3525_3998 156
697 3300050507 nmdc:mga05p37_71_c2 nmdc:mga05p37_71_c2_22560_23033 156
698 3300050508 nmdc:mga09592_2253_c1 nmdc:mga09592_2253_c1_1179_1652 156
699 3300050508 nmdc:mga09592_33396_c1 nmdc:mga09592_33396_c1_674_1150 156
700 3300050508 nmdc:mga09592_584391_c1 nmdc:mga09592_584391_c1_123_596 156
701 3300050509 nmdc:mga0qj67_254_c1 nmdc:mga0qj67_254_c1_25208_25681 156
702 3300050509 nmdc:mga0qj67_613158_c1 nmdc:mga0qj67_613158_c1_380_856 156
703 3300050509 nmdc:mga0qj67_623672_c1 nmdc:mga0qj67_623672_c1_11_484 156
704 3300050510 nmdc:mga06r32_1565_c1 nmdc:mga06r32_1565_c1_15292_15765 156
705 3300050510 nmdc:mga06r32_98331_c1 nmdc:mga06r32_98331_c1_528_1004 156
706 3300050511 nmdc:mga08y16_10021_c1 nmdc:mga08y16_10021_c1_2817_3290 156
707 3300050511 nmdc:mga08y16_671322_c1 nmdc:mga08y16_671322_c1_469_945 156
708 3300050512 nmdc:mga0n895_18142_c1 nmdc:mga0n895_18142_c1_4727_5200 156
709 3300050512 nmdc:mga0n895_328516_c1 nmdc:mga0n895_328516_c1_570_1043 156
710 3300050512 nmdc:mga0n895_397475_c1 nmdc:mga0n895_397475_c1_260_736 156
711 3300050513 nmdc:mga0rr50_253738_c1 nmdc:mga0rr50_253738_c1_292_768 156
712 3300050513 nmdc:mga0rr50_28747_c1 nmdc:mga0rr50_28747_c1_2309_2782 156
713 3300050513 nmdc:mga0rr50_44266_c1 nmdc:mga0rr50_44266_c1_2615_3091 156
714 3300050513 nmdc:mga0rr50_601444_c1 nmdc:mga0rr50_601444_c1_293_766 156
715 3300050514 nmdc:mga08x19_137391_c1 nmdc:mga08x19_137391_c1_246_722 156
716 3300050514 nmdc:mga08x19_29955_c1 nmdc:mga08x19_29955_c1_117_590 156
717 3300050515 nmdc:mga0a205_186_c1 nmdc:mga0a205_186_c1_30940_31413 156
718 3300050515 nmdc:mga0a205_212060_c1 nmdc:mga0a205_212060_c1_693_1169 156
719 3300050515 nmdc:mga0a205_603_c1 nmdc:mga0a205_603_c1_15890_16363 156
720 3300053077 Ga0495601_0063817 Ga0495601_0063817_347_820 156
721 3300053078 Ga0495612_0396385 Ga0495612_0396385_14_487 156
722 3300053083 Ga0495655_0001448 Ga0495655_0001448_809_1282 156
723 3300053084 Ga0495595_0182556 Ga0495595_0182556_436_909 156
724 3300053084 Ga0495595_0409570 Ga0495595_0409570_40_519 156
725 3300053084 Ga0495595_0439882 Ga0495595_0439882_47_520 156
726 3300053085 Ga0495619_0043670 Ga0495619_0043670_2175_2648 156
727 3300053085 Ga0495619_0100928 Ga0495619_0100928_1239_1718 156
728 3300053140 Ga0500573_0177570 Ga0500573_0177570_264_737 156
729 3300054114 Ga0501084_0097418 Ga0501084_0097418_1567_2040 156
730 3300054114 Ga0501084_0108308 Ga0501084_0108308_1723_2196 156
731 3300054114 Ga0501084_0229430 Ga0501084_0229430_100_573 156
732 3300054114 Ga0501084_0652719 Ga0501084_0652719_81_554 156
733 3300059421 Ga0590071_031392 Ga0590071_031392_82_555 156
734 3300059423 Ga0590074_021574 Ga0590074_021574_375_848 156
735 3300060353 Ga0501082_0045243 Ga0501082_0045243_1333_1806 156
736 3300060353 Ga0501082_0058732 Ga0501082_0058732_404_877 156
737 3300060353 Ga0501082_0098964 Ga0501082_0098964_397_870 156
738 3300060353 Ga0501082_0122693 Ga0501082_0122693_364_837 156
739 3300060353 Ga0501082_0139925 Ga0501082_0139925_1609_2082 156
740 3300061734 Ga0530510_0075169 Ga0530510_0075169_863_1336 156
741 3300061734 Ga0530510_0176584 Ga0530510_0176584_891_1364 156
742 2162886007 SwRhRL2b_contig_1824184 SwRhRL2b_0742.00007370 157
743 3300005367 Ga0070667_100178979 Ga0070667_1001789792 157
744 3300026089 Ga0207648_10432043 Ga0207648_104320432 157
745 3300031852 Ga0307410_10265885 Ga0307410_102658851 157
746 3300031995 Ga0307409_101126326 Ga0307409_1011263262 157
747 3300032002 Ga0307416_100514615 Ga0307416_1005146151 157
748 3300032004 Ga0307414_10054989 Ga0307414_100549891 157
749 3300032005 Ga0307411_10068425 Ga0307411_100684254 157
750 3300032126 Ga0307415_100025995 Ga0307415_1000259954 157
751 3300037418 Ga0395900_0042510 Ga0395900_0042510_90_578 157
752 3300049572 Ga0501036_1269607 Ga0501036_1269607_51_524 157
753 3300049584 Ga0501068_0564344 Ga0501068_0564344_225_701 157
754 3300049592 Ga0501076_0677482 Ga0501076_0677482_302_778 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

34

104

0.99

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

110

186

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1grj-assembly1.cif.gz_A grea transcript cleavage factor from escherichia coli 0.9084 2 157
1grj-assembly1.cif.gz_A grea transcript cleavage factor from escherichia coli 0.9027 2 157
4wqt-assembly3.cif.gz_Z thermus thermophilus rna polymerase complexed with an rna cleavage stimulating factor (a grea/gfh1 chimeric protein) 0.9009 3 155
4wqt-assembly3.cif.gz_Z thermus thermophilus rna polymerase complexed with an rna cleavage stimulating factor (a grea/gfh1 chimeric protein) 0.8846 3 155
6rin-assembly1.cif.gz_F cryo-em structure of e. coli rna polymerase backtracked elongation complex bound to greb transcription factor 0.8834 5 157
ID Description Score Start End Superfamily
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9936 1 75 1.10.287.180
1grjA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9852 2 75 1.10.287.180
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9806 1 75 1.10.287.180
1grjA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9723 2 75 1.10.287.180
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9694 1 75 1.10.287.180
ID Description Score Start End GO Terms
AF-A0A3C1WF27-F1-model_v4 Transcription elongation factor GreA 0.9872 87 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-E3HNV0-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9798 1 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A847PGP4-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9765 2 154 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A2S6TA47-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9757 1 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A7V8KLB0-F1-model_v4 deleted 0.9747 88 157

Feature Viewer

pLDDT pTM Quality
92.48 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map