F479264
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 754 | 337 | 1508 | 356 |
Family's Representative Sequence
| Representative Sequence | 3300042124|Ga0450922_001319|Ga0450922_001319_518_1585 |
| Length | 345 |
| Sequence | MSKYRAGVLFGEELEALLKDAKDNQFALPAVNTIGTNTINATLETAAKVNSPVIVQFSNGGAQFIAGKGMPNDKLQANISGAISGALHIHNVAKYYGVPVVLHTDHAAKKWLPWISGLIDAGVEFNKEKGQPLFSSHMLDLSEEPLEENIQTSVEFFKRMAPLGMGIEIELGVTGGEEDGVDNSDLYTQPAHVELSKVGKLFTVAAAFGNVHGVYKSGNVQLTPIILHNSQVHIEKKLGTGPKPVYFVFHGGSGSPQHQIREAISYGAIKMNLDTDLQWAFWEGVLNNYKKSESYLQGQLGNPEGPDSPNKKYYDPRVWLRKGEESFIKRLEVAFEDLNCVNRNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 164 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 176 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 177 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 178 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 186 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 187 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 202 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 205 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 206 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 207 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 208 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 209 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 210 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 211 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 212 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 213 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 217 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 265 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 267 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 270 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 271 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 273 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 288 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 289 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 290 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 291 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 295 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 296 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 297 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 299 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 301 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 302 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 303 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 305 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 306 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 307 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 308 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 309 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 310 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 311 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 312 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 313 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 314 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 315 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 316 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 317 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 318 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 319 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 320 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 321 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 322 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 323 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 324 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 325 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 326 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 327 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 328 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 329 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 330 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 331 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 332 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 333 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 334 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 335 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
| 336 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 337 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.56 |
| Metatranscriptomes | 1.06 |
| Isolates | 4.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.11 |
| Nodule | 0 |
| Rhizoplane | 0.4 |
| Rhizosphere | 89.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450922_001319 | 3300042124 | Bacteria | 2451 |
| 2 | JGI24743J22301_10000005 | 3300001991 | Bacteria | 22941 |
| 3 | JGI24033J26618_1000119 | 3300002155 | Bacteria | 10596 |
| 4 | JGI24751J29686_10008130 | 3300002459 | Bacteria | 2145 |
| 5 | rootH2_10000149 | 3300003320 | Bacteria | 14845 |
| 6 | rootH2_10009508 | 3300003320 | Bacteria | 78035 |
| 7 | rootH2_10030789 | 3300003320 | Bacteria | 26106 |
| 8 | rootH2_10033273 | 3300003320 | Bacteria | 7449 |
| 9 | rootH2_10162427 | 3300003320 | Bacteria | 1472 |
| 10 | rootL2_10090605 | 3300003322 | Bacteria | 5299 |
| 11 | rootH1_10064317 | 3300003323 | Bacteria | 25294 |
| 12 | JGI25160J50197_1002187 | 3300003354 | Bacteria | 9203 |
| 13 | Ga0055530_10000315 | 3300003791 | Bacteria | 43745 |
| 14 | Ga0065165_1000060 | 3300005262 | Bacteria | 180226 |
| 15 | Ga0065704_10096676 | 3300005289 | Bacteria | 2366 |
| 16 | Ga0065704_10115828 | 3300005289 | Bacteria | 1852 |
| 17 | Ga0065712_10014468 | 3300005290 | Bacteria | 4898 |
| 18 | Ga0065712_10081375 | 3300005290 | Bacteria | 3012 |
| 19 | Ga0070658_10000095 | 3300005327 | Bacteria | 77839 |
| 20 | Ga0070658_10008866 | 3300005327 | Bacteria | 8084 |
| 21 | Ga0070658_10231933 | 3300005327 | Bacteria | 1563 |
| 22 | Ga0070658_10267109 | 3300005327 | Bacteria | 1454 |
| 23 | Ga0070676_10000252 | 3300005328 | Bacteria | 23270 |
| 24 | Ga0070676_10009134 | 3300005328 | Bacteria | 5363 |
| 25 | Ga0070683_100003259 | 3300005329 | Bacteria | 13114 |
| 26 | Ga0070683_100025140 | 3300005329 | Bacteria | 5344 |
| 27 | Ga0070690_100140451 | 3300005330 | Bacteria | 1639 |
| 28 | Ga0070690_100226063 | 3300005330 | Bacteria | 1313 |
| 29 | Ga0070670_100007971 | 3300005331 | Bacteria | 9008 |
| 30 | Ga0070670_100014145 | 3300005331 | Bacteria | 6844 |
| 31 | Ga0070670_100036514 | 3300005331 | Bacteria | 4229 |
| 32 | Ga0070670_100078424 | 3300005331 | Bacteria | 2837 |
| 33 | Ga0070670_100156232 | 3300005331 | Bacteria | 1975 |
| 34 | Ga0070670_100194295 | 3300005331 | Unclassified | 1763 |
| 35 | Ga0068869_100008995 | 3300005334 | Bacteria | 6469 |
| 36 | Ga0068869_100013406 | 3300005334 | Bacteria | 5452 |
| 37 | Ga0068869_100018447 | 3300005334 | Bacteria | 4750 |
| 38 | Ga0068869_100048072 | 3300005334 | Bacteria | 3083 |
| 39 | Ga0070666_10000616 | 3300005335 | Bacteria | 21365 |
| 40 | Ga0070666_10009653 | 3300005335 | Bacteria | 6025 |
| 41 | Ga0070666_10130184 | 3300005335 | Bacteria | 1748 |
| 42 | Ga0070682_100010522 | 3300005337 | Bacteria | 5250 |
| 43 | Ga0070682_100031550 | 3300005337 | Bacteria | 3205 |
| 44 | Ga0068868_100000091 | 3300005338 | Bacteria | 55405 |
| 45 | Ga0068868_100051846 | 3300005338 | Bacteria | 3229 |
| 46 | Ga0070689_100027356 | 3300005340 | Bacteria | 4299 |
| 47 | Ga0070689_100114899 | 3300005340 | Bacteria | 2145 |
| 48 | Ga0070691_10016494 | 3300005341 | Bacteria | 3393 |
| 49 | Ga0070661_100001232 | 3300005344 | Bacteria | 18015 |
| 50 | Ga0070668_100000043 | 3300005347 | Bacteria | 78564 |
| 51 | Ga0070668_100044375 | 3300005347 | Bacteria | 3411 |
| 52 | Ga0070668_100336312 | 3300005347 | Bacteria | 1275 |
| 53 | Ga0070669_100040844 | 3300005353 | Bacteria | 3372 |
| 54 | Ga0070675_100040358 | 3300005354 | Bacteria | 3809 |
| 55 | Ga0070675_100048827 | 3300005354 | Bacteria | 3471 |
| 56 | Ga0070675_100160301 | 3300005354 | Bacteria | 1934 |
| 57 | Ga0070671_100027742 | 3300005355 | Bacteria | 4662 |
| 58 | Ga0070671_100055549 | 3300005355 | Bacteria | 3294 |
| 59 | Ga0070671_100107623 | 3300005355 | Bacteria | 2341 |
| 60 | Ga0070674_100026685 | 3300005356 | Bacteria | 3776 |
| 61 | Ga0070674_100032734 | 3300005356 | Bacteria | 3454 |
| 62 | Ga0070673_100000283 | 3300005364 | Bacteria | 26297 |
| 63 | Ga0070673_100012211 | 3300005364 | Bacteria | 5890 |
| 64 | Ga0070673_100031990 | 3300005364 | Bacteria | 3955 |
| 65 | Ga0070688_100012566 | 3300005365 | Bacteria | 4746 |
| 66 | Ga0070659_100041296 | 3300005366 | Bacteria | 3605 |
| 67 | Ga0070659_100090583 | 3300005366 | Bacteria | 2451 |
| 68 | Ga0070667_100000254 | 3300005367 | Bacteria | 60664 |
| 69 | Ga0070667_100001284 | 3300005367 | Bacteria | 22707 |
| 70 | Ga0070667_100016664 | 3300005367 | Bacteria | 6082 |
| 71 | Ga0070667_100199438 | 3300005367 | Bacteria | 1775 |
| 72 | Ga0070667_100323849 | 3300005367 | Bacteria | 1391 |
| 73 | Ga0070663_100165609 | 3300005455 | Bacteria | 1705 |
| 74 | Ga0070678_100042090 | 3300005456 | Bacteria | 3244 |
| 75 | Ga0070662_100002778 | 3300005457 | Bacteria | 10836 |
| 76 | Ga0070662_100006706 | 3300005457 | Bacteria | 7438 |
| 77 | Ga0070681_10025679 | 3300005458 | Bacteria | 5925 |
| 78 | Ga0070681_10081003 | 3300005458 | Bacteria | 3202 |
| 79 | Ga0070681_10147131 | 3300005458 | Bacteria | 2284 |
| 80 | Ga0068867_100005482 | 3300005459 | Bacteria | 8980 |
| 81 | Ga0068867_100016258 | 3300005459 | Bacteria | 5284 |
| 82 | Ga0068867_100157290 | 3300005459 | Bacteria | 1790 |
| 83 | Ga0068867_100225940 | 3300005459 | Bacteria | 1511 |
| 84 | Ga0070685_10028768 | 3300005466 | Bacteria | 3082 |
| 85 | Ga0070706_100200107 | 3300005467 | Bacteria | 1866 |
| 86 | Ga0070698_100001232 | 3300005471 | Bacteria | 28474 |
| 87 | Ga0070698_100132976 | 3300005471 | Bacteria | 2442 |
| 88 | Ga0070679_100031738 | 3300005530 | Bacteria | 5222 |
| 89 | Ga0070679_100156060 | 3300005530 | Bacteria | 2257 |
| 90 | Ga0070684_100007323 | 3300005535 | Bacteria | 8578 |
| 91 | Ga0070684_100271675 | 3300005535 | Bacteria | 1552 |
| 92 | Ga0068853_100000675 | 3300005539 | Bacteria | 23525 |
| 93 | Ga0068853_100004921 | 3300005539 | Bacteria | 10399 |
| 94 | Ga0068853_100022678 | 3300005539 | Bacteria | 5247 |
| 95 | Ga0068853_100037199 | 3300005539 | Bacteria | 4141 |
| 96 | Ga0068853_100324852 | 3300005539 | Bacteria | 1427 |
| 97 | Ga0070672_100000160 | 3300005543 | Bacteria | 37362 |
| 98 | Ga0070672_100114886 | 3300005543 | Bacteria | 2198 |
| 99 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 100 | Ga0070665_100000350 | 3300005548 | Bacteria | 69455 |
| 101 | Ga0070665_100012508 | 3300005548 | Bacteria | 8551 |
| 102 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 103 | Ga0068855_100002600 | 3300005563 | Bacteria | 22255 |
| 104 | Ga0068855_100023787 | 3300005563 | Bacteria | 7339 |
| 105 | Ga0068855_100046257 | 3300005563 | Bacteria | 5145 |
| 106 | Ga0068855_100066665 | 3300005563 | Bacteria | 4197 |
| 107 | Ga0068855_100079334 | 3300005563 | Bacteria | 3807 |
| 108 | Ga0068855_100158975 | 3300005563 | Bacteria | 2566 |
| 109 | Ga0070664_100002175 | 3300005564 | Bacteria | 15745 |
| 110 | Ga0070664_100046003 | 3300005564 | Bacteria | 3686 |
| 111 | Ga0068854_100026248 | 3300005578 | Bacteria | 4002 |
| 112 | Ga0068856_100000313 | 3300005614 | Bacteria | 53232 |
| 113 | Ga0068856_100009691 | 3300005614 | Bacteria | 9355 |
| 114 | Ga0068856_100042851 | 3300005614 | Bacteria | 4453 |
| 115 | Ga0068856_100049149 | 3300005614 | Bacteria | 4157 |
| 116 | Ga0068856_100478334 | 3300005614 | Bacteria | 1266 |
| 117 | Ga0070702_100080937 | 3300005615 | Bacteria | 1945 |
| 118 | Ga0068852_100000655 | 3300005616 | Bacteria | 22706 |
| 119 | Ga0068852_100015276 | 3300005616 | Bacteria | 5946 |
| 120 | Ga0068852_100019201 | 3300005616 | Bacteria | 5402 |
| 121 | Ga0068859_100000100 | 3300005617 | Bacteria | 79844 |
| 122 | Ga0068859_100010659 | 3300005617 | Bacteria | 9252 |
| 123 | Ga0068859_100014583 | 3300005617 | Bacteria | 7894 |
| 124 | Ga0068859_100332443 | 3300005617 | Bacteria | 1614 |
| 125 | Ga0068864_100001658 | 3300005618 | Bacteria | 18334 |
| 126 | Ga0068864_100013342 | 3300005618 | Bacteria | 6807 |
| 127 | Ga0068864_100138887 | 3300005618 | Bacteria | 2190 |
| 128 | Ga0068864_100359796 | 3300005618 | Bacteria | 1375 |
| 129 | Ga0068864_100362130 | 3300005618 | Bacteria | 1371 |
| 130 | Ga0068866_10143259 | 3300005718 | Bacteria | 1375 |
| 131 | Ga0068861_100003609 | 3300005719 | Bacteria | 10306 |
| 132 | Ga0068861_100006042 | 3300005719 | Bacteria | 8234 |
| 133 | Ga0068861_100013501 | 3300005719 | Bacteria | 5717 |
| 134 | Ga0068861_100061933 | 3300005719 | Bacteria | 2872 |
| 135 | Ga0068851_10004456 | 3300005834 | Bacteria | 6317 |
| 136 | Ga0068851_10058388 | 3300005834 | Bacteria | 1972 |
| 137 | Ga0068863_100018881 | 3300005841 | Bacteria | 6598 |
| 138 | Ga0068863_100022470 | 3300005841 | Bacteria | 6024 |
| 139 | Ga0068863_100038477 | 3300005841 | Bacteria | 4551 |
| 140 | Ga0068863_100039594 | 3300005841 | Bacteria | 4484 |
| 141 | Ga0068863_100079599 | 3300005841 | Bacteria | 3103 |
| 142 | Ga0068863_100310984 | 3300005841 | Bacteria | 1529 |
| 143 | Ga0068858_100000199 | 3300005842 | Bacteria | 64607 |
| 144 | Ga0068858_100001301 | 3300005842 | Bacteria | 25780 |
| 145 | Ga0068858_100225034 | 3300005842 | Bacteria | 1778 |
| 146 | Ga0068858_100340636 | 3300005842 | Bacteria | 1435 |
| 147 | Ga0068860_100000111 | 3300005843 | Bacteria | 131004 |
| 148 | Ga0068860_100000846 | 3300005843 | Bacteria | 34263 |
| 149 | Ga0068860_100001512 | 3300005843 | Bacteria | 25045 |
| 150 | Ga0068860_100003412 | 3300005843 | Bacteria | 16333 |
| 151 | Ga0068860_100005552 | 3300005843 | Bacteria | 12767 |
| 152 | Ga0068860_100042932 | 3300005843 | Bacteria | 4315 |
| 153 | Ga0068860_100139432 | 3300005843 | Bacteria | 2330 |
| 154 | Ga0068862_100058563 | 3300005844 | Bacteria | 3304 |
| 155 | Ga0075366_10018779 | 3300006195 | Bacteria | 3995 |
| 156 | Ga0075366_10116478 | 3300006195 | Bacteria | 1609 |
| 157 | Ga0097621_100002436 | 3300006237 | Bacteria | 12739 |
| 158 | Ga0097621_100002531 | 3300006237 | Bacteria | 12524 |
| 159 | Ga0097621_100003700 | 3300006237 | Bacteria | 10581 |
| 160 | Ga0097621_100020533 | 3300006237 | Bacteria | 5090 |
| 161 | Ga0097621_100051241 | 3300006237 | Bacteria | 3359 |
| 162 | Ga0068871_100004030 | 3300006358 | Bacteria | 10146 |
| 163 | Ga0068871_100010137 | 3300006358 | Bacteria | 6858 |
| 164 | Ga0068871_100027019 | 3300006358 | Bacteria | 4484 |
| 165 | Ga0068871_100031740 | 3300006358 | Bacteria | 4168 |
| 166 | Ga0068871_100039362 | 3300006358 | Bacteria | 3783 |
| 167 | Ga0068871_100044639 | 3300006358 | Bacteria | 3565 |
| 168 | Ga0068871_100062039 | 3300006358 | Bacteria | 3054 |
| 169 | Ga0068871_100198721 | 3300006358 | Bacteria | 1730 |
| 170 | Ga0075428_100013181 | 3300006844 | Bacteria | 9196 |
| 171 | Ga0075428_100015528 | 3300006844 | Bacteria | 8442 |
| 172 | Ga0075428_100041517 | 3300006844 | Bacteria | 5059 |
| 173 | Ga0075428_100251468 | 3300006844 | Bacteria | 1905 |
| 174 | Ga0075430_100051698 | 3300006846 | Bacteria | 3462 |
| 175 | Ga0075431_100140517 | 3300006847 | Bacteria | 2489 |
| 176 | Ga0075429_100003290 | 3300006880 | Bacteria | 13752 |
| 177 | Ga0075429_100222922 | 3300006880 | Bacteria | 1651 |
| 178 | Ga0068865_100005344 | 3300006881 | Bacteria | 7779 |
| 179 | Ga0068865_100007446 | 3300006881 | Bacteria | 6735 |
| 180 | Ga0097620_100000100 | 3300006931 | Bacteria | 79844 |
| 181 | Ga0097620_100010659 | 3300006931 | Bacteria | 9252 |
| 182 | Ga0097620_100014582 | 3300006931 | Bacteria | 7894 |
| 183 | Ga0097620_100332454 | 3300006931 | Bacteria | 1614 |
| 184 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 185 | Ga0105240_10000513 | 3300009093 | Bacteria | 71427 |
| 186 | Ga0105240_10007118 | 3300009093 | Bacteria | 16295 |
| 187 | Ga0105240_10008360 | 3300009093 | Bacteria | 14812 |
| 188 | Ga0105240_10041056 | 3300009093 | Bacteria | 5910 |
| 189 | Ga0105240_10111783 | 3300009093 | Bacteria | 3304 |
| 190 | Ga0105240_10375346 | 3300009093 | Bacteria | 1607 |
| 191 | Ga0111539_10028901 | 3300009094 | Bacteria | 6760 |
| 192 | Ga0111539_10218562 | 3300009094 | Unclassified | 2220 |
| 193 | Ga0111539_10330721 | 3300009094 | Bacteria | 1774 |
| 194 | Ga0111539_10447995 | 3300009094 | Bacteria | 1503 |
| 195 | Ga0105245_10025045 | 3300009098 | Bacteria | 5245 |
| 196 | Ga0105247_10002103 | 3300009101 | Bacteria | 13758 |
| 197 | Ga0105247_10005256 | 3300009101 | Bacteria | 8167 |
| 198 | Ga0114129_10004929 | 3300009147 | Bacteria | 18833 |
| 199 | Ga0105243_10177594 | 3300009148 | Bacteria | 1849 |
| 200 | Ga0105243_10213245 | 3300009148 | Bacteria | 1702 |
| 201 | Ga0105241_10011399 | 3300009174 | Bacteria | 6517 |
| 202 | Ga0105241_10023976 | 3300009174 | Bacteria | 4529 |
| 203 | Ga0105242_10035646 | 3300009176 | Bacteria | 3989 |
| 204 | Ga0105242_10041681 | 3300009176 | Bacteria | 3704 |
| 205 | Ga0105242_10101424 | 3300009176 | Bacteria | 2439 |
| 206 | Ga0105242_10119202 | 3300009176 | Bacteria | 2262 |
| 207 | Ga0105242_10147822 | 3300009176 | Bacteria | 2046 |
| 208 | Ga0105248_10031375 | 3300009177 | Bacteria | 5940 |
| 209 | Ga0105248_10190771 | 3300009177 | Bacteria | 2309 |
| 210 | Ga0105237_10000528 | 3300009545 | Bacteria | 53756 |
| 211 | Ga0105237_10002821 | 3300009545 | Bacteria | 21127 |
| 212 | Ga0105237_10005077 | 3300009545 | Bacteria | 14955 |
| 213 | Ga0105237_10007087 | 3300009545 | Bacteria | 12326 |
| 214 | Ga0105237_10026166 | 3300009545 | Bacteria | 5963 |
| 215 | Ga0105237_10088422 | 3300009545 | Bacteria | 3088 |
| 216 | Ga0105237_10488158 | 3300009545 | Bacteria | 1238 |
| 217 | Ga0105238_10001119 | 3300009551 | Bacteria | 27090 |
| 218 | Ga0105238_10107514 | 3300009551 | Bacteria | 2770 |
| 219 | Ga0105238_10254852 | 3300009551 | Bacteria | 1734 |
| 220 | Ga0105249_10000420 | 3300009553 | Bacteria | 40445 |
| 221 | Ga0105249_10004140 | 3300009553 | Bacteria | 12524 |
| 222 | Ga0105249_10012201 | 3300009553 | Bacteria | 7569 |
| 223 | Ga0105249_10020079 | 3300009553 | Bacteria | 5968 |
| 224 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 225 | Ga0105239_10000314 | 3300010375 | Bacteria | 71313 |
| 226 | Ga0105239_10000853 | 3300010375 | Bacteria | 43358 |
| 227 | Ga0105239_10002727 | 3300010375 | Bacteria | 22170 |
| 228 | Ga0105239_10026069 | 3300010375 | Bacteria | 6436 |
| 229 | Ga0105239_10033395 | 3300010375 | Bacteria | 5651 |
| 230 | Ga0105239_10039449 | 3300010375 | Bacteria | 5173 |
| 231 | Ga0105239_10237363 | 3300010375 | Bacteria | 2046 |
| 232 | Ga0105239_10387523 | 3300010375 | Bacteria | 1580 |
| 233 | Ga0105239_10532817 | 3300010375 | Bacteria | 1337 |
| 234 | Ga0105246_10037365 | 3300011119 | Bacteria | 3259 |
| 235 | Ga0157373_10034570 | 3300013100 | Bacteria | 3630 |
| 236 | Ga0157373_10036183 | 3300013100 | Bacteria | 3544 |
| 237 | Ga0157371_10019068 | 3300013102 | Bacteria | 5064 |
| 238 | Ga0157371_10063215 | 3300013102 | Bacteria | 2624 |
| 239 | Ga0157371_10087974 | 3300013102 | Bacteria | 2199 |
| 240 | Ga0157371_10201521 | 3300013102 | Bacteria | 1427 |
| 241 | Ga0157370_10007951 | 3300013104 | Bacteria | 11487 |
| 242 | Ga0157370_10018014 | 3300013104 | Bacteria | 7108 |
| 243 | Ga0157370_10075884 | 3300013104 | Unclassified | 3168 |
| 244 | Ga0157370_10195942 | 3300013104 | Bacteria | 1875 |
| 245 | Ga0157370_10233657 | 3300013104 | Bacteria | 1701 |
| 246 | Ga0157369_10010273 | 3300013105 | Bacteria | 10679 |
| 247 | Ga0157369_10067695 | 3300013105 | Bacteria | 3838 |
| 248 | Ga0157369_10223780 | 3300013105 | Unclassified | 1969 |
| 249 | Ga0157374_10000026 | 3300013296 | Bacteria | 238236 |
| 250 | Ga0157374_10000084 | 3300013296 | Bacteria | 94138 |
| 251 | Ga0157374_10005000 | 3300013296 | Bacteria | 11124 |
| 252 | Ga0157374_10012628 | 3300013296 | Bacteria | 7354 |
| 253 | Ga0157374_10076666 | 3300013296 | Bacteria | 3161 |
| 254 | Ga0157374_10265730 | 3300013296 | Bacteria | 1691 |
| 255 | Ga0157374_10325660 | 3300013296 | Bacteria | 1523 |
| 256 | Ga0157378_10001185 | 3300013297 | Bacteria | 23694 |
| 257 | Ga0157378_10001872 | 3300013297 | Bacteria | 18898 |
| 258 | Ga0157378_10027692 | 3300013297 | Bacteria | 4998 |
| 259 | Ga0157378_10032561 | 3300013297 | Bacteria | 4606 |
| 260 | Ga0157378_10098402 | 3300013297 | Bacteria | 2667 |
| 261 | Ga0163162_10000101 | 3300013306 | Bacteria | 77114 |
| 262 | Ga0163162_10000113 | 3300013306 | Bacteria | 71491 |
| 263 | Ga0163162_10003148 | 3300013306 | Bacteria | 15759 |
| 264 | Ga0163162_10005141 | 3300013306 | Bacteria | 12609 |
| 265 | Ga0163162_10011934 | 3300013306 | Bacteria | 8472 |
| 266 | Ga0163162_10024246 | 3300013306 | Bacteria | 5987 |
| 267 | Ga0163162_10071459 | 3300013306 | Bacteria | 3523 |
| 268 | Ga0163162_10097769 | 3300013306 | Bacteria | 3024 |
| 269 | Ga0157372_10001128 | 3300013307 | Bacteria | 28999 |
| 270 | Ga0157372_10005133 | 3300013307 | Bacteria | 13917 |
| 271 | Ga0157372_10005538 | 3300013307 | Bacteria | 13428 |
| 272 | Ga0157372_10030568 | 3300013307 | Bacteria | 5892 |
| 273 | Ga0157372_10049581 | 3300013307 | Bacteria | 4669 |
| 274 | Ga0157372_10069083 | 3300013307 | Bacteria | 3973 |
| 275 | Ga0157372_10073750 | 3300013307 | Bacteria | 3847 |
| 276 | Ga0157372_10152955 | 3300013307 | Bacteria | 2663 |
| 277 | Ga0157372_10434416 | 3300013307 | Bacteria | 1530 |
| 278 | Ga0157372_10479499 | 3300013307 | Bacteria | 1450 |
| 279 | Ga0157375_10000565 | 3300013308 | Bacteria | 33320 |
| 280 | Ga0157375_10009092 | 3300013308 | Bacteria | 8702 |
| 281 | Ga0157375_10067247 | 3300013308 | Bacteria | 3580 |
| 282 | Ga0157375_10069207 | 3300013308 | Bacteria | 3535 |
| 283 | Ga0157375_10070596 | 3300013308 | Bacteria | 3503 |
| 284 | Ga0157375_10122613 | 3300013308 | Bacteria | 2711 |
| 285 | Ga0157375_10162918 | 3300013308 | Bacteria | 2373 |
| 286 | Ga0163163_10000306 | 3300014325 | Bacteria | 48215 |
| 287 | Ga0163163_10025324 | 3300014325 | Bacteria | 5657 |
| 288 | Ga0163163_10361098 | 3300014325 | Bacteria | 1509 |
| 289 | Ga0157380_10034657 | 3300014326 | Bacteria | 3894 |
| 290 | Ga0157380_10042141 | 3300014326 | Bacteria | 3567 |
| 291 | Ga0157380_10118025 | 3300014326 | Bacteria | 2242 |
| 292 | Ga0157377_10085237 | 3300014745 | Bacteria | 1854 |
| 293 | Ga0157379_10000245 | 3300014968 | Bacteria | 42570 |
| 294 | Ga0157379_10016583 | 3300014968 | Bacteria | 6479 |
| 295 | Ga0157376_10002364 | 3300014969 | Bacteria | 12733 |
| 296 | Ga0157376_10003646 | 3300014969 | Bacteria | 10632 |
| 297 | Ga0157376_10003682 | 3300014969 | Bacteria | 10581 |
| 298 | Ga0157376_10004318 | 3300014969 | Bacteria | 9876 |
| 299 | Ga0157376_10023777 | 3300014969 | Bacteria | 4802 |
| 300 | Ga0157376_10089937 | 3300014969 | Bacteria | 2655 |
| 301 | Ga0157376_10156558 | 3300014969 | Bacteria | 2061 |
| 302 | Ga0157376_10190896 | 3300014969 | Bacteria | 1878 |
| 303 | Ga0157376_10418779 | 3300014969 | Bacteria | 1299 |
| 304 | Ga0163161_10037411 | 3300017792 | Bacteria | 3479 |
| 305 | Ga0163161_10095390 | 3300017792 | Bacteria | 2206 |
| 306 | Ga0163161_10126070 | 3300017792 | Bacteria | 1928 |
| 307 | Ga0209646_1001404 | 3300025246 | Bacteria | 6542 |
| 308 | Ga0209676_1000351 | 3300025292 | Bacteria | 87135 |
| 309 | Ga0207426_1000009 | 3300025302 | Bacteria | 797229 |
| 310 | Ga0209257_1000089 | 3300025304 | Bacteria | 277925 |
| 311 | Ga0207697_10047494 | 3300025315 | Bacteria | 1770 |
| 312 | Ga0207656_10002387 | 3300025321 | Bacteria | 6317 |
| 313 | Ga0207710_10011655 | 3300025900 | Bacteria | 3699 |
| 314 | Ga0207710_10017547 | 3300025900 | Bacteria | 3036 |
| 315 | Ga0207688_10029845 | 3300025901 | Bacteria | 3005 |
| 316 | Ga0207680_10003112 | 3300025903 | Bacteria | 7794 |
| 317 | Ga0207680_10013728 | 3300025903 | Bacteria | 4169 |
| 318 | Ga0207647_10004545 | 3300025904 | Bacteria | 10283 |
| 319 | Ga0207647_10026889 | 3300025904 | Bacteria | 3758 |
| 320 | Ga0207645_10000378 | 3300025907 | Bacteria | 36697 |
| 321 | Ga0207645_10001750 | 3300025907 | Bacteria | 17617 |
| 322 | Ga0207643_10052782 | 3300025908 | Bacteria | 2309 |
| 323 | Ga0207705_10014193 | 3300025909 | Bacteria | 5738 |
| 324 | Ga0207705_10146201 | 3300025909 | Bacteria | 1769 |
| 325 | Ga0207705_10194595 | 3300025909 | Bacteria | 1535 |
| 326 | Ga0207654_10001221 | 3300025911 | Bacteria | 13725 |
| 327 | Ga0207654_10001953 | 3300025911 | Bacteria | 10692 |
| 328 | Ga0207654_10008832 | 3300025911 | Bacteria | 5112 |
| 329 | Ga0207707_10002099 | 3300025912 | Bacteria | 18023 |
| 330 | Ga0207707_10130640 | 3300025912 | Bacteria | 2197 |
| 331 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 332 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 333 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 334 | Ga0207695_10001425 | 3300025913 | Bacteria | 40250 |
| 335 | Ga0207695_10007632 | 3300025913 | Bacteria | 13711 |
| 336 | Ga0207695_10011249 | 3300025913 | Bacteria | 10851 |
| 337 | Ga0207695_10071661 | 3300025913 | Bacteria | 3539 |
| 338 | Ga0207671_10001584 | 3300025914 | Bacteria | 25863 |
| 339 | Ga0207671_10001605 | 3300025914 | Bacteria | 25707 |
| 340 | Ga0207671_10008236 | 3300025914 | Bacteria | 8874 |
| 341 | Ga0207671_10010848 | 3300025914 | Bacteria | 7475 |
| 342 | Ga0207671_10016277 | 3300025914 | Bacteria | 5784 |
| 343 | Ga0207671_10021869 | 3300025914 | Bacteria | 4845 |
| 344 | Ga0207671_10336752 | 3300025914 | Bacteria | 1195 |
| 345 | Ga0207660_10001416 | 3300025917 | Bacteria | 16098 |
| 346 | Ga0207660_10053726 | 3300025917 | Bacteria | 2872 |
| 347 | Ga0207662_10023264 | 3300025918 | Bacteria | 3558 |
| 348 | Ga0207657_10151871 | 3300025919 | Bacteria | 1886 |
| 349 | Ga0207657_10188794 | 3300025919 | Bacteria | 1664 |
| 350 | Ga0207649_10000935 | 3300025920 | Bacteria | 18362 |
| 351 | Ga0207652_10000986 | 3300025921 | Bacteria | 26359 |
| 352 | Ga0207652_10131105 | 3300025921 | Bacteria | 2236 |
| 353 | Ga0207681_10039294 | 3300025923 | Bacteria | 3141 |
| 354 | Ga0207694_10069297 | 3300025924 | Bacteria | 2755 |
| 355 | Ga0207694_10115743 | 3300025924 | Bacteria | 2136 |
| 356 | Ga0207650_10011294 | 3300025925 | Bacteria | 6145 |
| 357 | Ga0207650_10041445 | 3300025925 | Bacteria | 3374 |
| 358 | Ga0207650_10071800 | 3300025925 | Bacteria | 2605 |
| 359 | Ga0207650_10076405 | 3300025925 | Bacteria | 2530 |
| 360 | Ga0207650_10090530 | 3300025925 | Bacteria | 2337 |
| 361 | Ga0207659_10017041 | 3300025926 | Bacteria | 4740 |
| 362 | Ga0207659_10105532 | 3300025926 | Bacteria | 2132 |
| 363 | Ga0207659_10132703 | 3300025926 | Bacteria | 1925 |
| 364 | Ga0207659_10324805 | 3300025926 | Bacteria | 1270 |
| 365 | Ga0207687_10027927 | 3300025927 | Bacteria | 3788 |
| 366 | Ga0207644_10058787 | 3300025931 | Bacteria | 2780 |
| 367 | Ga0207644_10088847 | 3300025931 | Bacteria | 2299 |
| 368 | Ga0207690_10113536 | 3300025932 | Bacteria | 1955 |
| 369 | Ga0207706_10005553 | 3300025933 | Bacteria | 11758 |
| 370 | Ga0207706_10014031 | 3300025933 | Bacteria | 7266 |
| 371 | Ga0207686_10030128 | 3300025934 | Bacteria | 3209 |
| 372 | Ga0207686_10041764 | 3300025934 | Bacteria | 2799 |
| 373 | Ga0207686_10073887 | 3300025934 | Bacteria | 2201 |
| 374 | Ga0207686_10081034 | 3300025934 | Bacteria | 2117 |
| 375 | Ga0207670_10025122 | 3300025936 | Bacteria | 3735 |
| 376 | Ga0207669_10045391 | 3300025937 | Bacteria | 2589 |
| 377 | Ga0207669_10103394 | 3300025937 | Bacteria | 1889 |
| 378 | Ga0207704_10001110 | 3300025938 | Bacteria | 11965 |
| 379 | Ga0207704_10018773 | 3300025938 | Bacteria | 3617 |
| 380 | Ga0207691_10000227 | 3300025940 | Bacteria | 54652 |
| 381 | Ga0207691_10184848 | 3300025940 | Bacteria | 1820 |
| 382 | Ga0207691_10343081 | 3300025940 | Bacteria | 1278 |
| 383 | Ga0207689_10008011 | 3300025942 | Bacteria | 9224 |
| 384 | Ga0207689_10010699 | 3300025942 | Bacteria | 7893 |
| 385 | Ga0207689_10035224 | 3300025942 | Bacteria | 4159 |
| 386 | Ga0207689_10094949 | 3300025942 | Bacteria | 2449 |
| 387 | Ga0207689_10126332 | 3300025942 | Bacteria | 2104 |
| 388 | Ga0207679_10032303 | 3300025945 | Bacteria | 3672 |
| 389 | Ga0207679_10094266 | 3300025945 | Bacteria | 2324 |
| 390 | Ga0207667_10000135 | 3300025949 | Bacteria | 111565 |
| 391 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 392 | Ga0207667_10009580 | 3300025949 | Bacteria | 11399 |
| 393 | Ga0207667_10025965 | 3300025949 | Bacteria | 6407 |
| 394 | Ga0207667_10060186 | 3300025949 | Bacteria | 3975 |
| 395 | Ga0207667_10205788 | 3300025949 | Unclassified | 2018 |
| 396 | Ga0207651_10001142 | 3300025960 | Bacteria | 11852 |
| 397 | Ga0207651_10336240 | 3300025960 | Bacteria | 1267 |
| 398 | Ga0207712_10001272 | 3300025961 | Bacteria | 17359 |
| 399 | Ga0207712_10004770 | 3300025961 | Bacteria | 8561 |
| 400 | Ga0207712_10006837 | 3300025961 | Bacteria | 7197 |
| 401 | Ga0207712_10025027 | 3300025961 | Bacteria | 3962 |
| 402 | Ga0207712_10112040 | 3300025961 | Bacteria | 2048 |
| 403 | Ga0207712_10183222 | 3300025961 | Bacteria | 1647 |
| 404 | Ga0207668_10000821 | 3300025972 | Bacteria | 18944 |
| 405 | Ga0207668_10028723 | 3300025972 | Bacteria | 3640 |
| 406 | Ga0207668_10116285 | 3300025972 | Bacteria | 2016 |
| 407 | Ga0207640_10174974 | 3300025981 | Bacteria | 1603 |
| 408 | Ga0207658_10000176 | 3300025986 | Bacteria | 68501 |
| 409 | Ga0207658_10036237 | 3300025986 | Bacteria | 3536 |
| 410 | Ga0207658_10043302 | 3300025986 | Bacteria | 3272 |
| 411 | Ga0207658_10054994 | 3300025986 | Bacteria | 2947 |
| 412 | Ga0207677_10002439 | 3300026023 | Bacteria | 9762 |
| 413 | Ga0207677_10032982 | 3300026023 | Bacteria | 3335 |
| 414 | Ga0207703_10003978 | 3300026035 | Bacteria | 12248 |
| 415 | Ga0207703_10034234 | 3300026035 | Bacteria | 4030 |
| 416 | Ga0207703_10072524 | 3300026035 | Bacteria | 2846 |
| 417 | Ga0207703_10172950 | 3300026035 | Bacteria | 1901 |
| 418 | Ga0207639_10005083 | 3300026041 | Bacteria | 8861 |
| 419 | Ga0207639_10010154 | 3300026041 | Bacteria | 6515 |
| 420 | Ga0207639_10138096 | 3300026041 | Bacteria | 2027 |
| 421 | Ga0207639_10138862 | 3300026041 | Bacteria | 2022 |
| 422 | Ga0207708_10045746 | 3300026075 | Bacteria | 3335 |
| 423 | Ga0207702_10001517 | 3300026078 | Bacteria | 22953 |
| 424 | Ga0207702_10067898 | 3300026078 | Bacteria | 3061 |
| 425 | Ga0207641_10000038 | 3300026088 | Bacteria | 205418 |
| 426 | Ga0207641_10010883 | 3300026088 | Bacteria | 7453 |
| 427 | Ga0207641_10013810 | 3300026088 | Bacteria | 6622 |
| 428 | Ga0207641_10072010 | 3300026088 | Bacteria | 2975 |
| 429 | Ga0207641_10119402 | 3300026088 | Bacteria | 2350 |
| 430 | Ga0207641_10289755 | 3300026088 | Bacteria | 1543 |
| 431 | Ga0207648_10002605 | 3300026089 | Bacteria | 19328 |
| 432 | Ga0207648_10010813 | 3300026089 | Bacteria | 8624 |
| 433 | Ga0207648_10020336 | 3300026089 | Bacteria | 5980 |
| 434 | Ga0207648_10040329 | 3300026089 | Bacteria | 4103 |
| 435 | Ga0207648_10052734 | 3300026089 | Bacteria | 3556 |
| 436 | Ga0207648_10068486 | 3300026089 | Bacteria | 3092 |
| 437 | Ga0207648_10104514 | 3300026089 | Bacteria | 2484 |
| 438 | Ga0207648_10263920 | 3300026089 | Bacteria | 1537 |
| 439 | Ga0207676_10002713 | 3300026095 | Bacteria | 12603 |
| 440 | Ga0207676_10009517 | 3300026095 | Bacteria | 6917 |
| 441 | Ga0207676_10037153 | 3300026095 | Bacteria | 3710 |
| 442 | Ga0207676_10088603 | 3300026095 | Bacteria | 2534 |
| 443 | Ga0207676_10236217 | 3300026095 | Bacteria | 1637 |
| 444 | Ga0207676_10361174 | 3300026095 | Bacteria | 1346 |
| 445 | Ga0207674_10054739 | 3300026116 | Bacteria | 4061 |
| 446 | Ga0207674_10082423 | 3300026116 | Bacteria | 3217 |
| 447 | Ga0207674_10269078 | 3300026116 | Bacteria | 1651 |
| 448 | Ga0207675_100008753 | 3300026118 | Bacteria | 9508 |
| 449 | Ga0207675_100017817 | 3300026118 | Bacteria | 6627 |
| 450 | Ga0207675_100018829 | 3300026118 | Bacteria | 6442 |
| 451 | Ga0207675_100043196 | 3300026118 | Bacteria | 4209 |
| 452 | Ga0207675_100047989 | 3300026118 | Bacteria | 3986 |
| 453 | Ga0207675_100086517 | 3300026118 | Bacteria | 2943 |
| 454 | Ga0207683_10027744 | 3300026121 | Bacteria | 4892 |
| 455 | Ga0207698_10005625 | 3300026142 | Bacteria | 7756 |
| 456 | Ga0207428_10178649 | 3300027907 | Unclassified | 1604 |
| 457 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 458 | Ga0268266_10010154 | 3300028379 | Bacteria | 8251 |
| 459 | Ga0268265_10014355 | 3300028380 | Bacteria | 5396 |
| 460 | Ga0268264_10000313 | 3300028381 | Bacteria | 77820 |
| 461 | Ga0268264_10010078 | 3300028381 | Bacteria | 7823 |
| 462 | Ga0268264_10011115 | 3300028381 | Bacteria | 7438 |
| 463 | Ga0268264_10012858 | 3300028381 | Bacteria | 6887 |
| 464 | Ga0307517_10002780 | 3300028786 | Bacteria | 27837 |
| 465 | Ga0307517_10095134 | 3300028786 | Bacteria | 2400 |
| 466 | Ga0307515_10000072 | 3300028794 | Bacteria | 237798 |
| 467 | Ga0265338_10012873 | 3300028800 | Bacteria | 9505 |
| 468 | Ga0265324_10002213 | 3300029957 | Bacteria | 10160 |
| 469 | Ga0316181_1156517 | 3300030744 | Bacteria | 1208 |
| 470 | Ga0265328_10001168 | 3300031239 | Bacteria | 12129 |
| 471 | Ga0265329_10001743 | 3300031242 | Bacteria | 10381 |
| 472 | Ga0265331_10006131 | 3300031250 | Bacteria | 7151 |
| 473 | Ga0265327_10000168 | 3300031251 | Bacteria | 141392 |
| 474 | Ga0265327_10000196 | 3300031251 | Bacteria | 127325 |
| 475 | Ga0265327_10000866 | 3300031251 | Bacteria | 44980 |
| 476 | Ga0265327_10004598 | 3300031251 | Bacteria | 12131 |
| 477 | Ga0265327_10026564 | 3300031251 | Bacteria | 3350 |
| 478 | Ga0265316_10000478 | 3300031344 | Bacteria | 45572 |
| 479 | Ga0265316_10007268 | 3300031344 | Bacteria | 10450 |
| 480 | Ga0265316_10128142 | 3300031344 | Bacteria | 1913 |
| 481 | Ga0307513_10267995 | 3300031456 | Bacteria | 1493 |
| 482 | Ga0307509_10068086 | 3300031507 | Bacteria | 3726 |
| 483 | Ga0307408_100000005 | 3300031548 | Bacteria | 529098 |
| 484 | Ga0307408_100000139 | 3300031548 | Bacteria | 80738 |
| 485 | Ga0307508_10003548 | 3300031616 | Bacteria | 15725 |
| 486 | Ga0307508_10273194 | 3300031616 | Bacteria | 1284 |
| 487 | Ga0265314_10038479 | 3300031711 | Bacteria | 3454 |
| 488 | Ga0265342_10095345 | 3300031712 | Bacteria | 1701 |
| 489 | Ga0316576_10004148 | 3300031727 | Bacteria | 8646 |
| 490 | Ga0316576_10067243 | 3300031727 | Bacteria | 2638 |
| 491 | Ga0316576_10071140 | 3300031727 | Bacteria | 2566 |
| 492 | Ga0316578_10003667 | 3300031728 | Bacteria | 7085 |
| 493 | Ga0316578_10006133 | 3300031728 | Bacteria | 5905 |
| 494 | Ga0316578_10061165 | 3300031728 | Bacteria | 2218 |
| 495 | Ga0307516_10000646 | 3300031730 | Bacteria | 47161 |
| 496 | Ga0316577_10013408 | 3300031733 | Bacteria | 4479 |
| 497 | Ga0307410_10199947 | 3300031852 | Bacteria | 1525 |
| 498 | Ga0307406_10000214 | 3300031901 | Bacteria | 34819 |
| 499 | Ga0307412_10207918 | 3300031911 | Bacteria | 1491 |
| 500 | Ga0307416_100203674 | 3300032002 | Bacteria | 1880 |
| 501 | Ga0307414_10000072 | 3300032004 | Bacteria | 94883 |
| 502 | Ga0307414_10003862 | 3300032004 | Bacteria | 8065 |
| 503 | Ga0307414_10095708 | 3300032004 | Bacteria | 2220 |
| 504 | Ga0307411_10238352 | 3300032005 | Bacteria | 1422 |
| 505 | Ga0316585_10013447 | 3300032137 | Bacteria | 2436 |
| 506 | Ga0316580_10013097 | 3300032139 | Bacteria | 2528 |
| 507 | Ga0316593_10002062 | 3300032168 | Bacteria | 4654 |
| 508 | Ga0316593_10011558 | 3300032168 | Bacteria | 2569 |
| 509 | Ga0316593_10020484 | 3300032168 | Bacteria | 2057 |
| 510 | Ga0316592_1017350 | 3300033524 | Bacteria | 1510 |
| 511 | Ga0316587_1004236 | 3300033529 | Bacteria | 2074 |
| 512 | Ga0316596_1002416 | 3300033541 | Bacteria | 3982 |
| 513 | Ga0316596_1016204 | 3300033541 | Bacteria | 1865 |
| 514 | Ga0373934_0031995 | 3300035086 | Bacteria | 2062 |
| 515 | Ga0373945_0042753 | 3300035116 | Bacteria | 1643 |
| 516 | Ga0316574_0005453 | 3300035398 | Bacteria | 6783 |
| 517 | Ga0316582_0003920 | 3300036647 | Bacteria | 7421 |
| 518 | Ga0316582_0050110 | 3300036647 | Bacteria | 2644 |
| 519 | Ga0316582_0235889 | 3300036647 | Bacteria | 1252 |
| 520 | Ga0316584_0000096 | 3300036712 | Bacteria | 35816 |
| 521 | Ga0316584_0000480 | 3300036712 | Bacteria | 21015 |
| 522 | Ga0316584_0088813 | 3300036712 | Bacteria | 2314 |
| 523 | Ga0316584_0089844 | 3300036712 | Bacteria | 2300 |
| 524 | Ga0316584_0106334 | 3300036712 | Bacteria | 2100 |
| 525 | Ga0316584_0122322 | 3300036712 | Bacteria | 1944 |
| 526 | Ga0316584_0175901 | 3300036712 | Bacteria | 1586 |
| 527 | Ga0395899_0000022 | 3300037312 | Bacteria | 378509 |
| 528 | Ga0395899_0186443 | 3300037312 | Bacteria | 1454 |
| 529 | Ga0395900_0007723 | 3300037418 | Bacteria | 11092 |
| 530 | Ga0395900_0101169 | 3300037418 | Bacteria | 2960 |
| 531 | Ga0395898_0000012 | 3300037466 | Bacteria | 480882 |
| 532 | Ga0395905_0000007 | 3300037471 | Bacteria | 521849 |
| 533 | Ga0395905_0000494 | 3300037471 | Bacteria | 54156 |
| 534 | Ga0395905_0167138 | 3300037471 | Bacteria | 2067 |
| 535 | Ga0395905_0284453 | 3300037471 | Bacteria | 1540 |
| 536 | Ga0395901_0298399 | 3300038443 | Bacteria | 1671 |
| 537 | Ga0400486_17517 | 3300038742 | Bacteria | 3115 |
| 538 | Ga0400483_069014 | 3300039062 | Bacteria | 11319 |
| 539 | Ga0400483_078471 | 3300039062 | Bacteria | 1485 |
| 540 | Ga0400483_174753 | 3300039062 | Bacteria | 26112 |
| 541 | Ga0436365_1600972 | 3300039437 | Bacteria | 4033 |
| 542 | Ga0439436_0004744 | 3300041404 | Bacteria | 4169 |
| 543 | Ga0439436_0029713 | 3300041404 | Bacteria | 1591 |
| 544 | Ga0439439_0018409 | 3300041406 | Bacteria | 1725 |
| 545 | Ga0439461_0015025 | 3300041410 | Bacteria | 1480 |
| 546 | Ga0451853_1566562 | 3300041512 | Bacteria | 2213 |
| 547 | Ga0439431_0019848 | 3300041997 | Bacteria | 1601 |
| 548 | Ga0439433_0014612 | 3300041999 | Bacteria | 1729 |
| 549 | Ga0439433_0038600 | 3300041999 | Bacteria | 1108 |
| 550 | Ga0439441_002190 | 3300042001 | Bacteria | 2714 |
| 551 | Ga0439449_0008488 | 3300042007 | Bacteria | 3904 |
| 552 | Ga0439457_001097 | 3300042014 | Bacteria | 8163 |
| 553 | Ga0450923_013374 | 3300042125 | Bacteria | 1508 |
| 554 | Ga0451577_0000120 | 3300042876 | Bacteria | 172425 |
| 555 | Ga0451577_0001493 | 3300042876 | Bacteria | 30989 |
| 556 | Ga0451577_0002301 | 3300042876 | Bacteria | 23092 |
| 557 | Ga0451577_0010455 | 3300042876 | Bacteria | 8867 |
| 558 | Ga0451577_0023348 | 3300042876 | Bacteria | 5641 |
| 559 | Ga0466972_0000013 | 3300044658 | Bacteria | 229345 |
| 560 | Ga0466972_0000020 | 3300044658 | Bacteria | 197336 |
| 561 | Ga0466972_0003179 | 3300044658 | Bacteria | 8160 |
| 562 | Ga0453683_0000241 | 3300044673 | Bacteria | 72899 |
| 563 | Ga0453683_0001409 | 3300044673 | Bacteria | 20902 |
| 564 | Ga0453683_0003448 | 3300044673 | Bacteria | 11652 |
| 565 | Ga0453683_0156432 | 3300044673 | Bacteria | 1441 |
| 566 | Ga0466965_0001828 | 3300044683 | Bacteria | 8849 |
| 567 | Ga0466965_0084842 | 3300044683 | Bacteria | 1605 |
| 568 | Ga0466966_0000045 | 3300044684 | Bacteria | 92504 |
| 569 | Ga0453684_0000721 | 3300044712 | Bacteria | 116843 |
| 570 | Ga0453684_0001358 | 3300044712 | Bacteria | 71434 |
| 571 | Ga0453684_0004196 | 3300044712 | Bacteria | 30989 |
| 572 | Ga0453684_0010057 | 3300044712 | Bacteria | 16264 |
| 573 | Ga0453684_0010472 | 3300044712 | Bacteria | 15850 |
| 574 | Ga0453684_0012355 | 3300044712 | Bacteria | 14113 |
| 575 | Ga0453684_0025978 | 3300044712 | Bacteria | 8480 |
| 576 | Ga0453684_0026693 | 3300044712 | Bacteria | 8325 |
| 577 | Ga0453684_0039498 | 3300044712 | Bacteria | 6429 |
| 578 | Ga0453684_0121903 | 3300044712 | Bacteria | 3146 |
| 579 | Ga0453684_0160406 | 3300044712 | Bacteria | 2661 |
| 580 | Ga0453684_0166014 | 3300044712 | Bacteria | 2606 |
| 581 | Ga0453684_0222224 | 3300044712 | Bacteria | 2187 |
| 582 | Ga0453684_0241468 | 3300044712 | Bacteria | 2079 |
| 583 | Ga0453684_0423641 | 3300044712 | Bacteria | 1486 |
| 584 | Ga0453684_0624768 | 3300044712 | Bacteria | 1178 |
| 585 | Ga0466971_0000591 | 3300044719 | Bacteria | 14363 |
| 586 | Ga0466971_0070216 | 3300044719 | Bacteria | 1590 |
| 587 | Ga0466970_0000491 | 3300044765 | Bacteria | 19409 |
| 588 | Ga0466970_0093345 | 3300044765 | Bacteria | 1635 |
| 589 | Ga0466970_0104694 | 3300044765 | Bacteria | 1543 |
| 590 | Ga0466957_0000544 | 3300044842 | Bacteria | 19041 |
| 591 | Ga0466957_0003789 | 3300044842 | Bacteria | 8357 |
| 592 | Ga0466957_0018826 | 3300044842 | Bacteria | 4059 |
| 593 | Ga0466959_0000023 | 3300045049 | Bacteria | 124545 |
| 594 | Ga0466959_0007926 | 3300045049 | Bacteria | 7481 |
| 595 | Ga0451576_0002107 | 3300045051 | Bacteria | 30989 |
| 596 | Ga0451576_0005360 | 3300045051 | Bacteria | 16125 |
| 597 | Ga0451576_0020756 | 3300045051 | Bacteria | 7150 |
| 598 | Ga0451576_0046622 | 3300045051 | Bacteria | 4563 |
| 599 | Ga0466958_0044918 | 3300045836 | Bacteria | 2664 |
| 600 | Ga0466967_0024602 | 3300045976 | Bacteria | 4954 |
| 601 | Ga0495629_0037803 | 3300046459 | Unclassified | 3402 |
| 602 | Ga0495638_0071059 | 3300046460 | Bacteria | 2130 |
| 603 | Ga0495650_0076584 | 3300046471 | Bacteria | 1300 |
| 604 | Ga0495580_0119283 | 3300046472 | Unclassified | 1832 |
| 605 | Ga0495594_0077794 | 3300046499 | Bacteria | 1851 |
| 606 | Ga0495606_0005542 | 3300046507 | Bacteria | 12040 |
| 607 | Ga0495643_0000815 | 3300046522 | Bacteria | 34055 |
| 608 | Ga0495648_0008867 | 3300046524 | Bacteria | 7865 |
| 609 | Ga0495598_0009085 | 3300046537 | Bacteria | 2337 |
| 610 | Ga0495633_0046732 | 3300046558 | Bacteria | 2047 |
| 611 | Ga0495668_0002414 | 3300046616 | Bacteria | 15444 |
| 612 | Ga0495668_0007203 | 3300046616 | Bacteria | 7146 |
| 613 | Ga0495611_0000204 | 3300046648 | Bacteria | 41676 |
| 614 | Ga0495611_0008341 | 3300046648 | Bacteria | 4387 |
| 615 | Ga0495623_0113437 | 3300046679 | Bacteria | 1640 |
| 616 | Ga0495670_0007145 | 3300046691 | Bacteria | 5497 |
| 617 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 618 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 619 | Ga0495686_0004111 | 3300047472 | Bacteria | 12115 |
| 620 | Ga0495686_0035343 | 3300047472 | Bacteria | 3213 |
| 621 | Ga0495686_0038920 | 3300047472 | Bacteria | 3040 |
| 622 | Ga0496109_0327402 | 3300048912 | Bacteria | 1446 |
| 623 | Ga0496114_0238737 | 3300048917 | Bacteria | 1598 |
| 624 | Ga0496115_0197709 | 3300048918 | Bacteria | 1661 |
| 625 | Ga0496125_0000017 | 3300048928 | Bacteria | 508217 |
| 626 | Ga0496126_0006314 | 3300048929 | Bacteria | 13234 |
| 627 | Ga0501031_0001670 | 3300049568 | Bacteria | 13928 |
| 628 | Ga0501031_0014692 | 3300049568 | Bacteria | 5089 |
| 629 | Ga0501032_0000245 | 3300049569 | Bacteria | 45098 |
| 630 | Ga0501032_0099433 | 3300049569 | Bacteria | 1927 |
| 631 | Ga0501032_0106121 | 3300049569 | Bacteria | 1861 |
| 632 | Ga0501033_0000002 | 3300049570 | Bacteria | 668574 |
| 633 | Ga0501033_0000049 | 3300049570 | Bacteria | 114610 |
| 634 | Ga0501033_0207150 | 3300049570 | Unclassified | 1399 |
| 635 | Ga0501033_0216202 | 3300049570 | Bacteria | 1366 |
| 636 | Ga0501034_0044922 | 3300049571 | Bacteria | 4465 |
| 637 | Ga0501034_0059472 | 3300049571 | Bacteria | 3838 |
| 638 | Ga0501034_0074425 | 3300049571 | Bacteria | 3404 |
| 639 | Ga0501036_0132238 | 3300049572 | Unclassified | 2106 |
| 640 | Ga0501037_0000459 | 3300049573 | Bacteria | 33122 |
| 641 | Ga0501037_0243701 | 3300049573 | Bacteria | 1259 |
| 642 | Ga0501038_0000020 | 3300049574 | Bacteria | 152738 |
| 643 | Ga0501038_0024802 | 3300049574 | Bacteria | 5346 |
| 644 | Ga0501038_0061904 | 3300049574 | Unclassified | 3200 |
| 645 | Ga0501039_0007009 | 3300049575 | Bacteria | 8581 |
| 646 | Ga0501043_0003640 | 3300049579 | Bacteria | 12650 |
| 647 | Ga0501043_0010076 | 3300049579 | Bacteria | 7410 |
| 648 | Ga0501043_0128090 | 3300049579 | Bacteria | 1990 |
| 649 | Ga0501043_0311588 | 3300049579 | Bacteria | 1201 |
| 650 | Ga0501046_0046898 | 3300049580 | Bacteria | 3428 |
| 651 | Ga0501046_0242480 | 3300049580 | Bacteria | 1329 |
| 652 | Ga0501047_0010102 | 3300049581 | Bacteria | 8922 |
| 653 | Ga0501047_0031817 | 3300049581 | Bacteria | 5090 |
| 654 | Ga0501047_0064834 | 3300049581 | Bacteria | 3523 |
| 655 | Ga0501047_0247097 | 3300049581 | Unclassified | 1633 |
| 656 | Ga0501047_0250731 | 3300049581 | Bacteria | 1619 |
| 657 | Ga0501067_0110755 | 3300049583 | Bacteria | 1526 |
| 658 | Ga0501068_0063276 | 3300049584 | Bacteria | 2251 |
| 659 | Ga0501069_0196604 | 3300049585 | Bacteria | 1168 |
| 660 | Ga0501070_0008406 | 3300049586 | Bacteria | 8717 |
| 661 | Ga0501070_0044040 | 3300049586 | Bacteria | 3714 |
| 662 | Ga0501073_0033415 | 3300049589 | Bacteria | 3663 |
| 663 | Ga0501199_001464 | 3300049650 | Bacteria | 2143 |
| 664 | Ga0501202_001117 | 3300049652 | Bacteria | 4186 |
| 665 | Ga0501217_010862 | 3300049661 | Bacteria | 2004 |
| 666 | Ga0501217_017971 | 3300049661 | Bacteria | 1636 |
| 667 | Ga0501223_011844 | 3300049663 | Bacteria | 1749 |
| 668 | Ga0501223_019433 | 3300049663 | Bacteria | 1335 |
| 669 | Ga0501235_001439 | 3300049669 | Bacteria | 5077 |
| 670 | Ga0501243_009183 | 3300049675 | Bacteria | 1534 |
| 671 | Ga0501257_005896 | 3300049686 | Bacteria | 2711 |
| 672 | Ga0501259_002355 | 3300049688 | Bacteria | 3085 |
| 673 | Ga0501259_003203 | 3300049688 | Bacteria | 2616 |
| 674 | Ga0501219_000038 | 3300049703 | Bacteria | 21298 |
| 675 | Ga0501221_000867 | 3300049704 | Bacteria | 4936 |
| 676 | Ga0501083_0030624 | 3300049744 | Bacteria | 3695 |
| 677 | Ga0501241_000198 | 3300049758 | Bacteria | 13561 |
| 678 | Ga0501241_002421 | 3300049758 | Bacteria | 3605 |
| 679 | Ga0501272_004269 | 3300049769 | Bacteria | 1481 |
| 680 | Ga0501279_009168 | 3300049775 | Bacteria | 1324 |
| 681 | Ga0501035_0000001 | 3300049822 | Bacteria | 1037138 |
| 682 | Ga0501035_0023072 | 3300049822 | Bacteria | 5711 |
| 683 | Ga0501044_0007030 | 3300049823 | Bacteria | 12384 |
| 684 | Ga0501044_0028431 | 3300049823 | Bacteria | 5902 |
| 685 | Ga0501044_0028857 | 3300049823 | Bacteria | 5852 |
| 686 | Ga0501044_0035810 | 3300049823 | Bacteria | 5195 |
| 687 | Ga0501044_0100058 | 3300049823 | Bacteria | 2918 |
| 688 | Ga0501284_00021 | 3300050005 | Bacteria | 89729 |
| 689 | nmdc:mga0k408_134812_c1 | 3300050493 | Bacteria | 1467 |
| 690 | nmdc:mga0k408_29824_c1 | 3300050493 | Bacteria | 3107 |
| 691 | nmdc:mga05p37_3343_c1 | 3300050507 | Bacteria | 18701 |
| 692 | nmdc:mga09592_29840_c1 | 3300050508 | Bacteria | 4536 |
| 693 | nmdc:mga09592_400339_c1 | 3300050508 | Bacteria | 1187 |
| 694 | nmdc:mga0qj67_17217_c1 | 3300050509 | Bacteria | 5492 |
| 695 | nmdc:mga06r32_162916_c1 | 3300050510 | Bacteria | 2212 |
| 696 | nmdc:mga08y16_137821_c1 | 3300050511 | Bacteria | 2537 |
| 697 | nmdc:mga08y16_94339_c1 | 3300050511 | Bacteria | 3117 |
| 698 | nmdc:mga08y16_99592_c1 | 3300050511 | Bacteria | 3026 |
| 699 | Ga0500578_0000155 | 3300053086 | Bacteria | 80380 |
| 700 | Ga0500646_0011376 | 3300053090 | Bacteria | 2289 |
| 701 | Ga0500583_0000043 | 3300053092 | Bacteria | 81313 |
| 702 | Ga0500583_0000675 | 3300053092 | Bacteria | 10019 |
| 703 | Ga0500562_000007 | 3300053108 | Bacteria | 241755 |
| 704 | Ga0500652_032439 | 3300053131 | Bacteria | 2058 |
| 705 | Ga0500559_0025149 | 3300053136 | Bacteria | 2534 |
| 706 | Ga0500568_0000702 | 3300053139 | Bacteria | 24042 |
| 707 | Ga0500589_004209 | 3300053147 | Bacteria | 5366 |
| 708 | Ga0500604_0000317 | 3300053151 | Bacteria | 13432 |
| 709 | Ga0500622_0000052 | 3300053156 | Bacteria | 145201 |
| 710 | Ga0500622_0000575 | 3300053156 | Bacteria | 33359 |
| 711 | Ga0500622_0001876 | 3300053156 | Bacteria | 15870 |
| 712 | Ga0500622_0013673 | 3300053156 | Bacteria | 4375 |
| 713 | Ga0500627_0013003 | 3300053158 | Bacteria | 3139 |
| 714 | Ga0500639_091952 | 3300053163 | Bacteria | 1509 |
| 715 | Ga0500636_0004180 | 3300053177 | Bacteria | 8177 |
| 716 | Ga0500611_000011 | 3300053727 | Bacteria | 141259 |
| 717 | Ga0500611_001356 | 3300053727 | Bacteria | 2672 |
| 718 | Ga0500645_011995 | 3300053730 | Bacteria | 2811 |
| 719 | Ga0500661_006149 | 3300055283 | Bacteria | 2239 |
| 720 | Ga0587090_011249 | 3300059510 | Bacteria | 1255 |
| 721 | Ga0466962_0000091 | 3300061719 | Bacteria | 36637 |
| 722 | 2522548262 | 2522125168 | Bacteria | 7376607 |
| 723 | 2524006569 | 2523533629 | Bacteria | 2982326 |
| 724 | 2649121315 | 2648501241 | Bacteria | 5312320 |
| 725 | 2652974568 | 2651869818 | Bacteria | 5864031 |
| 726 | 2738726340 | 2738541278 | Bacteria | 9755573 |
| 727 | 2787509772 | 2786546548 | Bacteria | 4745694 |
| 728 | 2819576420 | 2818991442 | Bacteria | 8318214 |
| 729 | 2819589661 | 2818991444 | Bacteria | 6968812 |
| 730 | 2819678103 | 2818991460 | Bacteria | 7595395 |
| 731 | 2821142621 | 2821136567 | Bacteria | 8080116 |
| 732 | 2883068288 | 2883068021 | Bacteria | 6192739 |
| 733 | 2884634769 | 2884634485 | Bacteria | 3928637 |
| 734 | 2884792949 | 2884791551 | Bacteria | 8511252 |
| 735 | 2890805887 | 2890804823 | Bacteria | 3717572 |
| 736 | 2896089115 | 2896085136 | Bacteria | 6129793 |
| 737 | 2904470211 | 2904467357 | Bacteria | 8057758 |
| 738 | 2910249789 | 2910245624 | Bacteria | 6935613 |
| 739 | 2911140558 | 2911138879 | Bacteria | 5811561 |
| 740 | 2914760840 | 2914759650 | Bacteria | 4701441 |
| 741 | 2919496828 | 2919493220 | Bacteria | 4598500 |
| 742 | 2919546402 | 2919543075 | Bacteria | 4728703 |
| 743 | 2919694602 | 2919692658 | Bacteria | 5943958 |
| 744 | 2923529953 | 2923525760 | Bacteria | 4472324 |
| 745 | 2929156214 | 2929154850 | Bacteria | 6753285 |
| 746 | 2929181189 | 2929177148 | Bacteria | 7883697 |
| 747 | 2929243252 | 2929239360 | Bacteria | 7745570 |
| 748 | 2929925088 | 2929921140 | Bacteria | 8649150 |
| 749 | 2945983593 | 2945977869 | Bacteria | 7777518 |
| 750 | 2946017019 | 2946013367 | Bacteria | 7766675 |
| 751 | 2965323728 | 2965320100 | Bacteria | 3975600 |
| 752 | 646812803 | 646564506 | Bacteria | 3192235 |
| 753 | 8001525860 | 8001522603 | Bacteria | 4726425 |
| 754 | 8003157335 | 8003151029 | Bacteria | 8187759 |
| 755 | Ga0450922_001319 | |||
| 756 | JGI24743J22301_10000005 | |||
| 757 | JGI24033J26618_1000119 | |||
| 758 | JGI24751J29686_10008130 | |||
| 759 | rootH2_10000149 | |||
| 760 | rootH2_10009508 | |||
| 761 | rootH2_10030789 | |||
| 762 | rootH2_10033273 | |||
| 763 | rootH2_10162427 | |||
| 764 | rootL2_10090605 | |||
| 765 | rootH1_10064317 | |||
| 766 | JGI25160J50197_1002187 | |||
| 767 | Ga0055530_10000315 | |||
| 768 | Ga0065165_1000060 | |||
| 769 | Ga0065704_10096676 | |||
| 770 | Ga0065704_10115828 | |||
| 771 | Ga0065712_10014468 | |||
| 772 | Ga0065712_10081375 | |||
| 773 | Ga0070658_10000095 | |||
| 774 | Ga0070658_10008866 | |||
| 775 | Ga0070658_10231933 | |||
| 776 | Ga0070658_10267109 | |||
| 777 | Ga0070676_10000252 | |||
| 778 | Ga0070676_10009134 | |||
| 779 | Ga0070683_100003259 | |||
| 780 | Ga0070683_100025140 | |||
| 781 | Ga0070690_100140451 | |||
| 782 | Ga0070690_100226063 | |||
| 783 | Ga0070670_100007971 | |||
| 784 | Ga0070670_100014145 | |||
| 785 | Ga0070670_100036514 | |||
| 786 | Ga0070670_100078424 | |||
| 787 | Ga0070670_100156232 | |||
| 788 | Ga0070670_100194295 | |||
| 789 | Ga0068869_100008995 | |||
| 790 | Ga0068869_100013406 | |||
| 791 | Ga0068869_100018447 | |||
| 792 | Ga0068869_100048072 | |||
| 793 | Ga0070666_10000616 | |||
| 794 | Ga0070666_10009653 | |||
| 795 | Ga0070666_10130184 | |||
| 796 | Ga0070682_100010522 | |||
| 797 | Ga0070682_100031550 | |||
| 798 | Ga0068868_100000091 | |||
| 799 | Ga0068868_100051846 | |||
| 800 | Ga0070689_100027356 | |||
| 801 | Ga0070689_100114899 | |||
| 802 | Ga0070691_10016494 | |||
| 803 | Ga0070661_100001232 | |||
| 804 | Ga0070668_100000043 | |||
| 805 | Ga0070668_100044375 | |||
| 806 | Ga0070668_100336312 | |||
| 807 | Ga0070669_100040844 | |||
| 808 | Ga0070675_100040358 | |||
| 809 | Ga0070675_100048827 | |||
| 810 | Ga0070675_100160301 | |||
| 811 | Ga0070671_100027742 | |||
| 812 | Ga0070671_100055549 | |||
| 813 | Ga0070671_100107623 | |||
| 814 | Ga0070674_100026685 | |||
| 815 | Ga0070674_100032734 | |||
| 816 | Ga0070673_100000283 | |||
| 817 | Ga0070673_100012211 | |||
| 818 | Ga0070673_100031990 | |||
| 819 | Ga0070688_100012566 | |||
| 820 | Ga0070659_100041296 | |||
| 821 | Ga0070659_100090583 | |||
| 822 | Ga0070667_100000254 | |||
| 823 | Ga0070667_100001284 | |||
| 824 | Ga0070667_100016664 | |||
| 825 | Ga0070667_100199438 | |||
| 826 | Ga0070667_100323849 | |||
| 827 | Ga0070663_100165609 | |||
| 828 | Ga0070678_100042090 | |||
| 829 | Ga0070662_100002778 | |||
| 830 | Ga0070662_100006706 | |||
| 831 | Ga0070681_10025679 | |||
| 832 | Ga0070681_10081003 | |||
| 833 | Ga0070681_10147131 | |||
| 834 | Ga0068867_100005482 | |||
| 835 | Ga0068867_100016258 | |||
| 836 | Ga0068867_100157290 | |||
| 837 | Ga0068867_100225940 | |||
| 838 | Ga0070685_10028768 | |||
| 839 | Ga0070706_100200107 | |||
| 840 | Ga0070698_100001232 | |||
| 841 | Ga0070698_100132976 | |||
| 842 | Ga0070679_100031738 | |||
| 843 | Ga0070679_100156060 | |||
| 844 | Ga0070684_100007323 | |||
| 845 | Ga0070684_100271675 | |||
| 846 | Ga0068853_100000675 | |||
| 847 | Ga0068853_100004921 | |||
| 848 | Ga0068853_100022678 | |||
| 849 | Ga0068853_100037199 | |||
| 850 | Ga0068853_100324852 | |||
| 851 | Ga0070672_100000160 | |||
| 852 | Ga0070672_100114886 | |||
| 853 | Ga0070665_100000001 | |||
| 854 | Ga0070665_100000350 | |||
| 855 | Ga0070665_100012508 | |||
| 856 | Ga0068855_100000089 | |||
| 857 | Ga0068855_100002600 | |||
| 858 | Ga0068855_100023787 | |||
| 859 | Ga0068855_100046257 | |||
| 860 | Ga0068855_100066665 | |||
| 861 | Ga0068855_100079334 | |||
| 862 | Ga0068855_100158975 | |||
| 863 | Ga0070664_100002175 | |||
| 864 | Ga0070664_100046003 | |||
| 865 | Ga0068854_100026248 | |||
| 866 | Ga0068856_100000313 | |||
| 867 | Ga0068856_100009691 | |||
| 868 | Ga0068856_100042851 | |||
| 869 | Ga0068856_100049149 | |||
| 870 | Ga0068856_100478334 | |||
| 871 | Ga0070702_100080937 | |||
| 872 | Ga0068852_100000655 | |||
| 873 | Ga0068852_100015276 | |||
| 874 | Ga0068852_100019201 | |||
| 875 | Ga0068859_100000100 | |||
| 876 | Ga0068859_100010659 | |||
| 877 | Ga0068859_100014583 | |||
| 878 | Ga0068859_100332443 | |||
| 879 | Ga0068864_100001658 | |||
| 880 | Ga0068864_100013342 | |||
| 881 | Ga0068864_100138887 | |||
| 882 | Ga0068864_100359796 | |||
| 883 | Ga0068864_100362130 | |||
| 884 | Ga0068866_10143259 | |||
| 885 | Ga0068861_100003609 | |||
| 886 | Ga0068861_100006042 | |||
| 887 | Ga0068861_100013501 | |||
| 888 | Ga0068861_100061933 | |||
| 889 | Ga0068851_10004456 | |||
| 890 | Ga0068851_10058388 | |||
| 891 | Ga0068863_100018881 | |||
| 892 | Ga0068863_100022470 | |||
| 893 | Ga0068863_100038477 | |||
| 894 | Ga0068863_100039594 | |||
| 895 | Ga0068863_100079599 | |||
| 896 | Ga0068863_100310984 | |||
| 897 | Ga0068858_100000199 | |||
| 898 | Ga0068858_100001301 | |||
| 899 | Ga0068858_100225034 | |||
| 900 | Ga0068858_100340636 | |||
| 901 | Ga0068860_100000111 | |||
| 902 | Ga0068860_100000846 | |||
| 903 | Ga0068860_100001512 | |||
| 904 | Ga0068860_100003412 | |||
| 905 | Ga0068860_100005552 | |||
| 906 | Ga0068860_100042932 | |||
| 907 | Ga0068860_100139432 | |||
| 908 | Ga0068862_100058563 | |||
| 909 | Ga0075366_10018779 | |||
| 910 | Ga0075366_10116478 | |||
| 911 | Ga0097621_100002436 | |||
| 912 | Ga0097621_100002531 | |||
| 913 | Ga0097621_100003700 | |||
| 914 | Ga0097621_100020533 | |||
| 915 | Ga0097621_100051241 | |||
| 916 | Ga0068871_100004030 | |||
| 917 | Ga0068871_100010137 | |||
| 918 | Ga0068871_100027019 | |||
| 919 | Ga0068871_100031740 | |||
| 920 | Ga0068871_100039362 | |||
| 921 | Ga0068871_100044639 | |||
| 922 | Ga0068871_100062039 | |||
| 923 | Ga0068871_100198721 | |||
| 924 | Ga0075428_100013181 | |||
| 925 | Ga0075428_100015528 | |||
| 926 | Ga0075428_100041517 | |||
| 927 | Ga0075428_100251468 | |||
| 928 | Ga0075430_100051698 | |||
| 929 | Ga0075431_100140517 | |||
| 930 | Ga0075429_100003290 | |||
| 931 | Ga0075429_100222922 | |||
| 932 | Ga0068865_100005344 | |||
| 933 | Ga0068865_100007446 | |||
| 934 | Ga0097620_100000100 | |||
| 935 | Ga0097620_100010659 | |||
| 936 | Ga0097620_100014582 | |||
| 937 | Ga0097620_100332454 | |||
| 938 | Ga0105240_10000074 | |||
| 939 | Ga0105240_10000513 | |||
| 940 | Ga0105240_10007118 | |||
| 941 | Ga0105240_10008360 | |||
| 942 | Ga0105240_10041056 | |||
| 943 | Ga0105240_10111783 | |||
| 944 | Ga0105240_10375346 | |||
| 945 | Ga0111539_10028901 | |||
| 946 | Ga0111539_10218562 | |||
| 947 | Ga0111539_10330721 | |||
| 948 | Ga0111539_10447995 | |||
| 949 | Ga0105245_10025045 | |||
| 950 | Ga0105247_10002103 | |||
| 951 | Ga0105247_10005256 | |||
| 952 | Ga0114129_10004929 | |||
| 953 | Ga0105243_10177594 | |||
| 954 | Ga0105243_10213245 | |||
| 955 | Ga0105241_10011399 | |||
| 956 | Ga0105241_10023976 | |||
| 957 | Ga0105242_10035646 | |||
| 958 | Ga0105242_10041681 | |||
| 959 | Ga0105242_10101424 | |||
| 960 | Ga0105242_10119202 | |||
| 961 | Ga0105242_10147822 | |||
| 962 | Ga0105248_10031375 | |||
| 963 | Ga0105248_10190771 | |||
| 964 | Ga0105237_10000528 | |||
| 965 | Ga0105237_10002821 | |||
| 966 | Ga0105237_10005077 | |||
| 967 | Ga0105237_10007087 | |||
| 968 | Ga0105237_10026166 | |||
| 969 | Ga0105237_10088422 | |||
| 970 | Ga0105237_10488158 | |||
| 971 | Ga0105238_10001119 | |||
| 972 | Ga0105238_10107514 | |||
| 973 | Ga0105238_10254852 | |||
| 974 | Ga0105249_10000420 | |||
| 975 | Ga0105249_10004140 | |||
| 976 | Ga0105249_10012201 | |||
| 977 | Ga0105249_10020079 | |||
| 978 | Ga0105239_10000048 | |||
| 979 | Ga0105239_10000314 | |||
| 980 | Ga0105239_10000853 | |||
| 981 | Ga0105239_10002727 | |||
| 982 | Ga0105239_10026069 | |||
| 983 | Ga0105239_10033395 | |||
| 984 | Ga0105239_10039449 | |||
| 985 | Ga0105239_10237363 | |||
| 986 | Ga0105239_10387523 | |||
| 987 | Ga0105239_10532817 | |||
| 988 | Ga0105246_10037365 | |||
| 989 | Ga0157373_10034570 | |||
| 990 | Ga0157373_10036183 | |||
| 991 | Ga0157371_10019068 | |||
| 992 | Ga0157371_10063215 | |||
| 993 | Ga0157371_10087974 | |||
| 994 | Ga0157371_10201521 | |||
| 995 | Ga0157370_10007951 | |||
| 996 | Ga0157370_10018014 | |||
| 997 | Ga0157370_10075884 | |||
| 998 | Ga0157370_10195942 | |||
| 999 | Ga0157370_10233657 | |||
| 1000 | Ga0157369_10010273 | |||
| 1001 | Ga0157369_10067695 | |||
| 1002 | Ga0157369_10223780 | |||
| 1003 | Ga0157374_10000026 | |||
| 1004 | Ga0157374_10000084 | |||
| 1005 | Ga0157374_10005000 | |||
| 1006 | Ga0157374_10012628 | |||
| 1007 | Ga0157374_10076666 | |||
| 1008 | Ga0157374_10265730 | |||
| 1009 | Ga0157374_10325660 | |||
| 1010 | Ga0157378_10001185 | |||
| 1011 | Ga0157378_10001872 | |||
| 1012 | Ga0157378_10027692 | |||
| 1013 | Ga0157378_10032561 | |||
| 1014 | Ga0157378_10098402 | |||
| 1015 | Ga0163162_10000101 | |||
| 1016 | Ga0163162_10000113 | |||
| 1017 | Ga0163162_10003148 | |||
| 1018 | Ga0163162_10005141 | |||
| 1019 | Ga0163162_10011934 | |||
| 1020 | Ga0163162_10024246 | |||
| 1021 | Ga0163162_10071459 | |||
| 1022 | Ga0163162_10097769 | |||
| 1023 | Ga0157372_10001128 | |||
| 1024 | Ga0157372_10005133 | |||
| 1025 | Ga0157372_10005538 | |||
| 1026 | Ga0157372_10030568 | |||
| 1027 | Ga0157372_10049581 | |||
| 1028 | Ga0157372_10069083 | |||
| 1029 | Ga0157372_10073750 | |||
| 1030 | Ga0157372_10152955 | |||
| 1031 | Ga0157372_10434416 | |||
| 1032 | Ga0157372_10479499 | |||
| 1033 | Ga0157375_10000565 | |||
| 1034 | Ga0157375_10009092 | |||
| 1035 | Ga0157375_10067247 | |||
| 1036 | Ga0157375_10069207 | |||
| 1037 | Ga0157375_10070596 | |||
| 1038 | Ga0157375_10122613 | |||
| 1039 | Ga0157375_10162918 | |||
| 1040 | Ga0163163_10000306 | |||
| 1041 | Ga0163163_10025324 | |||
| 1042 | Ga0163163_10361098 | |||
| 1043 | Ga0157380_10034657 | |||
| 1044 | Ga0157380_10042141 | |||
| 1045 | Ga0157380_10118025 | |||
| 1046 | Ga0157377_10085237 | |||
| 1047 | Ga0157379_10000245 | |||
| 1048 | Ga0157379_10016583 | |||
| 1049 | Ga0157376_10002364 | |||
| 1050 | Ga0157376_10003646 | |||
| 1051 | Ga0157376_10003682 | |||
| 1052 | Ga0157376_10004318 | |||
| 1053 | Ga0157376_10023777 | |||
| 1054 | Ga0157376_10089937 | |||
| 1055 | Ga0157376_10156558 | |||
| 1056 | Ga0157376_10190896 | |||
| 1057 | Ga0157376_10418779 | |||
| 1058 | Ga0163161_10037411 | |||
| 1059 | Ga0163161_10095390 | |||
| 1060 | Ga0163161_10126070 | |||
| 1061 | Ga0209646_1001404 | |||
| 1062 | Ga0209676_1000351 | |||
| 1063 | Ga0207426_1000009 | |||
| 1064 | Ga0209257_1000089 | |||
| 1065 | Ga0207697_10047494 | |||
| 1066 | Ga0207656_10002387 | |||
| 1067 | Ga0207710_10011655 | |||
| 1068 | Ga0207710_10017547 | |||
| 1069 | Ga0207688_10029845 | |||
| 1070 | Ga0207680_10003112 | |||
| 1071 | Ga0207680_10013728 | |||
| 1072 | Ga0207647_10004545 | |||
| 1073 | Ga0207647_10026889 | |||
| 1074 | Ga0207645_10000378 | |||
| 1075 | Ga0207645_10001750 | |||
| 1076 | Ga0207643_10052782 | |||
| 1077 | Ga0207705_10014193 | |||
| 1078 | Ga0207705_10146201 | |||
| 1079 | Ga0207705_10194595 | |||
| 1080 | Ga0207654_10001221 | |||
| 1081 | Ga0207654_10001953 | |||
| 1082 | Ga0207654_10008832 | |||
| 1083 | Ga0207707_10002099 | |||
| 1084 | Ga0207707_10130640 | |||
| 1085 | Ga0207695_10000071 | |||
| 1086 | Ga0207695_10000084 | |||
| 1087 | Ga0207695_10000323 | |||
| 1088 | Ga0207695_10001425 | |||
| 1089 | Ga0207695_10007632 | |||
| 1090 | Ga0207695_10011249 | |||
| 1091 | Ga0207695_10071661 | |||
| 1092 | Ga0207671_10001584 | |||
| 1093 | Ga0207671_10001605 | |||
| 1094 | Ga0207671_10008236 | |||
| 1095 | Ga0207671_10010848 | |||
| 1096 | Ga0207671_10016277 | |||
| 1097 | Ga0207671_10021869 | |||
| 1098 | Ga0207671_10336752 | |||
| 1099 | Ga0207660_10001416 | |||
| 1100 | Ga0207660_10053726 | |||
| 1101 | Ga0207662_10023264 | |||
| 1102 | Ga0207657_10151871 | |||
| 1103 | Ga0207657_10188794 | |||
| 1104 | Ga0207649_10000935 | |||
| 1105 | Ga0207652_10000986 | |||
| 1106 | Ga0207652_10131105 | |||
| 1107 | Ga0207681_10039294 | |||
| 1108 | Ga0207694_10069297 | |||
| 1109 | Ga0207694_10115743 | |||
| 1110 | Ga0207650_10011294 | |||
| 1111 | Ga0207650_10041445 | |||
| 1112 | Ga0207650_10071800 | |||
| 1113 | Ga0207650_10076405 | |||
| 1114 | Ga0207650_10090530 | |||
| 1115 | Ga0207659_10017041 | |||
| 1116 | Ga0207659_10105532 | |||
| 1117 | Ga0207659_10132703 | |||
| 1118 | Ga0207659_10324805 | |||
| 1119 | Ga0207687_10027927 | |||
| 1120 | Ga0207644_10058787 | |||
| 1121 | Ga0207644_10088847 | |||
| 1122 | Ga0207690_10113536 | |||
| 1123 | Ga0207706_10005553 | |||
| 1124 | Ga0207706_10014031 | |||
| 1125 | Ga0207686_10030128 | |||
| 1126 | Ga0207686_10041764 | |||
| 1127 | Ga0207686_10073887 | |||
| 1128 | Ga0207686_10081034 | |||
| 1129 | Ga0207670_10025122 | |||
| 1130 | Ga0207669_10045391 | |||
| 1131 | Ga0207669_10103394 | |||
| 1132 | Ga0207704_10001110 | |||
| 1133 | Ga0207704_10018773 | |||
| 1134 | Ga0207691_10000227 | |||
| 1135 | Ga0207691_10184848 | |||
| 1136 | Ga0207691_10343081 | |||
| 1137 | Ga0207689_10008011 | |||
| 1138 | Ga0207689_10010699 | |||
| 1139 | Ga0207689_10035224 | |||
| 1140 | Ga0207689_10094949 | |||
| 1141 | Ga0207689_10126332 | |||
| 1142 | Ga0207679_10032303 | |||
| 1143 | Ga0207679_10094266 | |||
| 1144 | Ga0207667_10000135 | |||
| 1145 | Ga0207667_10000177 | |||
| 1146 | Ga0207667_10009580 | |||
| 1147 | Ga0207667_10025965 | |||
| 1148 | Ga0207667_10060186 | |||
| 1149 | Ga0207667_10205788 | |||
| 1150 | Ga0207651_10001142 | |||
| 1151 | Ga0207651_10336240 | |||
| 1152 | Ga0207712_10001272 | |||
| 1153 | Ga0207712_10004770 | |||
| 1154 | Ga0207712_10006837 | |||
| 1155 | Ga0207712_10025027 | |||
| 1156 | Ga0207712_10112040 | |||
| 1157 | Ga0207712_10183222 | |||
| 1158 | Ga0207668_10000821 | |||
| 1159 | Ga0207668_10028723 | |||
| 1160 | Ga0207668_10116285 | |||
| 1161 | Ga0207640_10174974 | |||
| 1162 | Ga0207658_10000176 | |||
| 1163 | Ga0207658_10036237 | |||
| 1164 | Ga0207658_10043302 | |||
| 1165 | Ga0207658_10054994 | |||
| 1166 | Ga0207677_10002439 | |||
| 1167 | Ga0207677_10032982 | |||
| 1168 | Ga0207703_10003978 | |||
| 1169 | Ga0207703_10034234 | |||
| 1170 | Ga0207703_10072524 | |||
| 1171 | Ga0207703_10172950 | |||
| 1172 | Ga0207639_10005083 | |||
| 1173 | Ga0207639_10010154 | |||
| 1174 | Ga0207639_10138096 | |||
| 1175 | Ga0207639_10138862 | |||
| 1176 | Ga0207708_10045746 | |||
| 1177 | Ga0207702_10001517 | |||
| 1178 | Ga0207702_10067898 | |||
| 1179 | Ga0207641_10000038 | |||
| 1180 | Ga0207641_10010883 | |||
| 1181 | Ga0207641_10013810 | |||
| 1182 | Ga0207641_10072010 | |||
| 1183 | Ga0207641_10119402 | |||
| 1184 | Ga0207641_10289755 | |||
| 1185 | Ga0207648_10002605 | |||
| 1186 | Ga0207648_10010813 | |||
| 1187 | Ga0207648_10020336 | |||
| 1188 | Ga0207648_10040329 | |||
| 1189 | Ga0207648_10052734 | |||
| 1190 | Ga0207648_10068486 | |||
| 1191 | Ga0207648_10104514 | |||
| 1192 | Ga0207648_10263920 | |||
| 1193 | Ga0207676_10002713 | |||
| 1194 | Ga0207676_10009517 | |||
| 1195 | Ga0207676_10037153 | |||
| 1196 | Ga0207676_10088603 | |||
| 1197 | Ga0207676_10236217 | |||
| 1198 | Ga0207676_10361174 | |||
| 1199 | Ga0207674_10054739 | |||
| 1200 | Ga0207674_10082423 | |||
| 1201 | Ga0207674_10269078 | |||
| 1202 | Ga0207675_100008753 | |||
| 1203 | Ga0207675_100017817 | |||
| 1204 | Ga0207675_100018829 | |||
| 1205 | Ga0207675_100043196 | |||
| 1206 | Ga0207675_100047989 | |||
| 1207 | Ga0207675_100086517 | |||
| 1208 | Ga0207683_10027744 | |||
| 1209 | Ga0207698_10005625 | |||
| 1210 | Ga0207428_10178649 | |||
| 1211 | Ga0268266_10000049 | |||
| 1212 | Ga0268266_10010154 | |||
| 1213 | Ga0268265_10014355 | |||
| 1214 | Ga0268264_10000313 | |||
| 1215 | Ga0268264_10010078 | |||
| 1216 | Ga0268264_10011115 | |||
| 1217 | Ga0268264_10012858 | |||
| 1218 | Ga0307517_10002780 | |||
| 1219 | Ga0307517_10095134 | |||
| 1220 | Ga0307515_10000072 | |||
| 1221 | Ga0265338_10012873 | |||
| 1222 | Ga0265324_10002213 | |||
| 1223 | Ga0316181_1156517 | |||
| 1224 | Ga0265328_10001168 | |||
| 1225 | Ga0265329_10001743 | |||
| 1226 | Ga0265331_10006131 | |||
| 1227 | Ga0265327_10000168 | |||
| 1228 | Ga0265327_10000196 | |||
| 1229 | Ga0265327_10000866 | |||
| 1230 | Ga0265327_10004598 | |||
| 1231 | Ga0265327_10026564 | |||
| 1232 | Ga0265316_10000478 | |||
| 1233 | Ga0265316_10007268 | |||
| 1234 | Ga0265316_10128142 | |||
| 1235 | Ga0307513_10267995 | |||
| 1236 | Ga0307509_10068086 | |||
| 1237 | Ga0307408_100000005 | |||
| 1238 | Ga0307408_100000139 | |||
| 1239 | Ga0307508_10003548 | |||
| 1240 | Ga0307508_10273194 | |||
| 1241 | Ga0265314_10038479 | |||
| 1242 | Ga0265342_10095345 | |||
| 1243 | Ga0316576_10004148 | |||
| 1244 | Ga0316576_10067243 | |||
| 1245 | Ga0316576_10071140 | |||
| 1246 | Ga0316578_10003667 | |||
| 1247 | Ga0316578_10006133 | |||
| 1248 | Ga0316578_10061165 | |||
| 1249 | Ga0307516_10000646 | |||
| 1250 | Ga0316577_10013408 | |||
| 1251 | Ga0307410_10199947 | |||
| 1252 | Ga0307406_10000214 | |||
| 1253 | Ga0307412_10207918 | |||
| 1254 | Ga0307416_100203674 | |||
| 1255 | Ga0307414_10000072 | |||
| 1256 | Ga0307414_10003862 | |||
| 1257 | Ga0307414_10095708 | |||
| 1258 | Ga0307411_10238352 | |||
| 1259 | Ga0316585_10013447 | |||
| 1260 | Ga0316580_10013097 | |||
| 1261 | Ga0316593_10002062 | |||
| 1262 | Ga0316593_10011558 | |||
| 1263 | Ga0316593_10020484 | |||
| 1264 | Ga0316592_1017350 | |||
| 1265 | Ga0316587_1004236 | |||
| 1266 | Ga0316596_1002416 | |||
| 1267 | Ga0316596_1016204 | |||
| 1268 | Ga0373934_0031995 | |||
| 1269 | Ga0373945_0042753 | |||
| 1270 | Ga0316574_0005453 | |||
| 1271 | Ga0316582_0003920 | |||
| 1272 | Ga0316582_0050110 | |||
| 1273 | Ga0316582_0235889 | |||
| 1274 | Ga0316584_0000096 | |||
| 1275 | Ga0316584_0000480 | |||
| 1276 | Ga0316584_0088813 | |||
| 1277 | Ga0316584_0089844 | |||
| 1278 | Ga0316584_0106334 | |||
| 1279 | Ga0316584_0122322 | |||
| 1280 | Ga0316584_0175901 | |||
| 1281 | Ga0395899_0000022 | |||
| 1282 | Ga0395899_0186443 | |||
| 1283 | Ga0395900_0007723 | |||
| 1284 | Ga0395900_0101169 | |||
| 1285 | Ga0395898_0000012 | |||
| 1286 | Ga0395905_0000007 | |||
| 1287 | Ga0395905_0000494 | |||
| 1288 | Ga0395905_0167138 | |||
| 1289 | Ga0395905_0284453 | |||
| 1290 | Ga0395901_0298399 | |||
| 1291 | Ga0400486_17517 | |||
| 1292 | Ga0400483_069014 | |||
| 1293 | Ga0400483_078471 | |||
| 1294 | Ga0400483_174753 | |||
| 1295 | Ga0436365_1600972 | |||
| 1296 | Ga0439436_0004744 | |||
| 1297 | Ga0439436_0029713 | |||
| 1298 | Ga0439439_0018409 | |||
| 1299 | Ga0439461_0015025 | |||
| 1300 | Ga0451853_1566562 | |||
| 1301 | Ga0439431_0019848 | |||
| 1302 | Ga0439433_0014612 | |||
| 1303 | Ga0439433_0038600 | |||
| 1304 | Ga0439441_002190 | |||
| 1305 | Ga0439449_0008488 | |||
| 1306 | Ga0439457_001097 | |||
| 1307 | Ga0450923_013374 | |||
| 1308 | Ga0451577_0000120 | |||
| 1309 | Ga0451577_0001493 | |||
| 1310 | Ga0451577_0002301 | |||
| 1311 | Ga0451577_0010455 | |||
| 1312 | Ga0451577_0023348 | |||
| 1313 | Ga0466972_0000013 | |||
| 1314 | Ga0466972_0000020 | |||
| 1315 | Ga0466972_0003179 | |||
| 1316 | Ga0453683_0000241 | |||
| 1317 | Ga0453683_0001409 | |||
| 1318 | Ga0453683_0003448 | |||
| 1319 | Ga0453683_0156432 | |||
| 1320 | Ga0466965_0001828 | |||
| 1321 | Ga0466965_0084842 | |||
| 1322 | Ga0466966_0000045 | |||
| 1323 | Ga0453684_0000721 | |||
| 1324 | Ga0453684_0001358 | |||
| 1325 | Ga0453684_0004196 | |||
| 1326 | Ga0453684_0010057 | |||
| 1327 | Ga0453684_0010472 | |||
| 1328 | Ga0453684_0012355 | |||
| 1329 | Ga0453684_0025978 | |||
| 1330 | Ga0453684_0026693 | |||
| 1331 | Ga0453684_0039498 | |||
| 1332 | Ga0453684_0121903 | |||
| 1333 | Ga0453684_0160406 | |||
| 1334 | Ga0453684_0166014 | |||
| 1335 | Ga0453684_0222224 | |||
| 1336 | Ga0453684_0241468 | |||
| 1337 | Ga0453684_0423641 | |||
| 1338 | Ga0453684_0624768 | |||
| 1339 | Ga0466971_0000591 | |||
| 1340 | Ga0466971_0070216 | |||
| 1341 | Ga0466970_0000491 | |||
| 1342 | Ga0466970_0093345 | |||
| 1343 | Ga0466970_0104694 | |||
| 1344 | Ga0466957_0000544 | |||
| 1345 | Ga0466957_0003789 | |||
| 1346 | Ga0466957_0018826 | |||
| 1347 | Ga0466959_0000023 | |||
| 1348 | Ga0466959_0007926 | |||
| 1349 | Ga0451576_0002107 | |||
| 1350 | Ga0451576_0005360 | |||
| 1351 | Ga0451576_0020756 | |||
| 1352 | Ga0451576_0046622 | |||
| 1353 | Ga0466958_0044918 | |||
| 1354 | Ga0466967_0024602 | |||
| 1355 | Ga0495629_0037803 | |||
| 1356 | Ga0495638_0071059 | |||
| 1357 | Ga0495650_0076584 | |||
| 1358 | Ga0495580_0119283 | |||
| 1359 | Ga0495594_0077794 | |||
| 1360 | Ga0495606_0005542 | |||
| 1361 | Ga0495643_0000815 | |||
| 1362 | Ga0495648_0008867 | |||
| 1363 | Ga0495598_0009085 | |||
| 1364 | Ga0495633_0046732 | |||
| 1365 | Ga0495668_0002414 | |||
| 1366 | Ga0495668_0007203 | |||
| 1367 | Ga0495611_0000204 | |||
| 1368 | Ga0495611_0008341 | |||
| 1369 | Ga0495623_0113437 | |||
| 1370 | Ga0495670_0007145 | |||
| 1371 | Ga0495687_000001 | |||
| 1372 | Ga0495686_0000004 | |||
| 1373 | Ga0495686_0004111 | |||
| 1374 | Ga0495686_0035343 | |||
| 1375 | Ga0495686_0038920 | |||
| 1376 | Ga0496109_0327402 | |||
| 1377 | Ga0496114_0238737 | |||
| 1378 | Ga0496115_0197709 | |||
| 1379 | Ga0496125_0000017 | |||
| 1380 | Ga0496126_0006314 | |||
| 1381 | Ga0501031_0001670 | |||
| 1382 | Ga0501031_0014692 | |||
| 1383 | Ga0501032_0000245 | |||
| 1384 | Ga0501032_0099433 | |||
| 1385 | Ga0501032_0106121 | |||
| 1386 | Ga0501033_0000002 | |||
| 1387 | Ga0501033_0000049 | |||
| 1388 | Ga0501033_0207150 | |||
| 1389 | Ga0501033_0216202 | |||
| 1390 | Ga0501034_0044922 | |||
| 1391 | Ga0501034_0059472 | |||
| 1392 | Ga0501034_0074425 | |||
| 1393 | Ga0501036_0132238 | |||
| 1394 | Ga0501037_0000459 | |||
| 1395 | Ga0501037_0243701 | |||
| 1396 | Ga0501038_0000020 | |||
| 1397 | Ga0501038_0024802 | |||
| 1398 | Ga0501038_0061904 | |||
| 1399 | Ga0501039_0007009 | |||
| 1400 | Ga0501043_0003640 | |||
| 1401 | Ga0501043_0010076 | |||
| 1402 | Ga0501043_0128090 | |||
| 1403 | Ga0501043_0311588 | |||
| 1404 | Ga0501046_0046898 | |||
| 1405 | Ga0501046_0242480 | |||
| 1406 | Ga0501047_0010102 | |||
| 1407 | Ga0501047_0031817 | |||
| 1408 | Ga0501047_0064834 | |||
| 1409 | Ga0501047_0247097 | |||
| 1410 | Ga0501047_0250731 | |||
| 1411 | Ga0501067_0110755 | |||
| 1412 | Ga0501068_0063276 | |||
| 1413 | Ga0501069_0196604 | |||
| 1414 | Ga0501070_0008406 | |||
| 1415 | Ga0501070_0044040 | |||
| 1416 | Ga0501073_0033415 | |||
| 1417 | Ga0501199_001464 | |||
| 1418 | Ga0501202_001117 | |||
| 1419 | Ga0501217_010862 | |||
| 1420 | Ga0501217_017971 | |||
| 1421 | Ga0501223_011844 | |||
| 1422 | Ga0501223_019433 | |||
| 1423 | Ga0501235_001439 | |||
| 1424 | Ga0501243_009183 | |||
| 1425 | Ga0501257_005896 | |||
| 1426 | Ga0501259_002355 | |||
| 1427 | Ga0501259_003203 | |||
| 1428 | Ga0501219_000038 | |||
| 1429 | Ga0501221_000867 | |||
| 1430 | Ga0501083_0030624 | |||
| 1431 | Ga0501241_000198 | |||
| 1432 | Ga0501241_002421 | |||
| 1433 | Ga0501272_004269 | |||
| 1434 | Ga0501279_009168 | |||
| 1435 | Ga0501035_0000001 | |||
| 1436 | Ga0501035_0023072 | |||
| 1437 | Ga0501044_0007030 | |||
| 1438 | Ga0501044_0028431 | |||
| 1439 | Ga0501044_0028857 | |||
| 1440 | Ga0501044_0035810 | |||
| 1441 | Ga0501044_0100058 | |||
| 1442 | Ga0501284_00021 | |||
| 1443 | nmdc:mga0k408_134812_c1 | |||
| 1444 | nmdc:mga0k408_29824_c1 | |||
| 1445 | nmdc:mga05p37_3343_c1 | |||
| 1446 | nmdc:mga09592_29840_c1 | |||
| 1447 | nmdc:mga09592_400339_c1 | |||
| 1448 | nmdc:mga0qj67_17217_c1 | |||
| 1449 | nmdc:mga06r32_162916_c1 | |||
| 1450 | nmdc:mga08y16_137821_c1 | |||
| 1451 | nmdc:mga08y16_94339_c1 | |||
| 1452 | nmdc:mga08y16_99592_c1 | |||
| 1453 | Ga0500578_0000155 | |||
| 1454 | Ga0500646_0011376 | |||
| 1455 | Ga0500583_0000043 | |||
| 1456 | Ga0500583_0000675 | |||
| 1457 | Ga0500562_000007 | |||
| 1458 | Ga0500652_032439 | |||
| 1459 | Ga0500559_0025149 | |||
| 1460 | Ga0500568_0000702 | |||
| 1461 | Ga0500589_004209 | |||
| 1462 | Ga0500604_0000317 | |||
| 1463 | Ga0500622_0000052 | |||
| 1464 | Ga0500622_0000575 | |||
| 1465 | Ga0500622_0001876 | |||
| 1466 | Ga0500622_0013673 | |||
| 1467 | Ga0500627_0013003 | |||
| 1468 | Ga0500639_091952 | |||
| 1469 | Ga0500636_0004180 | |||
| 1470 | Ga0500611_000011 | |||
| 1471 | Ga0500611_001356 | |||
| 1472 | Ga0500645_011995 | |||
| 1473 | Ga0500661_006149 | |||
| 1474 | Ga0587090_011249 | |||
| 1475 | Ga0466962_0000091 | |||
| 1476 | 2522548262 | |||
| 1477 | 2524006569 | |||
| 1478 | 2649121315 | |||
| 1479 | 2652974568 | |||
| 1480 | 2738726340 | |||
| 1481 | 2787509772 | |||
| 1482 | 2819576420 | |||
| 1483 | 2819589661 | |||
| 1484 | 2819678103 | |||
| 1485 | 2821142621 | |||
| 1486 | 2883068288 | |||
| 1487 | 2884634769 | |||
| 1488 | 2884792949 | |||
| 1489 | 2890805887 | |||
| 1490 | 2896089115 | |||
| 1491 | 2904470211 | |||
| 1492 | 2910249789 | |||
| 1493 | 2911140558 | |||
| 1494 | 2914760840 | |||
| 1495 | 2919496828 | |||
| 1496 | 2919546402 | |||
| 1497 | 2919694602 | |||
| 1498 | 2923529953 | |||
| 1499 | 2929156214 | |||
| 1500 | 2929181189 | |||
| 1501 | 2929243252 | |||
| 1502 | 2929925088 | |||
| 1503 | 2945983593 | |||
| 1504 | 2946017019 | |||
| 1505 | 2965323728 | |||
| 1506 | 646812803 | |||
| 1507 | 8001525860 | |||
| 1508 | 8003157335 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gk7-assembly1.cif.gz_B | structure of e.coli fructose 1,6-bisphosphate aldolase bound to tris | 0.9747 | 5 | 357 |
| 5gk4-assembly1.cif.gz_A | native structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 2.0 angstrom resolution | 0.9747 | 5 | 357 |
| 5gk4-assembly1.cif.gz_B | native structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 2.0 angstrom resolution | 0.9737 | 7 | 357 |
| 5gk5-assembly2.cif.gz_D | apo structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 1.9 angstrom resolution | 0.9734 | 7 | 357 |
| 5gk8-assembly1.cif.gz_A | structure of e.coli fructose 1,6-bisphosphate aldolase, acetate bound form | 0.9731 | 7 | 357 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P14540_5_359_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9622 | 5 | 353 | 3.20.20.70 |
| af_P14540_5_359_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9436 | 5 | 353 | 3.20.20.70 |
| 1dosA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9321 | 7 | 357 | 3.20.20.70 |
| 4a22A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9186 | 14 | 356 | 3.20.20.70 |
| 1dosA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9142 | 7 | 357 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A182S9Y6-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9916 | 7 | 174 |
GO:0004332
GO:0005829 GO:0006094 GO:0006096 GO:0008270 |
| AF-A0A7Y7CJ11-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-1,6-bisphosphate aldolase) | 0.9892 | 5 | 122 |
GO:0004332
GO:0005829 GO:0006094 GO:0006096 GO:0008270 |
| AF-A0A4V1ULU9-F1-model_v4 | deleted | 0.9872 | 5 | 179 |
|
| AF-A0A7R9U1S8-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9864 | 7 | 163 |
GO:0004332
GO:0005829 GO:0006094 GO:0006096 GO:0008270 |
| AF-A0A7S2XVF8-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9863 | 6 | 139 |
GO:0004332
GO:0005829 GO:0006094 GO:0006096 GO:0008270 |