F479261

General Info

Members Datasets Scaffolds Average Seq Length
754 334 1508 119

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0167972|Ga0395905_0167972_577_948
Length 123
Sequence VNNDKTPNDSLAQLAAVIESRKAGDPDQSYVARLLKMGPDAILKKVGEEAGEVIMAAKDAQYGGDRQRIVSEVADLWFHCMIALSHFGLGPRDVIAELEQRAGTSGIEEKALRKARKREDGGA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
93 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
94 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
228 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
229 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
233 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
290 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
291 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
292 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
293 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
294 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
295 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
305 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
306 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
307 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
308 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
309 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
310 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
311 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
312 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
313 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
314 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
315 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
316 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
317 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
327 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
328 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
329 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
330 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
331 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
332 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
333 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
334 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.13
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 0
Rhizoplane 4.77
Rhizosphere 77.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0167972 3300037471 Bacteria 2061
2 JGI24744J21845_10006631 3300002077 Bacteria 2399
3 JGI25152J39213_1001224 3300002773 Bacteria 11749
4 JGI25152J39213_1001251 3300002773 Bacteria 11566
5 JGI25152J39213_1001299 3300002773 Bacteria 11168
6 JGI25150J39212_1005235 3300002774 Bacteria 2792
7 JGI25153J46596_10002653 3300003215 Bacteria 10222
8 JGI25153J46596_10004183 3300003215 Bacteria 7828
9 Ga0006777J48905_1047703 3300003308 Bacteria 1412
10 Ga0055526_1002262 3300003771 Bacteria 13160
11 Ga0055530_10009773 3300003791 Bacteria 3632
12 Ga0065165_1001456 3300005262 Bacteria 25564
13 Ga0065707_10220135 3300005295 Bacteria 1228
14 Ga0070658_10551114 3300005327 Bacteria 998
15 Ga0070658_10678651 3300005327 Bacteria 894
16 Ga0070676_10021332 3300005328 Bacteria 3626
17 Ga0070676_10034097 3300005328 Bacteria 2922
18 Ga0070676_10056576 3300005328 Bacteria 2318
19 Ga0070683_100252217 3300005329 Bacteria 1678
20 Ga0070683_100403035 3300005329 Bacteria 1304
21 Ga0070690_100020420 3300005330 Bacteria 4035
22 Ga0070690_100645339 3300005330 Bacteria 808
23 Ga0070690_100728401 3300005330 Bacteria 764
24 Ga0070670_100001787 3300005331 Bacteria 17505
25 Ga0070670_100096015 3300005331 Bacteria 2550
26 Ga0070670_100168819 3300005331 Bacteria 1897
27 Ga0070670_100655440 3300005331 Bacteria 942
28 Ga0070677_10039217 3300005333 Bacteria 1858
29 Ga0070677_10067530 3300005333 Bacteria 1494
30 Ga0070677_10344192 3300005333 Bacteria 770
31 Ga0068869_100006465 3300005334 Bacteria 7436
32 Ga0068869_100009400 3300005334 Bacteria 6343
33 Ga0068869_100090154 3300005334 Bacteria 2304
34 Ga0068869_100804787 3300005334 Bacteria 808
35 Ga0070666_10006757 3300005335 Bacteria 7065
36 Ga0070666_10197154 3300005335 Bacteria 1416
37 Ga0070666_10486118 3300005335 Bacteria 894
38 Ga0070682_100600912 3300005337 Bacteria 869
39 Ga0070682_101627522 3300005337 Bacteria 559
40 Ga0068868_100000966 3300005338 Bacteria 19576
41 Ga0068868_100032419 3300005338 Bacteria 4019
42 Ga0068868_100073841 3300005338 Bacteria 2724
43 Ga0068868_100229637 3300005338 Bacteria 1556
44 Ga0068868_100361051 3300005338 Bacteria 1246
45 Ga0068868_101568063 3300005338 Bacteria 618
46 Ga0070660_100102149 3300005339 Bacteria 2272
47 Ga0070689_100175898 3300005340 Bacteria 1736
48 Ga0070689_102109219 3300005340 Bacteria 516
49 Ga0070687_100781062 3300005343 Bacteria 675
50 Ga0070687_101207084 3300005343 Bacteria 558
51 Ga0070661_100108802 3300005344 Bacteria 2068
52 Ga0070661_100156321 3300005344 Bacteria 1725
53 Ga0070692_10262472 3300005345 Bacteria 1039
54 Ga0070668_100036969 3300005347 Bacteria 3727
55 Ga0070668_100137109 3300005347 Bacteria 1969
56 Ga0070668_100173369 3300005347 Bacteria 1757
57 Ga0070669_100088090 3300005353 Bacteria 2323
58 Ga0070669_100101683 3300005353 Bacteria 2169
59 Ga0070669_100382001 3300005353 Bacteria 1149
60 Ga0070669_100395680 3300005353 Bacteria 1129
61 Ga0070669_101338456 3300005353 Bacteria 621
62 Ga0070675_100008036 3300005354 Bacteria 8179
63 Ga0070675_100061241 3300005354 Bacteria 3107
64 Ga0070675_100062673 3300005354 Bacteria 3072
65 Ga0070675_100080667 3300005354 Bacteria 2712
66 Ga0070671_100011057 3300005355 Bacteria 7245
67 Ga0070671_100160588 3300005355 Bacteria 1900
68 Ga0070671_100208222 3300005355 Bacteria 1658
69 Ga0070671_100323786 3300005355 Bacteria 1314
70 Ga0070671_102113961 3300005355 Bacteria 502
71 Ga0070674_100094896 3300005356 Bacteria 2161
72 Ga0070674_100102944 3300005356 Bacteria 2083
73 Ga0070674_100348681 3300005356 Bacteria 1195
74 Ga0070674_101050108 3300005356 Bacteria 717
75 Ga0070674_101090703 3300005356 Bacteria 704
76 Ga0070673_100019930 3300005364 Bacteria 4827
77 Ga0070673_100050040 3300005364 Bacteria 3265
78 Ga0070673_100118826 3300005364 Bacteria 2201
79 Ga0070673_100244226 3300005364 Bacteria 1562
80 Ga0070673_100495865 3300005364 Bacteria 1104
81 Ga0070688_100072638 3300005365 Bacteria 2205
82 Ga0070688_101379380 3300005365 Bacteria 571
83 Ga0070659_100043932 3300005366 Bacteria 3496
84 Ga0070659_101312441 3300005366 Bacteria 642
85 Ga0070667_100023158 3300005367 Bacteria 5151
86 Ga0070667_100081424 3300005367 Bacteria 2770
87 Ga0070667_100099658 3300005367 Bacteria 2508
88 Ga0070667_100192145 3300005367 Bacteria 1809
89 Ga0070667_100533439 3300005367 Bacteria 1078
90 Ga0070667_100950070 3300005367 Bacteria 801
91 Ga0070700_100095800 3300005441 Bacteria 1946
92 Ga0070700_100973609 3300005441 Bacteria 696
93 Ga0070663_100001375 3300005455 Bacteria 13329
94 Ga0070663_100273872 3300005455 Bacteria 1343
95 Ga0070663_102104065 3300005455 Bacteria 509
96 Ga0070678_100006239 3300005456 Bacteria 6975
97 Ga0070678_100077866 3300005456 Bacteria 2502
98 Ga0070678_101352439 3300005456 Bacteria 664
99 Ga0070662_100017313 3300005457 Bacteria 4857
100 Ga0070662_100034193 3300005457 Bacteria 3583
101 Ga0070662_100947686 3300005457 Bacteria 736
102 Ga0070662_101424447 3300005457 Bacteria 597
103 Ga0070681_10176293 3300005458 Bacteria 2060
104 Ga0070681_10628428 3300005458 Bacteria 988
105 Ga0068867_100005640 3300005459 Bacteria 8872
106 Ga0068867_100011669 3300005459 Bacteria 6206
107 Ga0068867_100049124 3300005459 Bacteria 3105
108 Ga0070685_10296691 3300005466 Bacteria 1088
109 Ga0070685_10367513 3300005466 Bacteria 988
110 Ga0070707_100985463 3300005468 Bacteria 808
111 Ga0070699_102152406 3300005518 Bacteria 509
112 Ga0070679_100108254 3300005530 Bacteria 2765
113 Ga0070679_101489044 3300005530 Bacteria 624
114 Ga0070684_100031515 3300005535 Bacteria 4514
115 Ga0070684_100468989 3300005535 Bacteria 1164
116 Ga0070684_101008342 3300005535 Bacteria 781
117 Ga0068853_100077580 3300005539 Bacteria 2902
118 Ga0068853_101845419 3300005539 Bacteria 586
119 Ga0070672_100007718 3300005543 Bacteria 7327
120 Ga0070672_100013592 3300005543 Bacteria 5757
121 Ga0070672_100021973 3300005543 Bacteria 4677
122 Ga0070672_100036721 3300005543 Bacteria 3734
123 Ga0070672_100042843 3300005543 Bacteria 3486
124 Ga0070672_100149059 3300005543 Bacteria 1934
125 Ga0070686_100452954 3300005544 Bacteria 987
126 Ga0070686_100702272 3300005544 Bacteria 807
127 Ga0070693_100079478 3300005547 Bacteria 1952
128 Ga0070693_100952951 3300005547 Bacteria 646
129 Ga0070693_100988821 3300005547 Bacteria 636
130 Ga0070665_100015286 3300005548 Bacteria 7706
131 Ga0070665_100163978 3300005548 Bacteria 2225
132 Ga0070665_100523187 3300005548 Bacteria 1198
133 Ga0070665_100656324 3300005548 Bacteria 1062
134 Ga0070704_100581445 3300005549 Bacteria 982
135 Ga0070664_100112711 3300005564 Bacteria 2375
136 Ga0070664_100240697 3300005564 Bacteria 1624
137 Ga0070664_101111116 3300005564 Bacteria 745
138 Ga0068857_100241040 3300005577 Bacteria 1655
139 Ga0068857_100285172 3300005577 Bacteria 1520
140 Ga0068857_100354262 3300005577 Bacteria 1359
141 Ga0068857_101673816 3300005577 Bacteria 622
142 Ga0068854_100436926 3300005578 Bacteria 1090
143 Ga0068854_100499553 3300005578 Bacteria 1024
144 Ga0068856_100007776 3300005614 Bacteria 10473
145 Ga0068856_100200434 3300005614 Bacteria 2010
146 Ga0070702_100261656 3300005615 Bacteria 1178
147 Ga0070702_100410075 3300005615 Bacteria 972
148 Ga0068852_100005075 3300005616 Bacteria 9367
149 Ga0068852_100030245 3300005616 Bacteria 4456
150 Ga0068852_100256445 3300005616 Bacteria 1677
151 Ga0068852_100707440 3300005616 Bacteria 1018
152 Ga0068852_100709170 3300005616 Bacteria 1016
153 Ga0068852_101023768 3300005616 Bacteria 845
154 Ga0068859_100019167 3300005617 Bacteria 6872
155 Ga0068859_100594680 3300005617 Bacteria 1200
156 Ga0068859_101511878 3300005617 Bacteria 741
157 Ga0068864_100002065 3300005618 Bacteria 16597
158 Ga0068864_100013594 3300005618 Bacteria 6748
159 Ga0068864_100035249 3300005618 Bacteria 4259
160 Ga0068864_100072290 3300005618 Bacteria 3005
161 Ga0068866_10003257 3300005718 Bacteria 6683
162 Ga0068866_10569852 3300005718 Bacteria 760
163 Ga0068866_10725864 3300005718 Bacteria 684
164 Ga0068861_100052430 3300005719 Bacteria 3100
165 Ga0068861_100236372 3300005719 Bacteria 1552
166 Ga0068861_100510359 3300005719 Bacteria 1088
167 Ga0068851_10071766 3300005834 Bacteria 1792
168 Ga0068851_10102633 3300005834 Bacteria 1519
169 Ga0068851_10261466 3300005834 Bacteria 984
170 Ga0068851_10489408 3300005834 Bacteria 736
171 Ga0068870_11362289 3300005840 Bacteria 519
172 Ga0068863_100017036 3300005841 Bacteria 6968
173 Ga0068863_100020937 3300005841 Bacteria 6246
174 Ga0068863_100059870 3300005841 Bacteria 3603
175 Ga0068863_100085478 3300005841 Bacteria 2989
176 Ga0068863_100248762 3300005841 Bacteria 1717
177 Ga0068858_100015823 3300005842 Bacteria 7091
178 Ga0068858_100039082 3300005842 Bacteria 4402
179 Ga0068858_100061093 3300005842 Bacteria 3483
180 Ga0068858_100319144 3300005842 Bacteria 1484
181 Ga0068858_100936021 3300005842 Bacteria 848
182 Ga0068858_101711269 3300005842 Bacteria 621
183 Ga0068860_100000823 3300005843 Bacteria 34706
184 Ga0068860_100022795 3300005843 Bacteria 6055
185 Ga0068860_100139445 3300005843 Bacteria 2330
186 Ga0068860_100975716 3300005843 Bacteria 865
187 Ga0068860_101476549 3300005843 Bacteria 701
188 Ga0068860_101949740 3300005843 Bacteria 609
189 Ga0068862_100020457 3300005844 Bacteria 5529
190 Ga0068862_100074012 3300005844 Bacteria 2944
191 Ga0068862_100155446 3300005844 Bacteria 2038
192 Ga0068862_100303293 3300005844 Bacteria 1470
193 Ga0075363_100362819 3300006048 Bacteria 847
194 Ga0075366_10010581 3300006195 Bacteria 5179
195 Ga0075366_10031527 3300006195 Bacteria 3120
196 Ga0075366_10055381 3300006195 Bacteria 2355
197 Ga0075366_10146543 3300006195 Bacteria 1429
198 Ga0075366_10224405 3300006195 Bacteria 1145
199 Ga0075366_10501107 3300006195 Bacteria 751
200 Ga0097621_100047919 3300006237 Bacteria 3464
201 Ga0097621_100081780 3300006237 Bacteria 2689
202 Ga0097621_100144783 3300006237 Bacteria 2033
203 Ga0097621_100205376 3300006237 Bacteria 1712
204 Ga0097621_100501400 3300006237 Bacteria 1099
205 Ga0075370_10028805 3300006353 Bacteria 3090
206 Ga0075370_10040124 3300006353 Bacteria 2640
207 Ga0075370_10195814 3300006353 Bacteria 1192
208 Ga0068871_100041620 3300006358 Bacteria 3684
209 Ga0068871_100071350 3300006358 Bacteria 2856
210 Ga0068871_100143639 3300006358 Bacteria 2031
211 Ga0068871_100582458 3300006358 Bacteria 1016
212 Ga0075434_100203918 3300006871 Bacteria 1998
213 Ga0068865_100027661 3300006881 Bacteria 3748
214 Ga0068865_100141331 3300006881 Bacteria 1815
215 Ga0068865_100241335 3300006881 Bacteria 1422
216 Ga0097620_100019167 3300006931 Bacteria 6872
217 Ga0097620_100594727 3300006931 Bacteria 1200
218 Ga0097620_101512653 3300006931 Bacteria 741
219 Ga0075435_100347657 3300007076 Bacteria 1271
220 Ga0105250_10087916 3300009092 Bacteria 1262
221 Ga0105240_10025030 3300009093 Bacteria 7857
222 Ga0105240_10646029 3300009093 Bacteria 1160
223 Ga0105240_11241366 3300009093 Bacteria 788
224 Ga0111539_12021008 3300009094 Bacteria 668
225 Ga0105245_10085160 3300009098 Bacteria 2897
226 Ga0105245_10290168 3300009098 Bacteria 1602
227 Ga0105245_10381366 3300009098 Bacteria 1404
228 Ga0105247_11386081 3300009101 Bacteria 568
229 Ga0114129_12679103 3300009147 Bacteria 594
230 Ga0105243_10011388 3300009148 Bacteria 6730
231 Ga0105243_10206614 3300009148 Bacteria 1726
232 Ga0105243_10587883 3300009148 Bacteria 1070
233 Ga0105243_10847446 3300009148 Bacteria 905
234 Ga0105243_11192326 3300009148 Bacteria 774
235 Ga0105243_12547590 3300009148 Bacteria 551
236 Ga0105241_10327317 3300009174 Bacteria 1323
237 Ga0105241_11754658 3300009174 Bacteria 604
238 Ga0105242_10260803 3300009176 Bacteria 1565
239 Ga0105248_10040305 3300009177 Bacteria 5235
240 Ga0105248_10074832 3300009177 Bacteria 3806
241 Ga0105248_10360699 3300009177 Bacteria 1636
242 Ga0105248_10388190 3300009177 Bacteria 1572
243 Ga0105248_10423779 3300009177 Bacteria 1499
244 Ga0105237_10007447 3300009545 Bacteria 11978
245 Ga0105237_10098355 3300009545 Bacteria 2917
246 Ga0105237_10191070 3300009545 Bacteria 2048
247 Ga0105237_11401836 3300009545 Bacteria 705
248 Ga0105238_10005477 3300009551 Bacteria 12552
249 Ga0105238_10053451 3300009551 Bacteria 4059
250 Ga0105238_10959206 3300009551 Bacteria 875
251 Ga0105238_11614897 3300009551 Bacteria 678
252 Ga0105249_10023493 3300009553 Bacteria 5532
253 Ga0105249_10315700 3300009553 Bacteria 1572
254 Ga0105249_10636261 3300009553 Bacteria 1124
255 Ga0105249_11483979 3300009553 Bacteria 750
256 Ga0105249_12699000 3300009553 Bacteria 569
257 Ga0105239_10010780 3300010375 Bacteria 10211
258 Ga0105239_10114929 3300010375 Bacteria 2985
259 Ga0105239_12771490 3300010375 Bacteria 572
260 Ga0105246_11004708 3300011119 Bacteria 755
261 Ga0157323_1045220 3300012495 Bacteria 518
262 Ga0157316_1071264 3300012510 Bacteria 525
263 Ga0157327_1003137 3300012512 Bacteria 1198
264 Ga0157373_10108192 3300013100 Bacteria 1955
265 Ga0157371_10107101 3300013102 Bacteria 1984
266 Ga0157369_10083325 3300013105 Bacteria 3421
267 Ga0157369_10243757 3300013105 Bacteria 1877
268 Ga0157374_10047942 3300013296 Bacteria 3963
269 Ga0157374_10084070 3300013296 Bacteria 3025
270 Ga0157374_10570997 3300013296 Bacteria 1140
271 Ga0157374_10733648 3300013296 Bacteria 1002
272 Ga0157374_10903417 3300013296 Bacteria 901
273 Ga0157378_10001703 3300013297 Bacteria 19776
274 Ga0157378_10107143 3300013297 Bacteria 2557
275 Ga0157378_10606877 3300013297 Bacteria 1106
276 Ga0163162_10002252 3300013306 Bacteria 18114
277 Ga0163162_10011131 3300013306 Bacteria 8762
278 Ga0163162_10181411 3300013306 Bacteria 2231
279 Ga0163162_10205553 3300013306 Bacteria 2098
280 Ga0163162_10327514 3300013306 Bacteria 1664
281 Ga0163162_10332792 3300013306 Bacteria 1651
282 Ga0163162_10352505 3300013306 Bacteria 1604
283 Ga0163162_11136810 3300013306 Bacteria 885
284 Ga0157372_10076894 3300013307 Bacteria 3769
285 Ga0157372_10188338 3300013307 Bacteria 2390
286 Ga0157375_10048298 3300013308 Bacteria 4162
287 Ga0157375_10151456 3300013308 Bacteria 2455
288 Ga0157375_10192035 3300013308 Bacteria 2197
289 Ga0157375_10528887 3300013308 Bacteria 1342
290 Ga0157375_10572082 3300013308 Bacteria 1290
291 Ga0157375_10707123 3300013308 Bacteria 1161
292 Ga0157375_11341169 3300013308 Bacteria 842
293 Ga0163163_10009458 3300014325 Bacteria 8703
294 Ga0157380_10040311 3300014326 Bacteria 3637
295 Ga0157380_10258605 3300014326 Bacteria 1580
296 Ga0157380_12906071 3300014326 Bacteria 545
297 Ga0182008_10248962 3300014497 Bacteria 916
298 Ga0157377_10000032 3300014745 Bacteria 121003
299 Ga0157379_10013272 3300014968 Bacteria 7215
300 Ga0157379_10069128 3300014968 Bacteria 3158
301 Ga0157379_10120153 3300014968 Bacteria 2363
302 Ga0157379_10176376 3300014968 Bacteria 1930
303 Ga0157379_10276440 3300014968 Bacteria 1528
304 Ga0157379_10858909 3300014968 Bacteria 859
305 Ga0157379_11074407 3300014968 Bacteria 770
306 Ga0157376_10098430 3300014969 Bacteria 2550
307 Ga0157376_10115161 3300014969 Bacteria 2373
308 Ga0157376_10115243 3300014969 Bacteria 2372
309 Ga0157376_10176155 3300014969 Bacteria 1951
310 Ga0157376_10543407 3300014969 Bacteria 1149
311 Ga0157376_11459910 3300014969 Bacteria 716
312 Ga0182007_10115543 3300015262 Bacteria 895
313 Ga0163161_10076960 3300017792 Bacteria 2450
314 Ga0163161_10079358 3300017792 Bacteria 2413
315 Ga0163161_10462343 3300017792 Bacteria 1027
316 Ga0213876_10030362 3300021384 Bacteria 2851
317 Ga0209674_113403 3300025226 Bacteria 763
318 Ga0209563_100013 3300025230 Bacteria 941463
319 Ga0207425_1001237 3300025245 Bacteria 11199
320 Ga0209129_1000027 3300025258 Bacteria 409587
321 Ga0209673_1010832 3300025273 Bacteria 3810
322 Ga0209673_1065425 3300025273 Bacteria 888
323 Ga0209564_1000139 3300025295 Bacteria 180328
324 Ga0209758_1000281 3300025297 Bacteria 100826
325 Ga0209758_1000310 3300025297 Bacteria 94307
326 Ga0209050_1000303 3300025298 Bacteria 101498
327 Ga0209051_1013169 3300025303 Bacteria 3951
328 Ga0209257_1006026 3300025304 Bacteria 8101
329 Ga0209257_1088606 3300025304 Bacteria 778
330 Ga0207697_10145728 3300025315 Bacteria 1029
331 Ga0207697_10163381 3300025315 Bacteria 972
332 Ga0207656_10030997 3300025321 Bacteria 2212
333 Ga0207656_10031008 3300025321 Bacteria 2211
334 Ga0207656_10377168 3300025321 Bacteria 711
335 Ga0207696_1085435 3300025711 Bacteria 868
336 Ga0207682_10023185 3300025893 Bacteria 2450
337 Ga0207682_10111417 3300025893 Bacteria 1205
338 Ga0207682_10114272 3300025893 Bacteria 1191
339 Ga0207642_10012685 3300025899 Bacteria 3051
340 Ga0207680_10002140 3300025903 Bacteria 9255
341 Ga0207647_10136054 3300025904 Bacteria 1442
342 Ga0207645_10023242 3300025907 Bacteria 4029
343 Ga0207645_10063446 3300025907 Bacteria 2361
344 Ga0207645_10113574 3300025907 Bacteria 1755
345 Ga0207643_10837842 3300025908 Bacteria 596
346 Ga0207705_10344261 3300025909 Bacteria 1148
347 Ga0207654_10354674 3300025911 Bacteria 1011
348 Ga0207654_11328800 3300025911 Bacteria 524
349 Ga0207695_10009980 3300025913 Bacteria 11666
350 Ga0207695_10736876 3300025913 Bacteria 866
351 Ga0207671_10008972 3300025914 Bacteria 8414
352 Ga0207671_10113852 3300025914 Bacteria 2061
353 Ga0207671_10153863 3300025914 Bacteria 1778
354 Ga0207660_10145784 3300025917 Bacteria 1814
355 Ga0207662_10721860 3300025918 Bacteria 699
356 Ga0207649_10070050 3300025920 Bacteria 2235
357 Ga0207649_10412864 3300025920 Bacteria 1012
358 Ga0207652_10030048 3300025921 Bacteria 4548
359 Ga0207681_10016930 3300025923 Bacteria 4570
360 Ga0207681_10081625 3300025923 Bacteria 2283
361 Ga0207681_10248638 3300025923 Bacteria 1387
362 Ga0207681_10287302 3300025923 Bacteria 1297
363 Ga0207681_10331005 3300025923 Bacteria 1214
364 Ga0207681_10636469 3300025923 Bacteria 883
365 Ga0207681_11005095 3300025923 Bacteria 700
366 Ga0207694_10149504 3300025924 Bacteria 1881
367 Ga0207694_11149245 3300025924 Bacteria 657
368 Ga0207650_10072993 3300025925 Bacteria 2584
369 Ga0207650_10169482 3300025925 Bacteria 1735
370 Ga0207650_10240084 3300025925 Bacteria 1464
371 Ga0207659_10020943 3300025926 Bacteria 4331
372 Ga0207659_10024900 3300025926 Bacteria 4016
373 Ga0207659_10090445 3300025926 Bacteria 2285
374 Ga0207659_10098365 3300025926 Bacteria 2200
375 Ga0207687_10102368 3300025927 Bacteria 2110
376 Ga0207687_10251793 3300025927 Bacteria 1404
377 Ga0207687_10266526 3300025927 Bacteria 1367
378 Ga0207644_10002654 3300025931 Bacteria 11522
379 Ga0207644_10220439 3300025931 Bacteria 1503
380 Ga0207644_10423984 3300025931 Bacteria 1090
381 Ga0207690_10112138 3300025932 Bacteria 1966
382 Ga0207690_10454509 3300025932 Bacteria 1030
383 Ga0207706_10013493 3300025933 Bacteria 7425
384 Ga0207706_10031863 3300025933 Bacteria 4696
385 Ga0207706_10388948 3300025933 Bacteria 1210
386 Ga0207709_10002313 3300025935 Bacteria 12063
387 Ga0207709_10063317 3300025935 Bacteria 2318
388 Ga0207709_10577994 3300025935 Bacteria 887
389 Ga0207670_10007649 3300025936 Bacteria 6048
390 Ga0207670_11561846 3300025936 Bacteria 561
391 Ga0207669_10259192 3300025937 Bacteria 1299
392 Ga0207669_10715248 3300025937 Bacteria 824
393 Ga0207704_10003689 3300025938 Bacteria 6966
394 Ga0207691_10004404 3300025940 Bacteria 13651
395 Ga0207691_10018804 3300025940 Bacteria 6544
396 Ga0207691_10019002 3300025940 Bacteria 6509
397 Ga0207691_10031019 3300025940 Bacteria 4992
398 Ga0207691_10039159 3300025940 Bacteria 4385
399 Ga0207691_10395526 3300025940 Bacteria 1179
400 Ga0207711_10048589 3300025941 Bacteria 3630
401 Ga0207711_10087324 3300025941 Bacteria 2736
402 Ga0207711_10195222 3300025941 Bacteria 1846
403 Ga0207711_10239440 3300025941 Bacteria 1664
404 Ga0207689_10014107 3300025942 Bacteria 6801
405 Ga0207689_10060014 3300025942 Bacteria 3128
406 Ga0207689_10116843 3300025942 Bacteria 2193
407 Ga0207661_10500212 3300025944 Bacteria 1110
408 Ga0207679_10008471 3300025945 Bacteria 6549
409 Ga0207679_11061976 3300025945 Bacteria 743
410 Ga0207667_10514752 3300025949 Bacteria 1213
411 Ga0207651_10004672 3300025960 Bacteria 6942
412 Ga0207651_10013837 3300025960 Bacteria 4634
413 Ga0207651_10032262 3300025960 Bacteria 3362
414 Ga0207712_10043080 3300025961 Bacteria 3112
415 Ga0207712_10284197 3300025961 Bacteria 1351
416 Ga0207668_10024415 3300025972 Bacteria 3901
417 Ga0207668_10121965 3300025972 Bacteria 1975
418 Ga0207668_10275890 3300025972 Bacteria 1376
419 Ga0207668_10570713 3300025972 Bacteria 982
420 Ga0207668_10971850 3300025972 Bacteria 758
421 Ga0207640_10155351 3300025981 Bacteria 1686
422 Ga0207640_10158498 3300025981 Bacteria 1671
423 Ga0207640_10443593 3300025981 Bacteria 1068
424 Ga0207640_11481529 3300025981 Bacteria 609
425 Ga0207658_10010175 3300025986 Bacteria 6393
426 Ga0207658_10020095 3300025986 Bacteria 4624
427 Ga0207658_10051018 3300025986 Bacteria 3047
428 Ga0207658_10062467 3300025986 Bacteria 2787
429 Ga0207658_10084433 3300025986 Bacteria 2443
430 Ga0207658_10223334 3300025986 Bacteria 1586
431 Ga0207658_10252241 3300025986 Bacteria 1500
432 Ga0207658_11639547 3300025986 Bacteria 588
433 Ga0207677_10001522 3300026023 Bacteria 12255
434 Ga0207677_10018664 3300026023 Bacteria 4167
435 Ga0207677_10156774 3300026023 Bacteria 1764
436 Ga0207677_10158317 3300026023 Bacteria 1756
437 Ga0207677_10336598 3300026023 Bacteria 1259
438 Ga0207703_10006009 3300026035 Bacteria 9719
439 Ga0207703_10026459 3300026035 Bacteria 4567
440 Ga0207703_10032964 3300026035 Bacteria 4103
441 Ga0207703_11171630 3300026035 Bacteria 739
442 Ga0207703_11290075 3300026035 Bacteria 702
443 Ga0207639_10099598 3300026041 Bacteria 2345
444 Ga0207639_10141624 3300026041 Bacteria 2004
445 Ga0207639_11765660 3300026041 Bacteria 579
446 Ga0207678_10016216 3300026067 Bacteria 6538
447 Ga0207678_10083543 3300026067 Bacteria 2731
448 Ga0207708_10153438 3300026075 Bacteria 1815
449 Ga0207708_10699366 3300026075 Bacteria 866
450 Ga0207702_10004429 3300026078 Bacteria 12481
451 Ga0207702_10335077 3300026078 Bacteria 1444
452 Ga0207641_10003329 3300026088 Bacteria 14294
453 Ga0207641_10079161 3300026088 Bacteria 2848
454 Ga0207641_10137677 3300026088 Bacteria 2199
455 Ga0207641_10452533 3300026088 Bacteria 1241
456 Ga0207641_10639320 3300026088 Bacteria 1044
457 Ga0207641_10715550 3300026088 Bacteria 987
458 Ga0207648_10000179 3300026089 Bacteria 66602
459 Ga0207648_10001296 3300026089 Bacteria 27908
460 Ga0207648_10010028 3300026089 Bacteria 9011
461 Ga0207648_10101337 3300026089 Bacteria 2524
462 Ga0207648_10325133 3300026089 Bacteria 1383
463 Ga0207648_10449942 3300026089 Bacteria 1173
464 Ga0207648_11271580 3300026089 Bacteria 691
465 Ga0207676_10002741 3300026095 Bacteria 12542
466 Ga0207676_10003295 3300026095 Bacteria 11473
467 Ga0207676_10044642 3300026095 Bacteria 3420
468 Ga0207676_10073876 3300026095 Bacteria 2745
469 Ga0207676_10904337 3300026095 Bacteria 866
470 Ga0207674_10008627 3300026116 Bacteria 11748
471 Ga0207674_10332208 3300026116 Bacteria 1470
472 Ga0207674_10446401 3300026116 Bacteria 1250
473 Ga0207675_100005391 3300026118 Bacteria 12258
474 Ga0207675_100060714 3300026118 Bacteria 3529
475 Ga0207675_100088572 3300026118 Bacteria 2908
476 Ga0207683_10148626 3300026121 Bacteria 2114
477 Ga0207683_10365924 3300026121 Bacteria 1324
478 Ga0207683_10673289 3300026121 Bacteria 959
479 Ga0207698_10009766 3300026142 Bacteria 6129
480 Ga0207698_10021332 3300026142 Bacteria 4477
481 Ga0207698_10051692 3300026142 Bacteria 3143
482 Ga0207698_10603936 3300026142 Bacteria 1082
483 Ga0207698_10687655 3300026142 Bacteria 1017
484 Ga0207698_10748657 3300026142 Bacteria 976
485 Ga0207698_11223306 3300026142 Bacteria 765
486 Ga0209179_1001677 3300027512 Bacteria 2800
487 Ga0268266_10045732 3300028379 Bacteria 3745
488 Ga0268266_10350275 3300028379 Bacteria 1388
489 Ga0268266_10368943 3300028379 Bacteria 1352
490 Ga0268265_10011328 3300028380 Bacteria 6031
491 Ga0268265_10026717 3300028380 Bacteria 4109
492 Ga0268265_10201146 3300028380 Bacteria 1728
493 Ga0268264_10000613 3300028381 Bacteria 42687
494 Ga0268264_10024923 3300028381 Bacteria 4888
495 Ga0268264_10572287 3300028381 Bacteria 1110
496 Ga0307517_10076041 3300028786 Bacteria 2937
497 Ga0307517_10184301 3300028786 Bacteria 1340
498 Ga0307517_10189474 3300028786 Bacteria 1309
499 Ga0307515_10000609 3300028794 Bacteria 83557
500 Ga0307515_10001693 3300028794 Bacteria 49203
501 Ga0307515_10003934 3300028794 Bacteria 31018
502 Ga0307515_10018282 3300028794 Bacteria 12704
503 Ga0307515_10044072 3300028794 Bacteria 6908
504 Ga0307515_10260267 3300028794 Bacteria 1472
505 Ga0307515_10472368 3300028794 Bacteria 867
506 Ga0307512_10121681 3300030522 Bacteria 1673
507 Ga0307512_10385555 3300030522 Bacteria 597
508 Ga0265330_10031672 3300031235 Bacteria 2370
509 Ga0265332_10076988 3300031238 Bacteria 1417
510 Ga0265328_10385106 3300031239 Bacteria 549
511 Ga0265339_10238007 3300031249 Bacteria 885
512 Ga0265316_10103655 3300031344 Bacteria 2160
513 Ga0307513_10114170 3300031456 Bacteria 2687
514 Ga0307513_10378910 3300031456 Bacteria 1155
515 Ga0307513_10392129 3300031456 Bacteria 1125
516 Ga0307513_10424194 3300031456 Bacteria 1059
517 Ga0307509_10000991 3300031507 Bacteria 48763
518 Ga0307509_10040089 3300031507 Bacteria 5095
519 Ga0307509_10058903 3300031507 Bacteria 4065
520 Ga0307509_10106381 3300031507 Bacteria 2824
521 Ga0307509_10142847 3300031507 Bacteria 2325
522 Ga0307509_10212595 3300031507 Bacteria 1757
523 Ga0307509_10420658 3300031507 Bacteria 1037
524 Ga0307509_10646017 3300031507 Bacteria 727
525 Ga0307509_10689182 3300031507 Bacteria 689
526 Ga0307509_10780701 3300031507 Bacteria 620
527 Ga0307509_10891337 3300031507 Bacteria 554
528 Ga0307509_11007268 3300031507 Bacteria 500
529 Ga0307408_100046772 3300031548 Bacteria 3096
530 Ga0307408_100311467 3300031548 Bacteria 1323
531 Ga0307408_101356986 3300031548 Bacteria 668
532 Ga0307508_10000404 3300031616 Bacteria 51734
533 Ga0307508_10005736 3300031616 Bacteria 11754
534 Ga0307508_10011564 3300031616 Bacteria 8064
535 Ga0307508_10349404 3300031616 Bacteria 1070
536 Ga0307514_10053594 3300031649 Bacteria 3112
537 Ga0307514_10058422 3300031649 Bacteria 2950
538 Ga0307514_10149542 3300031649 Bacteria 1570
539 Ga0307514_10394112 3300031649 Bacteria 711
540 Ga0265314_10006203 3300031711 Bacteria 10617
541 Ga0265342_10060778 3300031712 Bacteria 2227
542 Ga0307516_10009071 3300031730 Bacteria 11141
543 Ga0307516_10237732 3300031730 Bacteria 1522
544 Ga0307516_10370119 3300031730 Bacteria 1096
545 Ga0307405_10006962 3300031731 Bacteria 5616
546 Ga0307413_10263992 3300031824 Bacteria 1285
547 Ga0307518_10047827 3300031838 Bacteria 3110
548 Ga0307410_10916573 3300031852 Bacteria 751
549 Ga0307406_10114919 3300031901 Bacteria 1860
550 Ga0307406_10712935 3300031901 Bacteria 839
551 Ga0307407_10907830 3300031903 Bacteria 676
552 Ga0307412_10024007 3300031911 Bacteria 3760
553 Ga0307412_10277509 3300031911 Bacteria 1314
554 Ga0307409_100000580 3300031995 Bacteria 15944
555 Ga0307409_102811226 3300031995 Bacteria 514
556 Ga0307416_100014097 3300032002 Bacteria 5460
557 Ga0307416_100236784 3300032002 Bacteria 1765
558 Ga0307416_100291949 3300032002 Bacteria 1615
559 Ga0307416_101955761 3300032002 Bacteria 689
560 Ga0307411_10351244 3300032005 Bacteria 1202
561 Ga0307411_10521007 3300032005 Bacteria 1009
562 Ga0307411_10738275 3300032005 Bacteria 861
563 Ga0307415_100002051 3300032126 Bacteria 9953
564 Ga0307507_10038483 3300033179 Bacteria 4847
565 Ga0307507_10050992 3300033179 Bacteria 3988
566 Ga0307507_10161529 3300033179 Bacteria 1654
567 Ga0307510_10003212 3300033180 Bacteria 19002
568 Ga0307510_10059995 3300033180 Bacteria 3920
569 Ga0307510_10131040 3300033180 Bacteria 2180
570 Ga0307510_10135291 3300033180 Bacteria 2124
571 Ga0373944_0194926 3300035089 Bacteria 731
572 Ga0373932_0019983 3300035112 Bacteria 1751
573 Ga0373955_0309537 3300035172 Bacteria 953
574 Ga0373961_0378091 3300035241 Bacteria 539
575 Ga0373924_0172895 3300035410 Bacteria 950
576 Ga0373931_0001378 3300035691 Bacteria 10389
577 Ga0373927_0064689 3300035695 Bacteria 2366
578 Ga0373937_0321803 3300036401 Bacteria 1463
579 Ga0373937_1086171 3300036401 Bacteria 749
580 Ga0373925_0132974 3300037068 Bacteria 1941
581 Ga0373925_0552801 3300037068 Bacteria 947
582 Ga0395905_0023956 3300037471 Bacteria 5763
583 Ga0395905_0601971 3300037471 Bacteria 1001
584 Ga0436365_1640203 3300039437 Bacteria 3024
585 Ga0436361_1177655 3300039447 Bacteria 803
586 Ga0436363_1475448 3300039450 Bacteria 1005
587 Ga0451787_580127 3300041441 Bacteria 930
588 Ga0451789_0198671 3300041443 Bacteria 1635
589 Ga0451793_0018596 3300041452 Bacteria 1636
590 Ga0451793_1009547 3300041452 Bacteria 541
591 Ga0451797_0220704 3300041453 Bacteria 630
592 Ga0451800_1641012 3300041459 Bacteria 605
593 Ga0451802_2074907 3300041460 Bacteria 554
594 Ga0451807_1825296 3300041486 Bacteria 950
595 Ga0451833_1469414 3300041491 Bacteria 633
596 Ga0451845_0977099 3300041501 Bacteria 660
597 Ga0451843_0870225 3300041509 Bacteria 508
598 Ga0451853_0327863 3300041512 Bacteria 611
599 Ga0451853_0350852 3300041512 Bacteria 1424
600 Ga0451853_3674141 3300041512 Bacteria 873
601 Ga0439449_0343875 3300042007 Bacteria 564
602 Ga0439456_144950 3300042013 Bacteria 552
603 Ga0450896_022249 3300042133 Bacteria 934
604 Ga0439459_0014586 3300042438 Bacteria 1430
605 Ga0439460_0175468 3300042461 Bacteria 723
606 Ga0450893_0034880 3300042532 Bacteria 907
607 Ga0451577_0004221 3300042876 Bacteria 15320
608 Ga0451577_0004741 3300042876 Bacteria 14236
609 Ga0451577_0020267 3300042876 Bacteria 6105
610 Ga0451577_0057615 3300042876 Bacteria 3463
611 Ga0451577_0186853 3300042876 Bacteria 1869
612 Ga0451577_0401658 3300042876 Bacteria 1244
613 Ga0451577_0733135 3300042876 Bacteria 894
614 Ga0453683_0092672 3300044673 Bacteria 1894
615 Ga0453683_0134334 3300044673 Bacteria 1560
616 Ga0453684_0005216 3300044712 Bacteria 26063
617 Ga0453684_0244278 3300044712 Bacteria 2065
618 Ga0453684_0251708 3300044712 Bacteria 2028
619 Ga0453684_0384845 3300044712 Bacteria 1574
620 Ga0451576_0017940 3300045051 Bacteria 7769
621 Ga0451576_0062948 3300045051 Bacteria 3867
622 Ga0451576_2164302 3300045051 Bacteria 571
623 Ga0495592_0000083 3300046454 Bacteria 83092
624 Ga0495629_0311784 3300046459 Bacteria 1076
625 Ga0495629_0365673 3300046459 Bacteria 983
626 Ga0495638_0111579 3300046460 Bacteria 1624
627 Ga0495650_0145821 3300046471 Bacteria 853
628 Ga0495580_0018628 3300046472 Bacteria 5167
629 Ga0495639_0142511 3300046475 Bacteria 1153
630 Ga0495606_0461145 3300046507 Bacteria 649
631 Ga0495618_0656644 3300046514 Bacteria 620
632 Ga0495631_0051252 3300046518 Bacteria 1804
633 Ga0495632_0168428 3300046519 Bacteria 1007
634 Ga0495632_0283575 3300046519 Bacteria 737
635 Ga0495648_0139642 3300046524 Bacteria 1277
636 Ga0495648_0271303 3300046524 Bacteria 809
637 Ga0495648_0283877 3300046524 Bacteria 783
638 Ga0495598_0072198 3300046537 Bacteria 1089
639 Ga0495621_0024915 3300046539 Bacteria 2004
640 Ga0495645_0538572 3300046543 Bacteria 725
641 Ga0495668_0087108 3300046616 Bacteria 1713
642 Ga0495625_0009747 3300046660 Bacteria 7995
643 Ga0495625_0108748 3300046660 Bacteria 1897
644 Ga0495646_0064363 3300046680 Bacteria 2174
645 Ga0495658_0178716 3300046683 Bacteria 1316
646 Ga0495658_0347228 3300046683 Bacteria 943
647 Ga0495613_0386887 3300046689 Bacteria 956
648 Ga0495624_0016323 3300046690 Bacteria 4998
649 Ga0495670_0045101 3300046691 Bacteria 2201
650 Ga0495671_0028003 3300046692 Bacteria 2906
651 Ga0495671_0118049 3300046692 Bacteria 1295
652 Ga0495600_0706943 3300046809 Bacteria 606
653 Ga0495581_0455107 3300047315 Bacteria 745
654 Ga0495604_0254180 3300047317 Bacteria 1197
655 Ga0495674_1236223 3300047319 Bacteria 563
656 Ga0495676_0392362 3300047321 Bacteria 922
657 Ga0495673_0152346 3300047469 Bacteria 893
658 Ga0495686_0030754 3300047472 Bacteria 3486
659 Ga0495686_0215174 3300047472 Bacteria 1096
660 Ga0495593_0059628 3300047673 Bacteria 1999
661 Ga0495602_0316539 3300048088 Bacteria 1137
662 Ga0495614_0056011 3300048089 Bacteria 1692
663 Ga0495614_0098532 3300048089 Bacteria 1276
664 Ga0496100_0091111 3300048903 Bacteria 2080
665 Ga0496100_0112887 3300048903 Bacteria 1891
666 Ga0496101_0008293 3300048904 Bacteria 6789
667 Ga0496101_0303590 3300048904 Bacteria 1251
668 Ga0496102_0018445 3300048905 Bacteria 6133
669 Ga0496102_0272326 3300048905 Bacteria 1596
670 Ga0496102_0503763 3300048905 Bacteria 1133
671 Ga0496104_0032470 3300048907 Bacteria 4859
672 Ga0496104_0055646 3300048907 Bacteria 3741
673 Ga0496104_0753854 3300048907 Bacteria 880
674 Ga0496104_1245281 3300048907 Bacteria 647
675 Ga0496105_0073192 3300048908 Bacteria 2831
676 Ga0496105_0167701 3300048908 Bacteria 1801
677 Ga0496106_0008934 3300048909 Bacteria 7406
678 Ga0496106_0294814 3300048909 Bacteria 1300
679 Ga0496107_0256318 3300048910 Bacteria 1302
680 Ga0496108_0011606 3300048911 Bacteria 7167
681 Ga0496108_0023125 3300048911 Bacteria 5112
682 Ga0496108_1030897 3300048911 Bacteria 702
683 Ga0496109_0082364 3300048912 Bacteria 2965
684 Ga0496109_0082794 3300048912 Bacteria 2958
685 Ga0496110_0118474 3300048913 Bacteria 2384
686 Ga0496111_0275498 3300048914 Bacteria 1248
687 Ga0496112_0193243 3300048915 Bacteria 1996
688 Ga0496113_0067776 3300048916 Bacteria 2707
689 Ga0496113_0068982 3300048916 Bacteria 2684
690 Ga0496114_0126437 3300048917 Bacteria 2204
691 Ga0496114_0559505 3300048917 Bacteria 1010
692 Ga0496122_0207922 3300048925 Bacteria 1137
693 Ga0496125_0423925 3300048928 Bacteria 770
694 Ga0501198_037180 3300049649 Bacteria 833
695 Ga0501206_007243 3300049653 Bacteria 1452
696 Ga0501209_276053 3300049656 Bacteria 527
697 Ga0501252_000122 3300049682 Bacteria 4551
698 Ga0501264_024709 3300049761 Bacteria 659
699 Ga0501226_010804 3300049853 Bacteria 1012
700 nmdc:mga03683_199333_c1 3300050489 Bacteria 918
701 nmdc:mga0k408_119019_c1 3300050493 Bacteria 1563
702 nmdc:mga0k408_16652_c1 3300050493 Bacteria 4083
703 nmdc:mga0k408_267305_c1 3300050493 Bacteria 1021
704 nmdc:mga0k408_33581_c1 3300050493 Bacteria 2935
705 nmdc:mga0k408_590424_c1 3300050493 Bacteria 655
706 nmdc:mga07m45_103137_c1 3300050496 Bacteria 1639
707 nmdc:mga07m45_147621_c1 3300050496 Bacteria 1363
708 nmdc:mga07m45_48382_c1 3300050496 Bacteria 2391
709 nmdc:mga07m45_517306_c1 3300050496 Bacteria 691
710 nmdc:mga07m45_71714_c1 3300050496 Bacteria 1971
711 nmdc:mga05p37_2022283_c1 3300050507 Bacteria 544
712 nmdc:mga08y16_114587_c1 3300050511 Bacteria 2806
713 nmdc:mga0n895_44649_c1 3300050512 Bacteria 4321
714 nmdc:mga0rr50_182035_c1 3300050513 Bacteria 1718
715 Ga0500635_0204951 3300053080 Bacteria 767
716 Ga0495619_0908110 3300053085 Bacteria 592
717 Ga0500578_0000363 3300053086 Bacteria 55670
718 Ga0500578_0068943 3300053086 Bacteria 2254
719 Ga0500644_0010849 3300053088 Bacteria 2474
720 Ga0500581_301149 3300053089 Bacteria 638
721 Ga0500647_0386792 3300053091 Bacteria 571
722 Ga0500651_0045174 3300053093 Bacteria 2772
723 Ga0500651_0319672 3300053093 Bacteria 887
724 Ga0500648_120659 3300053097 Bacteria 1436
725 Ga0500650_0199384 3300053098 Bacteria 912
726 Ga0500562_033273 3300053108 Bacteria 1362
727 Ga0500593_000526 3300053117 Bacteria 15083
728 Ga0500594_0004214 3300053118 Bacteria 3169
729 Ga0500594_0318097 3300053118 Bacteria 523
730 Ga0500597_335690 3300053120 Bacteria 593
731 Ga0500655_018956 3300053133 Bacteria 1279
732 Ga0500559_0000019 3300053136 Bacteria 134862
733 Ga0500564_199644 3300053138 Bacteria 822
734 Ga0500568_0064970 3300053139 Bacteria 1405
735 Ga0500568_0185956 3300053139 Bacteria 763
736 Ga0500604_0018787 3300053151 Bacteria 1930
737 Ga0500604_0028615 3300053151 Bacteria 1619
738 Ga0500616_0264849 3300053153 Bacteria 728
739 Ga0500619_000171 3300053154 Bacteria 15684
740 Ga0500619_048118 3300053154 Bacteria 1372
741 Ga0500622_0003170 3300053156 Bacteria 11250
742 Ga0500622_0206699 3300053156 Bacteria 889
743 Ga0500633_0246116 3300053160 Bacteria 665
744 Ga0500636_0250282 3300053177 Bacteria 904
745 Ga0500645_001960 3300053730 Bacteria 9727
746 Ga0500599_054603 3300053736 Bacteria 639
747 Ga0500587_006746 3300053739 Bacteria 1513
748 Ga0590077_062339 3300059426 Bacteria 846
749 2587724929 2585428057 Bacteria 6737412
750 2588292431 2588253510 Bacteria 6901809
751 2643968189 2643221592 Bacteria 6608788
752 2644142455 2643221625 Bacteria 6512927
753 2644277046 2643221648 Bacteria 6521465
754 2886850375 2886848708 Bacteria 5632523
755 Ga0395905_0167972
756 JGI24744J21845_10006631
757 JGI25152J39213_1001224
758 JGI25152J39213_1001251
759 JGI25152J39213_1001299
760 JGI25150J39212_1005235
761 JGI25153J46596_10002653
762 JGI25153J46596_10004183
763 Ga0006777J48905_1047703
764 Ga0055526_1002262
765 Ga0055530_10009773
766 Ga0065165_1001456
767 Ga0065707_10220135
768 Ga0070658_10551114
769 Ga0070658_10678651
770 Ga0070676_10021332
771 Ga0070676_10034097
772 Ga0070676_10056576
773 Ga0070683_100252217
774 Ga0070683_100403035
775 Ga0070690_100020420
776 Ga0070690_100645339
777 Ga0070690_100728401
778 Ga0070670_100001787
779 Ga0070670_100096015
780 Ga0070670_100168819
781 Ga0070670_100655440
782 Ga0070677_10039217
783 Ga0070677_10067530
784 Ga0070677_10344192
785 Ga0068869_100006465
786 Ga0068869_100009400
787 Ga0068869_100090154
788 Ga0068869_100804787
789 Ga0070666_10006757
790 Ga0070666_10197154
791 Ga0070666_10486118
792 Ga0070682_100600912
793 Ga0070682_101627522
794 Ga0068868_100000966
795 Ga0068868_100032419
796 Ga0068868_100073841
797 Ga0068868_100229637
798 Ga0068868_100361051
799 Ga0068868_101568063
800 Ga0070660_100102149
801 Ga0070689_100175898
802 Ga0070689_102109219
803 Ga0070687_100781062
804 Ga0070687_101207084
805 Ga0070661_100108802
806 Ga0070661_100156321
807 Ga0070692_10262472
808 Ga0070668_100036969
809 Ga0070668_100137109
810 Ga0070668_100173369
811 Ga0070669_100088090
812 Ga0070669_100101683
813 Ga0070669_100382001
814 Ga0070669_100395680
815 Ga0070669_101338456
816 Ga0070675_100008036
817 Ga0070675_100061241
818 Ga0070675_100062673
819 Ga0070675_100080667
820 Ga0070671_100011057
821 Ga0070671_100160588
822 Ga0070671_100208222
823 Ga0070671_100323786
824 Ga0070671_102113961
825 Ga0070674_100094896
826 Ga0070674_100102944
827 Ga0070674_100348681
828 Ga0070674_101050108
829 Ga0070674_101090703
830 Ga0070673_100019930
831 Ga0070673_100050040
832 Ga0070673_100118826
833 Ga0070673_100244226
834 Ga0070673_100495865
835 Ga0070688_100072638
836 Ga0070688_101379380
837 Ga0070659_100043932
838 Ga0070659_101312441
839 Ga0070667_100023158
840 Ga0070667_100081424
841 Ga0070667_100099658
842 Ga0070667_100192145
843 Ga0070667_100533439
844 Ga0070667_100950070
845 Ga0070700_100095800
846 Ga0070700_100973609
847 Ga0070663_100001375
848 Ga0070663_100273872
849 Ga0070663_102104065
850 Ga0070678_100006239
851 Ga0070678_100077866
852 Ga0070678_101352439
853 Ga0070662_100017313
854 Ga0070662_100034193
855 Ga0070662_100947686
856 Ga0070662_101424447
857 Ga0070681_10176293
858 Ga0070681_10628428
859 Ga0068867_100005640
860 Ga0068867_100011669
861 Ga0068867_100049124
862 Ga0070685_10296691
863 Ga0070685_10367513
864 Ga0070707_100985463
865 Ga0070699_102152406
866 Ga0070679_100108254
867 Ga0070679_101489044
868 Ga0070684_100031515
869 Ga0070684_100468989
870 Ga0070684_101008342
871 Ga0068853_100077580
872 Ga0068853_101845419
873 Ga0070672_100007718
874 Ga0070672_100013592
875 Ga0070672_100021973
876 Ga0070672_100036721
877 Ga0070672_100042843
878 Ga0070672_100149059
879 Ga0070686_100452954
880 Ga0070686_100702272
881 Ga0070693_100079478
882 Ga0070693_100952951
883 Ga0070693_100988821
884 Ga0070665_100015286
885 Ga0070665_100163978
886 Ga0070665_100523187
887 Ga0070665_100656324
888 Ga0070704_100581445
889 Ga0070664_100112711
890 Ga0070664_100240697
891 Ga0070664_101111116
892 Ga0068857_100241040
893 Ga0068857_100285172
894 Ga0068857_100354262
895 Ga0068857_101673816
896 Ga0068854_100436926
897 Ga0068854_100499553
898 Ga0068856_100007776
899 Ga0068856_100200434
900 Ga0070702_100261656
901 Ga0070702_100410075
902 Ga0068852_100005075
903 Ga0068852_100030245
904 Ga0068852_100256445
905 Ga0068852_100707440
906 Ga0068852_100709170
907 Ga0068852_101023768
908 Ga0068859_100019167
909 Ga0068859_100594680
910 Ga0068859_101511878
911 Ga0068864_100002065
912 Ga0068864_100013594
913 Ga0068864_100035249
914 Ga0068864_100072290
915 Ga0068866_10003257
916 Ga0068866_10569852
917 Ga0068866_10725864
918 Ga0068861_100052430
919 Ga0068861_100236372
920 Ga0068861_100510359
921 Ga0068851_10071766
922 Ga0068851_10102633
923 Ga0068851_10261466
924 Ga0068851_10489408
925 Ga0068870_11362289
926 Ga0068863_100017036
927 Ga0068863_100020937
928 Ga0068863_100059870
929 Ga0068863_100085478
930 Ga0068863_100248762
931 Ga0068858_100015823
932 Ga0068858_100039082
933 Ga0068858_100061093
934 Ga0068858_100319144
935 Ga0068858_100936021
936 Ga0068858_101711269
937 Ga0068860_100000823
938 Ga0068860_100022795
939 Ga0068860_100139445
940 Ga0068860_100975716
941 Ga0068860_101476549
942 Ga0068860_101949740
943 Ga0068862_100020457
944 Ga0068862_100074012
945 Ga0068862_100155446
946 Ga0068862_100303293
947 Ga0075363_100362819
948 Ga0075366_10010581
949 Ga0075366_10031527
950 Ga0075366_10055381
951 Ga0075366_10146543
952 Ga0075366_10224405
953 Ga0075366_10501107
954 Ga0097621_100047919
955 Ga0097621_100081780
956 Ga0097621_100144783
957 Ga0097621_100205376
958 Ga0097621_100501400
959 Ga0075370_10028805
960 Ga0075370_10040124
961 Ga0075370_10195814
962 Ga0068871_100041620
963 Ga0068871_100071350
964 Ga0068871_100143639
965 Ga0068871_100582458
966 Ga0075434_100203918
967 Ga0068865_100027661
968 Ga0068865_100141331
969 Ga0068865_100241335
970 Ga0097620_100019167
971 Ga0097620_100594727
972 Ga0097620_101512653
973 Ga0075435_100347657
974 Ga0105250_10087916
975 Ga0105240_10025030
976 Ga0105240_10646029
977 Ga0105240_11241366
978 Ga0111539_12021008
979 Ga0105245_10085160
980 Ga0105245_10290168
981 Ga0105245_10381366
982 Ga0105247_11386081
983 Ga0114129_12679103
984 Ga0105243_10011388
985 Ga0105243_10206614
986 Ga0105243_10587883
987 Ga0105243_10847446
988 Ga0105243_11192326
989 Ga0105243_12547590
990 Ga0105241_10327317
991 Ga0105241_11754658
992 Ga0105242_10260803
993 Ga0105248_10040305
994 Ga0105248_10074832
995 Ga0105248_10360699
996 Ga0105248_10388190
997 Ga0105248_10423779
998 Ga0105237_10007447
999 Ga0105237_10098355
1000 Ga0105237_10191070
1001 Ga0105237_11401836
1002 Ga0105238_10005477
1003 Ga0105238_10053451
1004 Ga0105238_10959206
1005 Ga0105238_11614897
1006 Ga0105249_10023493
1007 Ga0105249_10315700
1008 Ga0105249_10636261
1009 Ga0105249_11483979
1010 Ga0105249_12699000
1011 Ga0105239_10010780
1012 Ga0105239_10114929
1013 Ga0105239_12771490
1014 Ga0105246_11004708
1015 Ga0157323_1045220
1016 Ga0157316_1071264
1017 Ga0157327_1003137
1018 Ga0157373_10108192
1019 Ga0157371_10107101
1020 Ga0157369_10083325
1021 Ga0157369_10243757
1022 Ga0157374_10047942
1023 Ga0157374_10084070
1024 Ga0157374_10570997
1025 Ga0157374_10733648
1026 Ga0157374_10903417
1027 Ga0157378_10001703
1028 Ga0157378_10107143
1029 Ga0157378_10606877
1030 Ga0163162_10002252
1031 Ga0163162_10011131
1032 Ga0163162_10181411
1033 Ga0163162_10205553
1034 Ga0163162_10327514
1035 Ga0163162_10332792
1036 Ga0163162_10352505
1037 Ga0163162_11136810
1038 Ga0157372_10076894
1039 Ga0157372_10188338
1040 Ga0157375_10048298
1041 Ga0157375_10151456
1042 Ga0157375_10192035
1043 Ga0157375_10528887
1044 Ga0157375_10572082
1045 Ga0157375_10707123
1046 Ga0157375_11341169
1047 Ga0163163_10009458
1048 Ga0157380_10040311
1049 Ga0157380_10258605
1050 Ga0157380_12906071
1051 Ga0182008_10248962
1052 Ga0157377_10000032
1053 Ga0157379_10013272
1054 Ga0157379_10069128
1055 Ga0157379_10120153
1056 Ga0157379_10176376
1057 Ga0157379_10276440
1058 Ga0157379_10858909
1059 Ga0157379_11074407
1060 Ga0157376_10098430
1061 Ga0157376_10115161
1062 Ga0157376_10115243
1063 Ga0157376_10176155
1064 Ga0157376_10543407
1065 Ga0157376_11459910
1066 Ga0182007_10115543
1067 Ga0163161_10076960
1068 Ga0163161_10079358
1069 Ga0163161_10462343
1070 Ga0213876_10030362
1071 Ga0209674_113403
1072 Ga0209563_100013
1073 Ga0207425_1001237
1074 Ga0209129_1000027
1075 Ga0209673_1010832
1076 Ga0209673_1065425
1077 Ga0209564_1000139
1078 Ga0209758_1000281
1079 Ga0209758_1000310
1080 Ga0209050_1000303
1081 Ga0209051_1013169
1082 Ga0209257_1006026
1083 Ga0209257_1088606
1084 Ga0207697_10145728
1085 Ga0207697_10163381
1086 Ga0207656_10030997
1087 Ga0207656_10031008
1088 Ga0207656_10377168
1089 Ga0207696_1085435
1090 Ga0207682_10023185
1091 Ga0207682_10111417
1092 Ga0207682_10114272
1093 Ga0207642_10012685
1094 Ga0207680_10002140
1095 Ga0207647_10136054
1096 Ga0207645_10023242
1097 Ga0207645_10063446
1098 Ga0207645_10113574
1099 Ga0207643_10837842
1100 Ga0207705_10344261
1101 Ga0207654_10354674
1102 Ga0207654_11328800
1103 Ga0207695_10009980
1104 Ga0207695_10736876
1105 Ga0207671_10008972
1106 Ga0207671_10113852
1107 Ga0207671_10153863
1108 Ga0207660_10145784
1109 Ga0207662_10721860
1110 Ga0207649_10070050
1111 Ga0207649_10412864
1112 Ga0207652_10030048
1113 Ga0207681_10016930
1114 Ga0207681_10081625
1115 Ga0207681_10248638
1116 Ga0207681_10287302
1117 Ga0207681_10331005
1118 Ga0207681_10636469
1119 Ga0207681_11005095
1120 Ga0207694_10149504
1121 Ga0207694_11149245
1122 Ga0207650_10072993
1123 Ga0207650_10169482
1124 Ga0207650_10240084
1125 Ga0207659_10020943
1126 Ga0207659_10024900
1127 Ga0207659_10090445
1128 Ga0207659_10098365
1129 Ga0207687_10102368
1130 Ga0207687_10251793
1131 Ga0207687_10266526
1132 Ga0207644_10002654
1133 Ga0207644_10220439
1134 Ga0207644_10423984
1135 Ga0207690_10112138
1136 Ga0207690_10454509
1137 Ga0207706_10013493
1138 Ga0207706_10031863
1139 Ga0207706_10388948
1140 Ga0207709_10002313
1141 Ga0207709_10063317
1142 Ga0207709_10577994
1143 Ga0207670_10007649
1144 Ga0207670_11561846
1145 Ga0207669_10259192
1146 Ga0207669_10715248
1147 Ga0207704_10003689
1148 Ga0207691_10004404
1149 Ga0207691_10018804
1150 Ga0207691_10019002
1151 Ga0207691_10031019
1152 Ga0207691_10039159
1153 Ga0207691_10395526
1154 Ga0207711_10048589
1155 Ga0207711_10087324
1156 Ga0207711_10195222
1157 Ga0207711_10239440
1158 Ga0207689_10014107
1159 Ga0207689_10060014
1160 Ga0207689_10116843
1161 Ga0207661_10500212
1162 Ga0207679_10008471
1163 Ga0207679_11061976
1164 Ga0207667_10514752
1165 Ga0207651_10004672
1166 Ga0207651_10013837
1167 Ga0207651_10032262
1168 Ga0207712_10043080
1169 Ga0207712_10284197
1170 Ga0207668_10024415
1171 Ga0207668_10121965
1172 Ga0207668_10275890
1173 Ga0207668_10570713
1174 Ga0207668_10971850
1175 Ga0207640_10155351
1176 Ga0207640_10158498
1177 Ga0207640_10443593
1178 Ga0207640_11481529
1179 Ga0207658_10010175
1180 Ga0207658_10020095
1181 Ga0207658_10051018
1182 Ga0207658_10062467
1183 Ga0207658_10084433
1184 Ga0207658_10223334
1185 Ga0207658_10252241
1186 Ga0207658_11639547
1187 Ga0207677_10001522
1188 Ga0207677_10018664
1189 Ga0207677_10156774
1190 Ga0207677_10158317
1191 Ga0207677_10336598
1192 Ga0207703_10006009
1193 Ga0207703_10026459
1194 Ga0207703_10032964
1195 Ga0207703_11171630
1196 Ga0207703_11290075
1197 Ga0207639_10099598
1198 Ga0207639_10141624
1199 Ga0207639_11765660
1200 Ga0207678_10016216
1201 Ga0207678_10083543
1202 Ga0207708_10153438
1203 Ga0207708_10699366
1204 Ga0207702_10004429
1205 Ga0207702_10335077
1206 Ga0207641_10003329
1207 Ga0207641_10079161
1208 Ga0207641_10137677
1209 Ga0207641_10452533
1210 Ga0207641_10639320
1211 Ga0207641_10715550
1212 Ga0207648_10000179
1213 Ga0207648_10001296
1214 Ga0207648_10010028
1215 Ga0207648_10101337
1216 Ga0207648_10325133
1217 Ga0207648_10449942
1218 Ga0207648_11271580
1219 Ga0207676_10002741
1220 Ga0207676_10003295
1221 Ga0207676_10044642
1222 Ga0207676_10073876
1223 Ga0207676_10904337
1224 Ga0207674_10008627
1225 Ga0207674_10332208
1226 Ga0207674_10446401
1227 Ga0207675_100005391
1228 Ga0207675_100060714
1229 Ga0207675_100088572
1230 Ga0207683_10148626
1231 Ga0207683_10365924
1232 Ga0207683_10673289
1233 Ga0207698_10009766
1234 Ga0207698_10021332
1235 Ga0207698_10051692
1236 Ga0207698_10603936
1237 Ga0207698_10687655
1238 Ga0207698_10748657
1239 Ga0207698_11223306
1240 Ga0209179_1001677
1241 Ga0268266_10045732
1242 Ga0268266_10350275
1243 Ga0268266_10368943
1244 Ga0268265_10011328
1245 Ga0268265_10026717
1246 Ga0268265_10201146
1247 Ga0268264_10000613
1248 Ga0268264_10024923
1249 Ga0268264_10572287
1250 Ga0307517_10076041
1251 Ga0307517_10184301
1252 Ga0307517_10189474
1253 Ga0307515_10000609
1254 Ga0307515_10001693
1255 Ga0307515_10003934
1256 Ga0307515_10018282
1257 Ga0307515_10044072
1258 Ga0307515_10260267
1259 Ga0307515_10472368
1260 Ga0307512_10121681
1261 Ga0307512_10385555
1262 Ga0265330_10031672
1263 Ga0265332_10076988
1264 Ga0265328_10385106
1265 Ga0265339_10238007
1266 Ga0265316_10103655
1267 Ga0307513_10114170
1268 Ga0307513_10378910
1269 Ga0307513_10392129
1270 Ga0307513_10424194
1271 Ga0307509_10000991
1272 Ga0307509_10040089
1273 Ga0307509_10058903
1274 Ga0307509_10106381
1275 Ga0307509_10142847
1276 Ga0307509_10212595
1277 Ga0307509_10420658
1278 Ga0307509_10646017
1279 Ga0307509_10689182
1280 Ga0307509_10780701
1281 Ga0307509_10891337
1282 Ga0307509_11007268
1283 Ga0307408_100046772
1284 Ga0307408_100311467
1285 Ga0307408_101356986
1286 Ga0307508_10000404
1287 Ga0307508_10005736
1288 Ga0307508_10011564
1289 Ga0307508_10349404
1290 Ga0307514_10053594
1291 Ga0307514_10058422
1292 Ga0307514_10149542
1293 Ga0307514_10394112
1294 Ga0265314_10006203
1295 Ga0265342_10060778
1296 Ga0307516_10009071
1297 Ga0307516_10237732
1298 Ga0307516_10370119
1299 Ga0307405_10006962
1300 Ga0307413_10263992
1301 Ga0307518_10047827
1302 Ga0307410_10916573
1303 Ga0307406_10114919
1304 Ga0307406_10712935
1305 Ga0307407_10907830
1306 Ga0307412_10024007
1307 Ga0307412_10277509
1308 Ga0307409_100000580
1309 Ga0307409_102811226
1310 Ga0307416_100014097
1311 Ga0307416_100236784
1312 Ga0307416_100291949
1313 Ga0307416_101955761
1314 Ga0307411_10351244
1315 Ga0307411_10521007
1316 Ga0307411_10738275
1317 Ga0307415_100002051
1318 Ga0307507_10038483
1319 Ga0307507_10050992
1320 Ga0307507_10161529
1321 Ga0307510_10003212
1322 Ga0307510_10059995
1323 Ga0307510_10131040
1324 Ga0307510_10135291
1325 Ga0373944_0194926
1326 Ga0373932_0019983
1327 Ga0373955_0309537
1328 Ga0373961_0378091
1329 Ga0373924_0172895
1330 Ga0373931_0001378
1331 Ga0373927_0064689
1332 Ga0373937_0321803
1333 Ga0373937_1086171
1334 Ga0373925_0132974
1335 Ga0373925_0552801
1336 Ga0395905_0023956
1337 Ga0395905_0601971
1338 Ga0436365_1640203
1339 Ga0436361_1177655
1340 Ga0436363_1475448
1341 Ga0451787_580127
1342 Ga0451789_0198671
1343 Ga0451793_0018596
1344 Ga0451793_1009547
1345 Ga0451797_0220704
1346 Ga0451800_1641012
1347 Ga0451802_2074907
1348 Ga0451807_1825296
1349 Ga0451833_1469414
1350 Ga0451845_0977099
1351 Ga0451843_0870225
1352 Ga0451853_0327863
1353 Ga0451853_0350852
1354 Ga0451853_3674141
1355 Ga0439449_0343875
1356 Ga0439456_144950
1357 Ga0450896_022249
1358 Ga0439459_0014586
1359 Ga0439460_0175468
1360 Ga0450893_0034880
1361 Ga0451577_0004221
1362 Ga0451577_0004741
1363 Ga0451577_0020267
1364 Ga0451577_0057615
1365 Ga0451577_0186853
1366 Ga0451577_0401658
1367 Ga0451577_0733135
1368 Ga0453683_0092672
1369 Ga0453683_0134334
1370 Ga0453684_0005216
1371 Ga0453684_0244278
1372 Ga0453684_0251708
1373 Ga0453684_0384845
1374 Ga0451576_0017940
1375 Ga0451576_0062948
1376 Ga0451576_2164302
1377 Ga0495592_0000083
1378 Ga0495629_0311784
1379 Ga0495629_0365673
1380 Ga0495638_0111579
1381 Ga0495650_0145821
1382 Ga0495580_0018628
1383 Ga0495639_0142511
1384 Ga0495606_0461145
1385 Ga0495618_0656644
1386 Ga0495631_0051252
1387 Ga0495632_0168428
1388 Ga0495632_0283575
1389 Ga0495648_0139642
1390 Ga0495648_0271303
1391 Ga0495648_0283877
1392 Ga0495598_0072198
1393 Ga0495621_0024915
1394 Ga0495645_0538572
1395 Ga0495668_0087108
1396 Ga0495625_0009747
1397 Ga0495625_0108748
1398 Ga0495646_0064363
1399 Ga0495658_0178716
1400 Ga0495658_0347228
1401 Ga0495613_0386887
1402 Ga0495624_0016323
1403 Ga0495670_0045101
1404 Ga0495671_0028003
1405 Ga0495671_0118049
1406 Ga0495600_0706943
1407 Ga0495581_0455107
1408 Ga0495604_0254180
1409 Ga0495674_1236223
1410 Ga0495676_0392362
1411 Ga0495673_0152346
1412 Ga0495686_0030754
1413 Ga0495686_0215174
1414 Ga0495593_0059628
1415 Ga0495602_0316539
1416 Ga0495614_0056011
1417 Ga0495614_0098532
1418 Ga0496100_0091111
1419 Ga0496100_0112887
1420 Ga0496101_0008293
1421 Ga0496101_0303590
1422 Ga0496102_0018445
1423 Ga0496102_0272326
1424 Ga0496102_0503763
1425 Ga0496104_0032470
1426 Ga0496104_0055646
1427 Ga0496104_0753854
1428 Ga0496104_1245281
1429 Ga0496105_0073192
1430 Ga0496105_0167701
1431 Ga0496106_0008934
1432 Ga0496106_0294814
1433 Ga0496107_0256318
1434 Ga0496108_0011606
1435 Ga0496108_0023125
1436 Ga0496108_1030897
1437 Ga0496109_0082364
1438 Ga0496109_0082794
1439 Ga0496110_0118474
1440 Ga0496111_0275498
1441 Ga0496112_0193243
1442 Ga0496113_0067776
1443 Ga0496113_0068982
1444 Ga0496114_0126437
1445 Ga0496114_0559505
1446 Ga0496122_0207922
1447 Ga0496125_0423925
1448 Ga0501198_037180
1449 Ga0501206_007243
1450 Ga0501209_276053
1451 Ga0501252_000122
1452 Ga0501264_024709
1453 Ga0501226_010804
1454 nmdc:mga03683_199333_c1
1455 nmdc:mga0k408_119019_c1
1456 nmdc:mga0k408_16652_c1
1457 nmdc:mga0k408_267305_c1
1458 nmdc:mga0k408_33581_c1
1459 nmdc:mga0k408_590424_c1
1460 nmdc:mga07m45_103137_c1
1461 nmdc:mga07m45_147621_c1
1462 nmdc:mga07m45_48382_c1
1463 nmdc:mga07m45_517306_c1
1464 nmdc:mga07m45_71714_c1
1465 nmdc:mga05p37_2022283_c1
1466 nmdc:mga08y16_114587_c1
1467 nmdc:mga0n895_44649_c1
1468 nmdc:mga0rr50_182035_c1
1469 Ga0500635_0204951
1470 Ga0495619_0908110
1471 Ga0500578_0000363
1472 Ga0500578_0068943
1473 Ga0500644_0010849
1474 Ga0500581_301149
1475 Ga0500647_0386792
1476 Ga0500651_0045174
1477 Ga0500651_0319672
1478 Ga0500648_120659
1479 Ga0500650_0199384
1480 Ga0500562_033273
1481 Ga0500593_000526
1482 Ga0500594_0004214
1483 Ga0500594_0318097
1484 Ga0500597_335690
1485 Ga0500655_018956
1486 Ga0500559_0000019
1487 Ga0500564_199644
1488 Ga0500568_0064970
1489 Ga0500568_0185956
1490 Ga0500604_0018787
1491 Ga0500604_0028615
1492 Ga0500616_0264849
1493 Ga0500619_000171
1494 Ga0500619_048118
1495 Ga0500622_0003170
1496 Ga0500622_0206699
1497 Ga0500633_0246116
1498 Ga0500636_0250282
1499 Ga0500645_001960
1500 Ga0500599_054603
1501 Ga0500587_006746
1502 Ga0590077_062339
1503 2587724929
1504 2588292431
1505 2643968189
1506 2644142455
1507 2644277046
1508 2886850375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

11

102

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cpq-assembly1.cif.gz_A cytochrome c' from rhodopseudomonas capsulata 0.9796 35 77
4ulv-assembly1.cif.gz_B cytochrome c prime from shewanella frigidimarina 0.968 35 76
3vrc-assembly1.cif.gz_B crystal structure of cytochrome c' from thermochromatium tepidum 0.9664 37 76
2a7w-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7 0.9663 5 93
1bbh-assembly1.cif.gz_A atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution 0.9552 37 77
ID Description Score Start End Superfamily
af_K7MSJ4_110_274_3.90.1600.10 Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain 0.9764 37 78 3.90.1600.10
2a7wA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9595 5 93 1.10.287.1080
af_Q54P12_52_173_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.9558 37 74 1.20.120.230
1bbhA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9552 37 77 1.20.120.10
1z0jB00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9503 35 79 4.10.860.20
ID Description Score Start End GO Terms
AF-A0A536V468-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9941 1 95 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A536WTV4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.985 6 102 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A126R805-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9827 2 102 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A7Y5DLF5-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9814 5 102 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A2D6H5Q3-F1-model_v4 deleted 0.9804 5 103

Map